CN106796242A

CN106796242A - For the quantitative method and system with detection of selectivity of allergen

Info

Publication number: CN106796242A
Application number: CN201580054874.8A
Authority: CN
Inventors: T·J·阿曼; B·W·谢弗; R·C·希尔; G·单
Original assignee: Dow AgroSciences LLC
Current assignee: Corteva Agriscience LLC
Priority date: 2014-08-11
Filing date: 2015-08-11
Publication date: 2017-05-31
Also published as: CA2958063A1; BR112017002622A2; EP3180622A4; EP3180622A1; AU2015301806A1; WO2016025516A1

Abstract

The present invention relates to such method and system, it identifies candidate feature peptide by bioinformatics research, for carrying out quantitative Multi-way analysis to the complex proteins sample from plant, plant part and/or food product using mass spectrum.There is provided the purposes and method that are selected using bioinformatics means for quantitative candidate feature peptide.Additionally provide comprising chromatogram and mass spectrographic system, for using selected feature peptide.

Description

For the quantitative method and system with detection of selectivity of allergen

Priority request

This application claims the rights and interests of the applying date of following U.S. Provisional Patent Application：It is entitled that August in 2014 is submitted on the 11st “Methods and Systems for Selective Quantitation and Detection of Allergens The sequence number 62/035,744 of Including GLY M 1 "；In entitled " the Methods and of submission on the 11st of August in 2014 Systems for Selective Quantitation and Detection of Allergens Including GLY M 3 " sequence number 62/035,731；In entitled " the Methods and Systems for of submission on the 11st of August in 2014 The U.S. of Selective Quantitation and Detection of Allergens Including GLY M 4 " is special Sharp patent application serial numbers 62/035,768；In entitled " the Methods and Systems for of submission on the 11st of August in 2014 The U.S. of Selective Quantitation and Detection of Allergens Including GLY M 5 " is special Sharp patent application serial numbers 62/035,800；Entitled " the Methods and Systems for of submission on the 11st of August in 2014 Selective Quantitation and Detection of Allergens Including GLY M 6 GI The sequence number 62/035,858 of SUBUNIT "；Entitled " the Methods and Systems for of submission on the 11st of August in 2014 Selective Quantitation and Detection of Allergens Including GLY M 6 G2 The sequence number 62/035,876 of SUBUNIT "；In entitled " the Methods and Systems for of submission on the 11st of August in 2014 Selective Quantitation and Detection of Allergens Including GLY M 6 G3 The sequence number 62/035,920 of SUBUNIT "；Entitled " the Methods and Systems for of submission on the 13rd of August in 2014 Selective Quantitation and Detection of Allergens Including GLY M 6 G4 The sequence number 62/036,926 of SUBUNIT "；And the Serial No. 62/035,944 submitted to for 11st in August in 2014 “Methods and Systems for Selective Quantitation and Detection of Allergens The Precursor of Including GLY M 6 ", the disclosure content of each application is incorporated herein by reference in their entirety.

Background

The method that this area is presently preferably used to analyze gene expression in plants includes technology (such as PCR based on DNA And/or RT-PCR)；Use reporter gene；Southern traces；And immunochemistry.These methods have various shortcomings.Planting Detect that known and potential allergen is an important topic of public safety in thing, plant part and/or food.

Although mass spectrum is previously disclosed, existing means are limited, are quantified with sensitive without selection.Still Need for the selection, sensitive quantitative of known in plant, plant part and/or food and/or potential allergen High throughput method.

It is open

The present invention relates to the use of bioinformatics research to identify candidate feature peptide, for using mass spectrography to from plant The complex proteins sample of thing, plant part and/or food carries out the method and system of quantitative multiplex analysis.Given birth to there is provided using Thing Informatics Method selection candidate feature peptide is used for quantitative purposes and method.Additionally provide including chromatogram and mass spectrographic system, For the feature peptide selected by utilization.

In one aspect, there is provided selection candidate feature peptide is used for the quantitative known allergen from the sample based on plant With the method for potential allergen.The method includes：

A () is based on the potential allergen of homological identification with least one known allergenic proteins sequence；

B () carries out the sequence alignment of at least one known allergen and the potential allergen of identification in step (a)；

C () is based on the sequence alignment and selects consensus sequence or representative series；

D () is based on coming the consensus sequence of selection or the sequence alignment and computer of representative series in comfortable step (c) and disappears Change the conservative region or domain of data, it is determined that multiple candidate feature peptides；With

E () is based on the measurement (measurements) of the feature peptide, described in the quantitative sample based on plant The amount of at least one known allergen and potential allergen.

In one embodiment, the quantification steps use column chromatography and mass spectrum.In another embodiment, it is quantitative Step includes measuring the multiple candidate feature peptide using high-resolution accurate mass mass spectrum (HRAM MS).In another implementation In scheme, quantification steps include being calculated from mass spectrum the corresponding peak heights or peak area of candidate feature peptide.In another embodiment In, quantification steps include being compared data and the data of low fragmentation mode from mass spectrographic fragmentation mode high.

In one embodiment, at least one known allergen includes at least one allergic effect being selected from the group It is former：Gly m 1, Gly m 3, Gly m 4, Gly m 5 (beta-conglycinin), (glycinin) Gly of Gly m 6 m 6 (the soybean ball eggs of 6 (glycinin) G3, Gly m of (glycinin) G2, Gly m, 6 (glycinin) G4, Gly m 6 Precursor in vain), Kunitz trypsin inhibitors 1, Kunitz trypsin inhibitors 3, Gly m Bd 28 K, Gly m Bd 30 K, Gly m 8 (2S albumin), agglutinin and lipoxygenase.In another embodiment, at least one known allergen Including Gly m 1, Gly m 3, Gly m 4, Gly m 5 (beta-conglycinin), Gly m 6 (glycinin) Gl, Gly (the soybean balls of 66 (glycinin) G4 or Gly m of (glycinin) G3, Gly m of m 6 (glycinin) G2, Gly m 6 Albumen) precursor.

In another embodiment, the consensus sequence or representative series of step (c) are included for Gly m 1 SEQ ID NO:12nd, 28,29,30,31,32,33,34 or 35.In another embodiment, the consensus sequence of step (c) or Representative series include SEQ ID NO for Gly m1:12nd, 28 or 29.In another embodiment, step (c) Consensus sequence or representative series include SEQ ID NO for Gly m 3:13rd, 38,39 or 40.In another embodiment party In case, the consensus sequence or representative series of step (c) include SEQ ID NO for Gly m 3:13 or 38.Another In individual embodiment, the consensus sequence or representative series of step (c) include SEQ ID NO for Gly m 4:14、42、 43rd, 44,45,46,47,48,49,50 or 51.In another embodiment, the consensus sequence or representative series of step (c) SEQ ID NO are included for Gly m 4:14 or 42.In another embodiment, the consensus sequence of step (c) or generation Table sequence includes SEQ ID NO for Gly m 5:15、61、62、63、64、65、66、67、68、69、70、71、72、 73 or 74.In another embodiment, the sequence or representative series of consensus sequence step (c) are wrapped for Gly m 5 The NO of ID containing SEQ:15 or 61.In another embodiment, the consensus sequence or representative series of step (c) are for Gly m SEQ ID NO are included for 6 G1:16 or 95.In another embodiment, the consensus sequence or representative series of step (c) SEQ ID NO are included for the G2 of Gly m 6:17 or 107.In another embodiment, the consensus sequence of step (c) Or representative series include SEQ ID NO for the G3 of Gly m 6:18.In another embodiment, step (c) is total to There are sequence or representative series for the G4 of Gly m 6 comprising SEQ ID NO:19th, 130,131,132,133 or 134. In another embodiment, the consensus sequence or representative series of step (c) include SEQ ID for the G4 of Gly m 6 NO:19 or 130.In another embodiment, the consensus sequence or representative series of step (c) are for Gly m6 precursors Comprising SEQ ID NO:20.

In one embodiment, for Gly m 1, potential allergen is comprising selected from SEQ ID NO:12 and 30-35 At least one sequence.In another embodiment, for Gly m 3, potential allergen is comprising selected from SEQ ID NO:13 With at least one sequence of 39-40.In another embodiment, for Gly m4, potential allergen is comprising selected from SEQ ID NO:At least one sequence of 14 and 43-51.In another embodiment, for Gly m5, potential allergen is included Selected from SEQ ID NO:At least one sequence of 15 and 62-74.In another embodiment, it is potential for the G1 of Gly m 6 Allergen comprising be selected from SEQ ID NO:16 and 95 at least one sequence.In another embodiment, for Gly m 6 G2, potential allergen is comprising selected from SEQ ID NO:17 and 107 at least one sequence.In another embodiment, it is right In the G4 of Gly m 6, potential allergen is comprising selected from SEQ ID NO:At least one sequence of 19 and 131-134.

In another embodiment, for Gly m 1, candidate feature peptide is comprising selected from SEQ ID NO:1st, 36 and 37 At least one sequence.In another embodiment, for Gly m 1, candidate feature peptide is comprising selected from SEQ ID NO:36 Hes 37 at least one sequence.In another embodiment, for Gly m 3, candidate feature peptide is comprising selected from SEQ ID NO:2 At least one sequence with 41.In another embodiment, for Gly m 3, candidate feature peptide includes SEQ ID NO:41. In another embodiment, for Gly m 4, candidate feature peptide is comprising selected from SEQ ID NO:At least one sequence of 52-57 Row.In another embodiment, for Gly m 4, candidate feature peptide includes SEQ ID NO:52-57.In another implementation In scheme, for Gly m5, candidate feature peptide is comprising selected from SEQ ID NO:At least one sequence of 3 and 75-94.At another In embodiment, for Gly m5, candidate feature peptide includes SEQ ID NO:75-94.In another embodiment, for The G1 of Gly m 6, candidate feature peptide is comprising selected from SEQ ID NO:At least one sequence of 96-106.In another embodiment In, for Gly m 6G1, candidate feature peptide includes SEQ ID NO:96-106.In another embodiment, for Gly m 6 G2, candidate feature peptide is comprising selected from SEQ ID NO:At least one sequence of 4 and 108-120.In another embodiment, For the G2 of Gly m 6, candidate feature peptide includes SEQ ID NO:108-120.In another embodiment, for Gly m 6 G3, candidate feature peptide is comprising selected from SEQ ID NO:At least one sequence of 5 and 121-129.In another embodiment, it is right In the G3 of Gly m 6, candidate feature peptide includes SEQ ID NO:121-129.In another embodiment, for Gly m 6 G4, candidate feature peptide is comprising selected from SEQ ID NO:At least one sequence of 135-156 and 58.In another embodiment, For the G4 of Gly m 6, candidate feature peptide includes SEQ ID NO:135-156 and 58.In another embodiment, for Gly M6 precursors, candidate feature peptide is comprising selected from SEQ ID NO:6th, 59 and 60 at least one sequence.In another embodiment, For Gly m6 precursors, candidate feature peptide includes SEQ ID NO:59 and 60.In another embodiment, the sample based on plant Part of the product comprising soya seeds or soya seeds.

On the other hand, there is provided there is known amino acid sequence for quantitative one or more in the sample based on plant The system of the target protein of row.The system includes：

A () is used to be extracted from the sample based on plant the high flux means of protein；

B () is used for the processing module of the protein extracted with least one protease digestion；

C () is used for the separation module of isolated peptides in a single step；

D () is used to be the selecting module of at least one known allergen and the multiple feature peptides of potential allergen selection； With

E () is used to measure the mass spectrum of the multiple feature peptide.

In one embodiment, separation module includes column chromatography.In another embodiment, column chromatography includes liquid Phase column chromatography.In another embodiment, mass spectrum includes high-resolution accurate mass mass spectrum (HRAM MS).In another reality In applying scheme, selecting module using provided herein is method.

In one embodiment, one or more purpose with known amino acid sequence in the sample based on plant Protein includes potential allergen.In another embodiment, for Gly m1, potential allergen is comprising selected from SEQ ID NO:At least one sequence of 12 and 30-35.In another embodiment, for Gly m 3, potential allergen is included Selected from SEQ ID NO:At least one of 13 and 39-40 sequence.In another embodiment, for Gly m 4, potentially Allergen is comprising selected from SEQ ID NO:At least one sequence of 14 and 43-51.In another embodiment, for Gly M5, potential allergen is comprising selected from SEQ ID NO:At least one sequence of 15 and 62-74.In another embodiment, For the G1 of Gly m 6, potential allergen is comprising selected from SEQ ID NO:16 and 95 at least one sequence.In another reality Apply in scheme, for the G2 of Gly m 6, potential allergen is comprising selected from SEQ ID NO:17 and 107 at least one sequence. In another embodiment, for the G4 of Gly m 6, potential allergen is comprising selected from SEQ ID NO:19 and 131-134's At least one sequence.

In another embodiment, for Gly m 1, feature peptide is comprising selected from SEQ ID NO:1st, 36 and 37 at least One sequence.In another embodiment, for Gly m 1, feature peptide includes SEQ ID NO:36 and 37.In another reality Apply in scheme, for Gly m 3, feature peptide is comprising selected from SEQ ID NO:2 and 41 at least one sequence.In another implementation In scheme, for Gly m 3, the SEQ ID NO that feature peptide is included:41.In another embodiment, it is special for Gly m 4 Peptide is levied comprising selected from SEQ ID NO:At least one sequence of 52-57.In another embodiment, for Gly m 4, feature Peptide includes SEQ ID NO:52-57.In another embodiment, for Gly m5, feature peptide is comprising selected from SEQ ID NO: At least one sequence of 75-94.In another embodiment, for Gly m5, feature peptide includes SEQ ID NO:75-94. In another embodiment, for the G1 of Gly m 6, feature peptide is comprising selected from SEQ ID NO:At least one sequence of 96-106 Row.In another embodiment, for the G1 of Gly m 6, feature peptide includes SEQ ID NO:96-106.In another implementation In scheme, for the G2 of Gly m 6, feature peptide is comprising selected from SEQ ID NO:At least one sequence of 4 and 108-120.Another In individual embodiment, for the G2 of Gly m 6, feature peptide includes SEQ ID NO:108-120.In another embodiment, it is right In the G3 of Gly m 6, feature peptide is comprising selected from SEQ ID NO:At least one sequence of 5 and 121-129.In another embodiment party In case, for the G3 of Gly m 6, feature peptide includes SEQ ID NO:121-129.In another embodiment, for Gly m 6 G4, feature peptide is comprising selected from SEQ ID NO:At least one sequence of 135-156 and 58.In another embodiment, it is right In the G4 of Gly m 6, feature peptide includes SEQ ID NO:135-156 and 58.In another embodiment, before for Gly m6 Body, feature peptide is comprising selected from SEQ ID NO:6th, 59 and 60 at least one sequence.In another embodiment, for Gly M6 precursors, feature peptide includes SEQ ID NO:59 and 60.In another embodiment, the sample based on plant includes Soybean Species The part of son or soya seeds.

On the other hand, there is provided quantitative at least one change with known amino acid sequence in the sample based on plant Answer the high throughput method of former and homologous potential allergen.The method include using provided herein is system.

Brief description of the drawings

Fig. 1 shows the delegate analysis workflow of method disclosed herein and system.

Fig. 2A -2C show the feature peptide for selecting：SEQ ID NO:1 SYPSNATCPR；SEQ ID NO:36 ALGILNLNR；With SEQ ID NO:The representative SRM LC-MS/MS of 37 NLQL1LNSCGR；Tryptose from Gly m 1 The soybean sample chromatogram of enzymic digestion.

Fig. 2 D show representational SRM LC-MS/MS reference colours spectrogram -500ng/mL synthetic peptide SEQ ID NO:1 SYPSNATCPR natural abundances peptide and heavy label peptide are changed.

Sequence alignment between the potential homologue of Fig. 2 E display Gly m1 and Gly m1.

Fig. 3 A show the selected feature peptide SEQ ID of the soybean sample chromatogram of the Trypsin Induced from Gly m 3 NO:The representative SRM LC-MS/MS of 2 YMVIQGEPGAVIR.

Fig. 3 B show representational SRM LC-MS/MS reference colours spectrogram -500ng/mL synthetic peptide SEQ ID NO:2 YMVIQGEPGAVIR natural abundances peptide and heavy label peptide are changed.

Sequence alignment between Fig. 3 C display Gly m 3 and the potential homologue of Gly m 3.

Fig. 4 A-4F show the representative SRM LC-MS/MS for following selected feature peptides：SEQ ID NO:52 MVVFTFEDEINSPVAPATLYK；SEQ ID NO:53 ALDSFK；SEQ ID NO:54 SVENVEGNGGPGTIK；SEQ ID NO:55 ITFLEDGETK；SEQ ID NO:56 FVLHK；With SEQ ID NO:57 AIEAYLLAHPDYN；From Gly m 4 Trypsin Induced soybean sample chromatogram.

Sequence alignment between the potential homologue of Fig. 4 G display Gly m4 and Gly m4.

Fig. 5 A-5U show the representative SRM LC-MS/MS of following selected feature peptides：SEQ ID NO:3 NILEASYDTK；SEQ ID NO:75 CNLLK；SEQ ID NO:76 EEDEDEQPRPIPFPRPQPR；SEQ ID NO:77 EEQEWPR；SEQ ID NO:78 QFPFPRPPHQK；SEQ ID NO:79 ESEESEDSELR；SEQ ID NO:80 NPFLFGSNR；SEQ ID NO:81 FETLFK；SEQ ID NO:82 SPQLQNLR；SEQ ID NO:83 LQSGDALR；SEQ ID NO:84 VPSGTTYYVVNPDNNENLR；SEQ ID NO:85 FESFFLSSTEAQQSYLQGFSR；SEQ ID NO:86 FEEINK；SEQ ID NO:87 VLFSR；SEQ ID NO:88 TISSEDKPFNLR；SEQ ID NO:89 DP1YSNK；SEQ ID NO:90 FFEITPEK；SEQ ID NO:91 AIVILVINEGDANIELVGLK；SEQ ID NO:92 EQQQEQQQEEQPLEVR；SEQ ID NO:93 NFLAGSQDNVISQ1PSQVQELAFPGSAQAVEK；With SEQ ID NO: 94ESYFVDAQPK；The soybean sample chromatogram of the Trypsin Induced from Gly m5.

Fig. 5 V show representational SRM LC-MS/MS reference colours spectrogram -500ng/mL synthetic peptide SEQ ID NO:3 The peptide conversion of NILEASYDTK natural abundances peptide and heavy label.

Sequence alignment between Fig. 5 W display Gly m 5 and the potential homologue of Gly m 5.

Fig. 6 A-6K show the representative SRM LC-MS/MS of the feature peptide of lower column selection：SEQ ID NO:96 LVFSLCFLLFSGCCFAFSSR；SEQ ID NO:97 EQPQQNECQIQK；SEQ ID NO:98 RPSYTNGPQEIYIQQGK；SEQ ID NO:99 HQQENENEGGSILSGFTLEFLEHAFSVDK；SEQ ID NO:100 HCQRPR；SEQ ID NO:101 HNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLR；SEQ ID NO:102 ALIQVVNCNGER；SEQ ID NO:The VFDGELQEGR of expression vector 103；SEQ ID NO:104 TNDTPMIGTLAGANSLLNALPEEVIQHTFNLK；SEQ ID NO:105 NNNPFK；With SEQ ID NO:106 FLVPPQESQK；The soybean sample chromatogram of the Trypsin Induced from Gly m 6G1.

Sequence alignment between the potential homologue of the G1 of 6 G1 and Gly m of Fig. 6 L display Gly m 6.

Fig. 7 A-7N show the representative SRM LC-MS/MS of following selected feature peptide：SEQ ID NO:4 VTAPAMR；SEQ ID NO:108 LVLSLCFLLFSGCFALR；SEQ ID NO:109 EQAQQNECQIQK；SEQ ID NO: 110 RPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQR；SEQ ID NO:111 SQRPQDR；SEQ ID NO: 112 QQEEENEGSNILSGFAPEFLK；SEQ ID NO:113 EAFGVNMQIVR；SEQ ID NO:114 KPQQEEDDDDEEEQPQCVETDK；SEQ ID NO:115 LSAQYGSLR；SEQ ID NO:116 NAMFVPHYTLNANSIIYALNGR；SEQ ID NO:117 ALVQVVNCNGER；SEQ ID NO:118 VFDGELQEGGVLIVPQNFAVAAK；SEQ ID NO:119 TNDRPSIGNLAGANSLLNALPEE-VIQHTFNLK；And SEQ ID NO:120 NNNPFSFLVPPQESQR；The chromatogram of the soybean sample of the Trypsin Induced from the G2 of Gly m 6.

Fig. 7 O show representational SRM LC-MS/MS reference colours spectrogram -500ng/mL synthetic peptide SEQ ID NO:4 VTAPAMR natural abundances peptide and heavy label peptide are changed.

Sequence alignment between the potential homologue of the G2 of 6 G2 and Gly m of Fig. 7 P display Gly m 6.

Fig. 8 A-8J show the representative SRM LC-MS/MS of following selected feature peptides：SEQ ID NO:5 NNNPFSFLVPPK：SEQ ID NO:121 LVLSLCFLLFSGCCFAFSFR；SEQ ID NO:122 EQPQQNECQIQR； SEQ ID NO:123 QQEEENEGGSILSGFAPEFLEHAFVVDR；SEQ ID NO:124 LQGENEEEEK；SEQ ID NO:125 GGLSVISPPTEEQQQRPEEEEKPDCDEK；SEQ ID NO:126 HCQSQSR；SEQ ID NO:127 LSAQFGSLR；SEQ ID NO:128 VFDGELQEGQVLIVPQNFAVAAR；With SEQ ID NO:129 TNDRPSIGNLAGANSLLNALPEEVIQQTFNLR；The soybean sample chromatogram of the Trypsin Induced from the G3 of Gly m 6 Figure.

Fig. 8 K show representational SRM LC-MS/MS reference colours spectrogram -500ng/mL synthetic peptide SEQ ID NO:5 NNNPFSFLVPPK natural abundances peptide and heavy label peptide are changed.

Fig. 9 A-9X show the representative SRM LC-MS/MS of following selected feature peptides：SEQ ID NO:6 ADFYNPK；SEQ ID NO:135 LNECQLNNLNALEPDHR；SEQ ID NO:136 CAGVTVSK；SEQ ID NO:137 LTLNR；SEQ ID NO:138 MIIIAQGK；SEQ ID NO:139 GALGVAIPGCPETFEEPQEQSNR；SEQ ID NO: 140 QQLQDSHQK；SEQ ID NO:141 VFYLAGNPDIEYPETMQQQQQQK；SEQ ID NO:142 QGQHQQEEEEEGGSVLSGFSK；SEQ ID NO:143 HFLAQSFNTNEDIAEK；SEQ ID NO: 144QIVTVEGGLSVISPK；SEQ ID NO:145 WQEQQDEDEDEDEDDEDEQIPSHPPR；SEQ ID NO:146 RPSHGK；SEQ ID NO:147 EQDEDEDEDEDKPRPSRPSQGK；SEQ ID NO:148 QEEPR；SEQ ID NO: 149NGVEENICTLK；SEQ ID NO:150 LHENIARPSR；SEQ ID NO:151 ISTLNSLTLPALR；SEQ ID NO:152 QFQLSAQYVVLYK；SEQ ID NO:153 NGIYSPHWNLNANSVIYVTR；SEQ ID NO:154 DVFR； SEQ ID NO:155 AIPSEVLAHSYNLR；SEQ ID NO:156 QSQVSELK；With SEQ ID NO:58 YEGNWGPLVNPESQQGSPR, the soybean sample chromatogram of the Trypsin Induced from the G4 of Gly m 6.

Sequence alignment between the potential homologue of the G4 of 6 G4 and Gly m of Fig. 9 Y display Gly m 6.

Figure 10 A, 10B and 10C show the representative SRM LC-MS/MS of following selected feature peptide：SEQ ID NO:6 ADFYNPK, SEQ ID NO:59 GALQCKPGCPETFEEPQEQSNR and SEQ ID NO:60 LQSPDDER；From Gly m6 The soybean sample chromatogram of the Trypsin Induced of precursor.

Specific embodiment

Enabling can optionally detect that target protein and the sensitive multiple assay of measurement target protein level have Important meaning.At present, the technology of related protein expression detection depends critically upon traditional immunochemical technique, how should One challenge is become to the data volume that each sample requirement in the technology is produced.

Soybean is the trade product for being worth number in terms of 1,000,000,000 dollars, and this is because it balances protein, starch, oil composition --- By weight 2:2:1.Many seeds, including soybean, some contained protein are allergen and ANFs.Therefore someone Worry, in the soybean varieties of genetic modification, compared with the kind developed by traditional breeding method, allergen level is potentially possible to be changed Become.Allergen level so far in crop is entirely almost by immunoassay, such as enzyme linked immunosorbent assay (ELISA) Or IgE- Western blottings etc. are measured (ELISA)；However, the problem of these methods is limited sensitivity and specificity, and become The property changed is high.

Recently, the albumen that people are expressed method of the exploitation based on LC-MS/MS with the quantitative several plant in single analysis Matter generates interest.The analysis carried out using these " feature peptides " is included by several high degree of specificity of quantitative objective protein Digestion fragment tracks protein expression level.This can generally use with associated with Selective reaction monitoring (SRM) tandem mass spectrum Liquid chromatography is completed.There is provided herein improved multiple LC-MS/MS method and systems, it is caused in transgenosis and non-turn Several allergen proteins of simultaneous quantitative are possibly realized in transgenic soybean.Provided herein is method and system just include the degree of accuracy, essence Exactness, linear, test limit and quantitative limit etc. are in the interior analysis figure of merit (analytical figures of merit), and bag Sample throughput, transferability and ease for use is included to be verified in other interior Considerations.Multiplex pattern can be used (multiplexing format) quantifies allergen, and can for example one day (twenty four hours) window (from field to The numerical value of measurement) in harvest sample, treatment and analysis/quantitative from field.Additionally, the sample preparation of the method and system for being provided Scale can amplify to realize high flux completely, therefore, it is possible to analyze hundreds of samples in single batch.

Representational soybean allergen includes such as Gly m 1, Gly m 3, Gly m 4, Gly m 5 (β-companion's soybean ball Albumen), (glycinin) G2, the Gly m 6 of Gly m 6 (glycinin) G1, Gly m 6) G3, (the soybean ball eggs of Gly m 6 G4 in vain), Gly m 6 (glycinin) precursor, Gly m 6 (glycinin) G4 precursors, Kunitz trypsin inhibitors 1, Kunitz trypsin inhibitor 3, Gly m Bd 28 K, Gly m Bd 30 K, Gly m 8 (2S albumin), agglutinin And lipoxygenase.

Representational wheat allergens include such as factor Ⅰ (Tri a12), (Tri of wheat lipid transfer protein 1 A14), agglutinin isolectin 1 (Tri a18), ω -5 gliadins-seed storage protein (Tri a19), the molten egg of wheat alcohol (Tri a20 in vain；NCBI accession number M10092, M11073, M11074, M11075, M11076, K03074 and K03075), sulphur oxygen Also albumen (Tri a25), high molecular weight glutenin (Tri a26), low molecular weight glutenin (Tri a36), and α-purine Thionine (purothionin) (Tri a37).

Representational corn allergen includes such as corn lipid transfer proteins (LTP) (Zea m14) and thioredoxin (Zea m25)。

Representational corn allergen includes, for example, paddy rice factor Ⅰ A (Ory s12).

In some embodiments, the method and system for being provided uses the liquid chromatogram (LC- for being coupled to tandem mass spectrum MS/MS) the protein expression level of the different allergens of 16 kinds from soybean of detection.In some embodiments, the side Method and system can analyze single allergen, or analyze every kind of allergen with the combination of other oroteins to carry out resurvey more It is fixed, for the qualitative and quantitative analysis in plant substrates.

