CN107082800B - Inhibitor of MACC1 gene and application thereof in resisting hepatocellular carcinoma invasion - Google Patents
Inhibitor of MACC1 gene and application thereof in resisting hepatocellular carcinoma invasion Download PDFInfo
- Publication number
- CN107082800B CN107082800B CN201710268784.XA CN201710268784A CN107082800B CN 107082800 B CN107082800 B CN 107082800B CN 201710268784 A CN201710268784 A CN 201710268784A CN 107082800 B CN107082800 B CN 107082800B
- Authority
- CN
- China
- Prior art keywords
- polypeptide
- inhibitor
- macc1
- invasion
- hepatocellular carcinoma
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related
Links
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 90
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 90
- 229920001184 polypeptide Polymers 0.000 claims abstract description 89
- 239000003112 inhibitor Substances 0.000 claims abstract description 23
- 230000009545 invasion Effects 0.000 claims abstract description 22
- 101150009427 MACC1 gene Proteins 0.000 claims abstract description 21
- 206010073071 hepatocellular carcinoma Diseases 0.000 claims abstract description 18
- 231100000844 hepatocellular carcinoma Toxicity 0.000 claims abstract description 17
- 230000035755 proliferation Effects 0.000 claims abstract description 10
- 239000003814 drug Substances 0.000 claims abstract description 6
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 4
- 238000002360 preparation method Methods 0.000 claims description 2
- 238000013518 transcription Methods 0.000 abstract description 3
- 230000035897 transcription Effects 0.000 abstract description 3
- 238000013519 translation Methods 0.000 abstract description 3
- 210000004027 cell Anatomy 0.000 description 39
- 101001055106 Homo sapiens Metastasis-associated in colon cancer protein 1 Proteins 0.000 description 14
- 230000000694 effects Effects 0.000 description 14
- 102100026892 Metastasis-associated in colon cancer protein 1 Human genes 0.000 description 13
- 238000002474 experimental method Methods 0.000 description 9
- 230000005764 inhibitory process Effects 0.000 description 9
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 7
- 108090000623 proteins and genes Proteins 0.000 description 6
- 239000012980 RPMI-1640 medium Substances 0.000 description 5
- 238000000034 method Methods 0.000 description 5
- 102000007469 Actins Human genes 0.000 description 4
- 108010085238 Actins Proteins 0.000 description 4
- 238000012258 culturing Methods 0.000 description 4
- 201000007270 liver cancer Diseases 0.000 description 4
- 102000004169 proteins and genes Human genes 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 206010027476 Metastases Diseases 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 239000006285 cell suspension Substances 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 230000009401 metastasis Effects 0.000 description 3
- 102000003745 Hepatocyte Growth Factor Human genes 0.000 description 2
- 108090000100 Hepatocyte Growth Factor Proteins 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 230000009435 amidation Effects 0.000 description 2
- 238000007112 amidation reaction Methods 0.000 description 2
- 230000003698 anagen phase Effects 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 239000012043 crude product Substances 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 210000005229 liver cell Anatomy 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 150000003839 salts Chemical group 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- 238000011191 terminal modification Methods 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 1
- 235000003325 Ilex Nutrition 0.000 description 1
- 241000209035 Ilex Species 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108010019160 Pancreatin Proteins 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000004709 cell invasion Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 230000000857 drug effect Effects 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 125000005519 fluorenylmethyloxycarbonyl group Chemical group 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 230000009036 growth inhibition Effects 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 210000002372 intrahepatic bile duct epithelial cell Anatomy 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 108010082117 matrigel Proteins 0.000 description 1
- 229940055695 pancreatin Drugs 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 239000008194 pharmaceutical composition Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The invention discloses an inhibitor of MACC1 gene and application thereof in resisting hepatocellular carcinoma invasion, wherein the inhibitor is a polypeptide which comprises the following amino acid sequence: ETMFWYDAK(Xa) PCFTRVPMA(Xb) GTDEQLPDIWN, respectively; wherein Xa and Xb are selected from M, Y, L, V, W or E. The polypeptide inhibitor provided by the invention can inhibit the expression of MACC1 gene in HepG2 cells from the transcription and translation levels, and is an effective inhibitor of MACC1 gene; meanwhile, the effective inhibitor of the MACC1 gene can obviously inhibit the proliferation and invasion of HepG2 cells, and the effective inhibitor of the MACC1 gene can be used for preparing a medicine for resisting the invasion of hepatocellular carcinoma.