In some embodiments, the Mass Spectrometer Method for quantitative study can be by enterprising in triple quadrupole mass spectrometer Row Selective reaction monitoring is realized.Using such instrument and equipment, to the initial of the object ion (peptide) of formation in source Quality is selected, and then dissociate the precursor ion in the collision area of MS, followed by the quality of specific product (son) ion is selected And counting.In some embodiments, the Mass Spectrometer Method for quantitative study can have been come using Selective reaction monitoring (SRM) Into.Using certain types of instrument and equipment, the initial mass selection of the object ion formed in source, then at mass spectrograph (MS) Collision area in dissociate precursor (protein) ion, followed by the quality selection of specific product (peptide) ion and count. In some embodiments, the counting of unit interval can provide the peak area of integrable, can therefrom determine analyte amount or Concentration.In some embodiments, what is carried out on the mass spectrograph with HRAM abilities quantitative uses high-resolution accurate mass (HRAM) monitoring can include but is not limited to mixing quadrupole-flight time, quadrupole-track trap, ion trap-track trap or quadrupole- Ion trap-track trap (three grid) mass spectrograph.Using certain types of instrument and equipment, peptide does not suffer from fragmentation condition, but as complete Whole peptide is measured using full scan or targeting scan pattern (such as selected ion monitoring pattern or SIM).Can be by being each Specific analyte produces extraction chromatography of ions figure to determine the peak area of integrable, and can calculate the amount of analyte or dense Degree.The high-resolution and accurate mass property of data cause high degree of specificity and the spirit of target analytes (protein and/or peptide) Quick ion signal is possibly realized.

Unless otherwise indicated, the following term used in the application, including in specification and claims, with following The definition for being given.It has to be noticed that as used in specification and appended, singulative " ", " one " and " being somebody's turn to do " includes plural referents, unless the context clearly indicates otherwise.

As used herein, term " biology limitation " refer to limit genetic modification plant or its inhereditary material move to it is specified Region.The term includes physics, physicochemical, biology limitation, and other forms prevented genetic modification The limitation of survival, diffusion or breeding of the plant in natural environment or Artificial Growth condition.

As used herein, term " complex proteins sample " is used to distinguish the protein example of sample and purifying.Complicated egg White sample contains multiple proteins, and can in addition contain other pollutants.

As used herein, generic term " mass spectrum " or " MS " refer to any suitable mass spectrometry method, device or configuration, bag Include such as electron spray ionisation (ESI), substance assistant laser desorpted/ionization (MALDI) MS, MALDI- flight time (TOF) MS, big Air pressure (AP) MALDI MS, vacuum MALDI MS or its combination.Mass spectrometric apparatus are by measuring molecule by one group of magnetic field and electric field Flight path measure the molecular weight (as the function of the mass-to-charge ratio of molecule) of molecule.Mass-to-charge ratio is in the electronic of charged particle Widely used physical quantity in mechanics.The mass-to-charge ratio of particular peptide can a priori be calculated by those skilled in the art.With difference Two particles of mass-to-charge ratio will not be moved in identical path in a vacuum when by identical electric field and magnetic field.

Mass spectrometer is made up of three modules：Ion gun, sample molecule is separated into ion by it；Mass analyzer, it leads to Applying electromagnetic field is crossed to classify ion according to quality；And detector, the value of the amount of its measurement indicant, and therefore provide Data for calculating the abundance that every kind of ion is present.The technology can apply to qualitative and quantitative.These include that identification is unknown Compound, determines the isotopics of element in molecule, and its structure, and quantitative sample are determined by observing compound fragmentation The amount of middle compound.

The detailed overview of mass spectrometry method and device can find in below with reference to document, and these are incorporated by reference into this Text：Can and Annan (1997) Overview of peptide and protein analysis by mass Spectrometry. Current Protocols in Molecular Biology, Ausubel et al. volume, New are embodied in York:Wiley,p.10.21.1-10.21.27；Paterson and Aebersold (1995) Electrophoresis 16: 1791-1814；Patterson(1998)Protein identification and characterization by mass Spectrometry. Current Protocols in Molecular Biology, Ausubel et al. volume, New are embodied in York:Wiley,p.10.22.1-10.22.24；With Domon and Aebersold (2006) Science 312 (5771)：212- 17。

As the term is employed herein, when there is two or more target proteins and/or peptide in same sample, albumen Matter and/or peptide are " multiple ".

As it is used herein, " plant trait " can refer to any single features or quantifiable measurement of plant.

As used herein, the short polymerization for being linked in sequence and being formed that phrase " peptide " or " peptide " can refer to a-amino acid to determine Thing.Peptide can also be produced by with protease digestion polypeptide such as protein.

As it is used herein, phrase " protein " can refer to by being arranged in straight chain and by contiguous amino acid residues The organic compound of the Amino acid profile that the peptide bond between carboxyl and amino links together.Amino acid sequence in protein by The sequence definition of gene, the sequence of gene is with genetic code encoding.Generally, genetic code specifies 20 standard amino acids, but In some organisms, genetic code may include selenocysteine, in some archeobacterias, it may include pyrrolysine.It is logical The residue being frequently observed in protein is acted on by posttranslational modification and is modified by sulphation, and posttranslational modification effect can be in the albumen Matter is occurred before cell use, or is occurred as the part of controlling mechanism.Residue of protein can also be according to this area skill Technology familiar to art personnel is modified by design.As used herein, term " protein " is covered comprising naturally occurring The straight chain of amino acid, synthesizing amino acid, the amino acid of modification or any or all combinations of the above.

As it is used herein, term " single injection " refers to the initial step in the operation of MS or LC-MS devices.Work as albumen When quality sample is introduced into device in single injection, the whole sample is introduced in a single step.

As used herein, phrase " feature peptide " refers to mark (small peptide) sequence of specified protein.Any protein can be with Contain average 10 to 100 kinds of features peptide.Usual feature peptide has at least one in following standard：Examined easily by mass spectrography Survey；Can be predicted and stably from liquid chromatogram (LC) post wash-out；It is enriched with by RPLC (RP-HPLC)；Well Ionization；Good fragmentation；Or the combination of above-mentioned person.Easily by the peptide of mass spectrum standard measure generally with least in following standard Kind：Be readily synthesized, can by it is highly purified (>97%)≤20% acetonitrile, is dissolved in, low non-specific binding is anti-oxidant, anti-conjunction Into rear modification, hydrophobicity or hydrophobicity index >=10 and≤40.Hydrophobicity index can be according to Krokhin, Molecular and Cellular Proteomics 3 (2004) 908 are calculated, and it is incorporated herein by reference.Known hydrophobicity index less than 10 or Peptide more than 40 may repeatably be separated or eluted by RP-HPLC posts.

As used herein, term " stacking " refers to depositing for multiple heterologous polynucleotides for being incorporated into Plant Genome .

Tandem mass spectrum：In tandem mass spectrum, the parent ion produced from target molecule can be filtered in a mass spectrometer, and Parent ion is then fractured to produce one or more daughter ions, daughter ion to be then analyzed (inspection in second mass spectrum program Survey and/or quantitative)).In some embodiments, the use of tandem mass spectrum is excluded.In these embodiments, provided Tandem mass spectrum is not used in method and system.Therefore, parent ion is neither produced in these embodiments nor produces daughter ion.

As used herein, term " genetically modified plants " can refer to the plant comprising heterologous polynucleotide in its genome Thing.Generally, heterologous polynucleotide stable integration is in genome so that polynucleotides are delivered to subsequent generation.Heterologous multinuclear Thuja acid can be incorporated into genome either individually or as a part for recombinant expression cassettes." transgenosis " is used to include herein Any such cell, cell line, callus, tissue, plant part or plant, its genotype is by the presence of heterologous nucleic acids Change, including initially so change those genetically modified plants and from initial genetically modified plants pass through sexual hybridization or nothing Sexual reproduction and the genetically modified plants that generate.

Any plant that useful plant part is provided can be processed in an embodiment of the present invention.Example includes providing The plant of flower, water fruits and vegetables and cereal.

As used herein, phrase " plant " includes dicotyledon and monocotyledon.The example of dicotyledon includes Tobacco, arabidopsis, soybean, tomato, pawpaw, Canola, sunflower, cotton, clover, potato, grape, pigeonpea, pea, rue Tongue, chick-pea, beet, rape, watermelon, muskmelon, pepper, peanut, pumpkin, radish, spinach, pumpkin, broccoli, cabbage, Hu Luo Fore-telling, cauliflower, celery, Chinese cabbage, cucumber, eggplant and lettuce.Monocotyledonous example include corn, paddy rice, wheat, sugarcane, Barley, rye, sorghum, orchid, bamboo, banana, cattail, lily, oat, onion, millet and triticale.The example of fruit includes Banana, pineapple, orange, grape, grape fruit, watermelon, muskmelon, apple, peach, pears, Kiwi berry, mango, nectarine, guava, persimmon, Avocado, lemon, fig, and berry.Colored example include babysbreath, carnation, dahlia, narcissus, fish pelargonium, African Chrysanthemum, Lily, orchid, tree peony, cicely (Queen Anne ' s lace), rose, toad's-mouth or other flower arrangements or decoration flower, potted flower And bouquet.

The specificity that identification single protein is allowed from complex sample in mass spectrometry method is unique, because identification Target protein only needs the sequence of target protein.Compared with the multiplex of other forms, the unique distinction of mass spectrography is energy Enough using the total length of the primary amino acid sequences of protein come the unique mark type of the primary amino acid sequences of targeting protein Part, so as to almost eliminate non-specific detection.In some embodiments of the present invention, using uniquely identifying target protein The target protein that the proteolytic fragments of matter or a histone proteolytie fragrnent come in detection of complex protein example.

In some embodiments, disclosed method can be by single mass spectral analysis come quantitative complex proteins sample In multiple proteins or determine its ratio, rather than repeatedly measuring every kind of target protein respectively, then single result is converged Weave into a sample result.

In some embodiments, the present disclosure also provides the side that can be used for development and utilization transgene plant technology Method.Specifically, disclosed method can be used for maintaining the genotype experience successive generation of genetically modified plants.Additionally, being disclosed herein Some embodiments of method can be used to provide to the high throughput analysis of non-transgenic plant as described below：The non-transgenic Plant is in the risk by the transgenosis pollution from neighbouring plant (such as by cross-pollination).By these embodiment party Case, can promote and/or complete the biological limitation of transgenosis.In other embodiments, method disclosed herein can be used for High flux mode screens the result of Plant Transformation program, and the transformant of desired expression characteristic is shown to identify

Mass-to-charge ratio can be determined using quadrupole analyzer.For example, in " quadrupole " or " quadrupole ion trap " instrument, vibration Ion in radiofrequency field is subject to and applies DC potentials between the electrodes, the amplitude of RF signals and the proportional power of m/z.Can To select voltage and amplitude so that the ion only with specific m/z can advance the total length of quadrupole rod, and every other ion It is deflected.Therefore, quadrupole instrument can serve as " mass filter " and " mass detector " of the ion in injection instrument.

Collision induced dissociation (" CID ") is generally used for producing the daughter ion for further detection.In CID, parent ion Energy is obtained by being collided with inert gas (such as argon gas), and it is then broken by being referred to as the process of " unimolecule decomposition " Split.Enough energy must be stored in parent ion so that some keys in ion are broken because energy increases.

Mass spectrograph generally provides the user ion scan；Each m/z i.e. in given range (such as 10 to 1200amu) Relative abundance.The result of analyte determination, i.e. mass spectrum, can be by dividing in many methods known in the art and primary sample Analyse the amount association of thing.For example, in view of sampling and analysing parameter is carefully controlled, can by the relative abundance of given ion with The table that the relative abundance is converted into the absolute magnitude of initial molecule is compared.Or, molecule mark can be run together with sample Accurate (for example, internal standard and external standard), and standard curve is built based on the ion produced from those standards.Using this standard curve, The relative abundance of given ion can be converted into the absolute magnitude of initial molecule.It is many other for by the presence of ion or amount with it is former The presence of beginning molecule or the associated method of amount are known to a person of ordinary skill in the art.

The selection of ionization method can be based on analyte to be measured, sample type, detector type, the positive to negative mould Selection of formula etc. determines.Ion can be produced using various methods, including but not limited to：Electron ionization, chemi-ionization, quickly Atom bombardment, field desorption and substance assistant laser desorpted ionized (MALDI), Protein-based tumor biomarker (SELDI), desorption Electro-spray ionization (DESI), photon ionization, electro-spray ionization and inductively coupled plasma.Electro-spray ionization refers to this The method of sample, wherein making solution by one section of short capillary, the end of pipe applies positive or negative current potential high.Reach pipe end Solution is evaporated the jet or spraying of (atomization) into very small solution droplets in solvent vapour.The spray of this drop crosses steaming Hair room, vaporization chamber is heated to prevent condensation and evaporation solvent.As drop diminishes, ammeter surface charge density increases, until this The time of sample arrives：Natural repulsion between identical charges causes ion and neutral molecule to be released.

The effluent of LC can directly and automatically (that is, " online ") is injected into electrospray device.In some embodiment party In case, the protein included in LC effluents is first by electro-spray ionization into parent ion.

A variety of mass analyzers can be used for liquid chromatograph mass spectrography (LC-MS).Exemplary quality analysis device bag Include but be not limited to single quadrupole rod, triple quadrupole bar, ion trap, TOF (flight time) and quadrupole rod flight time (Q-TOF).

Four-electrode quality analyzer can be made up of 4 poles being set parallel to each other.In quadrupole mass spectrometer (QMS), Quadrupole rod is the responsible part based on mass-to-charge ratio (m/z) filtered sample ion in instrument.It is being applied on bar based on ion Oscillating electric field in track stability, ion is separated in quadrupole.

Ion trap is the combination in electric field or magnetic field, can capture the ion in certain region of vacuum system or pipe.In operation During the quantum state of ion, ion trap can be used in mass spectrum.

Time-of-flight mass spectrometry (TOFMS) (TOFMS) is a kind of mass spectrometry method, wherein determining the matter lotus of ion by time measurement Than.The electric field acceleration that ion passes through known strength.The acceleration cause ion have and any other ion with identical charges Identical kinetic energy.The speed of ion depends on mass-to-charge ratio.The detector that measurement particle then reaches known distance apart is spent Time.This time will depend on the mass-to-charge ratio (speed that heavier particle reaches is lower) of particle.From this time and The experiment parameter known, can obtain the mass-to-charge ratio of ion.

In some embodiments, the particular instrument for being used by the method and/or system that are provided can include fragmentation high Pattern and low fragmentation mode (or alternatively, non-fragmentation mode).Such different mode can include mixed sweep high-energy and Low energy acquisition methods are producing high-resolution qualitative data.In some embodiments, high-resolution qualitative data can be wrapped Include product data collection (such as the data obtained from product ion (fragment ion) under fragmentation mode high) and preceding volumetric data set (example The data obtained from precursor ion (non-fragmentation of ions) such as under low fragmentation or non-fragmentation mode).

In some embodiments, the method and/or system for being provided use mass spectrograph, and mass spectrograph is including can be used to select The filter of step, can be used for the fragmentation device of fragmentation step, and/or can be used for obtain and/or mass spectrum foundation step in One or more mass analyzers.

Filter and/or mass analyzer can include quadrupole.Selection step and/or obtaining step and/or mass spectrum wound Build step and may involve the use of resolution quadrupole (resolving quadrupole).Additionally or alternatively, filter may include two Dimension or three-dimensional ion trap or flight time (ToF) mass analyzer.One or more mass analyzers can include or can be with Further include following one or more：TOF and/or ion cyclotron resonance mass analyzer and/or Orbitrap mass analyser and/or two dimension or three-dimensional ion trap.

Filtering by means of the selection based on mass-to-charge ratio (m/z) can be by using the matter that can be based on m/z selection ions Contents analyzer (such as quadrupole rod) is realized；Or transmit m/z scopes wide, the m/z according to ion separates ion, then by from The m/z value selection target ions of son.The example of the latter is the TOF combined with timing ion selector.Institute The method and/or system of offer may include to use chromatographic technique, such as liquid chromatogram (LC), separate and/or separate and be a kind of or many Target protein is planted, is such as separated from two or more in multiple proteins and/or separated.The method can be wrapped further Include the elution time of measurement target protein and/or the elution time of measurement is compared with expected elution time.

Additionally or alternatively, it is possible to use ionic mobility technology separates target protein, and it can use Ion transfer Cell is carried out.Furthermore it is possible to by the order or time of ion mobility drift come selection target protein.The method can be with Including measure proteins of interest matter drift time and/or by the drift time of measurement with expection drift time be compared.

In some embodiments, the method and/or system for being provided are unmarked, wherein quantitatively can be by comparing Target precursors between injection and each sample between or area is realized under the peak intensity or mass spectra peak of product m/z values.At some In embodiment, it is possible to use internal standard standardizes to tackle any of correlation analysis error.It is another unmarked quantitative Method, spectrogram counts (spectral counting), including the fragment obtained to each given peptide with nonredundancy or redundant fashion Ionic spectrum or the number of scanning are sued for peace.Then the related peptide mass spectrum of every kind of protein is added, so as to provide every kind of protein The measurement of number is scanned, it is proportional to the abundance of the protein.Then can be compared between sample/injection.

In some embodiments, ion gun is selected from：(1) electro-spray ionization (" ESI ") ion gun；(2) air press polish Ionization (" APPI ") ion gun；(3) APCI (" APCI ") ion gun；(4) it is substance assistant laser desorpted ionized (" MALDI ") ion gun；(5) laser desorption ionisation (" LDI ") ion gun；(6) atmospheric pressure ionization (" API ") ion gun；(7) silicon On desorption ionization (" DIOS ") ion gun；(8) electron bombardment (" E1 ") ion gun；(9) chemi-ionization (" CI ") ion gun； (10) FI (" F1 ") ion gun；(11) field desorption (" FD ") ion gun；(12) inductively coupled plasma (" ICP ") ion Source；(13) fast atom bombardment (" FAB ") ion gun；(14) liquid SIMS (" LSIMS ") ion gun；(15) desorb Electro-spray ionization (" DESI ") ion gun；(16) isotopic ion of nickel -63 source；(17) atmospheric pressure matrix assisted laser desorption electricity Luxuriant component；(18) thermojet ion gun.

In some embodiments, the method and/or system for being provided include being configured as performing computer program element Device and/or control system, the computer program element includes for making computing device for realizing methods described The computer readable program code means of process.

In some embodiments, the method and/or system for being provided scan work(using alternate low energy and high-energy Can be with liquid chromatogram separating plant extract combination.The information list of target protein, including but not limited to precursor can be provided The m/z of ion, the m/z of product ion, retention time, ion mobility drift time and mobility change rate.Separated in LC Cheng Zhong, and when target ion is eluted in mass spectrograph (and when detect low energy precursor ion or detect high-energy product from When son or activation retention time window), so the mass analyzer and/or system of method can select the narrow m/z scopes (to have Alterable and changeable width), by ion transport to air chamber.Therefore, it can significantly increase signal to noise ratio for target egg White matter is quantified.

In some embodiments, when the chromatogram when target target protein will be eluted in mass spectrometer ion source retains Between, the method and/or the mass analyzer of system for being provided can select narrow m/z scopes according to target precursor example, and (having can Change and changeable width).Then by these selected ion-transfers to can be by fragmentation mode high and low fragmentation mould Replace and repeat the Instrument Level that switching carrys out disassociated ions between formula (or non-fragmentation mode), before sample under the fragmentation mode high Body ion is substantially fragmented into product ion, the sample precursor ion substantially not fragmentation under the low fragmentation mode.Generally Obtain high-resolution, accurate mass spectrum in both modes, and at the end of experiment, by its chromatographic elution time and The fitting tightness degree of other optional physicochemical properties recognizes related precursor and product ion.With target target protein phase The precursor ion of pass or the signal intensity of product ion can be used to determine the amount of protein in plant extracts.

It will be understood by those skilled in the art that there may be some changes on the basis of disclosed in being provided.Therefore, be given Following examples for the purpose of illustrating the invention, and should not be construed as to the present invention or claim scope limitation.

Embodiment

Embodiment 1

The method and system for being provided is used to determine the endogenous soybean allergen protein in soya seeds, including Gly m 1, Gly m 3, Gly m 4, Gly m 5 (beta-conglycinin), Gly m 6, Kunitz trypsin inhibitors 1, Kunitz trypsin inhibitors 3, K the and Gly m 8 (2S albumin) of Gly m Bd 28 K, Gly m Bd 30.By 100 ± The soybean seed representative of 0.5mg grindings twice and is dried with hexane degreasing, is then used and is contained 5M urea, 2M thiocarbamides, 50mM Tris The Extraction buffer of pH 8.0 and 65mM DTT is extracted.By sample ultrasonically treated 30 minutes in a water bath, it is vortexed 1 minute, ultrasound Process other 30 minutes, and 4 DEG C with>3,000rpm is centrifuged 10 minutes.

Collect aqueous supernatant and diluted so that endogenous soybean allergen protein concentration reaches calibration with Extraction buffer Critical field.Will dilute extract at 95 DEG C with additional 1M Tris pH 8.0,0.5M DTT and deionized water are together Denaturation 20 minutes, then refrigerates 10 minutes at 4 DEG C.The extract of denaturation was incubated at 37 DEG C with 0.5mg/mL trypsase Night (~15 hours).Digestion reaction formic acid water (50/50v/v) be quenched and 4 DEG C with>3,000rpm is centrifuged minute.Will digestion A aliquot of extract be transferred in automatic sampler bottle, and analyze liquid chromatogram together with calibration standard items and connect Same positive ionization electrospray (ESI) tandem mass spectrum (LC-MS/MS) is analyzed.The calibration standard items of feature peptide are made as listed in table 1 It is standby.

In this embodiment, the test limit (LOD) and quantitative limit (LOQ) of endogenous soybean allergen are listed in table 2, wherein LOD and LOQ represent protein concentration (ng/mg).

(such as the Analyst Bioanalytical for LC-MS/MS are soft from feature peptide quantitative for the concentration of allergen Part) calculate, and by other method validations including enzyme linked immunosorbent assay (ELISA) (ELISA).Compared using statistical analysis and come from The calculating concentration of the allergen of different samples, as a result shows the good uniformity between sample.

Embodiment 2

The homologous of several Gly m1 is identified in interior public database from including NCBI, Phytozome and UniProt Protein sequence.To sequence (the SEQ ID NO for identifying:12 and 29-35) analyzed using bioinformatics tools, to identify Sequence homology and consensus sequence between available protein sequence are constituted (referring to Fig. 2 E).Specifically, this is directed to use with Vector NTI Align X compare instrument, and the instrument performs CLUSTAL W types and compares.From the analysis, it may be determined that altogether There are sequence and/or representative series.

Once selection determines consensus sequence and/or representative series, by its on computers (in silico) disappear Change, the candidate feature fragments of peptides for being detected by LC-MS and being measured is treated in generation.According to provided herein is unique method, based on available Protein sequence between conservative select feature peptide so that selected feature peptide can be used in common sequence number According to quantitative protein isoforms all or as much as possible in the protein sequence identified in storehouse.Therefore, selected feature The quantitative of peptide can not only measure Gly m 1 itself, can also measure the potential allergen with the very high homologies of Gly m 1.

Soybean seed representative is ground to form into fine powder, with hexane degreasing twice, and buffer solution (such as 5M urine is determined with suitable Element, 2M thiocarbamides, 50mM Tris (pH 8.0), 65mM DTT) extract.Sample is ultrasonically treated extracting albumen in buffer solution Matter.The protein dilution that will be extracted, denaturation, then by adding trypsase protease and incubation 15-20 hours at 37 DEG C Carry out proteolytic digestion.Digestion reaction is acidified with formic acid (pH=1-2), and is analyzed using LC-MS/MS.

Selected feature peptide can be used for Gly m 1 (being combined individually or with other oroteins in multiple assay pattern) Qualitative and quantitative analysis.In this embodiment, three kinds of feature peptides (SEQ ID NO are have selected from all peptide possibilities: 1SYPSNATCPR；SEQ ID NO:36 ALGILNLNR；With SEQ ID NO:37 NLQLILNSCGR), the generation of these feature peptides Table quantitative display is in fig 1 and 2.Fig. 2A -2C.It is SEQ ID NO:1 SYPSNATCPR has synthesized poly saccharide peptide standard product for quantitative With qualitative analysis (referring to Fig. 2 D).Synthetic peptide can be directly as the analysis normative reference of quantification of protein.

Embodiment 3

The several same of Gly m 3 is identified in interior public database from including NCBI, Phytozome and UniProt Source protein matter sequence.Sequence (the SEQ ID NO analyzed and identified out using bioinformatics tools:13,39 and 40) with identify can Sequence homology and consensus sequence between protein sequence are constituted (referring to Fig. 3 C).Specifically, this includes using Vector NTI Align X compare instrument, and the instrument performs CLUSTAL W types and compares.From the analysis, it may be determined that altogether There are sequence and/or representative series.

Once selection determines consensus sequence and/or representative series, it is carried out to be digested on computer and is treated with generation The candidate feature fragments of peptides for being detected by LC-MS and being measured.According to provided herein is unique method, based on available protein sequence Conservative selection feature peptide between row so that selected feature peptide can be used for being identified in common sequence database Protein sequence in quantitative all or protein isoforms as much as possible.Therefore, the quantitative of selected feature peptide not only may be used To measure Gly m 3 itself, and the potential allergen with the very high homologies of Gly m 3 can be measured.

Selected feature peptide can be used for Gly m 3 (being combined individually or with other oroteins in multiple assay pattern) Qualitative and quantitative analysis.In this embodiment, two feature peptides (SEQ ID NO are have selected from all peptide possibilities:2 YMVIQGEPGAVIR；With SEQ ID NO:41 GPGGVTVK), and SEQ ID NO:The representativeness of 2YMVIQGEPGAVIR is determined Amount is shown in Fig. 3 A.It is SEQ ID NO:2 YMVIQGEPGAVIR have synthesized poly saccharide peptide standard product for qualitatively and quantitatively analysis (ginseng See Fig. 3 B).Synthetic peptide can be directly as the analysis normative reference of quantification of protein.

Embodiment 4

The several homologous of Gly m4 is identified in interior public database from including NCBI, Phytozome and UniProt Protein sequence.Sequence (the SEQ ID NO analyzed and identified out using bioinformatics tools:14 and 43-51) it is available to identify Protein sequence between sequence homology and consensus sequence constitute (referring to Fig. 4 G).Specifically, this is directed to use with Vector NTI Align X compare instrument, and the instrument performs CLUSTAL W types and compares.From the analysis, it may be determined that consensus sequence And/or representative series.

Once selection determines consensus sequence and/or representative series, it is carried out to be digested on computer and is treated with generation The candidate feature fragments of peptides for being detected by LC-MS and being measured.According to provided herein is unique method, based on available protein sequence Conservative selection feature peptide between row so that selected feature peptide can be used for being identified in common sequence database Protein sequence in quantitative all or protein isoforms as much as possible.Therefore, selected feature peptide it is quantitative not only Gly m 4 itself can be measured, but also the potential allergen with the very high homologies of Gly m 4 can be measured.

Selected feature peptide can be used for Gly m4 (being combined individually or with other oroteins in multiple assay pattern) Qualitative and quantitative analysis.In this embodiment, several feature peptides (SEQ ID NO are selected from all peptide possibilities:52 MGVFTFEDEINSPVAPATLYK；SEQ ID NO:53 ALDSFK；SEQ ID NO:54 SVENVEGNGGPGTIK；SEQ ID NO:55 ITFLEDGETK；SEQ ID NO:56 FVLHK；With SEQ ID NO:57 AIEAYLLAHPDYN), and these are special The representative quantitative display of peptide is levied in Fig. 4 A-4F.Synthetic peptide can be directly as the analysis normative reference of quantification of protein.

Embodiment 5

The several homologous of Gly m5 is identified in interior public database from including NCBI, Phytozome and UniProt Protein sequence.Sequence (the SEQ ID NO analyzed and identified out using bioinformatics tools:15 and 62-74) it is available to identify Protein sequence between sequence homology and consensus sequence constitute (referring to Fig. 5 W).Specifically, this is directed to use with Vector NTI Align X compare instrument, and the instrument performs CLUSTAL W types and compares.From the analysis, it may be determined that consensus sequence And/or representative series.

Once selection determines consensus sequence and/or representative series, it is carried out to be digested on computer and is treated with generation The candidate feature fragments of peptides for being detected by LC-MS and being measured.According to provided herein is unique method, based on available protein sequence Conservative selection feature peptide between row so that selected feature peptide can be used for being identified in common sequence database Protein sequence in quantitative all or protein isoforms as much as possible.Therefore, selected feature peptide it is quantitative not only Gly m 5 itself can be measured, the potential allergen with the very high homologies of Gly m 5 can also be measured.

Selected feature peptide can be used for Gly m 5 (being combined individually or with other oroteins in multiple assay pattern) Qualitative and quantitative analysis.In this embodiment, several feature peptides (SEQ ID NO are have selected from all peptide possibilities:3 NILEASYDTK；SEQ ID NO:75 CNLLK；SEQ ID NO:76 EEDEDEQPRPIPFPRPQPR；SEQ ID NO:77 EEQEWPR；SEQ ID NO:78 QFPFPRPPHQK；SEQ ID NO:79 ESEESEDSELR；SEQ ID NO:80 NPFLFGSNR；SEQ ID NO:81 FETLFK；SEQ ID NO:82 SPQLQNLR；SEQ ID NO:83 LQSGDALR；SEQ ID NO:84 VPSGTTYYVVNPDNNENLR；SEQ ID NO:85 FESFFLSSTEAQQSYLQGFSR；SEQ ID NO:86 FEEINK；SEQ ID NO:87 VLFSR；SEQ ID NO:88 TISSEDKPFNLR；SEQ ID NO:89 DPIYSNK；SEQ ID NO:90 FFEITPEK；SEQ ID NO:91 AIVILVINEGDANIELVGLK；SEQ ID NO:92 EQQQEQQQEEQPLEVR；SEQ ID NO:93 NFLAGSQDNVISQIPSQVQELAFPGSAQAVEK；With SEQ ID NO:94 ESYFVDAQPK), the representative quantitative display of these feature peptides is in 5A-5U.It is SEQ ID NO:3 NILEASYDTK synthesize Poly saccharide peptide standard product is used for qualitatively and quantitatively analysis (referring to Fig. 5 V).Synthetic peptide can be directly as the analysis of quantification of protein with reference to mark It is accurate.

Embodiment 6

At least the two of the G1 of Gly m 6 is identified in interior public database from including NCBI, Phytozome and UniProt Individual homologous protein sequence.Sequence (the SEQ ID NO analyzed and identified out using bioinformatics tools:16 and 95), to identify Sequence homology and consensus sequence between available protein sequence are constituted (referring to Fig. 6 L).Specifically, this is directed to use with Vector NTI Align X compare instrument, and the instrument performs CLUSTAL W types and compares.From the analysis, it may be determined that altogether There are sequence and/or representative series.

Once selection determines consensus sequence and/or representative series, it is carried out to be digested on computer and is treated with generation The candidate feature fragments of peptides for being detected by LC-MS and being measured.According to provided herein is unique method, based on available protein sequence Conservative selection feature peptide between row so that selected feature peptide can be used for being identified in common sequence database Protein sequence in quantitative all or protein isoforms as much as possible.Therefore, the quantitative of selected feature peptide not only may be used To measure the G1 of Gly m 6 in itself, but also the potential allergen with the G1 very high homologies of Gly m 6 can be measured.

Selected feature peptide can be used for the Gl of Gly m 6 (individually or in multiple assay pattern with other oroteins group Close) qualitative and quantitative analysis.In this embodiment, several feature peptides (SEQ ID NO are have selected from all peptide possibilities: 96 LVFSLCFLLFSGCCFAFSSR；SEQ ID NO:97 EQPQQNECQIQK；SEQ ID NO:98 RPSYTNGPQEIYIQQGK；SEQ ID NO:99 HQQEEENEGGSILSGFTLEFLEHAFSVDK；SEQ ID NO:100 HCQRPR；SEQ ID NO:101 HNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLR；SEQ ID NO:102 ALIQVVNCNGER；SEQ ID NO:103 VFDGELQEGR；SEQ ID NO:104 TNDTPMIGTLAGANSLLNALPEEVIQHTFNLK；SEQ ID NO:105 NNNPFK；With SEQ ID NO:106 FLVPPQESQK), the representative quantitative display of these mark peptides is in 6A-6K.Synthetic peptide can be directly as quantification of protein Analysis normative reference.

Embodiment 7

At least the two of the G2 of Gly m 6 is identified in interior public database from including NCBI, Phytozome and UniProt Individual homologous protein sequence.Sequence (the SEQ ID NO analyzed and identified out using bioinformatics tools:17 and 107) with identify Can be constituted (referring to Fig. 7 P) with the sequence homology between protein sequence and consensus sequence.Specifically, this is directed to use with Vector NTI Align X compare instrument, and the instrument performs CLUSTAL W types and compares.From the analysis, it may be determined that consensus sequence And/or representative series.

Once selection determines consensus sequence and/or representative series, it is carried out to be digested on computer and is treated with generation The candidate feature fragments of peptides for being detected by LC-MS and being measured.According to provided herein is unique method, based on available protein sequence Conservative selection feature peptide between row so that selected feature peptide can be used for being identified in common sequence database Protein sequence in quantitative all or protein isoforms as much as possible.Therefore, the quantitative of selected feature peptide not only may be used To measure the G2 of Gly m 6 in itself, but also the potential allergen with the G2 very high homologies of Gly m 6 can be measured.

Selected feature peptide can be used for the G2 of Gly m 6 (individually or in multiple assay pattern with other oroteins group Close) qualitative and quantitative analysis.In this embodiment, several feature peptides (SEQ ID NO are have selected from all peptide possibilities:4 VTAPAMR；SEQ ID NO:108 LVLSLCFLLFSGCFALR；SEQ ID NO:109 EQAQQNECQIQK；SEQ ID NO: 110 RPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQR；SEQ ID NO:111 SQRPQDR；SEQ ID NO: 112 QQEEENEGSNILSGFAPEFLK；SEQ ID NO:113 EAFGVNMQIVR；SEQ ID NO:114 KPQQEEDDDDEEEQPQCVETDK；SEQ ID NO:115 LSAQYGSLR；SEQ ID NO:116 NAMFVPHYTLNANSIIYALNGR；SEQ ID NO:117 ALVQVVNCNGER；SEQ ID NO:118 VFDGELQEGGVLIVPQNFAVAAK；SEQ ID NO:119 TNDRPSIGNLAGANSLLNALPEE-VIQHTFNLK；And SEQ ID NO:120 NNNPFSFLVPPQESQR), and these feature peptides representative quantitative display in Fig. 7 A-7N.It is SEQ ID NO:4VTAPAMR synthesis poly saccharide peptide standard products are used for qualitatively and quantitatively analysis (referring to Fig. 7 O).Synthetic peptide can be directly as albumen The quantitative analysis normative reference of matter.

Embodiment 8

The G3 sequences of Gly m 6 from database identification are digested in a computer to treat by LC-MS detections and measure to produce Candidate feature fragments of peptides.According to provided herein is unique method, based between available protein sequence conservative choosing Select feature peptide so that selected feature peptide can be used for quantitative in the protein sequence identified in common sequence database Protein isoforms all or as much as possible.The quantitative of selected feature peptide can not only measure the G3 of Gly m 6 in itself, And potential allergen with the G3 very high homologies of Gly m 6 can be measured.

Selected feature peptide can be individually or with multiplexed assay formats other protein combination be used for Gly m 6 The qualitative and quantitative analysis of G3.In this embodiment, several feature peptides (SEQ ID NO are have selected from all peptide possibilities:5 NNNPFSFLVPPK；SEQ ID NO:121 LVLSLCFLLFSGCCFAFSFR；SEQ ID NO:122 EQPQQNECQIQR； SEQ ID NO:123 QQEEENEGGSILSGFAPEFLEHAFVVDR；SEQ ID NO:124 LQGENEEEEK；SEQ ID NO:125 GGLSVISPPTEEQQQRPEEEEKPDCDEK；SEQ ID NO:126 HCQSQSR；SEQ ID NO:127 LSAQFGSLR；SEQ ID NO:128 VFDGELQEGQVLIVPQNFAVAAR；With SEQ ID NO:129 TNDRPSIGNLAGANSLLNALPEEVIQQTFNLR), and these feature peptides representative quantitative display in Fig. 8 A-8J.For SEQ ID NO:5 NNNPFSFLVPPK synthesis poly saccharide peptide standard products are used for qualitatively and quantitatively analysis (referring to Fig. 8 K).Synthetic peptide can be straight Connect as the analysis normative reference of quantification of protein.

Embodiment 9

Identify several G4's of Gly m 6 in interior public database from including NCBI, Phytozome and UniProt Homologous protein sequence.Sequence (the SEQ ID NO analyzed and identified out using bioinformatics tools:19 and 131-134) with mirror Sequence homology and consensus sequence between fixed available protein sequence are constituted (referring to Fig. 9 Y).Specifically, this is directed to use with Vector NTI Align X compare instrument, and the instrument performs CLUSTAL W types and compares.From the analysis, it may be determined that altogether There are sequence and/or representative series.

Once selection determines consensus sequence and/or representative series, it is carried out to be digested on computer and is treated with generation The candidate feature fragments of peptides for being detected by LC-MS and being measured.According to provided herein is unique method, based on available protein sequence Conservative selection feature peptide between row so that selected feature peptide can be used for being identified in common sequence database Protein sequence in quantitative all or protein isoforms as much as possible.Therefore, selected feature peptide it is quantitative not only The G4 of Gly m 6 can be measured in itself, the potential allergen with the G4 very high homologies of Gly m 6 can also be measured.

Selected feature peptide can be individually or with multiplexed assay formats other protein combination be used for Gly m 6 The qualitative and quantitative analysis of G4.In this embodiment, several feature peptides (SEQ ID NO are have selected from all peptide possibilities:6 ADFYNPK；SEQ ID NO:135 LNECQLNNLNALEPDHR；SEQ ID NO:136 CAGVTVSK；SEQ ID NO:137 LTLNR；SEQ ID NO:138 MIIIAQGK；SEQ ID NO:139 GALGVAIPGCPETFEEPQEQSNR；SEQ ID NO: 140 QQLQDSHQK；SEQ ID NO:141 VFYLAGNPDIEYPETMQQQQQQK；SEQ ID NO:142 QGQHQQEEEEEGGSVLSGFSK；SEQ ID NO:143 HFLAQSFNTNEDIAEK；SEQ ID NO:144 QIVTVEGGLSVISPK；SEQ ID NO:145 WQEQQDEDEDEDEDDEDEQIPSHPPR；SEQ ID NO:146 RPSHGK；SEQ ID NO:147 EQDEDEDEDEDKPRPSRPSQGK；SEQ ID NO:148 QEEPR；SEQ ID NO:149 NGVEENICTLK；SEQ ID NO:150 LHENIARPSR；SEQ ID NO:151 ISTLNSLTLPALR；SEQ ID NO: 152 QFQLSAQYVVLYK；SEQ ID NO:153 NGIYSPHWNLNANSVIYVTR；SEQ ID NO:154 DVFR；SEQ ID NO:155 AIPSEVLAHSYNLR；SEQ ID NO:156 QSQVSELK；With SEQ ID NO:58 YEGNWGPLVNPESQQGSPR), the representativeness of these signature peptides is quantitatively shown in Fig. 9 A-9X.Synthetic peptide can be directly as egg The quantitative analysis normative reference of white matter.

Embodiment 10

Gly m6 precursors are digested the candidate feature fragments of peptides for producing and treating to be detected by LC-MS and measured on computers. According to provided herein is unique method, based between available protein sequence conservative select feature peptide so that it is selected The feature peptide for going out can be used for quantitative all or as much as possible in the protein sequence identified in common sequence database Protein isoforms.Therefore, the quantitative of selected feature peptide can not only measure the precursors of Gly m 6 in itself, but also can be with Measurement and the potential allergen of the precursor very high homologies of Gly m 6.

Selected feature peptide can be individually or with multiplexed assay formats other protein combination be used for Gly m 6 before The qualitative and quantitative analysis of body.In this embodiment, three kinds of feature peptides (SEQ ID NO are have selected from all peptide possibilities:6 ADFYNPK,SEQ ID NO:59 GALQCKPGCPETFEEPQEQSNR and SEQ ID NO:60 LQSPDDER), these features The representative quantitative display of peptide is in Figure 10 B and 10C.Synthetic peptide can be directly as the analysis normative reference of quantification of protein.

Sequence table

SEQ ID NO:The example feature peptide of 1 Gly m 1

SYPSNATCPR

SEQ ID NO:The example feature peptide of 2 Gly m 3

YMVIQGEPGAVIR

SEQ ID NO:The example feature peptide of 3 Gly m 5 (beta-conglycinin)

NILEASYDTK

SEQ ID NO:The example feature peptide of 4 Gly m 6 (glycinin) G2

VTAPAMR

SEQ ID NO:The example feature peptide of 5 Gly m 6 (glycinin) G3

NNNPFSFLVPPK

SEQ ID NO:The example feature peptide of 6 Gly m 6 (glycinin) precursors

ADFYNPK

SEQ ID NO:The example feature peptide of 7 Kunitz trypsin inhibitors 1

GGGIEVDSTGK

SEQ ID NO:The example feature peptide of 8 Kunitz trypsin inhibitors 3

GIGTIISSPYR

SEQ ID NO:The example feature peptide of the K of 9 Gly m Bd 28

NKPQFLAGAASLLR

SEQ ID NO:The example feature peptide of the K of 10 Gly m Bd 30

GVITQVK

SEQ ID NO:The example feature peptide of 11 Gly m 8 (2S albumin)

IMENQSEELEEK

SEQ ID NO:The ABA54898.1 of 12 Gly m 1 [MW=12482.64Da]

MGSKVVASVALLLSINILFISMVSSSSHYDPQPQPSHVTALITRPSCPDLSICLNILGGSLGTVDDCCA LIGGLGDIEAIVCLCIQLRALGILNLNRNLQLILNSCGRSYPSNATCPRT

SEQ ID NO:The CAA11755.1 of 13 Gly m 3 [MW=14100.07Da]

MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAI MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLI DQGY

SEQ ID NO:The P26987 of 14 Gly m 4 [MW=16771.81Da]

MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLH KIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKA IEAYLLAHPDYN

SEQ ID NO:15 Gly m 5 (beta-conglycinin) 121281 [MW=70293.13Da]

MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNLLKVEKEECE EGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDE EQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQR SPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIV EISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPH FNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINA ENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY

SEQ ID NO:The glycinin G1 121276 [MW=55706.34Da] of 16 Gly m 6

MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVAL SRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPT GVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSG FTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLN ANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNA LPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA

SEQ ID NO:The glycinin G2 121277 [MW=54390.76Da] of 17 Gly m 6

MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALR RPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRPQDRHQKVHRFREGDLIAVPTGVAWWMYNNED TPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEAFG VNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETICT MRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVN CNGERVFDGELQEG GVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQA RQVKNNNPFSFLVPPQESQRRAVA

SEQ ID NO:The glycinin G3 121278 [MW=54241.73Da] of 18 Gly m 6

MAKLVLSLCFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAGVAL SRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFEEPQQKGQSSRPQDRHQKIYHFREGDLIAVPTGFA YWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGF APEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEEKPDCDEKDKHCQSQSRNGIDE TICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGSLRKNAMFVPHYNLNANSIIYALNGRALV QVVNCNGERVFDGELQEGQVLIVPQNFAVAARSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRR QQARQVKNNNPFSFLVPPKESQRRVVA

SEQ ID NO:The glycinin G4 121279 [MW=63587.16Da] of 19 Gly m 6

MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEGGLIQTWNSQHPELKCAGVT VSKLTLNRNGLHSPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDV LVIPPSVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEE EEGGSVLSGFSKHFLAQSFNTNEDIAEKLESPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP RRPSHGKREQDEDEDEDEDKPRPSRPSQGKRNKTGQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRN GVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRG QGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLR QSQVSELKYEGNWGPLVNPESQQGSPRVKVA

SEQ ID NO:The glycinin precursors 75221455 [MW=63876.47Da] of 20 Gly m 6

MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVEFEGGLIQTWNSQHPELKCAGVT VSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALQCKPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVL VIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEE EGGSVLSGFSKHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPR RPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRN GVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRG QGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLR QSQVSELKYEGNWGPLVNPESQQGSPRVKVA

SEQ ID NO:21 Gly m Bd 28K 12697782 [MW=52944.36Da]

MGNKTTLLLLLFVLCHGVATTTMAFHDDEGGDKKSPKSLFLMSNSTRVFKTDAGEMRVLKSHGGRIFYR HMHIGFISMEPKSLFVPQYLDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVIC SIDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMFVDDSHAPSLWTKFLQL KKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNLYDDKKADFKNAYGWSKALH GGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTIVLSGYGELHIGYPNGSRAMKTKIKQGDVFVVPRYFPFCQ VASRDGPLEFFGFSTSARKNKPQFLAGAASLLRTLMGPELSAAFGVSEDTLRRAVDAQHEAVILPSAWAAPPENAGK LKMEEEPNAIRSFANDVVMDVF

SEQ ID NO:22 Gly m Bd 30K 84371705 [MW=42757.81Da]

MGFLVLLLFSLLGLSSSSSISTHRSILDLDLTKFTTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFK NNLNYIRDMNANRKSPHSHRLGLNKFADITPQEFSKKYLQAPKDVSQQIKMANKKMKKEQYSCDHPPASWDWRKKGV ITQVKYQGGCGSGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESEGCYNGWHYQSFEWVLEHGGIATDDDYPY RAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILEQPISVSIDAKDFHLYTGGIYDGENCTSPYGIN HFVLLVGYGSADGVDYWIAKNSWGEDWGEDGYIWIQRNTGNLLGVCGMNYFASYPTKEESETLVSARVKGHRRVDHS PL

SEQ ID NO:23 KTI 1 125722 [MW=22545.94Da]

MKSTIFFALFLVCAFTISYLPSATAQFVLDTDDDPLQNGGTYYMLPVMRGKGGGIEVDSTGKEICPLTV VQSPNELDKGIGLVFTSPLHALFIAERYPLSIKFGSFAVITLCAGMPTEWAIVEREGLQAVKLAARDTVDGWFNIER VSREYNDYKLVFCPQQAEDNKCEDIGIQIDDDGIRRLVLSKNKPLVVQFQKFRSSTA

SEQ ID NO:24 KTI 3 125020 [MW=24005.29Da]

MKSTIFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQ SRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRLER VSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE

SEQ ID NO:25 Gly m 8 (2S albumin) NP_001238443 [MW=18459.97Da]

MTKFTILLISLLFCIAHTCSASKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILR TMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRF GPMIQCDLSSDD

SEQ ID NO:26 agglutinin ADC94422 [MW=30186.22Da]

MATSNFSIVLSLSLAFFLVLLTKANSTNTVSFTVSKFSPRQQNLIFQGDAAISPSGVLRLTKVDSIDVPTTGSLGRA LYATPIQIWDSETGKVASWATSFKFKVFSPNKTADGLAFFLAPVGSKPQSKGGFLGLFNSDSKNKSVQTVAVEFDTY YNAKWDPANRHIGIDVNSIKSVKTASWGLANGQIAQILITYDADTSLLVASLIHPSRKTSYILSETVSLKSNLPEWV NIGFSATTGLNKGFVETHDVFSWSFASKLSDGSTSDTLDLPSFLLNEAI

SEQ ID NO:27 LOX CAA39604 [MW=96817.14Da]

MFGIFDKGQKIKGTVVLMPKNVLDFNAITSIGKGGVIDTATGILGQGVSLVGGVIDTATSFLGRNISMQ LISATQTDGSGNGKVGKEVYLEKHLPTLPTLGARQDAFSIFFEWDASFGIPGAFYIKNFMTDEFFLVSVKLEDIPNH GTIEFVCNSWVYNFRSYKKNRIFFVNDTYLPSATPAPLLKYRKEELEVLRGDGTGKRKDFDRIYDYDVYNDLGNPDG GDPRPILGGSSIYPYPRRVRTGRERTRTDPNSEKPGEVYVPRDENFGHLKSSDFLTYGIKSLSHDVIPLFKSAIFQL RVTSSEFESFEDVRSLYEGGIKLPTDILSQISPLPALKEIFRTDGENVLQFPPPHVAKVSKSGWMTDEEFAREVIAG VNPNVIRRLQEFPPKSTLDPTLYGDQTSTITKEQLEINMGGVTVEEALSTQRLFILDYQDAFIPYLTRINSLPTAKA YATRTILFLKDDGTLKPLAIELSKPHPDGDNLGPESIVVLPATEGVDSTIWLLAKAHVIVNDSGYHQLVSHWLNTHA VMEPFAIATNRHLSVLHPIYKLLYPHYRDTININGLARQSLINADGIIEKSFLPGKYSIEMSSSVYKNWVFTDQALP ADLVKRGLAIEDPSAPHGLRLVIEDYPYAVDGLEIWDAIKTWVHEYVSLYYPTDAAVQQDTELQAWWKEAVEKGHGD LKEKPWWPKMQTTEDLIQSCSIIVWTASALHAAVNFGQYPYGGLILNRPTLARRFIPAEGTPEYDEMVKNPQKAYLR TITPKFETLIDLSVIEILSRHASDEIYLGERETPNWTTDKKALEAFKRFGSKLTGIEGKINARNSDPSLRNRTGPVQ LPYTLLHRSSEEGLTFKGIPNSISI

SEQ ID NO:The consensus sequences of 28 Gly m 1

MGSKVVASVALLLSINILFISMVSSSSHYDPPQPSYVTALITRPSCPDLSICLNILGGSLGTVDDCCAL IGGLGDIEAIVCLCIQLRALGILNLNRNLQLILNACGRSYPSNATCPRT

SEQ ID NO:The consensus sequence #2 of 29 Gly m 1

MGSKVVASVALLLSINILFISMVSSSSHYDPQPQPSHVTALITRPSCPDLSICLNILGGSLGTVDDCCA LIGGLGDIEAIVCLCIQLRALGILNLNRNLQLILNACGRSYPSNATCPRT

SEQ ID NO:30 Gly m 1 Ping AAB34755.1 42aa

ALITRPSXPDLSIXLNILGGSLGTVDDXXALIGGLXDXXAIV

SEQ ID NO:31 Gly m 1 Ping ABA54897.1 134aa

MGSKVVASVALLLSINILFISMVSSSSHYDPPPPPCYVPAPLTPPPSLSPPPSLSPPPPSGPSCPDLSV CLNILDGSPADDCCALIADLVDLEASVCLCIQLRVLGIVNLDLNLQLILNACGPSYPSNATCPRT

SEQ ID NO:32 Gly m 1 Eric ABA54899 118aa

GSKVVASVALLLSINILFISMVSSSSHYDPQPQPSHVTALITRPSCPDLSICLNILGGSLGTVDDCCALIGGLGDIE AIVCLCIQLRALGILNLNRNLQLILNSC GRSYPSNATCPRT

SEQ ID NO:33 Gly m 1 Glyma15g13740.1BLAST 120aa

MGSKVVAYVALLLSINILFISMVSSSSHYDPQPQPSYVTALITRPSCPDLSVCLNILGGYLGTVDDCCA LIGGLGDIEATVCLCIQLRALGILNLNRNLQLILNACGPSYPSNATCPRT

SEQ ID NO:34 Gly m 1 Glyma15g13770.1BLAST 130aa

MGSKVVASVALLLSINILFISMVSSSSHYDPPPPPCYVPAPFTPPPPSLSPPPPSGPSCPDLSVCLNIL DGSPADDCCALIADLVDLEASVCLCIQLRVLGIVNLDLNLQLILNACGPSYPSNATCPRT

SEQ ID NO:35 Gly m 1 Glyma15g13750.1BLAST 120aa

MGSKVVASVALLLSINILFISMVSSSSHYDPPPQPSYVTALITRPSCPDLSICLNILGGSLGTVDDCCA LIGGLGDIEAIVCLCIQLRALGILNLNRNLQLILNSCGRSYPSNATCPRT

SEQ ID NO:36 ALGILNLNR

SEQ ID NO:37 NLQLILNSCGR

SEQ ID NO:The consensus sequences of 38 Gly m 3

MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGG TKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLIDQGY

SEQ ID NO:39 Gly m 3 Ping ABU97472.1 131aa

MSWQAYVDDHLLCEIEGNHLTHAAIIGQDGSVWAQSTNFPQFKPEEITAINNDFNEPGSLAPTGLYIGG TKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLIDQGL

SEQ ID NO:40 Gly m 3 Ping O65809.1 131aa

MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGG TKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERPGDYLIDQGY

SEQ ID NO:41 GPGGVTVK

SEQ ID NO:The consensus sequences of 42 Gly m 4

MGVFTFEDETTSPVAPATLYKALVTDADNVIPKAVDAFKSVENVEGNGGPGTIKKITFVEDGETKFVLH KIEAIDEANLGYSYSVVGGAGLPDTVEKITFEAKLAAGANGGSAGKLTVKYQTKGDAQPNQDELKSGKAKADALFKA VEAYLLANPDYN

SEQ ID NO:43 Gly m 4 Glyma07g37240.1 BLAST 165aa

MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEADVNEWIDG ETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAK ADALFKAIEAYLLAHPDYN

SEQ ID NO:44 Gly m 4 Glyma17g03365.1 BLAST 159aa

MGIFTFEDEITSPVAPATLYKALVTDADNIIPKALDSFKSVENVEGNGGPGTIKKITFVEDGETKFVLH KIEAVDEANLGYSYSVVGGAALPDTAEKITFHSKLAAGPNGGSAGKLTVEYQTKGDAQPNQDQLKTGKAKADALFKA IEAYLLANPDYN

SEQ ID NO:45 Gly m 4 Glyma07g37240.3 BLAST 147aa

MGVFTFEDEINSPVAPATLYKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGY SYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN

SEQ ID NO:46 Gly m 4 Glyma07g37270.2 BLAST 159aa

MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLH KIEAIDEANLGYSYSVVGGDGLPDTVEKITFECKLAAGANGGSAGKLTVKYQTKGDAQPNQDDLKIGKAKSDALFKA VEAYLLAHPDYN

SEQ ID NO:47 Gly m 4 Glyma07g37270.1 BLAST 159aa

MGVFTFEDETTSPVAPATLYKALVTDADNVIPKAVDAFRSVENVEGNGGPGTIKKITFLEDGETKFVLH KIEAIDEANLGYSYSVVGGDGLPDTVEKITFECKLAAGANGGSAGKLTVKYQTKGDAQPNQDDLKIGKAKSDALFKA VEAYLLAHPDYN

SEQ ID NO:48 Gly m 4 Glyma17g03360.1 BLAST 159aa

MGVFTFEDETTSPVAPATLYKALVTDADNVIPKAVDAFRSVENLEGNGGPGTIKKITFVEDGESKFVLH KIESVDEANLGYSYSVVGGVGLPDTVEKITFECKLAAGANGGSAGKLTVKYQTKGDAQPNPDDLKIGKVKSDALFKA VEAYLLANPHYN

SEQ ID NO:49 Gly m 4 Glyma17g03350.1 BLAST 159aa

MGIFTFEDETTSPVAPATLYKALVTDADNVIPKAVEAFRSVENLEGNGGPGTIKKITFVEDGESKFVLH KIESVDEANLGYSYSVVGGVGLPDTVEKITFECKLAAGANGGSAGKLTVKYQTKGDAQPNPDDLKIGKVKSDALFKA VEAYLLANPHYN

SEQ ID NO:50 Gly m 4 Glyma09g04510.1 BLAST 159aa

MGVFTFEDETTSTVAPARLYKALVKDADNLVPKAVEAIKSVEIVEGNGGPGTIKKLTFVEDGQTKYVLHKVEAIDEA NWGYNYSVVGGVGLPDTVEKIS FEAKLVADPNGGSIAKITVKYQTKGDANPSEEELKSGKAKGDALFKALEGYVLA NPDYN

SEQ ID NO:51 Gly m 4 Glyma15g15590.1BLAST 159aa

MGVFTFEDETTSTVAPARLYKALVKDADNLVPKAVEAIKSVEIVEGNGGPGTIKKLTFVEDGQTKYVLH KVEAIDEANWGYNYSVVGGVGLPDTVEKISFEAKLVEGASGGSIAKITVKYQTKGDVNPSEEELKSGKAKGDALFKA LEGYVLANPDYN

SEQ ID NO:52 MGVFTFEDEINSPVAPATLYK

SEQ ID NO:53 ALDSFK

SEQ ID NO:54 SVENVEGNGGPGTIK

SEQ ID NO:55 ITFLEDGETK

SEQ ID NO:56 FVLHK

SEQ ID NO:57 AIEAYLLAHPDYN

SEQ ID NO:The consensus sequences of 61 Gly m 5

MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLQSCNSEKDSYRNQACHARCNLLKVEEEEEC EEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREH PRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLF KNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA LRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGRE EGQQQGEERLQESVIVEISKKQIRELSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDV FLSVVDMNEGALLLPHFNSKAIVVLVINEGDANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVV VNATSNLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKG RKGPLSSILRAFY