Description
Technical Field
The invention belongs to the field of genes, and particularly relates to an inhibitor of MACC1 gene and application thereof in resisting hepatocellular carcinoma invasion.
Background
Primary liver cancer is a malignant tumor with primary focus on liver cells and intrahepatic bile duct epithelial cells, wherein hepatocellular carcinoma (i.e. hepatocellular carcinoma, HCC) is the most predominant pathological type, accounting for over 90% of primary liver cancer. The MACC1 gene is a new gene discovered and named by STEIN et al in 2009. Studies of STEIN and the like find that MACC1 plays an important role in invasion and metastasis of colon cancer as a key regulator of a Hepatocyte Growth Factor (HGF)/C-met signal pathway, and in addition, Liuqingquan and the like find that MACC1 gene possibly plays an important role in invasion and metastasis of hepatocellular carcinoma, and the MACC1 gene possibly becomes one of new targets for liver cancer treatment (Liuqingquan and the like, expression and clinical significance of MACC1 gene in hepatocellular carcinoma, proceedings of Huazhong university of science and technology, 2010, 39: 22-24).
At present, no report of polypeptide inhibitors of MACC1 gene is found.
Disclosure of Invention
The invention aims to provide an inhibitor of MACC1 gene and application thereof in resisting hepatocellular carcinoma invasion.
The technical scheme for realizing the aim of the invention is as follows:
an inhibitor of the MACC1 gene, which inhibitor is a polypeptide comprising an amino acid sequence of formula (i):
ETMFWYDAK(Xa)PCFTRVPMA(Xb)GTDEQLPDIWN； (Ⅰ)
wherein Xa and Xb are selected from M, Y, L, V, W or E.
Preferably, Xa and Xb are selected from M or W.
Preferably, the inhibitor is one of the following polypeptides:
ETMFWYDAKMPCFTRVPMAMGTDEQLPDIWN；
ETMFWYDAKWPCFTRVPMAWGTDEQLPDIWN；
ETMFWYDAKMPCFTRVPMAWGTDEQLPDIWN；
ETMFWYDAKWPCFTRVPMAMGTDEQLPDIWN。
preferably, the polypeptide is chemically modified at the N-and/or C-terminus.
Preferably, the polypeptide is modified by acetylation at the N-terminus and amidation at the C-terminus.
Preferably, the polypeptide is in the form of:
Ac-ETMFWYDAKMPCFTRVPMAMGTDEQLPDIWN-NH2；
Ac-ETMFWYDAKWPCFTRVPMAWGTDEQLPDIWN-NH2；
Ac-ETMFWYDAKMPCFTRVPMAWGTDEQLPDIWN-NH2；
Ac-ETMFWYDAKWPCFTRVPMAMGTDEQLPDIWN-NH2。
preferably, the polypeptide is in free form or in pharmaceutically acceptable salt form, including hydrochloride, sulfate, phosphate, sulfonate, acetate, citrate, and tartrate.
The inhibitor is applied to the preparation of drugs for resisting proliferation and invasion of hepatocellular carcinoma.
A pharmaceutical composition comprises the above polypeptide inhibitor and pharmaceutically acceptable adjuvants.
The application of the composition in preparing the medicine for resisting proliferation and invasion of hepatocellular carcinoma.
The invention has the outstanding advantages that:
the polypeptide inhibitor provided by the invention can effectively inhibit the expression of MACC1 gene in hepatocellular carcinoma, further effectively inhibit the invasion and metastasis of hepatocellular carcinoma, and can be used for preparing a medicine for resisting the invasion of hepatocellular carcinoma.
Drawings
FIG. 1 is a graph of the effect of polypeptide inhibitors on MACC1mRNA expression;
FIG. 2 is a graph showing the effect of polypeptide inhibitors on MACC1 protein expression.
Detailed Description
The following detailed description of the present invention is provided in connection with the examples, and for reasons of brevity, the description of the experimental procedures is not intended to be exhaustive, and all parts not specifically described in the experiments are routine procedures well known to those skilled in the art.
First, experimental material
The polypeptides involved in the invention are synthesized by standard polypeptide solid phase synthesis technology known in the art, and a fluorenylmethyloxycarbonyl (Fmoc) N-terminal protection strategy is adopted. Connecting corresponding amino acids in sequence according to a resin solid phase synthesis method, removing Fmoc-protecting groups in sequence during the process, cutting peptides to obtain crude products, and separating and purifying the crude products by a C18 column to obtain the polypeptide shown in the formula (I).
HPLC and MS detection confirm the structure of the polypeptide of the invention, and the purity is more than or equal to 98%.
The amino acid sequences of the polypeptides I-1 to I-4 are as follows, the N-and C-termini being chemically unmodified:
ETMFWYDAKMPCFTRVPMAMGTDEQLPDIWN (polypeptide I-1);
ETMFWYDAKWPCFTRVPMAWGTDEQLPDIWN (polypeptide I-2);
ETMFWYDAKMPCFTRVPMAWGTDEQLPDIWN (polypeptide I-3);
ETMFWYDAKWPCFTRVPMAMGTDEQLPDIWN (polypeptide I-4).
The human hepatocellular carcinoma cell line HepG2 was stored in the molecular pharmacology laboratory of this company. Fetal bovine serum was purchased from Hangzhou ilex. Tetramethylazo salts and dimethyl sulfoxide were purchased from Sigma, USA. The rabbit anti-human MACC1 antibody was purchased from Santa Cruz, and the HRP-labeled goat anti-rabbit IgG secondary antibody was purchased from Beijing Zhonghuan gold bridge. Transwell chambers were purchased from Millipore corporation. PCR primers were synthesized in Ruibo, Guangzhou, and RT-PCR kits were purchased from Takara.
Second, Experimental methods
1. Culturing human liver cell cancer cell strain HepG2
The primary liver cancer cell line is cultured in RPMI-1640 culture solution containing 10% fetal calf serum at 37 deg.C and 5% CO2Culturing, and digesting with 0.25% pancreatin for 2-3d for passage. Cells in logarithmic growth phase were taken for the experiments.
2. MTT method for detecting influence of polypeptide on proliferation capacity of HepG2
HepG2 cells were collected at logarithmic growth phase and made into cell suspension at 5X 10 per well4Individual cells were seeded in 96-well plates with 100 μ L cell suspension per well. Divided into a control group, a polypeptide I-1 group, a polypeptide I-2 group, a polypeptide I-3 group and a polypeptide I-4 group. Adding 2, 4, 8, 16 and 32 mu M of polypeptide into the polypeptide group respectively, adding an equal volume of reagent into a control group, culturing for 24 hours, taking out a 96-well culture plate, discarding a culture solution, washing with PBS, adding 100 mu L of RPMI-1640 culture solution containing MTT (with a final mass concentration of 5g/L), continuously culturing cells for 4 hours, discarding the culture solution, adding 100 mu L of dimethyl sulfoxide into each well, and shaking a shaker to dissolve crystals. The OD per well was determined at 490nm with DMSO zeroing. The inhibition rate was calculated according to the following formula, and the IC50 value of each polypeptide was calculated by linear regression. Growth inhibition (%) was (1-dose group OD value/control group OD value) × 100%
3. Cell invasion experiment for detecting influence of polypeptide on invasion capacity of HepG2
Taking 4 ℃ pre-cooled Matrigel and serum-free RPMI-1640 cell culture solution, and mixing the components in a volume ratio of 1: 4, fully and uniformly mixing. To the upper chamber of the Transwell plate, 30. mu.L of the above-mentioned mixture was added per well, covering the entire polycarbonate membrane in the chamber, and after standing in an incubator at 37 ℃ for 3 hours, 100. mu.L of cell suspension (cell density 1X 10) was added per well5mL) and 200. mu.L serum-free RPMI-1640 medium; at the same time, 500. mu.L of RPMI-1640 medium containing 30% by volume of fetal bovine serum was added to each well of the Transwell plate. Then, HepG2 cells were treated with 0, 2, 4, 8, 16, 32. mu.M of the polypeptide for 24h, respectively, and then the chamber was taken out, the culture solution was aspirated, fixed with methanol for 30min, stained with crystal violet for 20min, inverted, observed with a Leica DC 300F upright microscope, and photographed. 5 pieces of the upper, lower, left, right and center of the bottom surface of the small chamber are selectedCells were counted in visual field and invasion rate was calculated. The experiment was repeated 3 times with 10 replicates per experimental point.