SEQ ID NO:62 Gly m 5 ABH09130BLAST 600aa

MFGIVYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGE QPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESE EEEEDQDEDEGQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRIL EFNSKPNTLLSPNHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPV NKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEIN KVLFGREEGQQQGEERLQESVIVEISKKQIRELSK HAKPSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVIN EGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSK DNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY

SEQ ID NO:63 Gly m 5 BAA74452 BLAST 559aa

VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEK HGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKN KNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLV NNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASY DTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLF EITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAEL SEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESY FVDAQPQQKEEGNKGRKGPLSSILRAFY

SEQ ID NO:64 Gly m 5 BAC78524 BLAST 621aa

MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNLLKVEEEEEC EEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPRQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREH PRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLF KNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA LRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGRE EGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDV FLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVV VNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKG RKGPLSSILRAFY

SEQ ID NO:65 Gly m 5 Glyma20g28460.1 BLAST 440aa

MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYLRSSNSFQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQF QSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNK PGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRK TISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIEL VGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIE RQVQELAFPGSAQDVERLLKKQR ESYFVDAQPQQKEEGSKGRKGPFPSILGALY

SEQ ID NO:66 Gly m 5 Ping AAB23463 439aa

MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENL RDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSR RAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVIN EGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEK DNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY

SEQ ID NO:67 Gly m 5 Glyma20g28650.1 BLAST 606aa

MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNLLKVEKEECE EGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDE EQDERQFPFPRPPHQKEERKQEEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQR SPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIV EISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPH FNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINA ENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY

SEQ ID NO:68 Gly m 5 Glyma20g28660.1 BLAST 606aa

SEQ ID NO:69 Gly m 5 Glyma20g28650.2 BLAST 543aa

MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNLLKVEKEECE EGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDE EQDERQFPFPRPPHQKEERKQEEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQR SPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIV EISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPH FNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINA ENNQRNFLAGI

SEQ ID NO:70 Gly m 5 Ping AAA33947 218aa

SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFN SKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAEN NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY

SEQ ID NO:71 Gly m 5 NP_001237316 BLAST 621aa

MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNLLKVEEEEEC EEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPRQEGEHEQKEEHEWHRKEEKHGGKGSEEEQDGREH PRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLF KNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA LRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGRE EGQQQGEERLQESVIVEISKKQIRELSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDV FLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVV VNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFLGSAKDIENLIKSQSESYFVDAQPQQKEEGNKG RKGPLSSILRAFY

SEQ ID NO:72 Gly m 5 BAE02726 BLAST 621aa

MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNLLKVEEEEECEEGQIPRP RPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQ KEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVR VLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTT YYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEE RLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMN EGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLN FFAFGINAENNQRN FLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSS ILRAFY

SEQ ID NO:73 Gly m 5 Ping AAB01374 639aa

MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNLLKVEEEEEC EEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREH PRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLF KNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA LRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNIL EASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKL GKLFEITQRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYR AELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQS ESYFVDAQPQQKEEGNKGRKGPLSSILRAFY

SEQ ID NO:74 Gly m 5 Glyma10g39150.1 BLAST 622aa

MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNLLKVEEEEEC EEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREH PRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLF KNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA LRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGRE EGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDV FLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVV VNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKG RKGPLSSILRAFY

SEQ ID NO:75 CNLLK

SEQ ID NO:76 EEDEDEQPRPIPFPRPQPR

SEQ ID NO:77 EEQEWPR

SEQ ID NO:78 QFPFPRPPHQK

SEQ ID NO:79 ESEESEDSELR

SEQ ID NO:80 NPFLFGSNR

SEQ ID NO:81 FETLFK

SEQ ID NO:82 SPQLQNLR

SEQ ID NO:83 LQSGDALR

SEQ ID NO:84 VPSGTTYYVVNPDNNENLR

SEQ ID NO:85 FESFFLSSTEAQQSYLQGFSR

SEQ ID NO:86 FEEINK

SEQ ID NO:87 VLFSR

SEQ ID NO:88 TISSEDKPFNLR

SEQ ID NO:89 DPIYSNK

SEQ ID NO:90 FFEITPEK

SEQ ID NO:91 AIVILVINEGDANIELVGLK

SEQ ID NO:92 EQQQEQQQEEQPLEVR

SEQ ID NO:93 NFLAGSQDNVISQIPSQVQELAFPGSAQAVEK

SEQ ID NO:94 ESYFVDAQPK

SEQ ID NO:95 Gly m 6 G1 Ping CAA26723.1 495aa

MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPGNRIESEGGLIETWNPNNKPFQCAGVAL SRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCSSTFEEPQQPQQRGQSSRPQDRHQKIYNSREGDLIAVPT GVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSG FTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAGFGSLRKNAMFVPHYNLN ANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNA LPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA

SEQ ID NO:96 LVFSLCFLLFSGCCFAFSSR

SEQ ID NO:97 EQPQQNECQIQK

SEQ ID NO:98 RPSYTNGPQEIYIQQGK

SEQ ID NO:99 HQQEEENEGGSILSGFTLEFLEHAFSVDK

SEQ ID NO:100 HCQRPR

SEQ ID NO:101 HNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLR

SEQ ID NO:102 ALIQVVNCNGER

SEQ ID NO:103 VFDGELQEGR

SEQ ID NO:104 TNDTPMIGTLAGANSLLNALPEEVIQHTFNLK

SEQ ID NO:105 NNNPFK

SEQ ID NO:106 FLVPPQESQK

SEQ ID NO:107 Gly m 6 G2 Ping CAA26575.1 485aa

MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLNALKPGNRIESEGGFIETWNPNNKPFQCAGVALSRC TLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRPQDRHQKVHRFREGDLIAVPTGVA WWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAP EFLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRN GIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNG RALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTF NLKSQQARQVKNNNPFSFLVPPQESQRRAVA

SEQ ID NO:108 LVLSLCFLLFSGCFALR

SEQ ID NO:109 EQAQQNECQIQK

SEQ ID NO:110 RPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQR

SEQ ID NO:111 SQRPQDR

SEQ ID NO:112 QQEEENEGSNILSGFAPEFLK

SEQ ID NO:113 EAFGVNMQIVR

SEQ ID NO:114 KPQQEEDDDDEEEQPQCVETDK

SEQ ID NO:115 LSAQYGSLR

SEQ ID NO:116 NAMFVPHYTLNANSIIYALNGR

SEQ ID NO:117 ALVQVVNCNGER

SEQ ID NO:118 VFDGELQEGGVLIVPQNFAVAAK

SEQ ID NO:119 TNDRPSIGNLAGANSLLNALPEEVIQHTFNLK

SEQ ID NO:120 NNNPFSFLVPPQESQR

The feature peptide of the G3 of Gly m 6

SEQ ID NO:121 LVLSLCFLLFSGCCFAFSFR

SEQ ID NO:122 EQPQQNECQIQR

SEQ ID NO:123 QQEEENEGGSILSGFAPEFLEHAFVVDR

SEQ ID NO:124 LQGENEEEEK

SEQ ID NO:125 GGLSVISPPTEEQQQRPEEEEKPDCDEK

SEQ ID NO:126 HCQSQSR

SEQ ID NO:127 LSAQFGSLR

SEQ ID NO:128 VFDGELQEGQVLIVPQNFAVAAR

SEQ ID NO:129 TNDRPSIGNLAGANSLLNALPEEVIQQTFNLR

SEQ ID NO:The G4 consensus sequences of 130 Gly m 6

MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEGGLIQTWNSQHPELKCAGVT VSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDV LVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEE EEGGSVLSGFSKHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHP

SEQ ID NO:131 Gly m 6 G4 Ping CAA60533.1 563aa

MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEGG LIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQSNRRGSRSQK QQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQ QQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDE DEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSHGKREQDQDQDEDEDEDEDQPRKSREWRSKKT QPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNG IYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYL KDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA

SEQ ID NO:132 Gly m 6 G4 UniProt Q9SB11 G4 563aa

MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEGGLIQTWNSQHPELKCAGVT VSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDV LVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEE EEGGSVLSGFSKHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP RRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETR NGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTR GQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYLKDVFRAIPSEVLAHSYNL RQSQVSELKYEGNWGPLVNPESQQGSPRVKVA

SEQ ID NO:133 Gly m 6 G4 Ping CAA55977.1 517aa

MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGV TVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGSRSQQQLQDSHQKIRHFNEGDV LVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEE EGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRP SHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRADFYNPKAGRIST LNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVV AEQGGEQGLEYVVFKTHHNAVSSYIKDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP

SEQ ID NO:134 Gly m 6 G4 Ping AAA33964.1 516aa

MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGV TVSKRTLNRNGSHLPSYLPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGSRSQQQLQDSHQKIRHFNEGDV LVIPLGVPYWTYNTGDEPVVAISPLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHRQQEE EGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYGRTPSYPPRRP SHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRADFYNPKAGRIST LNSLTLPALRQFGLSAQYVVLYRNGIYSPDWNLNANSVTMTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNPAVA EQGGEQGLEYVVFKTHHNAVSSYIKDVFRVIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP

SEQ ID NO:135 LNECQLNNLNALEPDHR

SEQ ID NO:136 CAGVTVSK

SEQ ID NO:137 LTLNR

SEQ ID NO:138 MIIIAQGK

SEQ ID NO:139 GALGVAIPGCPETFEEPQEQSNR

SEQ ID NO:140 QQLQDSHQK

SEQ ID NO:141 VFYLAGNPDIEYPETMQQQQQQK

SEQ ID NO:142 QGQHQQEEEEEGGSVLSGFSK

SEQ ID NO:143 HFLAQSFNTNEDIAEK

SEQ ID NO:144 QIVTVEGGLSVISPK

SEQ ID NO:145 WQEQQDEDEDEDEDDEDEQIPSHPPR

SEQ ID NO:146 RPSHGK

SEQ ID NO:147 EQDEDEDEDEDKPRPSRPSQGK

SEQ ID NO:148 QEEPR

SEQ ID NO:149 NGVEENICTLK

SEQ ID NO:150 LHENIARPSR

SEQ ID NO:151 ISTLNSLTLPALR

SEQ ID NO:152 QFQLSAQYVVLYK

SEQ ID NO:153 NGIYSPHWNLNANSVIYVTR

SEQ ID NO:154 DVFR

SEQ ID NO:155 AIPSEVLAHSYNLR

SEQ ID NO:156 QSQVSELK

SEQ ID NO:58 YEGNWGPLVNPESQQGSPR

The feature peptide of the precursors of Gly m 6

SEQ ID NO:59 GALQCKPGCPETFEEPQEQSNR

SEQ ID NO:60 LQSPDDER

Sequence table

<110>TJ Oman

BW Schaefers

RC Xi Er

G is mono-

<120>For the quantitative method and system with detection of selectivity of allergen

<130> 2971-12517.1PC (76259-WO-PCT)

<160> 156

<170> PatentIn version 3.5

<210> 1

<211> 10

<212> PRT

<213>Artificial sequence

<220>

<223>The example feature peptide of Gly m 1

<400> 1

Ser Tyr Pro Ser Asn Ala Thr Cys Pro Arg

1 5 10

<210> 2

<211> 13

<212> PRT

<213>Manually

<220>

<223>The example feature peptide of Gly m 3

<400> 2

Tyr Met Val Ile Gln Gly Glu Pro Gly Ala Val Ile Arg

1 5 10

<210> 3

<211> 10

<212> PRT

<213>Manually

<220>

<223>The example feature peptide of Gly m 5 (beta- conglycinins)

<400> 3

Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys

1 5 10

<210> 4

<211> 7

<212> PRT

<213>Manually

<220>

<223>The example feature peptide of Gly m 6 (glycinin) G2

<400> 4

Val Thr Ala Pro Ala Met Arg

1 5

<210> 5

<211> 12

<212> PRT

<213>Manually

<220>

<223>The example feature peptide of Gly m 6 (glycinin) G3

<400> 5

Asn Asn Asn Pro Phe Ser Phe Leu Val Pro Pro Lys

1 5 10

<210> 6

<211> 7

<212> PRT

<213>Manually

<220>

<223>The example feature peptide of Gly m 6 (glycinin) precursor

<400> 6

Ala Asp Phe Tyr Asn Pro Lys

1 5

<210> 7

<211> 11

<212> PRT

<213>Manually

<220>

<223>The example feature peptide of Kunitz trypsin inhibitors 1

<400> 7

Gly Gly Gly Ile Glu Val Asp Ser Thr Gly Lys

1 5 10

<210> 8

<211> 11

<212> PRT

<213>Manually

<220>

<223>The example feature peptide of Kunitz trypsin inhibitors 3

<400> 8

Gly Ile Gly Thr Ile Ile Ser Ser Pro Tyr Arg

1 5 10

<210> 9

<211> 14

<212> PRT

<213>Manually

<220>

<223>The example feature peptide of the K of Gly m Bd 28

<400> 9

Asn Lys Pro Gln Phe Leu Ala Gly Ala Ala Ser Leu Leu Arg

1 5 10

<210> 10

<211> 7

<212> PRT

<213>Manually

<220>

<223>The example feature peptide of the K of Gly m Bd 30

<400> 10

Gly Val Ile Thr Gln Val Lys

1 5

<210> 11

<211> 12

<212> PRT

<213>Manually

<220>

<223>The example feature peptide of Gly m 8 (2S albumin)

<400> 11

Ile Met Glu Asn Gln Ser Glu Glu Leu Glu Glu Lys

1 5 10

<210> 12

<211> 119

<212> PRT

<213>Manually

<220>

<223> Gly m 1 ABA54898.1 [MW= 12482.64 Da]

<400> 12

Met Gly Ser Lys Val Val Ala Ser Val Ala Leu Leu Leu Ser Ile Asn

1 5 10 15

Ile Leu Phe Ile Ser Met Val Ser Ser Ser Ser His Tyr Asp Pro Gln

20 25 30

Pro Gln Pro Ser His Val Thr Ala Leu Ile Thr Arg Pro Ser Cys Pro

35 40 45

Asp Leu Ser Ile Cys Leu Asn Ile Leu Gly Gly Ser Leu Gly Thr Val

50 55 60

Asp Asp Cys Cys Ala Leu Ile Gly Gly Leu Gly Asp Ile Glu Ala Ile

65 70 75 80

Val Cys Leu Cys Ile Gln Leu Arg Ala Leu Gly Ile Leu Asn Leu Asn

85 90 95

Arg Asn Leu Gln Leu Ile Leu Asn Ser Cys Gly Arg Ser Tyr Pro Ser

100 105 110

Asn Ala Thr Cys Pro Arg Thr

115

<210> 13

<211> 131

<212> PRT

<213>Manually

<220>

<223> Gly m 3 CAA11755.1 [MW= 14100.07 Da]

<400> 13

Met Ser Trp Gln Ala Tyr Val Asp Asp His Leu Leu Cys Gly Ile Glu

1 5 10 15

Gly Asn His Leu Thr His Ala Ala Ile Ile Gly Gln Asp Gly Ser Val

20 25 30

Trp Leu Gln Ser Thr Asp Phe Pro Gln Phe Lys Pro Glu Glu Ile Thr

35 40 45

Ala Ile Met Asn Asp Phe Asn Glu Pro Gly Ser Leu Ala Pro Thr Gly

50 55 60

Leu Tyr Leu Gly Gly Thr Lys Tyr Met Val Ile Gln Gly Glu Pro Gly

65 70 75 80

Ala Val Ile Arg Gly Lys Lys Gly Pro Gly Gly Val Thr Val Lys Lys

85 90 95

Thr Gly Ala Ala Leu Ile Ile Gly Ile Tyr Asp Glu Pro Met Thr Pro

100 105 110

Gly Gln Cys Asn Met Val Val Glu Arg Leu Gly Asp Tyr Leu Ile Asp

115 120 125

Gln Gly Tyr

130

<210> 14

<211> 158

<212> PRT

<213>Manually

<220>

<223> Gly m 4 P26987 [MW= 16771.81 Da]

<400> 14

Met Gly Val Phe Thr Phe Glu Asp Glu Ile Asn Ser Pro Val Ala Pro

1 5 10 15

Ala Thr Leu Tyr Lys Ala Leu Val Thr Asp Ala Asp Asn Val Ile Pro

20 25 30

Lys Ala Leu Asp Ser Phe Lys Ser Val Glu Asn Val Glu Gly Asn Gly

35 40 45

Gly Pro Gly Thr Ile Lys Lys Ile Thr Phe Leu Glu Asp Gly Glu Thr

50 55 60

Lys Phe Val Leu His Lys Ile Glu Ser Ile Asp Glu Ala Asn Leu Gly

65 70 75 80

Tyr Ser Tyr Ser Val Val Gly Gly Ala Ala Leu Pro Asp Thr Ala Glu

85 90 95

Lys Ile Thr Phe Asp Ser Lys Leu Val Ala Gly Pro Asn Gly Gly Ser

100 105 110

Ala Gly Lys Leu Thr Val Lys Tyr Glu Thr Lys Gly Asp Ala Glu Pro

115 120 125

Asn Gln Asp Glu Leu Lys Thr Gly Lys Ala Lys Ala Asp Ala Leu Phe

130 135 140

Lys Ala Ile Glu Ala Tyr Leu Leu Ala His Pro Asp Tyr Asn

145 150 155

<210> 15

<211> 605

<212> PRT

<213>Manually

<220>

<223>Gly m 5 (beta- conglycinins) 121281 [Da of MW=70293.13]

<400> 15

Met Met Arg Ala Arg Phe Pro Leu Leu Leu Leu Gly Leu Val Phe Leu

1 5 10 15

Ala Ser Val Ser Val Ser Phe Gly Ile Ala Tyr Trp Glu Lys Glu Asn

20 25 30

Pro Lys His Asn Lys Cys Leu Gln Ser Cys Asn Ser Glu Arg Asp Ser

35 40 45

Tyr Arg Asn Gln Ala Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu

50 55 60

Lys Glu Glu Cys Glu Glu Gly Glu Ile Pro Arg Pro Arg Pro Arg Pro

65 70 75 80

Gln His Pro Glu Arg Glu Pro Gln Gln Pro Gly Glu Lys Glu Glu Asp

85 90 95

Glu Asp Glu Gln Pro Arg Pro Ile Pro Phe Pro Arg Pro Gln Pro Arg

100 105 110

Gln Glu Glu Glu His Glu Gln Arg Glu Glu Gln Glu Trp Pro Arg Lys

115 120 125

Glu Glu Lys Arg Gly Glu Lys Gly Ser Glu Glu Glu Asp Glu Asp Glu

130 135 140

Asp Glu Glu Gln Asp Glu Arg Gln Phe Pro Phe Pro Arg Pro Pro His

145 150 155 160

Gln Lys Glu Glu Arg Asn Glu Glu Glu Asp Glu Asp Glu Glu Gln Gln

165 170 175

Arg Glu Ser Glu Glu Ser Glu Asp Ser Glu Leu Arg Arg His Lys Asn

180 185 190

Lys Asn Pro Phe Leu Phe Gly Ser Asn Arg Phe Glu Thr Leu Phe Lys

195 200 205

Asn Gln Tyr Gly Arg Ile Arg Val Leu Gln Arg Phe Asn Gln Arg Ser

210 215 220

Pro Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser

225 230 235 240

Lys Pro Asn Thr Leu Leu Leu Pro Asn His Ala Asp Ala Asp Tyr Leu

245 250 255

Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Ser Leu Val Asn Asn Asp

260 265 270

Asp Arg Asp Ser Tyr Arg Leu Gln Ser Gly Asp Ala Leu Arg Val Pro

275 280 285

Ser Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asn Glu Asn Leu

290 295 300

Arg Leu Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu

305 310 315 320

Ser Phe Phe Leu Ser Ser Thr Glu Ala Gln Gln Ser Tyr Leu Gln Gly

325 330 335

Phe Ser Arg Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu

340 345 350

Ile Asn Lys Val Leu Phe Ser Arg Glu Glu Gly Gln Gln Gln Gly Glu

355 360 365

Gln Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Glu Gln Ile

370 375 380

Arg Ala Leu Ser Lys Arg Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser

385 390 395 400

Ser Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser

405 410 415

Asn Lys Leu Gly Lys Phe Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln

420 425 430

Leu Arg Asp Leu Asp Ile Phe Leu Ser Ile Val Asp Met Asn Glu Gly

435 440 445

Ala Leu Leu Leu Pro His Phe Asn Ser Lys Ala Ile Val Ile Leu Val

450 455 460

Ile Asn Glu Gly Asp Ala Asn Ile Glu Leu Val Gly Leu Lys Glu Gln

465 470 475 480

Gln Gln Glu Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr

485 490 495

Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr

500 505 510

Pro Val Val Val Asn Ala Thr Ser Asn Leu Asn Phe Phe Ala Ile Gly

515 520 525

Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Gln Asp

530 535 540

Asn Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Pro

545 550 555 560

Gly Ser Ala Gln Ala Val Glu Lys Leu Leu Lys Asn Gln Arg Glu Ser

565 570 575

Tyr Phe Val Asp Ala Gln Pro Lys Lys Lys Glu Glu Gly Asn Lys Gly

580 585 590

Arg Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

595 600 605

<210> 16

<211> 495

<212> PRT

<213>Manually

<220>

<223>The glycinin G1 121276 [Da of MW=55706.34] of Gly m 6

<400> 16

Met Ala Lys Leu Val Phe Ser Leu Cys Phe Leu Leu Phe Ser Gly Cys

1 5 10 15

Cys Phe Ala Phe Ser Ser Arg Glu Gln Pro Gln Gln Asn Glu Cys Gln

20 25 30

Ile Gln Lys Leu Asn Ala Leu Lys Pro Asp Asn Arg Ile Glu Ser Glu

35 40 45

Gly Gly Leu Ile Glu Thr Trp Asn Pro Asn Asn Lys Pro Phe Gln Cys

50 55 60

Ala Gly Val Ala Leu Ser Arg Cys Thr Leu Asn Arg Asn Ala Leu Arg

65 70 75 80

Arg Pro Ser Tyr Thr Asn Gly Pro Gln Glu Ile Tyr Ile Gln Gln Gly

85 90 95

Lys Gly Ile Phe Gly Met Ile Tyr Pro Gly Cys Pro Ser Thr Phe Glu

100 105 110

Glu Pro Gln Gln Pro Gln Gln Arg Gly Gln Ser Ser Arg Pro Gln Asp

115 120 125

Arg His Gln Lys Ile Tyr Asn Phe Arg Glu Gly Asp Leu Ile Ala Val

130 135 140

Pro Thr Gly Val Ala Trp Trp Met Tyr Asn Asn Glu Asp Thr Pro Val

145 150 155 160

Val Ala Val Ser Ile Ile Asp Thr Asn Ser Leu Glu Asn Gln Leu Asp

165 170 175

Gln Met Pro Arg Arg Phe Tyr Leu Ala Gly Asn Gln Glu Gln Glu Phe

180 185 190

Leu Lys Tyr Gln Gln Glu Gln Gly Gly His Gln Ser Gln Lys Gly Lys

195 200 205

His Gln Gln Glu Glu Glu Asn Glu Gly Gly Ser Ile Leu Ser Gly Phe

210 215 220

Thr Leu Glu Phe Leu Glu His Ala Phe Ser Val Asp Lys Gln Ile Ala

225 230 235 240

Lys Asn Leu Gln Gly Glu Asn Glu Gly Glu Asp Lys Gly Ala Ile Val

245 250 255

Thr Val Lys Gly Gly Leu Ser Val Ile Lys Pro Pro Thr Asp Glu Gln

260 265 270

Gln Gln Arg Pro Gln Glu Glu Glu Glu Glu Glu Glu Asp Glu Lys Pro

275 280 285

Gln Cys Lys Gly Lys Asp Lys His Cys Gln Arg Pro Arg Gly Ser Gln

290 295 300

Ser Lys Ser Arg Arg Asn Gly Ile Asp Glu Thr Ile Cys Thr Met Arg

305 310 315 320

Leu Arg His Asn Ile Gly Gln Thr Ser Ser Pro Asp Ile Tyr Asn Pro

325 330 335

Gln Ala Gly Ser Val Thr Thr Ala Thr Ser Leu Asp Phe Pro Ala Leu

340 345 350

Ser Trp Leu Arg Leu Ser Ala Glu Phe Gly Ser Leu Arg Lys Asn Ala

355 360 365

Met Phe Val Pro His Tyr Asn Leu Asn Ala Asn Ser Ile Ile Tyr Ala

370 375 380

Leu Asn Gly Arg Ala Leu Ile Gln Val Val Asn Cys Asn Gly Glu Arg

385 390 395 400

Val Phe Asp Gly Glu Leu Gln Glu Gly Arg Val Leu Ile Val Pro Gln

405 410 415

Asn Phe Val Val Ala Ala Arg Ser Gln Ser Asp Asn Phe Glu Tyr Val

420 425 430

Ser Phe Lys Thr Asn Asp Thr Pro Met Ile Gly Thr Leu Ala Gly Ala

435 440 445

Asn Ser Leu Leu Asn Ala Leu Pro Glu Glu Val Ile Gln His Thr Phe

450 455 460

Asn Leu Lys Ser Gln Gln Ala Arg Gln Ile Lys Asn Asn Asn Pro Phe

465 470 475 480

Lys Phe Leu Val Pro Pro Gln Glu Ser Gln Lys Arg Ala Val Ala

485 490 495

<210> 17

<211> 485

<212> PRT

<213>Manually

<220>

<223>The glycinin G2 121277 [Da of MW=54390.76] of Gly m 6

<400> 17

Met Ala Lys Leu Val Leu Ser Leu Cys Phe Leu Leu Phe Ser Gly Cys

1 5 10 15

Phe Ala Leu Arg Glu Gln Ala Gln Gln Asn Glu Cys Gln Ile Gln Lys

20 25 30

Leu Asn Ala Leu Lys Pro Asp Asn Arg Ile Glu Ser Glu Gly Gly Phe

35 40 45

Ile Glu Thr Trp Asn Pro Asn Asn Lys Pro Phe Gln Cys Ala Gly Val

50 55 60

Ala Leu Ser Arg Cys Thr Leu Asn Arg Asn Ala Leu Arg Arg Pro Ser

65 70 75 80

Tyr Thr Asn Gly Pro Gln Glu Ile Tyr Ile Gln Gln Gly Asn Gly Ile

85 90 95

Phe Gly Met Ile Phe Pro Gly Cys Pro Ser Thr Tyr Gln Glu Pro Gln

100 105 110

Glu Ser Gln Gln Arg Gly Arg Ser Gln Arg Pro Gln Asp Arg His Gln

115 120 125

Lys Val His Arg Phe Arg Glu Gly Asp Leu Ile Ala Val Pro Thr Gly

130 135 140

Val Ala Trp Trp Met Tyr Asn Asn Glu Asp Thr Pro Val Val Ala Val

145 150 155 160

Ser Ile Ile Asp Thr Asn Ser Leu Glu Asn Gln Leu Asp Gln Met Pro

165 170 175

Arg Arg Phe Tyr Leu Ala Gly Asn Gln Glu Gln Glu Phe Leu Lys Tyr

180 185 190

Gln Gln Gln Gln Gln Gly Gly Ser Gln Ser Gln Lys Gly Lys Gln Gln

195 200 205

Glu Glu Glu Asn Glu Gly Ser Asn Ile Leu Ser Gly Phe Ala Pro Glu

210 215 220

Phe Leu Lys Glu Ala Phe Gly Val Asn Met Gln Ile Val Arg Asn Leu

225 230 235 240

Gln Gly Glu Asn Glu Glu Glu Asp Ser Gly Ala Ile Val Thr Val Lys

245 250 255

Gly Gly Leu Arg Val Thr Ala Pro Ala Met Arg Lys Pro Gln Gln Glu

260 265 270

Glu Asp Asp Asp Asp Glu Glu Glu Gln Pro Gln Cys Val Glu Thr Asp

275 280 285

Lys Gly Cys Gln Arg Gln Ser Lys Arg Ser Arg Asn Gly Ile Asp Glu

290 295 300

Thr Ile Cys Thr Met Arg Leu Arg Gln Asn Ile Gly Gln Asn Ser Ser

305 310 315 320

Pro Asp Ile Tyr Asn Pro Gln Ala Gly Ser Ile Thr Thr Ala Thr Ser

325 330 335

Leu Asp Phe Pro Ala Leu Trp Leu Leu Lys Leu Ser Ala Gln Tyr Gly

340 345 350

Ser Leu Arg Lys Asn Ala Met Phe Val Pro His Tyr Thr Leu Asn Ala

355 360 365

Asn Ser Ile Ile Tyr Ala Leu Asn Gly Arg Ala Leu Val Gln Val Val

370 375 380

Asn Cys Asn Gly Glu Arg Val Phe Asp Gly Glu Leu Gln Glu Gly Gly

385 390 395 400

Val Leu Ile Val Pro Gln Asn Phe Ala Val Ala Ala Lys Ser Gln Ser

405 410 415

Asp Asn Phe Glu Tyr Val Ser Phe Lys Thr Asn Asp Arg Pro Ser Ile

420 425 430

Gly Asn Leu Ala Gly Ala Asn Ser Leu Leu Asn Ala Leu Pro Glu Glu

435 440 445

Val Ile Gln His Thr Phe Asn Leu Lys Ser Gln Gln Ala Arg Gln Val

450 455 460

Lys Asn Asn Asn Pro Phe Ser Phe Leu Val Pro Pro Gln Glu Ser Gln

465 470 475 480

Arg Arg Ala Val Ala

485

<210> 18

<211> 481

<212> PRT

<213>Manually

<220>

<223>The glycinin G3 121278 [Da of MW=54241.73] of Gly m 6

<400> 18

Met Ala Lys Leu Val Leu Ser Leu Cys Phe Leu Leu Phe Ser Gly Cys

1 5 10 15

Cys Phe Ala Phe Ser Phe Arg Glu Gln Pro Gln Gln Asn Glu Cys Gln

20 25 30

Ile Gln Arg Leu Asn Ala Leu Lys Pro Asp Asn Arg Ile Glu Ser Glu

35 40 45

Gly Gly Phe Ile Glu Thr Trp Asn Pro Asn Asn Lys Pro Phe Gln Cys

50 55 60

Ala Gly Val Ala Leu Ser Arg Cys Thr Leu Asn Arg Asn Ala Leu Arg

65 70 75 80

Arg Pro Ser Tyr Thr Asn Ala Pro Gln Glu Ile Tyr Ile Gln Gln Gly

85 90 95

Ser Gly Ile Phe Gly Met Ile Phe Pro Gly Cys Pro Ser Thr Phe Glu

100 105 110

Glu Pro Gln Gln Lys Gly Gln Ser Ser Arg Pro Gln Asp Arg His Gln

115 120 125

Lys Ile Tyr His Phe Arg Glu Gly Asp Leu Ile Ala Val Pro Thr Gly

130 135 140

Phe Ala Tyr Trp Met Tyr Asn Asn Glu Asp Thr Pro Val Val Ala Val

145 150 155 160

Ser Leu Ile Asp Thr Asn Ser Phe Gln Asn Gln Leu Asp Gln Met Pro

165 170 175

Arg Arg Phe Tyr Leu Ala Gly Asn Gln Glu Gln Glu Phe Leu Gln Tyr

180 185 190

Gln Pro Gln Lys Gln Gln Gly Gly Thr Gln Ser Gln Lys Gly Lys Arg

195 200 205

Gln Gln Glu Glu Glu Asn Glu Gly Gly Ser Ile Leu Ser Gly Phe Ala

210 215 220

Pro Glu Phe Leu Glu His Ala Phe Val Val Asp Arg Gln Ile Val Arg

225 230 235 240

Lys Leu Gln Gly Glu Asn Glu Glu Glu Glu Lys Gly Ala Ile Val Thr

245 250 255

Val Lys Gly Gly Leu Ser Val Ile Ser Pro Pro Thr Glu Glu Gln Gln

260 265 270

Gln Arg Pro Glu Glu Glu Glu Lys Pro Asp Cys Asp Glu Lys Asp Lys

275 280 285

His Cys Gln Ser Gln Ser Arg Asn Gly Ile Asp Glu Thr Ile Cys Thr

290 295 300

Met Arg Leu Arg His Asn Ile Gly Gln Thr Ser Ser Pro Asp Ile Phe

305 310 315 320

Asn Pro Gln Ala Gly Ser Ile Thr Thr Ala Thr Ser Leu Asp Phe Pro

325 330 335

Ala Leu Ser Trp Leu Lys Leu Ser Ala Gln Phe Gly Ser Leu Arg Lys

340 345 350

Asn Ala Met Phe Val Pro His Tyr Asn Leu Asn Ala Asn Ser Ile Ile

355 360 365

Tyr Ala Leu Asn Gly Arg Ala Leu Val Gln Val Val Asn Cys Asn Gly

370 375 380

Glu Arg Val Phe Asp Gly Glu Leu Gln Glu Gly Gln Val Leu Ile Val

385 390 395 400

Pro Gln Asn Phe Ala Val Ala Ala Arg Ser Gln Ser Asp Asn Phe Glu

405 410 415

Tyr Val Ser Phe Lys Thr Asn Asp Arg Pro Ser Ile Gly Asn Leu Ala

420 425 430

Gly Ala Asn Ser Leu Leu Asn Ala Leu Pro Glu Glu Val Ile Gln Gln

435 440 445

Thr Phe Asn Leu Arg Arg Gln Gln Ala Arg Gln Val Lys Asn Asn Asn

450 455 460

Pro Phe Ser Phe Leu Val Pro Pro Lys Glu Ser Gln Arg Arg Val Val

465 470 475 480

Ala

<210> 19

<211> 562

<212> PRT

<213>Manually

<220>

<223>The glycinin G4 121279 [Da of MW=63587.16] of Gly m 6

<400> 19

Met Gly Lys Pro Phe Thr Leu Ser Leu Ser Ser Leu Cys Leu Leu Leu

1 5 10 15

Leu Ser Ser Ala Cys Phe Ala Ile Ser Ser Ser Lys Leu Asn Glu Cys

20 25 30

Gln Leu Asn Asn Leu Asn Ala Leu Glu Pro Asp His Arg Val Glu Ser

35 40 45

Glu Gly Gly Leu Ile Gln Thr Trp Asn Ser Gln His Pro Glu Leu Lys

50 55 60

Cys Ala Gly Val Thr Val Ser Lys Leu Thr Leu Asn Arg Asn Gly Leu

65 70 75 80

His Ser Pro Ser Tyr Ser Pro Tyr Pro Arg Met Ile Ile Ile Ala Gln

85 90 95

Gly Lys Gly Ala Leu Gly Val Ala Ile Pro Gly Cys Pro Glu Thr Phe

100 105 110

Glu Glu Pro Gln Glu Gln Ser Asn Arg Arg Gly Ser Arg Ser Gln Lys

115 120 125

Gln Gln Leu Gln Asp Ser His Gln Lys Ile Arg His Phe Asn Glu Gly

130 135 140

Asp Val Leu Val Ile Pro Pro Ser Val Pro Tyr Trp Thr Tyr Asn Thr

145 150 155 160

Gly Asp Glu Pro Val Val Ala Ile Ser Leu Leu Asp Thr Ser Asn Phe

165 170 175

Asn Asn Gln Leu Asp Gln Thr Pro Arg Val Phe Tyr Leu Ala Gly Asn

180 185 190

Pro Asp Ile Glu Tyr Pro Glu Thr Met Gln Gln Gln Gln Gln Gln Lys

195 200 205

Ser His Gly Gly Arg Lys Gln Gly Gln His Gln Gln Glu Glu Glu Glu

210 215 220

Glu Gly Gly Ser Val Leu Ser Gly Phe Ser Lys His Phe Leu Ala Gln

225 230 235 240

Ser Phe Asn Thr Asn Glu Asp Ile Ala Glu Lys Leu Glu Ser Pro Asp

245 250 255

Asp Glu Arg Lys Gln Ile Val Thr Val Glu Gly Gly Leu Ser Val Ile

260 265 270

Ser Pro Lys Trp Gln Glu Gln Gln Asp Glu Asp Glu Asp Glu Asp Glu

275 280 285

Asp Asp Glu Asp Glu Gln Ile Pro Ser His Pro Pro Arg Arg Pro Ser

290 295 300

His Gly Lys Arg Glu Gln Asp Glu Asp Glu Asp Glu Asp Glu Asp Lys

305 310 315 320

Pro Arg Pro Ser Arg Pro Ser Gln Gly Lys Arg Asn Lys Thr Gly Gln

325 330 335

Asp Glu Asp Glu Asp Glu Asp Glu Asp Gln Pro Arg Lys Ser Arg Glu

340 345 350

Trp Arg Ser Lys Lys Thr Gln Pro Arg Arg Pro Arg Gln Glu Glu Pro

355 360 365

Arg Glu Arg Gly Cys Glu Thr Arg Asn Gly Val Glu Glu Asn Ile Cys

370 375 380

Thr Leu Lys Leu His Glu Asn Ile Ala Arg Pro Ser Arg Ala Asp Phe

385 390 395 400

Tyr Asn Pro Lys Ala Gly Arg Ile Ser Thr Leu Asn Ser Leu Thr Leu

405 410 415

Pro Ala Leu Arg Gln Phe Gln Leu Ser Ala Gln Tyr Val Val Leu Tyr

420 425 430

Lys Asn Gly Ile Tyr Ser Pro His Trp Asn Leu Asn Ala Asn Ser Val

435 440 445

Ile Tyr Val Thr Arg Gly Gln Gly Lys Val Arg Val Val Asn Cys Gln

450 455 460

Gly Asn Ala Val Phe Asp Gly Glu Leu Arg Arg Gly Gln Leu Leu Val

465 470 475 480

Val Pro Gln Asn Phe Val Val Ala Glu Gln Ala Gly Glu Gln Gly Phe

485 490 495

Glu Tyr Ile Val Phe Lys Thr His His Asn Ala Val Thr Ser Tyr Leu

500 505 510

Lys Asp Val Phe Arg Ala Ile Pro Ser Glu Val Leu Ala His Ser Tyr

515 520 525

Asn Leu Arg Gln Ser Gln Val Ser Glu Leu Lys Tyr Glu Gly Asn Trp

530 535 540

Gly Pro Leu Val Asn Pro Glu Ser Gln Gln Gly Ser Pro Arg Val Lys

545 550 555 560

Val Ala

<210> 20

<211> 562

<212> PRT

<213>Manually

<220>

<223>The glycinin precursors 75221455 [Da of MW=63876.47] of Gly m 6

<400> 20

Met Gly Lys Pro Phe Thr Leu Ser Leu Ser Ser Leu Cys Leu Leu Leu

1 5 10 15

Leu Ser Ser Ala Cys Phe Ala Ile Ser Ser Ser Lys Leu Asn Glu Cys

20 25 30

Gln Leu Asn Asn Leu Asn Ala Leu Glu Pro Asp His Arg Val Glu Phe

35 40 45

Glu Gly Gly Leu Ile Gln Thr Trp Asn Ser Gln His Pro Glu Leu Lys

50 55 60

Cys Ala Gly Val Thr Val Ser Lys Leu Thr Leu Asn Arg Asn Gly Leu

65 70 75 80

His Leu Pro Ser Tyr Ser Pro Tyr Pro Arg Met Ile Ile Ile Ala Gln

85 90 95

Gly Lys Gly Ala Leu Gln Cys Lys Pro Gly Cys Pro Glu Thr Phe Glu

100 105 110

Glu Pro Gln Glu Gln Ser Asn Arg Arg Gly Ser Arg Ser Gln Lys Gln

115 120 125

Gln Leu Gln Asp Ser His Gln Lys Ile Arg His Phe Asn Glu Gly Asp

130 135 140

Val Leu Val Ile Pro Pro Gly Val Pro Tyr Trp Thr Tyr Asn Thr Gly

145 150 155 160

Asp Glu Pro Val Val Ala Ile Ser Leu Leu Asp Thr Ser Asn Phe Asn

165 170 175

Asn Gln Leu Asp Gln Thr Pro Arg Val Phe Tyr Leu Ala Gly Asn Pro

180 185 190

Asp Ile Glu Tyr Pro Glu Thr Met Gln Gln Gln Gln Gln Gln Lys Ser

195 200 205

His Gly Gly Arg Lys Gln Gly Gln His Gln Gln Glu Glu Glu Glu Glu

210 215 220

Gly Gly Ser Val Leu Ser Gly Phe Ser Lys His Phe Leu Ala Gln Ser

225 230 235 240

Phe Asn Thr Asn Glu Asp Ile Ala Glu Lys Leu Gln Ser Pro Asp Asp

245 250 255

Glu Arg Lys Gln Ile Val Thr Val Glu Gly Gly Leu Ser Val Ile Ser

260 265 270

Pro Lys Trp Gln Glu Gln Gln Asp Glu Asp Glu Asp Glu Asp Glu Asp

275 280 285

Asp Glu Asp Glu Gln Ile Pro Ser His Pro Pro Arg Arg Pro Ser His

290 295 300

Gly Lys Arg Glu Gln Asp Glu Asp Glu Asp Glu Asp Glu Asp Lys Pro

305 310 315 320

Arg Pro Ser Arg Pro Ser Gln Gly Lys Arg Glu Gln Asp Gln Asp Gln

325 330 335

Asp Glu Asp Glu Asp Glu Asp Glu Asp Gln Pro Arg Lys Ser Arg Glu

340 345 350

Trp Arg Ser Lys Lys Thr Gln Pro Arg Arg Pro Arg Gln Glu Glu Pro

355 360 365

Arg Glu Arg Gly Cys Glu Thr Arg Asn Gly Val Glu Glu Asn Ile Cys

370 375 380

Thr Leu Lys Leu His Glu Asn Ile Ala Arg Pro Ser Arg Ala Asp Phe

385 390 395 400

Tyr Asn Pro Lys Ala Gly Arg Ile Ser Thr Leu Asn Ser Leu Thr Leu

405 410 415

Pro Ala Leu Arg Gln Phe Gln Leu Ser Ala Gln Tyr Val Val Leu Tyr

420 425 430

Lys Asn Gly Ile Tyr Ser Pro His Trp Asn Leu Asn Ala Asn Ser Val

435 440 445

Ile Tyr Val Thr Arg Gly Gln Gly Lys Val Arg Val Val Asn Cys Gln

450 455 460

Gly Asn Ala Val Phe Asp Gly Glu Leu Arg Arg Gly Gln Leu Leu Val

465 470 475 480

Val Pro Gln Asn Phe Val Val Ala Glu Gln Ala Gly Glu Gln Gly Phe

485 490 495

Glu Tyr Ile Val Phe Lys Thr His His Asn Ala Val Thr Ser Tyr Leu

500 505 510

Lys Asp Val Phe Arg Ala Ile Pro Ser Glu Val Leu Ala His Ser Tyr

515 520 525

Asn Leu Arg Gln Ser Gln Val Ser Glu Leu Lys Tyr Glu Gly Asn Trp

530 535 540

Gly Pro Leu Val Asn Pro Glu Ser Gln Gln Gly Ser Pro Arg Val Lys

545 550 555 560

Val Ala

<210> 21

<211> 476

<212> PRT

<213>Manually

<220>

<223> Gly m Bd 28K 12697782 [MW= 52944.36 Da]

<400> 21

Met Gly Asn Lys Thr Thr Leu Leu Leu Leu Leu Phe Val Leu Cys His

1 5 10 15

Gly Val Ala Thr Thr Thr Met Ala Phe His Asp Asp Glu Gly Gly Asp

20 25 30

Lys Lys Ser Pro Lys Ser Leu Phe Leu Met Ser Asn Ser Thr Arg Val

35 40 45

Phe Lys Thr Asp Ala Gly Glu Met Arg Val Leu Lys Ser His Gly Gly

50 55 60

Arg Ile Phe Tyr Arg His Met His Ile Gly Phe Ile Ser Met Glu Pro

65 70 75 80

Lys Ser Leu Phe Val Pro Gln Tyr Leu Asp Ser Asn Leu Ile Ile Phe

85 90 95

Ile Arg Arg Gly Glu Ala Lys Leu Gly Phe Ile Tyr Asp Asp Glu Leu

100 105 110

Ala Glu Arg Arg Leu Lys Thr Gly Asp Leu Tyr Met Ile Pro Ser Gly

115 120 125

Ser Ala Phe Tyr Leu Val Asn Ile Gly Glu Gly Gln Arg Leu His Val

130 135 140

Ile Cys Ser Ile Asp Pro Ser Thr Ser Leu Gly Leu Glu Thr Phe Gln

145 150 155 160

Ser Phe Tyr Ile Gly Gly Gly Ala Asn Ser His Ser Val Leu Ser Gly

165 170 175

Phe Glu Pro Ala Ile Leu Glu Thr Ala Phe Asn Glu Ser Arg Thr Val

180 185 190

Val Glu Glu Ile Phe Ser Lys Glu Leu Asp Gly Pro Ile Met Phe Val

195 200 205

Asp Asp Ser His Ala Pro Ser Leu Trp Thr Lys Phe Leu Gln Leu Lys

210 215 220

Lys Asp Asp Lys Glu Gln Gln Leu Lys Lys Met Met Gln Asp Gln Glu

225 230 235 240

Glu Asp Glu Glu Glu Lys Gln Thr Ser Arg Ser Trp Arg Lys Leu Leu

245 250 255

Glu Thr Val Phe Gly Lys Val Asn Glu Lys Ile Glu Asn Lys Asp Thr

260 265 270

Ala Gly Ser Pro Ala Ser Tyr Asn Leu Tyr Asp Asp Lys Lys Ala Asp

275 280 285

Phe Lys Asn Ala Tyr Gly Trp Ser Lys Ala Leu His Gly Gly Glu Tyr

290 295 300

Pro Pro Leu Ser Glu Pro Asp Ile Gly Val Leu Leu Val Lys Leu Ser

305 310 315 320

Ala Gly Ser Met Leu Ala Pro His Val Asn Pro Ile Ser Asp Glu Tyr

325 330 335

Thr Ile Val Leu Ser Gly Tyr Gly Glu Leu His Ile Gly Tyr Pro Asn

340 345 350

Gly Ser Arg Ala Met Lys Thr Lys Ile Lys Gln Gly Asp Val Phe Val

355 360 365

Val Pro Arg Tyr Phe Pro Phe Cys Gln Val Ala Ser Arg Asp Gly Pro

370 375 380

Leu Glu Phe Phe Gly Phe Ser Thr Ser Ala Arg Lys Asn Lys Pro Gln

385 390 395 400

Phe Leu Ala Gly Ala Ala Ser Leu Leu Arg Thr Leu Met Gly Pro Glu

405 410 415

Leu Ser Ala Ala Phe Gly Val Ser Glu Asp Thr Leu Arg Arg Ala Val

420 425 430

Asp Ala Gln His Glu Ala Val Ile Leu Pro Ser Ala Trp Ala Ala Pro

435 440 445

Pro Glu Asn Ala Gly Lys Leu Lys Met Glu Glu Glu Pro Asn Ala Ile

450 455 460

Arg Ser Phe Ala Asn Asp Val Val Met Asp Val Phe

465 470 475

<210> 22

<211> 379

<212> PRT

<213>Manually

<220>

<223> Gly m Bd 30K 84371705 [MW= 42757.81 Da]

<400> 22

Met Gly Phe Leu Val Leu Leu Leu Phe Ser Leu Leu Gly Leu Ser Ser

1 5 10 15

Ser Ser Ser Ile Ser Thr His Arg Ser Ile Leu Asp Leu Asp Leu Thr

20 25 30

Lys Phe Thr Thr Gln Lys Gln Val Ser Ser Leu Phe Gln Leu Trp Lys

35 40 45

Ser Glu His Gly Arg Val Tyr His Asn His Glu Glu Glu Ala Lys Arg

50 55 60

Leu Glu Ile Phe Lys Asn Asn Leu Asn Tyr Ile Arg Asp Met Asn Ala

65 70 75 80

Asn Arg Lys Ser Pro His Ser His Arg Leu Gly Leu Asn Lys Phe Ala

85 90 95

Asp Ile Thr Pro Gln Glu Phe Ser Lys Lys Tyr Leu Gln Ala Pro Lys

100 105 110

Asp Val Ser Gln Gln Ile Lys Met Ala Asn Lys Lys Met Lys Lys Glu

115 120 125

Gln Tyr Ser Cys Asp His Pro Pro Ala Ser Trp Asp Trp Arg Lys Lys

130 135 140

Gly Val Ile Thr Gln Val Lys Tyr Gln Gly Gly Cys Gly Ser Gly Trp

145 150 155 160

Ala Phe Ser Ala Thr Gly Ala Ile Glu Ala Ala His Ala Ile Ala Thr

165 170 175

Gly Asp Leu Val Ser Leu Ser Glu Gln Glu Leu Val Asp Cys Val Glu

180 185 190

Glu Ser Glu Gly Cys Tyr Asn Gly Trp His Tyr Gln Ser Phe Glu Trp

195 200 205

Val Leu Glu His Gly Gly Ile Ala Thr Asp Asp Asp Tyr Pro Tyr Arg

210 215 220

Ala Lys Glu Gly Arg Cys Lys Ala Asn Lys Ile Gln Asp Lys Val Thr

225 230 235 240

Ile Asp Gly Tyr Glu Thr Leu Ile Met Ser Asp Glu Ser Thr Glu Ser

245 250 255

Glu Thr Glu Gln Ala Phe Leu Ser Ala Ile Leu Glu Gln Pro Ile Ser

260 265 270

Val Ser Ile Asp Ala Lys Asp Phe His Leu Tyr Thr Gly Gly Ile Tyr

275 280 285

Asp Gly Glu Asn Cys Thr Ser Pro Tyr Gly Ile Asn His Phe Val Leu

290 295 300

Leu Val Gly Tyr Gly Ser Ala Asp Gly Val Asp Tyr Trp Ile Ala Lys

305 310 315 320

Asn Ser Trp Gly Glu Asp Trp Gly Glu Asp Gly Tyr Ile Trp Ile Gln

325 330 335

Arg Asn Thr Gly Asn Leu Leu Gly Val Cys Gly Met Asn Tyr Phe Ala

340 345 350

Ser Tyr Pro Thr Lys Glu Glu Ser Glu Thr Leu Val Ser Ala Arg Val

355 360 365

Lys Gly His Arg Arg Val Asp His Ser Pro Leu

370 375

<210> 23

<211> 203

<212> PRT

<213>Manually

<220>

<223> KTI 1 125722 [MW= 22545.94 Da]

<400> 23

Met Lys Ser Thr Ile Phe Phe Ala Leu Phe Leu Val Cys Ala Phe Thr

1 5 10 15

Ile Ser Tyr Leu Pro Ser Ala Thr Ala Gln Phe Val Leu Asp Thr Asp

20 25 30

Asp Asp Pro Leu Gln Asn Gly Gly Thr Tyr Tyr Met Leu Pro Val Met

35 40 45

Arg Gly Lys Gly Gly Gly Ile Glu Val Asp Ser Thr Gly Lys Glu Ile

50 55 60

Cys Pro Leu Thr Val Val Gln Ser Pro Asn Glu Leu Asp Lys Gly Ile

65 70 75 80

Gly Leu Val Phe Thr Ser Pro Leu His Ala Leu Phe Ile Ala Glu Arg

85 90 95

Tyr Pro Leu Ser Ile Lys Phe Gly Ser Phe Ala Val Ile Thr Leu Cys

100 105 110

Ala Gly Met Pro Thr Glu Trp Ala Ile Val Glu Arg Glu Gly Leu Gln

115 120 125

Ala Val Lys Leu Ala Ala Arg Asp Thr Val Asp Gly Trp Phe Asn Ile

130 135 140

Glu Arg Val Ser Arg Glu Tyr Asn Asp Tyr Lys Leu Val Phe Cys Pro

145 150 155 160

Gln Gln Ala Glu Asp Asn Lys Cys Glu Asp Ile Gly Ile Gln Ile Asp

165 170 175

Asp Asp Gly Ile Arg Arg Leu Val Leu Ser Lys Asn Lys Pro Leu Val

180 185 190

Val Gln Phe Gln Lys Phe Arg Ser Ser Thr Ala

195 200

<210> 24

<211> 216

<212> PRT

<213>Manually

<220>

<223> KTI 3 125020 [ MW= 24005.29 Da]

<400> 24

Met Lys Ser Thr Ile Phe Phe Leu Phe Leu Phe Cys Ala Phe Thr Thr

1 5 10 15

Ser Tyr Leu Pro Ser Ala Ile Ala Asp Phe Val Leu Asp Asn Glu Gly

20 25 30

Asn Pro Leu Glu Asn Gly Gly Thr Tyr Tyr Ile Leu Ser Asp Ile Thr

35 40 45

Ala Phe Gly Gly Ile Arg Ala Ala Pro Thr Gly Asn Glu Arg Cys Pro

50 55 60

Leu Thr Val Val Gln Ser Arg Asn Glu Leu Asp Lys Gly Ile Gly Thr

65 70 75 80

Ile Ile Ser Ser Pro Tyr Arg Ile Arg Phe Ile Ala Glu Gly His Pro

85 90 95

Leu Ser Leu Lys Phe Asp Ser Phe Ala Val Ile Met Leu Cys Val Gly

100 105 110

Ile Pro Thr Glu Trp Ser Val Val Glu Asp Leu Pro Glu Gly Pro Ala

115 120 125

Val Lys Ile Gly Glu Asn Lys Asp Ala Met Asp Gly Trp Phe Arg Leu

130 135 140

Glu Arg Val Ser Asp Asp Glu Phe Asn Asn Tyr Lys Leu Val Phe Cys

145 150 155 160

Pro Gln Gln Ala Glu Asp Asp Lys Cys Gly Asp Ile Gly Ile Ser Ile

165 170 175

Asp His Asp Asp Gly Thr Arg Arg Leu Val Val Ser Lys Asn Lys Pro

180 185 190

Leu Val Val Gln Phe Gln Lys Leu Asp Lys Glu Ser Leu Ala Lys Lys

195 200 205

Asn His Gly Leu Ser Arg Ser Glu

210 215

<210> 25

<211> 158

<212> PRT

<213>Manually

<220>

<223>Gly m 8 (2S albumin) NP_001238443 [Da of MW=18459.97]

<400> 25

Met Thr Lys Phe Thr Ile Leu Leu Ile Ser Leu Leu Phe Cys Ile Ala

1 5 10 15

His Thr Cys Ser Ala Ser Lys Trp Gln His Gln Gln Asp Ser Cys Arg

20 25 30

Lys Gln Leu Gln Gly Val Asn Leu Thr Pro Cys Glu Lys His Ile Met

35 40 45

Glu Lys Ile Gln Gly Arg Gly Asp Asp Asp Asp Asp Asp Asp Asp Asp

50 55 60

Asn His Ile Leu Arg Thr Met Arg Gly Arg Ile Asn Tyr Ile Arg Arg

65 70 75 80

Asn Glu Gly Lys Asp Glu Asp Glu Glu Glu Glu Gly His Met Gln Lys

85 90 95

Cys Cys Thr Glu Met Ser Glu Leu Arg Ser Pro Lys Cys Gln Cys Lys

100 105 110

Ala Leu Gln Lys Ile Met Glu Asn Gln Ser Glu Glu Leu Glu Glu Lys

115 120 125

Gln Lys Lys Lys Met Glu Lys Glu Leu Ile Asn Leu Ala Thr Met Cys

130 135 140

Arg Phe Gly Pro Met Ile Gln Cys Asp Leu Ser Ser Asp Asp

145 150 155

<210> 26

<211> 280

<212> PRT

<213>Manually

<220>

<223>Agglutinin ADC94422 [Da of MW=30186.22]