4. RT-PCR detection of the Effect of Polypeptides on MACC1mRNA expression in HepG2 cells
After digestion and counting of HepG2 cells, the cells were added to a 6-well plate at a cell density of 5X 104and/mL, after the cells are attached, adding 4 and 16 mu M of polypeptide to culture for 24h, collecting the cells, and measuring the expression of MACC1mRNA in HepG2 cells. A control group was also provided, and no polypeptide was added to the control group. Extracting total RNA of cells, carrying out reverse transcription to obtain cDNA, and carrying out PCR by using the cDNA as a template. The primers are as follows:
MACC1 upstream primer: 5'-CCTTCGTGGTAATAATGCTTCC-3'
MACC1 downstream primer: 5'-AGGGCTTCCATTGTATTGAGGT-3'
Beta-actin upstream primer: 5'-ACGCACCCCAACTACAACTC-3'
Beta-actin downstream primer: 5'-TCTCCTTAATGTCACGCACGA-3'
Preparing a 50 mu L reaction system in a sterile enzyme-free PCR tube, wherein the reaction conditions are 94 ℃ for 60s, 60 ℃ for 50s and 72 ℃ for 90s, and after 40 cycles, the extension is carried out for 10min at 72 ℃; stored at 4 ℃ for 20g/L agarose gel electrophoresis. The experiment was repeated 3 times.
5. Western blot detection of influence of polypeptide on expression of MACC1 protein in HepG2 cells
After digestion and counting of HepG2 cells, the cells were added to a 6-well plate at a cell density of 5X 104and/mL, after the cells are attached, adding 4 and 16 mu M of polypeptide to culture for 24h, collecting the cells, and measuring the expression of the MACC1 protein in HepG2 cells. A control group was also provided, and no polypeptide was added to the control group. The total cell protein was quantitatively extracted by BCA method, and a loading buffer was added to the total cell protein sample and sufficiently denatured with boiling water. Separating protein by polyacrylamide gel electrophoresis, performing chemiluminescence after protein membrane transfer, blocking, hybridization of primary antibody (diluted by 1: 5000) and secondary antibody (diluted by 1: 10000). Beta-actin is used as an internal reference. Finally, the strip is subjected to gray scale scanning. Relative expression of MACC1 is MACC1 integrated optical density of the band/beta-actin integrated optical density of the band.
Third, experimental results
1. Effect of Polypeptides on the proliferative Capacity of HepG2
Compared with a control group, the proliferation of HepG2 cells of each polypeptide administration group is obviously inhibited, the proliferation inhibition rate is related to the concentration of the polypeptide, and the higher the concentration is, the stronger the inhibition effect is, and the obvious concentration dependence is realized. The results are shown in Table 1.
TABLE 1 proliferation inhibition (%), of different concentrations of polypeptide on HepG 2%
| 2μM | 4μM | 8μM | 16μM | 32μM | |
| Polypeptide group I-1 | 13.55 | 24.32 | 40.69 | 64.95 | 78.32 |
| Group I-2 Polypeptides | 18.60 | 28.58 | 45.46 | 69.36 | 84.58 |
| Group I-3 Polypeptides | 10.84 | 21.72 | 38.06 | 59.84 | 72.44 |
| Polypeptide group I-4 | 11.56 | 22.85 | 39.73 | 62.08 | 75.73 |
The results show that the polypeptide I-1, the polypeptide I-2, the polypeptide I-3 and the polypeptide I-4 have obvious inhibition effect on the proliferation of HepG2 cells, the inhibition effect presents a certain concentration dependence relationship, the IC50 is about 12 mu M, and the drug effect is excellent.
2. Effect of Polypeptides on the invasive Capacity of HepG2
Each polypeptide can obviously inhibit the invasion of HepG2 cells, and the invasion rate of HepG2 cells is reduced along with the increase of the concentration of the polypeptide.
The results are shown in Table 2.
TABLE 2 Effect of different concentrations of polypeptide on the invasion Rate (%) of HepG2
| 2μM | 4μM | 8μM | 16μM | 32μM | |
| Polypeptide group I-1 | 83.48 | 62.69 | 44.94 | 23.84 | 11.25 |
| Group I-2 Polypeptides | 80.16 | 61.20 | 43.04 | 22.28 | 9.64 |
| Group I-3 Polypeptides | 86.85 | 65.74 | 47.35 | 26.52 | 13.12 |
| Polypeptide group I-4 | 85.26 | 64.92 | 46.03 | 25.06 | 12.03 |
Transwell invasion experiments prove that the polypeptide I-1, the polypeptide I-2, the polypeptide I-3 and the polypeptide I-4 have obvious inhibition effect on the invasion of HepG2 cells, and the inhibition effect presents a certain concentration dependence relationship.
3. Effect of the Polypeptides on MACC1mRNA expression in HepG2 cells
After 24 hours of administration treatment of the polypeptide I-1, the polypeptide I-2, the polypeptide I-3 and the polypeptide I-4, the MACC1mRNA expression level in HepG2 cells is obviously reduced, and the higher the polypeptide concentration is, the more obvious the MACC1mRNA expression level is reduced.
The relative expression levels of MACC1mRNA in each group are shown in FIG. 1.
The results show that the polypeptide I-1, the polypeptide I-2, the polypeptide I-3 and the polypeptide I-4 have obvious inhibiting effect on the transcription level of MACC1 genes of HepG2 cells.
4. Effect of the Polypeptides on MACC1 protein expression in HepG2 cells
After the polypeptide I-1, the polypeptide I-2, the polypeptide I-3 and the polypeptide I-4 are treated by administration for 24 hours, the MACC1 protein expression level in HepG2 cells is obviously reduced, and the MACC1 protein expression level is obviously reduced when the polypeptide concentration is higher.
The relative expression of MACC1 protein in each group is shown in FIG. 2.
The results show that the polypeptide I-1, the polypeptide I-2, the polypeptide I-3 and the polypeptide I-4 have obvious inhibition effect on the translation level of MACC1 gene of HepG2 cells.
The following conclusions can be drawn by combining the above experiments: the polypeptide I-1, the polypeptide I-2, the polypeptide I-3 and the polypeptide I-4 can inhibit the expression of the MACC1 gene in HepG2 cells from the transcription and translation levels, and are effective inhibitors of the MACC1 gene; meanwhile, the effective inhibitor of the MACC1 gene can obviously inhibit the proliferation and invasion of HepG2 cells, and the effective inhibitor of the MACC1 gene can be used for preparing a medicine for resisting the invasion of hepatocellular carcinoma.
The applicant also tested the pharmacological effects of the above-mentioned polypeptide after terminal modification (N-terminal modified by acetylation and C-terminal modified by amidation), and the results demonstrated that the above-mentioned polypeptide after terminal modification has similar pharmacological effects and potency to those of the unmodified form.
The foregoing embodiments are provided to illustrate the present invention more fully, but those skilled in the art will appreciate that the scope of the present invention should not be limited to the specific embodiments described above.
Claims (2)
1. An inhibitor of the MACC1 gene, which is a polypeptide characterized by the amino acid sequence of one of the following sequences:
sequence 1: ETMFWYDAKMPCFTRVPMAMGTDEQLPDIWN, respectively;
sequence 2: ETMFWYDAKWPCFTRVPMAWGTDEQLPDIWN, respectively;
and (3) sequence: ETMFWYDAKMPCFTRVPMAWGTDEQLPDIWN, respectively;
and (3) sequence 4: ETMFWYDAKWPCFTRVPMAMGTDEQLPDIWN are provided.