<400> 26

Met Ala Thr Ser Asn Phe Ser Ile Val Leu Ser Leu Ser Leu Ala Phe

1 5 10 15

Phe Leu Val Leu Leu Thr Lys Ala Asn Ser Thr Asn Thr Val Ser Phe

20 25 30

Thr Val Ser Lys Phe Ser Pro Arg Gln Gln Asn Leu Ile Phe Gln Gly

35 40 45

Asp Ala Ala Ile Ser Pro Ser Gly Val Leu Arg Leu Thr Lys Val Asp

50 55 60

Ser Ile Asp Val Pro Thr Thr Gly Ser Leu Gly Arg Ala Leu Tyr Ala

65 70 75 80

Thr Pro Ile Gln Ile Trp Asp Ser Glu Thr Gly Lys Val Ala Ser Trp

85 90 95

Ala Thr Ser Phe Lys Phe Lys Val Phe Ser Pro Asn Lys Thr Ala Asp

100 105 110

Gly Leu Ala Phe Phe Leu Ala Pro Val Gly Ser Lys Pro Gln Ser Lys

115 120 125

Gly Gly Phe Leu Gly Leu Phe Asn Ser Asp Ser Lys Asn Lys Ser Val

130 135 140

Gln Thr Val Ala Val Glu Phe Asp Thr Tyr Tyr Asn Ala Lys Trp Asp

145 150 155 160

Pro Ala Asn Arg His Ile Gly Ile Asp Val Asn Ser Ile Lys Ser Val

165 170 175

Lys Thr Ala Ser Trp Gly Leu Ala Asn Gly Gln Ile Ala Gln Ile Leu

180 185 190

Ile Thr Tyr Asp Ala Asp Thr Ser Leu Leu Val Ala Ser Leu Ile His

195 200 205

Pro Ser Arg Lys Thr Ser Tyr Ile Leu Ser Glu Thr Val Ser Leu Lys

210 215 220

Ser Asn Leu Pro Glu Trp Val Asn Ile Gly Phe Ser Ala Thr Thr Gly

225 230 235 240

Leu Asn Lys Gly Phe Val Glu Thr His Asp Val Phe Ser Trp Ser Phe

245 250 255

Ala Ser Lys Leu Ser Asp Gly Ser Thr Ser Asp Thr Leu Asp Leu Pro

260 265 270

Ser Phe Leu Leu Asn Glu Ala Ile

275 280

<210> 27

<211> 864

<212> PRT

<213>Manually

<220>

<223>Lipoxygenase CAA39604 [Da of MW=96817.14]

<400> 27

Met Phe Gly Ile Phe Asp Lys Gly Gln Lys Ile Lys Gly Thr Val Val

1 5 10 15

Leu Met Pro Lys Asn Val Leu Asp Phe Asn Ala Ile Thr Ser Ile Gly

20 25 30

Lys Gly Gly Val Ile Asp Thr Ala Thr Gly Ile Leu Gly Gln Gly Val

35 40 45

Ser Leu Val Gly Gly Val Ile Asp Thr Ala Thr Ser Phe Leu Gly Arg

50 55 60

Asn Ile Ser Met Gln Leu Ile Ser Ala Thr Gln Thr Asp Gly Ser Gly

65 70 75 80

Asn Gly Lys Val Gly Lys Glu Val Tyr Leu Glu Lys His Leu Pro Thr

85 90 95

Leu Pro Thr Leu Gly Ala Arg Gln Asp Ala Phe Ser Ile Phe Phe Glu

100 105 110

Trp Asp Ala Ser Phe Gly Ile Pro Gly Ala Phe Tyr Ile Lys Asn Phe

115 120 125

Met Thr Asp Glu Phe Phe Leu Val Ser Val Lys Leu Glu Asp Ile Pro

130 135 140

Asn His Gly Thr Ile Glu Phe Val Cys Asn Ser Trp Val Tyr Asn Phe

145 150 155 160

Arg Ser Tyr Lys Lys Asn Arg Ile Phe Phe Val Asn Asp Thr Tyr Leu

165 170 175

Pro Ser Ala Thr Pro Ala Pro Leu Leu Lys Tyr Arg Lys Glu Glu Leu

180 185 190

Glu Val Leu Arg Gly Asp Gly Thr Gly Lys Arg Lys Asp Phe Asp Arg

195 200 205

Ile Tyr Asp Tyr Asp Val Tyr Asn Asp Leu Gly Asn Pro Asp Gly Gly

210 215 220

Asp Pro Arg Pro Ile Leu Gly Gly Ser Ser Ile Tyr Pro Tyr Pro Arg

225 230 235 240

Arg Val Arg Thr Gly Arg Glu Arg Thr Arg Thr Asp Pro Asn Ser Glu

245 250 255

Lys Pro Gly Glu Val Tyr Val Pro Arg Asp Glu Asn Phe Gly His Leu

260 265 270

Lys Ser Ser Asp Phe Leu Thr Tyr Gly Ile Lys Ser Leu Ser His Asp

275 280 285

Val Ile Pro Leu Phe Lys Ser Ala Ile Phe Gln Leu Arg Val Thr Ser

290 295 300

Ser Glu Phe Glu Ser Phe Glu Asp Val Arg Ser Leu Tyr Glu Gly Gly

305 310 315 320

Ile Lys Leu Pro Thr Asp Ile Leu Ser Gln Ile Ser Pro Leu Pro Ala

325 330 335

Leu Lys Glu Ile Phe Arg Thr Asp Gly Glu Asn Val Leu Gln Phe Pro

340 345 350

Pro Pro His Val Ala Lys Val Ser Lys Ser Gly Trp Met Thr Asp Glu

355 360 365

Glu Phe Ala Arg Glu Val Ile Ala Gly Val Asn Pro Asn Val Ile Arg

370 375 380

Arg Leu Gln Glu Phe Pro Pro Lys Ser Thr Leu Asp Pro Thr Leu Tyr

385 390 395 400

Gly Asp Gln Thr Ser Thr Ile Thr Lys Glu Gln Leu Glu Ile Asn Met

405 410 415

Gly Gly Val Thr Val Glu Glu Ala Leu Ser Thr Gln Arg Leu Phe Ile

420 425 430

Leu Asp Tyr Gln Asp Ala Phe Ile Pro Tyr Leu Thr Arg Ile Asn Ser

435 440 445

Leu Pro Thr Ala Lys Ala Tyr Ala Thr Arg Thr Ile Leu Phe Leu Lys

450 455 460

Asp Asp Gly Thr Leu Lys Pro Leu Ala Ile Glu Leu Ser Lys Pro His

465 470 475 480

Pro Asp Gly Asp Asn Leu Gly Pro Glu Ser Ile Val Val Leu Pro Ala

485 490 495

Thr Glu Gly Val Asp Ser Thr Ile Trp Leu Leu Ala Lys Ala His Val

500 505 510

Ile Val Asn Asp Ser Gly Tyr His Gln Leu Val Ser His Trp Leu Asn

515 520 525

Thr His Ala Val Met Glu Pro Phe Ala Ile Ala Thr Asn Arg His Leu

530 535 540

Ser Val Leu His Pro Ile Tyr Lys Leu Leu Tyr Pro His Tyr Arg Asp

545 550 555 560

Thr Ile Asn Ile Asn Gly Leu Ala Arg Gln Ser Leu Ile Asn Ala Asp

565 570 575

Gly Ile Ile Glu Lys Ser Phe Leu Pro Gly Lys Tyr Ser Ile Glu Met

580 585 590

Ser Ser Ser Val Tyr Lys Asn Trp Val Phe Thr Asp Gln Ala Leu Pro

595 600 605

Ala Asp Leu Val Lys Arg Gly Leu Ala Ile Glu Asp Pro Ser Ala Pro

610 615 620

His Gly Leu Arg Leu Val Ile Glu Asp Tyr Pro Tyr Ala Val Asp Gly

625 630 635 640

Leu Glu Ile Trp Asp Ala Ile Lys Thr Trp Val His Glu Tyr Val Ser

645 650 655

Leu Tyr Tyr Pro Thr Asp Ala Ala Val Gln Gln Asp Thr Glu Leu Gln

660 665 670

Ala Trp Trp Lys Glu Ala Val Glu Lys Gly His Gly Asp Leu Lys Glu

675 680 685

Lys Pro Trp Trp Pro Lys Met Gln Thr Thr Glu Asp Leu Ile Gln Ser

690 695 700

Cys Ser Ile Ile Val Trp Thr Ala Ser Ala Leu His Ala Ala Val Asn

705 710 715 720

Phe Gly Gln Tyr Pro Tyr Gly Gly Leu Ile Leu Asn Arg Pro Thr Leu

725 730 735

Ala Arg Arg Phe Ile Pro Ala Glu Gly Thr Pro Glu Tyr Asp Glu Met

740 745 750

Val Lys Asn Pro Gln Lys Ala Tyr Leu Arg Thr Ile Thr Pro Lys Phe

755 760 765

Glu Thr Leu Ile Asp Leu Ser Val Ile Glu Ile Leu Ser Arg His Ala

770 775 780

Ser Asp Glu Ile Tyr Leu Gly Glu Arg Glu Thr Pro Asn Trp Thr Thr

785 790 795 800

Asp Lys Lys Ala Leu Glu Ala Phe Lys Arg Phe Gly Ser Lys Leu Thr

805 810 815

Gly Ile Glu Gly Lys Ile Asn Ala Arg Asn Ser Asp Pro Ser Leu Arg

820 825 830

Asn Arg Thr Gly Pro Val Gln Leu Pro Tyr Thr Leu Leu His Arg Ser

835 840 845

Ser Glu Glu Gly Leu Thr Phe Lys Gly Ile Pro Asn Ser Ile Ser Ile

850 855 860

<210> 28

<211> 118

<212> PRT

<213>Manually

<220>

<223>The consensus sequences of Gly m 1

<400> 28

Met Gly Ser Lys Val Val Ala Ser Val Ala Leu Leu Leu Ser Ile Asn

1 5 10 15

Ile Leu Phe Ile Ser Met Val Ser Ser Ser Ser His Tyr Asp Pro Pro

20 25 30

Gln Pro Ser Tyr Val Thr Ala Leu Ile Thr Arg Pro Ser Cys Pro Asp

35 40 45

Leu Ser Ile Cys Leu Asn Ile Leu Gly Gly Ser Leu Gly Thr Val Asp

50 55 60

Asp Cys Cys Ala Leu Ile Gly Gly Leu Gly Asp Ile Glu Ala Ile Val

65 70 75 80

Cys Leu Cys Ile Gln Leu Arg Ala Leu Gly Ile Leu Asn Leu Asn Arg

85 90 95

Asn Leu Gln Leu Ile Leu Asn Ala Cys Gly Arg Ser Tyr Pro Ser Asn

100 105 110

Ala Thr Cys Pro Arg Thr

115

<210> 29

<211> 119

<212> PRT

<213>Manually

<220>

<223>The consensus sequence #2 of Gly m 1

<400> 29

Met Gly Ser Lys Val Val Ala Ser Val Ala Leu Leu Leu Ser Ile Asn

1 5 10 15

Ile Leu Phe Ile Ser Met Val Ser Ser Ser Ser His Tyr Asp Pro Gln

20 25 30

Pro Gln Pro Ser His Val Thr Ala Leu Ile Thr Arg Pro Ser Cys Pro

35 40 45

Asp Leu Ser Ile Cys Leu Asn Ile Leu Gly Gly Ser Leu Gly Thr Val

50 55 60

Asp Asp Cys Cys Ala Leu Ile Gly Gly Leu Gly Asp Ile Glu Ala Ile

65 70 75 80

Val Cys Leu Cys Ile Gln Leu Arg Ala Leu Gly Ile Leu Asn Leu Asn

85 90 95

Arg Asn Leu Gln Leu Ile Leu Asn Ala Cys Gly Arg Ser Tyr Pro Ser

100 105 110

Asn Ala Thr Cys Pro Arg Thr

115

<210> 30

<211> 42

<212> PRT

<213>Manually

<220>

<223> Gly m 1 Ping AAB34755.1 42aa

<220>

<221> misc_feature

<222> (8)..(8)

<223> Xaa can be any naturally occurring amino acid

<220>

<221> misc_feature

<222> (14)..(14)

<223> Xaa can be any naturally occurring amino acid

<220>

<221> misc_feature

<222> (28)..(29)

<223> Xaa can be any naturally occurring amino acid

<220>

<221> misc_feature

<222> (36)..(36)

<223> Xaa can be any naturally occurring amino acid

<220>

<221> misc_feature

<222> (38)..(39)