2. Use of the inhibitor of claim 1 for the preparation of a medicament for the treatment of proliferation and invasion of hepatocellular carcinoma.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710268784.XA CN107082800B (en) | 2017-04-24 | 2017-04-24 | Inhibitor of MACC1 gene and application thereof in resisting hepatocellular carcinoma invasion |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710268784.XA CN107082800B (en) | 2017-04-24 | 2017-04-24 | Inhibitor of MACC1 gene and application thereof in resisting hepatocellular carcinoma invasion |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN107082800A CN107082800A (en) | 2017-08-22 |
| CN107082800B true CN107082800B (en) | 2020-12-11 |
Family
ID=59613134
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710268784.XA Expired - Fee Related CN107082800B (en) | 2017-04-24 | 2017-04-24 | Inhibitor of MACC1 gene and application thereof in resisting hepatocellular carcinoma invasion |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107082800B (en) |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016020427A1 (en) * | 2014-08-05 | 2016-02-11 | Charité - Universitätsmedizin Berlin | Macc1 inhibitors and use thereof in the treatment of cancer |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104725398B (en) * | 2015-01-29 | 2017-01-18 | 杨威 | JAK/STAT3 phosphorylation inhibitor as well as preparation method and application thereof |
-
2017
- 2017-04-24 CN CN201710268784.XA patent/CN107082800B/en not_active Expired - Fee Related
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016020427A1 (en) * | 2014-08-05 | 2016-02-11 | Charité - Universitätsmedizin Berlin | Macc1 inhibitors and use thereof in the treatment of cancer |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107082800A (en) | 2017-08-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Hu et al. | Nox2 impairs VEGF-A-induced angiogenesis in placenta via mitochondrial ROS-STAT3 pathway | |
| Li et al. | LncRNA SNHG1 promotes liver cancer development through inhibiting p53 expression via binding to DNMT1. | |
| CN111500734B (en) | Liver cancer diagnosis marker and application thereof | |
| CN102839181B (en) | Nucleic acid aptamer sequence of gastric cancer cells, and uses thereof | |
| CN104211765B (en) | Polypeptide specifically binding to TRB3 protein, its screening method, identification and use | |
| CN112870362B (en) | Application of Circ-MET-1214 and/or Circ-M50 as targets in preparation of antitumor drugs | |
| CN107417772B (en) | Polypeptide HIP-20 capable of antagonizing RNA binding activity of hnRNPU protein and application thereof | |
| Yuan et al. | Fibroblast-localized lncRNA CFIRL promotes cardiac fibrosis and dysfunction in dilated cardiomyopathy | |
| CN114836424B (en) | lncRNA IFFD and application thereof in porcine ovarian granulosa cells | |
| CN108570096A (en) | A kind of polypeptide or derivatives thereof and its application in the drug for preparing treatment tumour | |
| Yu et al. | BMP9 promotes autophagy and inhibits migration and invasion in breast cancer cells through the c-Myc/SNHG3/mTOR signaling axis | |
| Zhang et al. | STX5 inhibits hepatocellular carcinoma adhesion and promotes metastasis by regulating the PI3K/mTOR pathway | |
| CN107602670B (en) | Polypeptide EIP-22 capable of antagonizing RNA binding activity of EWSR1 protein and application thereof | |
| CN107082800B (en) | Inhibitor of MACC1 gene and application thereof in resisting hepatocellular carcinoma invasion | |
| CN106916211B (en) | Polypeptide Inhibitor of MACC1 Gene and Its Application | |
| CN117756893A (en) | EGFR (epidermal growth factor receptor) inhibition polypeptide compound and preparation method and application thereof | |
| WO2016082192A1 (en) | Polypeptide capable of specifically binding with trb3 protein, screening method therefor, and identification and use thereof | |
| CN110964726B (en) | Recombinant siMACF1 and production method and application thereof | |
| CN112410429A (en) | Application of FXYD3 as gastric cancer diagnosis marker and treatment target | |
| CN102808016B (en) | Applications of ARID1A gene and protein product encoded by the same | |
| CN112143805A (en) | Use of RIT1 in diagnosis and treatment of hepatocellular carcinoma | |
| CN115896283B (en) | Application of CROT in the preparation of diagnostic reagents and therapeutic drugs for paclitaxel-resistant ovarian cancer | |
| CN118290537B (en) | A peptide that inhibits CK2 in the NCI-H460 cell line | |
| CN114634551B (en) | Polypeptides and their application in the preparation of anticancer drugs that antagonize the binding of wild-type p53 to MDM2 | |
| CN108330193A (en) | The application of IQUB genes or albumen in preparing breast cancer diagnosis product and medicine |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| TA01 | Transfer of patent application right |
Effective date of registration: 20201124 Address after: 050000 3-2-2701, East District, Changjiu center, 88 Zhujiang Avenue, hi tech Zone, Shijiazhuang City, Hebei Province Applicant after: Hebei songnuo Biotechnology Co., Ltd Address before: 211198 No. 18 Zhilan Road, Science Park, Jiangning District, Nanjing City, Jiangsu Province Applicant before: NANJING GAISIFU MEDICAL TECHNOLOGY Co.,Ltd. |
|
| TA01 | Transfer of patent application right | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20201211 Termination date: 20210424 |
|
| CF01 | Termination of patent right due to non-payment of annual fee |