<223> Xaa can be any naturally occurring amino acid

<400> 30

Ala Leu Ile Thr Arg Pro Ser Xaa Pro Asp Leu Ser Ile Xaa Leu Asn

1 5 10 15

Ile Leu Gly Gly Ser Leu Gly Thr Val Asp Asp Xaa Xaa Ala Leu Ile

20 25 30

Gly Gly Leu Xaa Asp Xaa Xaa Ala Ile Val

35 40

<210> 31

<211> 134

<212> PRT

<213>Manually

<220>

<223> Gly m 1 Ping ABA54897.1 134aa

<400> 31

Met Gly Ser Lys Val Val Ala Ser Val Ala Leu Leu Leu Ser Ile Asn

1 5 10 15

Ile Leu Phe Ile Ser Met Val Ser Ser Ser Ser His Tyr Asp Pro Pro

20 25 30

Pro Pro Pro Cys Tyr Val Pro Ala Pro Leu Thr Pro Pro Pro Ser Leu

35 40 45

Ser Pro Pro Pro Ser Leu Ser Pro Pro Pro Pro Ser Gly Pro Ser Cys

50 55 60

Pro Asp Leu Ser Val Cys Leu Asn Ile Leu Asp Gly Ser Pro Ala Asp

65 70 75 80

Asp Cys Cys Ala Leu Ile Ala Asp Leu Val Asp Leu Glu Ala Ser Val

85 90 95

Cys Leu Cys Ile Gln Leu Arg Val Leu Gly Ile Val Asn Leu Asp Leu

100 105 110

Asn Leu Gln Leu Ile Leu Asn Ala Cys Gly Pro Ser Tyr Pro Ser Asn

115 120 125

Ala Thr Cys Pro Arg Thr

130

<210> 32

<211> 118

<212> PRT

<213>Manually

<220>

<223> Gly m 1 Eric ABA54899 118aa

<400> 32

Gly Ser Lys Val Val Ala Ser Val Ala Leu Leu Leu Ser Ile Asn Ile

1 5 10 15

Leu Phe Ile Ser Met Val Ser Ser Ser Ser His Tyr Asp Pro Gln Pro

20 25 30

Gln Pro Ser His Val Thr Ala Leu Ile Thr Arg Pro Ser Cys Pro Asp

35 40 45

Leu Ser Ile Cys Leu Asn Ile Leu Gly Gly Ser Leu Gly Thr Val Asp

50 55 60

Asp Cys Cys Ala Leu Ile Gly Gly Leu Gly Asp Ile Glu Ala Ile Val

65 70 75 80

Cys Leu Cys Ile Gln Leu Arg Ala Leu Gly Ile Leu Asn Leu Asn Arg

85 90 95

Asn Leu Gln Leu Ile Leu Asn Ser Cys Gly Arg Ser Tyr Pro Ser Asn

100 105 110

Ala Thr Cys Pro Arg Thr

115

<210> 33

<211> 119

<212> PRT

<213>Manually

<220>

<223> Gly m 1 Glyma15g13740.1 BLAST 120aa

<400> 33

Met Gly Ser Lys Val Val Ala Tyr Val Ala Leu Leu Leu Ser Ile Asn

1 5 10 15

Ile Leu Phe Ile Ser Met Val Ser Ser Ser Ser His Tyr Asp Pro Gln

20 25 30

Pro Gln Pro Ser Tyr Val Thr Ala Leu Ile Thr Arg Pro Ser Cys Pro

35 40 45

Asp Leu Ser Val Cys Leu Asn Ile Leu Gly Gly Tyr Leu Gly Thr Val

50 55 60

Asp Asp Cys Cys Ala Leu Ile Gly Gly Leu Gly Asp Ile Glu Ala Thr

65 70 75 80

Val Cys Leu Cys Ile Gln Leu Arg Ala Leu Gly Ile Leu Asn Leu Asn

85 90 95

Arg Asn Leu Gln Leu Ile Leu Asn Ala Cys Gly Pro Ser Tyr Pro Ser

100 105 110

Asn Ala Thr Cys Pro Arg Thr

115

<210> 34

<211> 129

<212> PRT

<213>Manually

<220>

<223> Gly m 1 Glyma15g13770.1 BLAST 130aa

<400> 34

Met Gly Ser Lys Val Val Ala Ser Val Ala Leu Leu Leu Ser Ile Asn

1 5 10 15

Ile Leu Phe Ile Ser Met Val Ser Ser Ser Ser His Tyr Asp Pro Pro

20 25 30

Pro Pro Pro Cys Tyr Val Pro Ala Pro Phe Thr Pro Pro Pro Pro Ser

35 40 45

Leu Ser Pro Pro Pro Pro Ser Gly Pro Ser Cys Pro Asp Leu Ser Val

50 55 60

Cys Leu Asn Ile Leu Asp Gly Ser Pro Ala Asp Asp Cys Cys Ala Leu

65 70 75 80

Ile Ala Asp Leu Val Asp Leu Glu Ala Ser Val Cys Leu Cys Ile Gln

85 90 95

Leu Arg Val Leu Gly Ile Val Asn Leu Asp Leu Asn Leu Gln Leu Ile

100 105 110

Leu Asn Ala Cys Gly Pro Ser Tyr Pro Ser Asn Ala Thr Cys Pro Arg

115 120 125

Thr

<210> 35

<211> 119

<212> PRT

<213>Manually

<220>

<223> Gly m 1 Glyma15g13750.1 BLAST 120aa

<400> 35

Met Gly Ser Lys Val Val Ala Ser Val Ala Leu Leu Leu Ser Ile Asn

1 5 10 15

Ile Leu Phe Ile Ser Met Val Ser Ser Ser Ser His Tyr Asp Pro Pro

20 25 30

Pro Gln Pro Ser Tyr Val Thr Ala Leu Ile Thr Arg Pro Ser Cys Pro

35 40 45

Asp Leu Ser Ile Cys Leu Asn Ile Leu Gly Gly Ser Leu Gly Thr Val

50 55 60

Asp Asp Cys Cys Ala Leu Ile Gly Gly Leu Gly Asp Ile Glu Ala Ile

65 70 75 80

Val Cys Leu Cys Ile Gln Leu Arg Ala Leu Gly Ile Leu Asn Leu Asn

85 90 95

Arg Asn Leu Gln Leu Ile Leu Asn Ser Cys Gly Arg Ser Tyr Pro Ser

100 105 110

Asn Ala Thr Cys Pro Arg Thr

115

<210> 36

<211> 9

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 1

<400> 36

Ala Leu Gly Ile Leu Asn Leu Asn Arg

1 5

<210> 37

<211> 11

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 1

<400> 37

Asn Leu Gln Leu Ile Leu Asn Ser Cys Gly Arg

1 5 10

<210> 38

<211> 131

<212> PRT

<213>Manually

<220>

<223>The consensus sequences of Gly m 3

<400> 38

Met Ser Trp Gln Ala Tyr Val Asp Asp His Leu Leu Cys Gly Ile Glu

1 5 10 15

Gly Asn His Leu Thr His Ala Ala Ile Ile Gly Gln Asp Gly Ser Val

20 25 30

Trp Ala Gln Ser Thr Asp Phe Pro Gln Phe Lys Pro Glu Glu Ile Thr

35 40 45

Ala Ile Met Asn Asp Phe Asn Glu Pro Gly Ser Leu Ala Pro Thr Gly

50 55 60

Leu Tyr Leu Gly Gly Thr Lys Tyr Met Val Ile Gln Gly Glu Pro Gly

65 70 75 80

Ala Val Ile Arg Gly Lys Lys Gly Pro Gly Gly Val Thr Val Lys Lys

85 90 95

Thr Gly Ala Ala Leu Ile Ile Gly Ile Tyr Asp Glu Pro Met Thr Pro

100 105 110

Gly Gln Cys Asn Met Val Val Glu Arg Leu Gly Asp Tyr Leu Ile Asp

115 120 125

Gln Gly Tyr

130

<210> 39

<211> 131

<212> PRT

<213>Manually

<220>

<223> Gly m 3 Ping ABU97472.1 131aa

<400> 39

Met Ser Trp Gln Ala Tyr Val Asp Asp His Leu Leu Cys Glu Ile Glu

1 5 10 15

Gly Asn His Leu Thr His Ala Ala Ile Ile Gly Gln Asp Gly Ser Val

20 25 30

Trp Ala Gln Ser Thr Asn Phe Pro Gln Phe Lys Pro Glu Glu Ile Thr

35 40 45

Ala Ile Asn Asn Asp Phe Asn Glu Pro Gly Ser Leu Ala Pro Thr Gly

50 55 60

Leu Tyr Ile Gly Gly Thr Lys Tyr Met Val Ile Gln Gly Glu Pro Gly

65 70 75 80

Ala Val Ile Arg Gly Lys Lys Gly Pro Gly Gly Val Thr Val Lys Lys

85 90 95

Thr Gly Ala Ala Leu Ile Ile Gly Ile Tyr Asp Glu Pro Met Thr Pro

100 105 110

Gly Gln Cys Asn Met Val Val Glu Arg Leu Gly Asp Tyr Leu Ile Asp

115 120 125

Gln Gly Leu

130

<210> 40

<211> 131

<212> PRT

<213>Manually

<220>

<223> Gly m 3 Ping O65809.1 131aa

<400> 40

Met Ser Trp Gln Ala Tyr Val Asp Asp His Leu Leu Cys Asp Ile Glu

1 5 10 15

Gly Asn His Leu Thr His Ala Ala Ile Ile Gly Gln Asp Gly Ser Val

20 25 30

Trp Ala Gln Ser Thr Asp Phe Pro Gln Phe Lys Pro Glu Glu Ile Thr

35 40 45

Ala Ile Met Asn Asp Phe Asn Glu Pro Gly Ser Leu Ala Pro Thr Gly

50 55 60

Leu Tyr Leu Gly Gly Thr Lys Tyr Met Val Ile Gln Gly Glu Pro Gly

65 70 75 80

Ala Val Ile Arg Gly Lys Lys Gly Pro Gly Gly Val Thr Val Lys Lys

85 90 95

Thr Gly Ala Ala Leu Ile Ile Gly Ile Tyr Asp Glu Pro Met Thr Pro

100 105 110

Gly Gln Cys Asn Met Val Val Glu Arg Pro Gly Asp Tyr Leu Ile Asp

115 120 125

Gln Gly Tyr

130

<210> 41

<211> 8

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 3

<400> 41

Gly Pro Gly Gly Val Thr Val Lys

1 5

<210> 42

<211> 158

<212> PRT

<213>Manually

<220>

<223>The consensus sequences of Gly m 4

<400> 42

Met Gly Val Phe Thr Phe Glu Asp Glu Thr Thr Ser Pro Val Ala Pro

1 5 10 15

Ala Thr Leu Tyr Lys Ala Leu Val Thr Asp Ala Asp Asn Val Ile Pro

20 25 30

Lys Ala Val Asp Ala Phe Lys Ser Val Glu Asn Val Glu Gly Asn Gly

35 40 45

Gly Pro Gly Thr Ile Lys Lys Ile Thr Phe Val Glu Asp Gly Glu Thr

50 55 60

Lys Phe Val Leu His Lys Ile Glu Ala Ile Asp Glu Ala Asn Leu Gly

65 70 75 80

Tyr Ser Tyr Ser Val Val Gly Gly Ala Gly Leu Pro Asp Thr Val Glu

85 90 95

Lys Ile Thr Phe Glu Ala Lys Leu Ala Ala Gly Ala Asn Gly Gly Ser

100 105 110

Ala Gly Lys Leu Thr Val Lys Tyr Gln Thr Lys Gly Asp Ala Gln Pro

115 120 125

Asn Gln Asp Glu Leu Lys Ser Gly Lys Ala Lys Ala Asp Ala Leu Phe

130 135 140

Lys Ala Val Glu Ala Tyr Leu Leu Ala Asn Pro Asp Tyr Asn

145 150 155

<210> 43

<211> 165

<212> PRT

<213>Manually

<220>

<223> Gly m 4 Glyma07g37240.1 BLAST 165aa

<400> 43

Met Gly Val Phe Thr Phe Glu Asp Glu Ile Asn Ser Pro Val Ala Pro

1 5 10 15

Ala Thr Leu Tyr Lys Ala Leu Val Thr Asp Ala Asp Asn Val Ile Pro

20 25 30

Lys Ala Leu Asp Ser Phe Lys Ser Val Glu Asn Val Glu Gly Asn Gly

35 40 45

Gly Pro Gly Thr Ile Lys Lys Ile Thr Phe Leu Glu Ala Asp Val Asn

50 55 60

Glu Trp Ile Asp Gly Glu Thr Lys Phe Val Leu His Lys Ile Glu Ser

65 70 75 80

Ile Asp Glu Ala Asn Leu Gly Tyr Ser Tyr Ser Val Val Gly Gly Ala

85 90 95

Ala Leu Pro Asp Thr Ala Glu Lys Ile Thr Phe Asp Ser Lys Leu Val

100 105 110

Ala Gly Pro Asn Gly Gly Ser Ala Gly Lys Leu Thr Val Lys Tyr Glu

115 120 125

Thr Lys Gly Asp Ala Glu Pro Asn Gln Asp Glu Leu Lys Thr Gly Lys

130 135 140

Ala Lys Ala Asp Ala Leu Phe Lys Ala Ile Glu Ala Tyr Leu Leu Ala

145 150 155 160

His Pro Asp Tyr Asn

165

<210> 44

<211> 158

<212> PRT

<213>Manually

<220>

<223> Gly m 4 Glyma17g03365.1 BLAST 159aa

<400> 44

Met Gly Ile Phe Thr Phe Glu Asp Glu Ile Thr Ser Pro Val Ala Pro

1 5 10 15

Ala Thr Leu Tyr Lys Ala Leu Val Thr Asp Ala Asp Asn Ile Ile Pro

20 25 30

Lys Ala Leu Asp Ser Phe Lys Ser Val Glu Asn Val Glu Gly Asn Gly

35 40 45

Gly Pro Gly Thr Ile Lys Lys Ile Thr Phe Val Glu Asp Gly Glu Thr

50 55 60

Lys Phe Val Leu His Lys Ile Glu Ala Val Asp Glu Ala Asn Leu Gly

65 70 75 80

Tyr Ser Tyr Ser Val Val Gly Gly Ala Ala Leu Pro Asp Thr Ala Glu

85 90 95

Lys Ile Thr Phe His Ser Lys Leu Ala Ala Gly Pro Asn Gly Gly Ser

100 105 110

Ala Gly Lys Leu Thr Val Glu Tyr Gln Thr Lys Gly Asp Ala Gln Pro

115 120 125

Asn Gln Asp Gln Leu Lys Thr Gly Lys Ala Lys Ala Asp Ala Leu Phe

130 135 140

Lys Ala Ile Glu Ala Tyr Leu Leu Ala Asn Pro Asp Tyr Asn

145 150 155

<210> 45

<211> 146

<212> PRT

<213>Manually

<220>

<223> Gly m 4 Glyma07g37240.3 BLAST 147aa

<400> 45

Met Gly Val Phe Thr Phe Glu Asp Glu Ile Asn Ser Pro Val Ala Pro

1 5 10 15

Ala Thr Leu Tyr Lys Ala Leu Asp Ser Phe Lys Ser Val Glu Asn Val

20 25 30

Glu Gly Asn Gly Gly Pro Gly Thr Ile Lys Lys Ile Thr Phe Leu Glu

35 40 45

Asp Gly Glu Thr Lys Phe Val Leu His Lys Ile Glu Ser Ile Asp Glu

50 55 60

Ala Asn Leu Gly Tyr Ser Tyr Ser Val Val Gly Gly Ala Ala Leu Pro

65 70 75 80

Asp Thr Ala Glu Lys Ile Thr Phe Asp Ser Lys Leu Val Ala Gly Pro

85 90 95

Asn Gly Gly Ser Ala Gly Lys Leu Thr Val Lys Tyr Glu Thr Lys Gly

100 105 110

Asp Ala Glu Pro Asn Gln Asp Glu Leu Lys Thr Gly Lys Ala Lys Ala

115 120 125

Asp Ala Leu Phe Lys Ala Ile Glu Ala Tyr Leu Leu Ala His Pro Asp

130 135 140

Tyr Asn

145

<210> 46

<211> 158

<212> PRT

<213>Manually

<220>

<223> Gly m 4 Glyma07g37270.2 BLAST 159aa

<400> 46

Met Gly Val Phe Thr Phe Glu Asp Glu Ile Asn Ser Pro Val Ala Pro

1 5 10 15

Ala Thr Leu Tyr Lys Ala Leu Val Thr Asp Ala Asp Asn Val Ile Pro

20 25 30

Lys Ala Leu Asp Ser Phe Lys Ser Val Glu Asn Val Glu Gly Asn Gly

35 40 45

Gly Pro Gly Thr Ile Lys Lys Ile Thr Phe Leu Glu Asp Gly Glu Thr

50 55 60

Lys Phe Val Leu His Lys Ile Glu Ala Ile Asp Glu Ala Asn Leu Gly

65 70 75 80

Tyr Ser Tyr Ser Val Val Gly Gly Asp Gly Leu Pro Asp Thr Val Glu

85 90 95

Lys Ile Thr Phe Glu Cys Lys Leu Ala Ala Gly Ala Asn Gly Gly Ser

100 105 110

Ala Gly Lys Leu Thr Val Lys Tyr Gln Thr Lys Gly Asp Ala Gln Pro

115 120 125

Asn Gln Asp Asp Leu Lys Ile Gly Lys Ala Lys Ser Asp Ala Leu Phe

130 135 140

Lys Ala Val Glu Ala Tyr Leu Leu Ala His Pro Asp Tyr Asn

145 150 155

<210> 47

<211> 158

<212> PRT

<213>Manually

<220>

<223> Gly m 4 Glyma07g37270.1 BLAST 159aa

<400> 47

Met Gly Val Phe Thr Phe Glu Asp Glu Thr Thr Ser Pro Val Ala Pro

1 5 10 15

Ala Thr Leu Tyr Lys Ala Leu Val Thr Asp Ala Asp Asn Val Ile Pro

20 25 30

Lys Ala Val Asp Ala Phe Arg Ser Val Glu Asn Val Glu Gly Asn Gly

35 40 45

Gly Pro Gly Thr Ile Lys Lys Ile Thr Phe Leu Glu Asp Gly Glu Thr

50 55 60

Lys Phe Val Leu His Lys Ile Glu Ala Ile Asp Glu Ala Asn Leu Gly

65 70 75 80

Tyr Ser Tyr Ser Val Val Gly Gly Asp Gly Leu Pro Asp Thr Val Glu

85 90 95

Lys Ile Thr Phe Glu Cys Lys Leu Ala Ala Gly Ala Asn Gly Gly Ser

100 105 110

Ala Gly Lys Leu Thr Val Lys Tyr Gln Thr Lys Gly Asp Ala Gln Pro

115 120 125

Asn Gln Asp Asp Leu Lys Ile Gly Lys Ala Lys Ser Asp Ala Leu Phe

130 135 140

Lys Ala Val Glu Ala Tyr Leu Leu Ala His Pro Asp Tyr Asn

145 150 155

<210> 48

<211> 158

<212> PRT

<213>Manually

<220>

<223> Gly m 4 Glyma17g03360.1 BLAST 159aa

<400> 48

Met Gly Val Phe Thr Phe Glu Asp Glu Thr Thr Ser Pro Val Ala Pro

1 5 10 15

Ala Thr Leu Tyr Lys Ala Leu Val Thr Asp Ala Asp Asn Val Ile Pro

20 25 30

Lys Ala Val Asp Ala Phe Arg Ser Val Glu Asn Leu Glu Gly Asn Gly

35 40 45

Gly Pro Gly Thr Ile Lys Lys Ile Thr Phe Val Glu Asp Gly Glu Ser

50 55 60

Lys Phe Val Leu His Lys Ile Glu Ser Val Asp Glu Ala Asn Leu Gly

65 70 75 80

Tyr Ser Tyr Ser Val Val Gly Gly Val Gly Leu Pro Asp Thr Val Glu

85 90 95

Lys Ile Thr Phe Glu Cys Lys Leu Ala Ala Gly Ala Asn Gly Gly Ser

100 105 110

Ala Gly Lys Leu Thr Val Lys Tyr Gln Thr Lys Gly Asp Ala Gln Pro

115 120 125

Asn Pro Asp Asp Leu Lys Ile Gly Lys Val Lys Ser Asp Ala Leu Phe

130 135 140

Lys Ala Val Glu Ala Tyr Leu Leu Ala Asn Pro His Tyr Asn

145 150 155

<210> 49

<211> 158

<212> PRT

<213>Manually

<220>

<223> Gly m 4 Glyma17g03350.1 BLAST 159aa

<400> 49

Met Gly Ile Phe Thr Phe Glu Asp Glu Thr Thr Ser Pro Val Ala Pro

1 5 10 15

Ala Thr Leu Tyr Lys Ala Leu Val Thr Asp Ala Asp Asn Val Ile Pro

20 25 30

Lys Ala Val Glu Ala Phe Arg Ser Val Glu Asn Leu Glu Gly Asn Gly

35 40 45

Gly Pro Gly Thr Ile Lys Lys Ile Thr Phe Val Glu Asp Gly Glu Ser

50 55 60

Lys Phe Val Leu His Lys Ile Glu Ser Val Asp Glu Ala Asn Leu Gly

65 70 75 80

Tyr Ser Tyr Ser Val Val Gly Gly Val Gly Leu Pro Asp Thr Val Glu

85 90 95

Lys Ile Thr Phe Glu Cys Lys Leu Ala Ala Gly Ala Asn Gly Gly Ser

100 105 110

Ala Gly Lys Leu Thr Val Lys Tyr Gln Thr Lys Gly Asp Ala Gln Pro

115 120 125

Asn Pro Asp Asp Leu Lys Ile Gly Lys Val Lys Ser Asp Ala Leu Phe

130 135 140

Lys Ala Val Glu Ala Tyr Leu Leu Ala Asn Pro His Tyr Asn

145 150 155

<210> 50

<211> 158

<212> PRT

<213>Manually

<220>

<223> Gly m 4 Glyma09g04510.1 BLAST 159aa

<400> 50

Met Gly Val Phe Thr Phe Glu Asp Glu Thr Thr Ser Thr Val Ala Pro

1 5 10 15

Ala Arg Leu Tyr Lys Ala Leu Val Lys Asp Ala Asp Asn Leu Val Pro

20 25 30

Lys Ala Val Glu Ala Ile Lys Ser Val Glu Ile Val Glu Gly Asn Gly

35 40 45

Gly Pro Gly Thr Ile Lys Lys Leu Thr Phe Val Glu Asp Gly Gln Thr

50 55 60

Lys Tyr Val Leu His Lys Val Glu Ala Ile Asp Glu Ala Asn Trp Gly

65 70 75 80

Tyr Asn Tyr Ser Val Val Gly Gly Val Gly Leu Pro Asp Thr Val Glu

85 90 95

Lys Ile Ser Phe Glu Ala Lys Leu Val Ala Asp Pro Asn Gly Gly Ser

100 105 110

Ile Ala Lys Ile Thr Val Lys Tyr Gln Thr Lys Gly Asp Ala Asn Pro

115 120 125

Ser Glu Glu Glu Leu Lys Ser Gly Lys Ala Lys Gly Asp Ala Leu Phe

130 135 140

Lys Ala Leu Glu Gly Tyr Val Leu Ala Asn Pro Asp Tyr Asn

145 150 155

<210> 51

<211> 158

<212> PRT

<213>Manually

<220>

<223> Gly m 4 Glyma15g15590.1 BLAST 159aa

<400> 51

Met Gly Val Phe Thr Phe Glu Asp Glu Thr Thr Ser Thr Val Ala Pro

1 5 10 15

Ala Arg Leu Tyr Lys Ala Leu Val Lys Asp Ala Asp Asn Leu Val Pro

20 25 30

Lys Ala Val Glu Ala Ile Lys Ser Val Glu Ile Val Glu Gly Asn Gly

35 40 45

Gly Pro Gly Thr Ile Lys Lys Leu Thr Phe Val Glu Asp Gly Gln Thr

50 55 60

Lys Tyr Val Leu His Lys Val Glu Ala Ile Asp Glu Ala Asn Trp Gly

65 70 75 80

Tyr Asn Tyr Ser Val Val Gly Gly Val Gly Leu Pro Asp Thr Val Glu

85 90 95

Lys Ile Ser Phe Glu Ala Lys Leu Val Glu Gly Ala Ser Gly Gly Ser

100 105 110

Ile Ala Lys Ile Thr Val Lys Tyr Gln Thr Lys Gly Asp Val Asn Pro

115 120 125

Ser Glu Glu Glu Leu Lys Ser Gly Lys Ala Lys Gly Asp Ala Leu Phe

130 135 140

Lys Ala Leu Glu Gly Tyr Val Leu Ala Asn Pro Asp Tyr Asn

145 150 155

<210> 52

<211> 21

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 4

<400> 52

Met Gly Val Phe Thr Phe Glu Asp Glu Ile Asn Ser Pro Val Ala Pro

1 5 10 15

Ala Thr Leu Tyr Lys

20

<210> 53

<211> 6

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 4

<400> 53

Ala Leu Asp Ser Phe Lys

1 5

<210> 54

<211> 15

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 4

<400> 54

Ser Val Glu Asn Val Glu Gly Asn Gly Gly Pro Gly Thr Ile Lys

1 5 10 15

<210> 55

<211> 10

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 4

<400> 55

Ile Thr Phe Leu Glu Asp Gly Glu Thr Lys

1 5 10

<210> 56

<211> 5

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 4

<400> 56

Phe Val Leu His Lys

1 5

<210> 57

<211> 13

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 4

<400> 57

Ala Ile Glu Ala Tyr Leu Leu Ala His Pro Asp Tyr Asn

1 5 10

<210> 58

<211> 19

<212> PRT

<213>Artificial sequence

<220>

<223>Artificial sequence

<400> 58

Tyr Glu Gly Asn Trp Gly Pro Leu Val Asn Pro Glu Ser Gln Gln Gly

1 5 10 15

Ser Pro Arg

<210> 59

<211> 22

<212> PRT

<213>Artificial sequence

<220>

<223>Artificial sequence

<400> 59

Gly Ala Leu Gln Cys Lys Pro Gly Cys Pro Glu Thr Phe Glu Glu Pro

1 5 10 15

Gln Glu Gln Ser Asn Arg

20

<210> 60

<211> 8

<212> PRT

<213>Artificial sequence

<220>

<223>Artificial sequence

<400> 60

Leu Gln Ser Pro Asp Asp Glu Arg

1 5

<210> 61

<211> 621

<212> PRT

<213>Manually

<220>

<223>The consensus sequences of Gly m 5

<400> 61

Met Met Arg Ala Arg Phe Pro Leu Leu Leu Leu Gly Val Val Phe Leu

1 5 10 15

Ala Ser Val Ser Val Ser Phe Gly Ile Ala Tyr Trp Glu Lys Gln Asn

20 25 30

Pro Ser His Asn Lys Cys Leu Gln Ser Cys Asn Ser Glu Lys Asp Ser

35 40 45

Tyr Arg Asn Gln Ala Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu

50 55 60

Glu Glu Glu Glu Cys Glu Glu Gly Gln Ile Pro Arg Pro Arg Pro Gln

65 70 75 80

His Pro Glu Arg Glu Arg Gln Gln His Gly Glu Lys Glu Glu Asp Glu

85 90 95

Gly Glu Gln Pro Arg Pro Phe Pro Phe Pro Arg Pro Arg Gln Pro His

100 105 110

Gln Glu Glu Glu His Glu Gln Lys Glu Glu His Glu Trp His Arg Lys

115 120 125

Glu Glu Lys His Gly Gly Lys Gly Ser Glu Glu Glu Gln Asp Glu Arg

130 135 140

Glu His Pro Arg Pro His Gln Pro His Gln Lys Glu Glu Glu Lys His

145 150 155 160

Glu Trp Gln His Lys Gln Glu Lys His Gln Gly Lys Glu Ser Glu Glu

165 170 175

Glu Glu Glu Asp Gln Asp Glu Asp Glu Glu Gln Asp Lys Glu Ser Gln

180 185 190

Glu Ser Glu Gly Ser Glu Ser Gln Arg Glu Pro Arg Arg His Lys Asn

195 200 205

Lys Asn Pro Phe His Phe Asn Ser Lys Arg Phe Gln Thr Leu Phe Lys

210 215 220

Asn Gln Tyr Gly His Val Arg Val Leu Gln Arg Phe Asn Lys Arg Ser

225 230 235 240

Gln Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser

245 250 255

Lys Pro Asn Thr Leu Leu Leu Pro His His Ala Asp Ala Asp Tyr Leu

260 265 270

Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Thr Leu Val Asn Asn Asp

275 280 285

Asp Arg Asp Ser Tyr Asn Leu Gln Ser Gly Asp Ala Leu Arg Val Pro

290 295 300

Ala Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asp Glu Asn Leu

305 310 315 320

Arg Met Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu

325 330 335

Ser Phe Phe Leu Ser Ser Thr Gln Ala Gln Gln Ser Tyr Leu Gln Gly

340 345 350

Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu

355 360 365

Ile Asn Lys Val Leu Phe Gly Arg Glu Glu Gly Gln Gln Gln Gly Glu

370 375 380

Glu Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Lys Gln Ile

385 390 395 400

Arg Glu Leu Ser Lys Arg Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser

405 410 415

Ser Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser

420 425 430

Asn Lys Leu Gly Lys Leu Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln

435 440 445

Leu Arg Asp Leu Asp Val Phe Leu Ser Val Val Asp Met Asn Glu Gly

450 455 460

Ala Leu Leu Leu Pro His Phe Asn Ser Lys Ala Ile Val Val Leu Val

465 470 475 480

Ile Asn Glu Gly Asp Ala Asn Ile Glu Leu Val Gly Ile Lys Glu Gln

485 490 495

Gln Gln Arg Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr

500 505 510

Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr

515 520 525

Pro Val Val Val Asn Ala Thr Ser Asn Leu Asn Phe Phe Ala Phe Gly

530 535 540

Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Lys Asp

545 550 555 560

Asn Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Pro

565 570 575

Gly Ser Ala Lys Asp Ile Glu Asn Leu Ile Lys Ser Gln Ser Glu Ser

580 585 590

Tyr Phe Val Asp Ala Gln Pro Gln Gln Lys Glu Glu Gly Asn Lys Gly

595 600 605

Arg Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

610 615 620

<210> 62

<211> 600

<212> PRT

<213>Manually

<220>

<223> Gly m 5 ABH09130 BLAST 600aa

<400> 62

Met Phe Gly Ile Val Tyr Trp Glu Lys Gln Asn Pro Ser His Asn Lys

1 5 10 15

Cys Leu Arg Ser Cys Asn Ser Glu Lys Asp Ser Tyr Arg Asn Gln Ala

20 25 30

Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu Glu Glu Glu Glu Cys

35 40 45

Glu Glu Gly Gln Ile Pro Arg Pro Arg Pro Gln His Pro Glu Arg Glu

50 55 60

Arg Gln Gln His Gly Glu Lys Glu Glu Asp Glu Gly Glu Gln Pro Arg

65 70 75 80

Pro Phe Pro Phe Pro Arg Pro Arg Gln Pro His Gln Glu Glu Glu His

85 90 95

Glu Gln Lys Glu Glu His Glu Trp His Arg Lys Glu Glu Lys His Gly

100 105 110

Gly Lys Gly Ser Glu Glu Glu Gln Asp Glu Arg Glu His Pro Arg Pro

115 120 125

His Gln Pro His Gln Lys Glu Glu Glu Lys His Glu Trp Gln His Lys

130 135 140

Gln Glu Lys His Gln Gly Lys Glu Ser Glu Glu Glu Glu Glu Asp Gln

145 150 155 160

Asp Glu Asp Glu Gly Gln Asp Lys Glu Ser Gln Glu Ser Glu Gly Ser

165 170 175

Glu Ser Gln Arg Glu Pro Arg Arg His Lys Asn Lys Asn Pro Phe His

180 185 190

Phe Asn Ser Lys Arg Phe Gln Thr Leu Phe Lys Asn Gln Tyr Gly His

195 200 205

Val Arg Val Leu Gln Arg Phe Asn Lys Arg Ser Gln Gln Leu Gln Asn

210 215 220

Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser Lys Pro Asn Thr Leu

225 230 235 240

Leu Ser Pro Asn His Ala Asp Ala Asp Tyr Leu Ile Val Ile Leu Asn

245 250 255

Gly Thr Ala Ile Leu Thr Leu Val Asn Asn Asp Asp Arg Asp Ser Tyr

260 265 270

Asn Leu Gln Ser Gly Asp Ala Leu Arg Val Pro Ala Gly Thr Thr Tyr

275 280 285

Tyr Val Val Asn Pro Asp Asn Asp Glu Asn Leu Arg Met Ile Thr Leu

290 295 300

Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu Ser Phe Phe Leu Ser

305 310 315 320

Ser Thr Gln Ala Gln Gln Ser Tyr Leu Gln Gly Phe Ser Lys Asn Ile

325 330 335

Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu Ile Asn Lys Val Leu

340 345 350

Phe Gly Arg Glu Glu Gly Gln Gln Gln Gly Glu Glu Arg Leu Gln Glu

355 360 365

Ser Val Ile Val Glu Ile Ser Lys Lys Gln Ile Arg Glu Leu Ser Lys

370 375 380

His Ala Lys Pro Ser Ser Arg Lys Thr Ile Ser Ser Glu Asp Lys Pro

385 390 395 400

Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser Asn Lys Leu Gly Lys

405 410 415

Leu Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln Leu Arg Asp Leu Asp

420 425 430

Val Phe Leu Ser Val Val Asp Met Asn Glu Gly Ala Leu Phe Leu Pro

435 440 445

His Phe Asn Ser Lys Ala Ile Val Val Leu Val Ile Asn Glu Gly Glu

450 455 460

Ala Asn Ile Glu Leu Val Gly Ile Lys Glu Gln Gln Gln Arg Gln Gln

465 470 475 480

Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr Arg Ala Glu Leu Ser

485 490 495

Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr Pro Val Val Val Asn

500 505 510

Ala Thr Ser Asp Leu Asn Phe Phe Ala Phe Gly Ile Asn Ala Glu Asn

515 520 525

Asn Gln Arg Asn Phe Leu Ala Gly Ser Lys Asp Asn Val Ile Ser Gln

530 535 540

Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Pro Gly Ser Ala Lys Asp

545 550 555 560

Ile Glu Asn Leu Ile Lys Ser Gln Ser Glu Ser Tyr Phe Val Asp Ala

565 570 575

Gln Pro Gln Gln Lys Glu Glu Gly Asn Lys Gly Arg Lys Gly Pro Leu

580 585 590

Ser Ser Ile Leu Arg Ala Phe Tyr

595 600

<210> 63

<211> 559

<212> PRT

<213>Manually

<220>

<223> Gly m 5 BAA74452 BLAST 559aa

<400> 63

Val Glu Glu Glu Glu Glu Cys Glu Glu Gly Gln Ile Pro Arg Pro Arg

1 5 10 15

Pro Gln His Pro Glu Arg Glu Arg Gln Gln His Gly Glu Lys Glu Glu

20 25 30

Asp Glu Gly Glu Gln Pro Arg Pro Phe Pro Phe Pro Arg Pro Arg Gln

35 40 45

Pro His Gln Glu Glu Glu His Glu Gln Lys Glu Glu His Glu Trp His

50 55 60

Arg Lys Glu Glu Lys His Gly Gly Lys Gly Ser Glu Glu Glu Gln Asp

65 70 75 80

Glu Arg Glu His Pro Arg Pro His Gln Pro His Gln Lys Glu Glu Glu

85 90 95

Lys His Glu Trp Gln His Lys Gln Glu Lys His Gln Gly Lys Glu Ser

100 105 110

Glu Glu Glu Glu Glu Asp Gln Asp Glu Asp Glu Glu Gln Asp Lys Glu

115 120 125

Ser Gln Glu Ser Glu Gly Ser Glu Ser Gln Arg Glu Pro Arg Arg His

130 135 140

Lys Asn Lys Asn Pro Phe His Phe Asn Ser Lys Arg Phe Gln Thr Leu

145 150 155 160

Phe Lys Asn Gln Tyr Gly His Val Arg Val Leu Gln Arg Phe Asn Lys

165 170 175

Arg Ser Gln Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe

180 185 190

Asn Ser Lys Pro Asn Thr Leu Leu Leu Pro His His Ala Asp Ala Asp

195 200 205

Tyr Leu Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Thr Leu Val Asn

210 215 220

Asn Asp Asp Arg Asp Ser Tyr Asn Leu Gln Ser Gly Asp Ala Leu Arg

225 230 235 240

Val Pro Ala Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asp Glu

245 250 255

Asn Leu Arg Met Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg

260 265 270

Phe Glu Ser Phe Phe Leu Ser Ser Thr Gln Ala Gln Gln Ser Tyr Leu

275 280 285

Gln Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe

290 295 300

Glu Glu Ile Asn Lys Val Leu Phe Gly Arg Glu Glu Gly Gln Gln Gln

305 310 315 320

Gly Glu Glu Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Lys

325 330 335

Gln Ile Arg Glu Leu Ser Lys His Ala Lys Ser Ser Ser Arg Lys Thr

340 345 350

Ile Ser Ser Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile

355 360 365

Tyr Ser Asn Lys Leu Gly Lys Leu Phe Glu Ile Thr Pro Glu Lys Asn

370 375 380

Pro Gln Leu Arg Asp Leu Asp Val Phe Leu Ser Val Val Asp Met Asn

385 390 395 400

Glu Gly Ala Leu Phe Leu Pro His Phe Asn Ser Lys Ala Ile Val Val

405 410 415

Leu Val Ile Asn Glu Gly Glu Ala Asn Ile Glu Leu Val Gly Ile Lys

420 425 430

Glu Gln Gln Gln Arg Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg

435 440 445

Lys Tyr Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala

450 455 460

Gly Tyr Pro Val Val Val Asn Ala Thr Ser Asp Leu Asn Phe Phe Ala

465 470 475 480

Phe Gly Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser

485 490 495

Lys Asp Asn Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala

500 505 510

Phe Pro Gly Ser Ala Lys Asp Ile Glu Asn Leu Ile Lys Ser Gln Ser

515 520 525

Glu Ser Tyr Phe Val Asp Ala Gln Pro Gln Gln Lys Glu Glu Gly Asn

530 535 540

Lys Gly Arg Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

545 550 555

<210> 64

<211> 621

<212> PRT

<213>Manually

<220>

<223> Gly m 5 BAC78524 BLAST 621aa

<400> 64

Met Met Arg Ala Arg Phe Pro Leu Leu Leu Leu Gly Val Val Phe Leu

1 5 10 15

Ala Ser Val Ser Val Ser Phe Gly Ile Ala Tyr Trp Glu Lys Gln Asn

20 25 30

Pro Ser His Asn Lys Cys Leu Arg Ser Cys Asn Ser Glu Lys Asp Ser

35 40 45

Tyr Arg Asn Gln Ala Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu

50 55 60

Glu Glu Glu Glu Cys Glu Glu Gly Gln Ile Pro Arg Pro Arg Pro Gln

65 70 75 80

His Pro Glu Arg Glu Arg Gln Gln His Gly Glu Lys Glu Glu Asp Glu

85 90 95

Gly Glu Gln Pro Arg Pro Phe Pro Phe Pro Arg Pro Arg Gln Pro Arg

100 105 110

Gln Glu Glu Glu His Glu Gln Lys Glu Glu His Glu Trp His Arg Lys

115 120 125

Glu Glu Lys His Gly Gly Lys Gly Ser Glu Glu Glu Gln Asp Glu Arg

130 135 140

Glu His Pro Arg Pro His Gln Pro His Gln Lys Glu Glu Glu Lys His

145 150 155 160

Glu Trp Gln His Lys Gln Glu Lys His Gln Gly Lys Glu Ser Glu Glu

165 170 175

Glu Glu Glu Asp Gln Asp Glu Asp Glu Glu Gln Asp Lys Glu Ser Gln

180 185 190

Glu Ser Glu Gly Ser Glu Ser Gln Arg Glu Pro Arg Arg His Lys Asn

195 200 205

Lys Asn Pro Phe His Phe Asn Ser Lys Arg Phe Gln Thr Leu Phe Lys

210 215 220

Asn Gln Tyr Gly His Val Arg Val Leu Gln Arg Phe Asn Lys Arg Ser

225 230 235 240

Gln Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser

245 250 255

Lys Pro Asn Thr Leu Leu Leu Pro His His Ala Asp Ala Asp Tyr Leu

260 265 270

Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Thr Leu Val Asn Asn Asp

275 280 285

Asp Arg Asp Ser Tyr Asn Leu Gln Ser Gly Asp Ala Leu Arg Val Pro

290 295 300

Ala Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asp Glu Asn Leu

305 310 315 320

Arg Met Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu

325 330 335

Ser Phe Phe Leu Ser Ser Thr Gln Ala Gln Gln Ser Tyr Leu Gln Gly

340 345 350

Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu

355 360 365

Ile Asn Lys Val Leu Phe Gly Arg Glu Glu Gly Gln Gln Gln Gly Glu

370 375 380

Glu Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Lys Gln Ile

385 390 395 400

Arg Glu Leu Ser Lys His Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser

405 410 415

Ser Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser

420 425 430

Asn Lys Leu Gly Lys Leu Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln

435 440 445

Leu Arg Asp Leu Asp Val Phe Leu Ser Val Val Asp Met Asn Glu Gly

450 455 460

Ala Leu Phe Leu Pro His Phe Asn Ser Lys Ala Ile Val Val Leu Val

465 470 475 480

Ile Asn Glu Gly Glu Ala Asn Ile Glu Leu Val Gly Ile Lys Glu Gln

485 490 495

Gln Gln Arg Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr

500 505 510

Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr

515 520 525

Pro Val Val Val Asn Ala Thr Ser Asp Leu Asn Phe Phe Ala Phe Gly

530 535 540

Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Lys Asp

545 550 555 560

Asn Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Pro

565 570 575

Gly Ser Ala Lys Asp Ile Glu Asn Leu Ile Lys Ser Gln Ser Glu Ser

580 585 590

Tyr Phe Val Asp Ala Gln Pro Gln Gln Lys Glu Glu Gly Asn Lys Gly

595 600 605

Arg Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

610 615 620

<210> 65

<211> 439

<212> PRT

<213>Manually

<220>

<223> Gly m 5 Glyma20g28460.1 BLAST 440aa

<400> 65

Met Met Arg Val Arg Phe Pro Leu Leu Val Leu Leu Gly Thr Val Phe

1 5 10 15

Leu Ala Ser Val Cys Val Ser Leu Lys Val Arg Glu Asp Glu Asn Asn

20 25 30

Pro Phe Tyr Leu Arg Ser Ser Asn Ser Phe Gln Thr Leu Phe Glu Asn

35 40 45

Gln Asn Gly Arg Ile Arg Leu Leu Gln Arg Phe Asn Lys Arg Ser Pro

50 55 60

Gln Leu Glu Asn Leu Arg Asp Tyr Arg Ile Val Gln Phe Gln Ser Lys

65 70 75 80

Pro Asn Thr Ile Leu Leu Pro His His Ala Asp Ala Asp Phe Leu Leu

85 90 95

Phe Val Leu Ser Gly Arg Ala Ile Leu Thr Leu Val Asn Asn Asp Asp

100 105 110

Arg Asp Ser Tyr Asn Leu His Pro Gly Asp Ala Gln Arg Ile Pro Ala

115 120 125

Gly Thr Thr Tyr Tyr Leu Val Asn Pro His Asp His Gln Asn Leu Lys

130 135 140

Ile Ile Lys Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Tyr Asp Asp

145 150 155 160

Phe Phe Leu Ser Ser Thr Gln Ala Gln Gln Ser Tyr Leu Gln Gly Phe

165 170 175

Ser His Asn Ile Leu Glu Thr Ser Phe His Ser Glu Phe Glu Glu Ile

180 185 190

Asn Arg Val Leu Phe Gly Glu Glu Glu Glu Gln Arg Gln Gln Glu Gly

195 200 205

Val Ile Val Glu Leu Ser Lys Glu Gln Ile Arg Gln Leu Ser Arg Arg

210 215 220

Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser Ser Glu Asp Glu Pro Phe

225 230 235 240

Asn Leu Arg Ser Arg Asn Pro Ile Tyr Ser Asn Asn Phe Gly Lys Phe

245 250 255

Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln Leu Arg Asp Leu Asp Ile

260 265 270

Phe Leu Ser Ser Val Asp Ile Asn Glu Gly Ala Leu Leu Leu Pro His

275 280 285

Phe Asn Ser Lys Ala Ile Val Ile Leu Val Ile Asn Glu Gly Asp Ala

290 295 300

Asn Ile Glu Leu Val Gly Ile Lys Glu Gln Gln Gln Lys Gln Lys Gln

305 310 315 320

Glu Glu Glu Pro Leu Glu Val Gln Arg Tyr Arg Ala Glu Leu Ser Glu

325 330 335

Asp Asp Val Phe Val Ile Pro Ala Ala Tyr Pro Phe Val Val Asn Ala

340 345 350

Thr Ser Asn Leu Asn Phe Leu Ala Phe Gly Ile Asn Ala Glu Asn Asn

355 360 365

Gln Arg Asn Phe Leu Ala Gly Glu Lys Asp Asn Val Val Arg Gln Ile

370 375 380

Glu Arg Gln Val Gln Glu Leu Ala Phe Pro Gly Ser Ala Gln Asp Val

385 390 395 400

Glu Arg Leu Leu Lys Lys Gln Arg Glu Ser Tyr Phe Val Asp Ala Gln

405 410 415

Pro Gln Gln Lys Glu Glu Gly Ser Lys Gly Arg Lys Gly Pro Phe Pro

420 425 430

Ser Ile Leu Gly Ala Leu Tyr

435

<210> 66

<211> 439

<212> PRT

<213>Manually

<220>

<223> Gly m 5 Ping AAB23463 439aa

<400> 66

Met Met Arg Val Arg Phe Pro Leu Leu Val Leu Leu Gly Thr Val Phe

1 5 10 15

Leu Ala Ser Val Cys Val Ser Leu Lys Val Arg Glu Asp Glu Asn Asn

20 25 30

Pro Phe Tyr Phe Arg Ser Ser Asn Ser Phe Gln Thr Leu Phe Glu Asn

35 40 45

Gln Asn Val Arg Ile Arg Leu Leu Gln Arg Phe Asn Lys Arg Ser Pro

50 55 60

Gln Leu Glu Asn Leu Arg Asp Tyr Arg Ile Val Gln Phe Gln Ser Lys

65 70 75 80

Pro Asn Thr Ile Leu Leu Pro His His Ala Asp Ala Asp Phe Leu Leu

85 90 95

Phe Val Leu Ser Gly Arg Ala Ile Leu Thr Leu Val Asn Asn Asp Asp

100 105 110

Arg Asp Ser Tyr Asn Leu His Pro Gly Asp Ala Gln Arg Ile Pro Ala

115 120 125

Gly Thr Thr Tyr Tyr Leu Val Asn Pro His Asp His Gln Asn Leu Lys

130 135 140

Ile Ile Lys Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Tyr Asp Asp

145 150 155 160

Phe Phe Leu Ser Ser Thr Gln Ala Gln Gln Ser Tyr Leu Gln Gly Phe

165 170 175

Ser His Asn Ile Leu Glu Thr Ser Phe His Ser Glu Phe Glu Glu Ile

180 185 190

Asn Arg Val Leu Phe Gly Glu Glu Glu Glu Gln Arg Gln Gln Glu Gly

195 200 205

Val Ile Val Glu Leu Ser Lys Glu Gln Ile Arg Gln Leu Ser Arg Arg

210 215 220

Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser Ser Glu Asp Glu Pro Phe

225 230 235 240

Asn Leu Arg Ser Arg Asn Pro Ile Tyr Ser Asn Asn Phe Gly Lys Phe

245 250 255

Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln Leu Arg Asp Leu Asp Ile

260 265 270

Phe Leu Ser Ser Val Asp Ile Asn Glu Gly Ala Leu Leu Leu Pro His

275 280 285

Phe Asn Ser Lys Ala Ile Val Ile Leu Val Ile Asn Glu Gly Asp Ala

290 295 300

Asn Ile Glu Leu Val Gly Ile Lys Glu Gln Gln Gln Lys Gln Lys Gln

305 310 315 320

Glu Glu Glu Pro Leu Glu Val Gln Arg Tyr Arg Ala Glu Leu Ser Glu

325 330 335

Asp Asp Val Phe Val Ile Pro Ala Ala Tyr Pro Phe Val Val Asn Ala

340 345 350

Thr Ser Asn Leu Asn Phe Leu Ala Phe Gly Ile Asn Ala Glu Asn Asn

355 360 365

Gln Arg Asn Phe Leu Ala Gly Glu Lys Asp Asn Val Val Arg Gln Ile

370 375 380

Glu Arg Gln Val Gln Glu Leu Ala Phe Pro Gly Ser Ala Gln Asp Val

385 390 395 400

Glu Arg Leu Leu Lys Lys Gln Arg Glu Ser Tyr Phe Val Asp Ala Gln

405 410 415

Pro Gln Gln Lys Glu Glu Gly Ser Lys Gly Arg Lys Gly Pro Phe Pro

420 425 430

Ser Ile Leu Gly Ala Leu Tyr

435

<210> 67

<211> 605

<212> PRT

<213>Manually

<220>

<223> Gly m 5 Glyma20g28650.1 BLAST 606aa

<400> 67

Met Met Arg Ala Arg Phe Pro Leu Leu Leu Leu Gly Leu Val Phe Leu

1 5 10 15

Ala Ser Val Ser Val Ser Phe Gly Ile Ala Tyr Trp Glu Lys Glu Asn

20 25 30

Pro Lys His Asn Lys Cys Leu Gln Ser Cys Asn Ser Glu Arg Asp Ser

35 40 45

Tyr Arg Asn Gln Ala Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu

50 55 60

Lys Glu Glu Cys Glu Glu Gly Glu Ile Pro Arg Pro Arg Pro Arg Pro

65 70 75 80

Gln His Pro Glu Arg Glu Pro Gln Gln Pro Gly Glu Lys Glu Glu Asp

85 90 95

Glu Asp Glu Gln Pro Arg Pro Ile Pro Phe Pro Arg Pro Gln Pro Arg

100 105 110

Gln Glu Glu Glu His Glu Gln Arg Glu Glu Gln Glu Trp Pro Arg Lys

115 120 125

Glu Glu Lys Arg Gly Glu Lys Gly Ser Glu Glu Glu Asp Glu Asp Glu

130 135 140

Asp Glu Glu Gln Asp Glu Arg Gln Phe Pro Phe Pro Arg Pro Pro His

145 150 155 160

Gln Lys Glu Glu Arg Lys Gln Glu Glu Asp Glu Asp Glu Glu Gln Gln

165 170 175

Arg Glu Ser Glu Glu Ser Glu Asp Ser Glu Leu Arg Arg His Lys Asn

180 185 190

Lys Asn Pro Phe Leu Phe Gly Ser Asn Arg Phe Glu Thr Leu Phe Lys

195 200 205

Asn Gln Tyr Gly Arg Ile Arg Val Leu Gln Arg Phe Asn Gln Arg Ser

210 215 220

Pro Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser

225 230 235 240

Lys Pro Asn Thr Leu Leu Leu Pro Asn His Ala Asp Ala Asp Tyr Leu

245 250 255

Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Ser Leu Val Asn Asn Asp

260 265 270

Asp Arg Asp Ser Tyr Arg Leu Gln Ser Gly Asp Ala Leu Arg Val Pro

275 280 285

Ser Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asn Glu Asn Leu

290 295 300

Arg Leu Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu

305 310 315 320

Ser Phe Phe Leu Ser Ser Thr Glu Ala Gln Gln Ser Tyr Leu Gln Gly

325 330 335

Phe Ser Arg Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu

340 345 350

Ile Asn Lys Val Leu Phe Ser Arg Glu Glu Gly Gln Gln Gln Gly Glu

355 360 365

Gln Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Glu Gln Ile

370 375 380

Arg Ala Leu Ser Lys Arg Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser

385 390 395 400

Ser Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser

405 410 415

Asn Lys Leu Gly Lys Phe Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln

420 425 430

Leu Arg Asp Leu Asp Ile Phe Leu Ser Ile Val Asp Met Asn Glu Gly

435 440 445

Ala Leu Leu Leu Pro His Phe Asn Ser Lys Ala Ile Val Ile Leu Val

450 455 460

Ile Asn Glu Gly Asp Ala Asn Ile Glu Leu Val Gly Leu Lys Glu Gln

465 470 475 480

Gln Gln Glu Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr

485 490 495

Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr

500 505 510

Pro Val Val Val Asn Ala Thr Ser Asn Leu Asn Phe Phe Ala Ile Gly

515 520 525

Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Gln Asp

530 535 540

Asn Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Pro

545 550 555 560

Gly Ser Ala Gln Ala Val Glu Lys Leu Leu Lys Asn Gln Arg Glu Ser

565 570 575

Tyr Phe Val Asp Ala Gln Pro Lys Lys Lys Glu Glu Gly Asn Lys Gly

580 585 590

Arg Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

595 600 605

<210> 68

<211> 605

<212> PRT

<213>Manually

<220>

<223> Gly m 5 Glyma20g28660.1 BLAST 606aa

<400> 68

Met Met Arg Ala Arg Phe Pro Leu Leu Leu Leu Gly Leu Val Phe Leu

1 5 10 15

Ala Ser Val Ser Val Ser Phe Gly Ile Ala Tyr Trp Glu Lys Glu Asn

20 25 30

Pro Lys His Asn Lys Cys Leu Gln Ser Cys Asn Ser Glu Arg Asp Ser

35 40 45

Tyr Arg Asn Gln Ala Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu

50 55 60

Lys Glu Glu Cys Glu Glu Gly Glu Ile Pro Arg Pro Arg Pro Arg Pro

65 70 75 80

Gln His Pro Glu Arg Glu Pro Gln Gln Pro Gly Glu Lys Glu Glu Asp

85 90 95

Glu Asp Glu Gln Pro Arg Pro Ile Pro Phe Pro Arg Pro Gln Pro Arg

100 105 110

Gln Glu Glu Glu His Glu Gln Arg Glu Glu Gln Glu Trp Pro Arg Lys

115 120 125

Glu Glu Lys Arg Gly Glu Lys Gly Ser Glu Glu Glu Asp Glu Asp Glu

130 135 140

Asp Glu Glu Gln Asp Glu Arg Gln Phe Pro Phe Pro Arg Pro Pro His

145 150 155 160

Gln Lys Glu Glu Arg Lys Gln Glu Glu Asp Glu Asp Glu Glu Gln Gln

165 170 175

Arg Glu Ser Glu Glu Ser Glu Asp Ser Glu Leu Arg Arg His Lys Asn

180 185 190

Lys Asn Pro Phe Leu Phe Gly Ser Asn Arg Phe Glu Thr Leu Phe Lys

195 200 205

Asn Gln Tyr Gly Arg Ile Arg Val Leu Gln Arg Phe Asn Gln Arg Ser

210 215 220

Pro Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser

225 230 235 240

Lys Pro Asn Thr Leu Leu Leu Pro Asn His Ala Asp Ala Asp Tyr Leu

245 250 255

Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Ser Leu Val Asn Asn Asp

260 265 270

Asp Arg Asp Ser Tyr Arg Leu Gln Ser Gly Asp Ala Leu Arg Val Pro

275 280 285

Ser Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asn Glu Asn Leu

290 295 300

Arg Leu Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu

305 310 315 320

Ser Phe Phe Leu Ser Ser Thr Glu Ala Gln Gln Ser Tyr Leu Gln Gly

325 330 335

Phe Ser Arg Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu

340 345 350

Ile Asn Lys Val Leu Phe Ser Arg Glu Glu Gly Gln Gln Gln Gly Glu

355 360 365

Gln Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Glu Gln Ile

370 375 380

Arg Ala Leu Ser Lys Arg Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser

385 390 395 400

Ser Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser

405 410 415

Asn Lys Leu Gly Lys Phe Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln

420 425 430

Leu Arg Asp Leu Asp Ile Phe Leu Ser Ile Val Asp Met Asn Glu Gly

435 440 445

Ala Leu Leu Leu Pro His Phe Asn Ser Lys Ala Ile Val Ile Leu Val

450 455 460

Ile Asn Glu Gly Asp Ala Asn Ile Glu Leu Val Gly Leu Lys Glu Gln

465 470 475 480

Gln Gln Glu Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr

485 490 495

Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr

500 505 510

Pro Val Val Val Asn Ala Thr Ser Asn Leu Asn Phe Phe Ala Ile Gly

515 520 525

Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Gln Asp

530 535 540

Asn Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Pro

545 550 555 560

Gly Ser Ala Gln Ala Val Glu Lys Leu Leu Lys Asn Gln Arg Glu Ser

565 570 575

Tyr Phe Val Asp Ala Gln Pro Lys Lys Lys Glu Glu Gly Asn Lys Gly

580 585 590

Arg Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

595 600 605

<210> 69

<211> 542

<212> PRT

<213>Manually

<220>

<223> Gly m 5 Glyma20g28650.2 BLAST 543aa

<400> 69

Met Met Arg Ala Arg Phe Pro Leu Leu Leu Leu Gly Leu Val Phe Leu

1 5 10 15

Ala Ser Val Ser Val Ser Phe Gly Ile Ala Tyr Trp Glu Lys Glu Asn

20 25 30

Pro Lys His Asn Lys Cys Leu Gln Ser Cys Asn Ser Glu Arg Asp Ser

35 40 45

Tyr Arg Asn Gln Ala Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu

50 55 60

Lys Glu Glu Cys Glu Glu Gly Glu Ile Pro Arg Pro Arg Pro Arg Pro

65 70 75 80

Gln His Pro Glu Arg Glu Pro Gln Gln Pro Gly Glu Lys Glu Glu Asp

85 90 95

Glu Asp Glu Gln Pro Arg Pro Ile Pro Phe Pro Arg Pro Gln Pro Arg

100 105 110

Gln Glu Glu Glu His Glu Gln Arg Glu Glu Gln Glu Trp Pro Arg Lys

115 120 125

Glu Glu Lys Arg Gly Glu Lys Gly Ser Glu Glu Glu Asp Glu Asp Glu

130 135 140

Asp Glu Glu Gln Asp Glu Arg Gln Phe Pro Phe Pro Arg Pro Pro His

145 150 155 160

Gln Lys Glu Glu Arg Lys Gln Glu Glu Asp Glu Asp Glu Glu Gln Gln

165 170 175

Arg Glu Ser Glu Glu Ser Glu Asp Ser Glu Leu Arg Arg His Lys Asn

180 185 190

Lys Asn Pro Phe Leu Phe Gly Ser Asn Arg Phe Glu Thr Leu Phe Lys

195 200 205

Asn Gln Tyr Gly Arg Ile Arg Val Leu Gln Arg Phe Asn Gln Arg Ser

210 215 220

Pro Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser

225 230 235 240

Lys Pro Asn Thr Leu Leu Leu Pro Asn His Ala Asp Ala Asp Tyr Leu

245 250 255

Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Ser Leu Val Asn Asn Asp

260 265 270

Asp Arg Asp Ser Tyr Arg Leu Gln Ser Gly Asp Ala Leu Arg Val Pro

275 280 285

Ser Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asn Glu Asn Leu

290 295 300

Arg Leu Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu

305 310 315 320

Ser Phe Phe Leu Ser Ser Thr Glu Ala Gln Gln Ser Tyr Leu Gln Gly

325 330 335

Phe Ser Arg Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu

340 345 350

Ile Asn Lys Val Leu Phe Ser Arg Glu Glu Gly Gln Gln Gln Gly Glu

355 360 365

Gln Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Glu Gln Ile

370 375 380

Arg Ala Leu Ser Lys Arg Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser

385 390 395 400

Ser Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser

405 410 415

Asn Lys Leu Gly Lys Phe Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln

420 425 430

Leu Arg Asp Leu Asp Ile Phe Leu Ser Ile Val Asp Met Asn Glu Gly

435 440 445

Ala Leu Leu Leu Pro His Phe Asn Ser Lys Ala Ile Val Ile Leu Val

450 455 460

Ile Asn Glu Gly Asp Ala Asn Ile Glu Leu Val Gly Leu Lys Glu Gln

465 470 475 480

Gln Gln Glu Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr

485 490 495

Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr

500 505 510

Pro Val Val Val Asn Ala Thr Ser Asn Leu Asn Phe Phe Ala Ile Gly

515 520 525

Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ile

530 535 540

<210> 70

<211> 218

<212> PRT

<213>Manually

<220>

<223> Gly m 5 Ping AAA33947 218aa

<400> 70

Ser Lys Arg Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser Ser Glu Asp

1 5 10 15

Lys Pro Phe Asn Leu Gly Ser Arg Asp Pro Ile Tyr Ser Lys Lys Leu

20 25 30

Gly Lys Phe Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln Leu Arg Asp

35 40 45

Leu Asp Ile Phe Leu Ser Ile Val Asp Met Asn Glu Gly Ala Leu Leu

50 55 60

Leu Pro His Phe Asn Ser Lys Ala Ile Val Ile Leu Val Ile Asn Glu

65 70 75 80

Gly Asp Ala Asn Ile Glu Leu Val Gly Leu Lys Glu Gln Gln Gln Glu

85 90 95

Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr Arg Ala Glu

100 105 110

Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr Pro Val Val

115 120 125

Val Asn Ala Thr Ser Asn Leu Asn Phe Phe Ala Ile Gly Ile Asn Ala

130 135 140

Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Gln Asp Asn Val Ile

145 150 155 160

Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Pro Gly Ser Ala

165 170 175

Gln Ala Val Glu Lys Leu Leu Lys Asn Gln Arg Glu Ser Tyr Phe Val

180 185 190

Asp Ala Gln Pro Asn Glu Lys Glu Glu Gly Asn Lys Gly Arg Lys Gly

195 200 205

Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

210 215

<210> 71

<211> 621

<212> PRT

<213>Manually

<220>

<223> Gly m 5 NP_001237316 BLAST 621aa

<400> 71

Met Met Arg Ala Arg Phe Pro Leu Leu Leu Leu Gly Val Val Phe Leu

1 5 10 15

Ala Ser Val Ser Val Ser Phe Gly Ile Ala Tyr Trp Glu Lys Gln Asn

20 25 30

Pro Ser His Asn Lys Cys Leu Arg Ser Cys Asn Ser Glu Lys Asp Ser

35 40 45

Tyr Arg Asn Gln Ala Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu

50 55 60

Glu Glu Glu Glu Cys Glu Glu Gly Gln Ile Pro Arg Pro Arg Pro Gln

65 70 75 80

His Pro Glu Arg Glu Arg Gln Gln His Gly Glu Lys Glu Glu Asp Glu

85 90 95

Gly Glu Gln Pro Arg Pro Phe Pro Phe Pro Arg Pro Arg Gln Pro Arg

100 105 110

Gln Glu Gly Glu His Glu Gln Lys Glu Glu His Glu Trp His Arg Lys

115 120 125

Glu Glu Lys His Gly Gly Lys Gly Ser Glu Glu Glu Gln Asp Gly Arg

130 135 140

Glu His Pro Arg Pro His Gln Pro His Gln Lys Glu Glu Glu Lys His

145 150 155 160

Glu Trp Gln His Lys Gln Glu Lys His Gln Gly Lys Glu Ser Glu Glu

165 170 175

Glu Glu Glu Asp Gln Asp Glu Asp Glu Glu Gln Asp Lys Glu Ser Gln

180 185 190

Glu Ser Glu Gly Ser Glu Ser Gln Arg Glu Pro Arg Arg His Lys Asn

195 200 205

Lys Asn Pro Phe His Phe Asn Ser Lys Arg Phe Gln Thr Leu Phe Lys

210 215 220

Asn Gln Tyr Gly His Val Arg Val Leu Gln Arg Phe Asn Lys Arg Ser

225 230 235 240

Gln Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser

245 250 255

Lys Pro Asn Thr Leu Leu Leu Pro His His Ala Asp Ala Asp Tyr Leu

260 265 270

Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Thr Leu Val Asn Asn Asp

275 280 285

Asp Arg Asp Ser Tyr Asn Leu Gln Ser Gly Asp Ala Leu Arg Val Pro

290 295 300

Ala Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asp Glu Asn Leu

305 310 315 320

Arg Met Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu

325 330 335

Ser Phe Phe Leu Ser Ser Thr Gln Ala Gln Gln Ser Tyr Leu Gln Gly

340 345 350

Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu

355 360 365

Ile Asn Lys Val Leu Phe Gly Arg Glu Glu Gly Gln Gln Gln Gly Glu

370 375 380

Glu Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Lys Gln Ile

385 390 395 400

Arg Glu Leu Ser Lys Arg Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser

405 410 415

Ser Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser

420 425 430

Asn Lys Leu Gly Lys Leu Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln

435 440 445

Leu Arg Asp Leu Asp Val Phe Leu Ser Val Val Asp Met Asn Glu Gly

450 455 460

Ala Leu Phe Leu Pro His Phe Asn Ser Lys Ala Ile Val Val Leu Val

465 470 475 480

Ile Asn Glu Gly Glu Ala Asn Ile Glu Leu Val Gly Ile Lys Glu Gln

485 490 495

Gln Gln Arg Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr

500 505 510

Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr

515 520 525

Pro Val Val Val Asn Ala Thr Ser Asp Leu Asn Phe Phe Ala Phe Gly

530 535 540

Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Lys Asp

545 550 555 560

Asn Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Leu

565 570 575

Gly Ser Ala Lys Asp Ile Glu Asn Leu Ile Lys Ser Gln Ser Glu Ser

580 585 590

Tyr Phe Val Asp Ala Gln Pro Gln Gln Lys Glu Glu Gly Asn Lys Gly

595 600 605

Arg Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

610 615 620

<210> 72

<211> 621

<212> PRT

<213>Manually

<220>

<223> Gly m 5 BAE02726 BLAST 621aa

<400> 72

Met Met Arg Ala Arg Phe Pro Leu Leu Leu Leu Gly Val Val Phe Leu

1 5 10 15

Ala Ser Val Ser Val Ser Phe Gly Ile Ala Tyr Trp Glu Lys Gln Asn

20 25 30

Pro Ser His Asn Lys Cys Leu Arg Ser Cys Asn Ser Glu Lys Asp Ser

35 40 45

Tyr Arg Asn Gln Ala Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu

50 55 60

Glu Glu Glu Glu Cys Glu Glu Gly Gln Ile Pro Arg Pro Arg Pro Gln

65 70 75 80

His Pro Glu Arg Glu Arg Gln Gln His Gly Glu Lys Glu Glu Asp Glu

85 90 95

Gly Glu Gln Pro Arg Pro Phe Pro Phe Pro Arg Pro Arg Gln Pro His

100 105 110

Gln Glu Glu Glu His Glu Gln Lys Glu Glu His Glu Trp His Arg Lys

115 120 125

Glu Glu Lys His Gly Gly Lys Gly Ser Glu Glu Glu Gln Asp Glu Arg

130 135 140

Glu His Pro Arg Pro His Gln Pro His Gln Lys Glu Glu Glu Lys His

145 150 155 160

Glu Trp Gln His Lys Gln Glu Lys His Gln Gly Lys Glu Ser Glu Glu

165 170 175

Glu Glu Glu Asp Gln Asp Glu Asp Glu Glu Gln Asp Lys Glu Ser Gln

180 185 190

Glu Ser Glu Gly Ser Glu Ser Gln Arg Glu Pro Arg Arg His Lys Asn

195 200 205

Lys Asn Pro Phe His Phe Asn Ser Lys Arg Phe Gln Thr Leu Phe Lys

210 215 220

Asn Gln Tyr Gly His Val Arg Val Leu Gln Arg Phe Asn Lys Arg Ser

225 230 235 240

Gln Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser

245 250 255

Lys Pro Asn Thr Leu Leu Leu Pro His His Ala Asp Ala Asp Tyr Leu

260 265 270

Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Thr Leu Val Asn Asn Asp

275 280 285

Asp Arg Asp Ser Tyr Asn Leu Gln Ser Gly Asp Ala Leu Arg Val Pro

290 295 300

Ala Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asp Glu Asn Leu

305 310 315 320

Arg Met Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu

325 330 335

Ser Phe Phe Leu Ser Ser Thr Gln Ala Gln Gln Ser Tyr Leu Gln Gly

340 345 350

Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu

355 360 365

Ile Asn Lys Val Leu Phe Gly Arg Glu Glu Gly Gln Gln Gln Gly Glu

370 375 380

Glu Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Lys Gln Ile

385 390 395 400

Arg Glu Leu Ser Lys His Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser

405 410 415

Ser Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser

420 425 430

Asn Lys Leu Gly Lys Leu Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln

435 440 445

Leu Arg Asp Leu Asp Val Phe Leu Ser Val Val Asp Met Asn Glu Gly

450 455 460

Ala Leu Phe Leu Pro His Phe Asn Ser Lys Ala Ile Val Val Leu Val

465 470 475 480

Ile Asn Glu Gly Glu Ala Asn Ile Glu Leu Val Gly Ile Lys Glu Gln

485 490 495

Gln Gln Arg Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr

500 505 510

Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr

515 520 525

Pro Val Val Val Asn Ala Thr Ser Asp Leu Asn Phe Phe Ala Phe Gly

530 535 540

Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Lys Asp

545 550 555 560

Asn Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Pro

565 570 575

Gly Ser Ala Lys Asp Ile Glu Asn Leu Ile Lys Ser Gln Ser Glu Ser

580 585 590

Tyr Phe Val Asp Ala Gln Pro Gln Gln Lys Glu Glu Gly Asn Lys Gly

595 600 605

Arg Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

610 615 620

<210> 73

<211> 639

<212> PRT

<213>Manually

<220>

<223> Gly m 5 Ping AAB01374 639aa

<400> 73

Met Met Arg Ala Arg Phe Pro Leu Leu Leu Leu Gly Val Val Phe Leu

1 5 10 15

Ala Ser Val Ser Val Ser Phe Gly Ile Ala Tyr Trp Glu Lys Gln Asn

20 25 30

Pro Ser His Asn Lys Cys Leu Arg Ser Cys Asn Ser Glu Lys Asp Ser

35 40 45

Tyr Arg Asn Gln Ala Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu

50 55 60

Glu Glu Glu Glu Cys Glu Glu Gly Gln Ile Pro Arg Pro Arg Pro Gln

65 70 75 80

His Pro Glu Arg Glu Arg Gln Gln His Gly Glu Lys Glu Glu Asp Glu

85 90 95

Gly Glu Gln Pro Arg Pro Phe Pro Phe Pro Arg Pro Arg Gln Pro His

100 105 110

Gln Glu Glu Glu His Glu Gln Lys Glu Glu His Glu Trp His Arg Lys

115 120 125

Glu Glu Lys His Gly Gly Lys Gly Ser Glu Glu Glu Gln Asp Glu Arg

130 135 140

Glu His Pro Arg Pro His Gln Pro His Gln Lys Glu Glu Glu Lys His

145 150 155 160

Glu Trp Gln His Lys Gln Glu Lys His Gln Gly Lys Glu Ser Glu Glu

165 170 175

Glu Glu Glu Asp Gln Asp Glu Asp Glu Glu Gln Asp Lys Glu Ser Gln

180 185 190

Glu Ser Glu Gly Ser Glu Ser Gln Arg Glu Pro Arg Arg His Lys Asn

195 200 205

Lys Asn Pro Phe His Phe Asn Ser Lys Arg Phe Gln Thr Leu Phe Lys

210 215 220

Asn Gln Tyr Gly His Val Arg Val Leu Gln Arg Phe Asn Lys Arg Ser

225 230 235 240

Gln Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser

245 250 255

Lys Pro Asn Thr Leu Leu Leu Pro His His Ala Asp Ala Asp Tyr Leu

260 265 270

Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Thr Leu Val Asn Asn Asp

275 280 285

Asp Arg Asp Ser Tyr Asn Leu Gln Ser Gly Asp Ala Leu Arg Val Pro

290 295 300

Ala Gly Thr Thr Phe Tyr Val Val Asn Pro Asp Asn Asp Glu Asn Leu

305 310 315 320

Arg Met Ile Ala Gly Thr Thr Phe Tyr Val Val Asn Pro Asp Asn Asp

325 330 335

Glu Asn Leu Arg Met Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly

340 345 350

Arg Phe Glu Ser Phe Phe Leu Ser Ser Thr Gln Ala Gln Gln Ser Tyr

355 360 365

Leu Gln Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys

370 375 380

Phe Glu Glu Ile Asn Lys Val Leu Phe Gly Arg Glu Glu Gly Gln Gln

385 390 395 400

Gln Gly Glu Glu Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys

405 410 415

Lys Gln Ile Arg Glu Leu Ser Lys His Ala Lys Ser Ser Ser Arg Lys

420 425 430

Thr Ile Ser Ser Glu Asp Lys Pro Phe Asn Leu Gly Ser Arg Asp Pro

435 440 445

Ile Tyr Ser Asn Lys Leu Gly Lys Leu Phe Glu Ile Thr Gln Arg Asn

450 455 460

Pro Gln Leu Arg Asp Leu Asp Val Phe Leu Ser Val Val Asp Met Asn

465 470 475 480

Glu Gly Ala Leu Phe Leu Pro His Phe Asn Ser Lys Ala Ile Val Val

485 490 495

Leu Val Ile Asn Glu Gly Glu Ala Asn Ile Glu Leu Val Gly Ile Lys

500 505 510

Glu Gln Gln Gln Arg Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg

515 520 525

Lys Tyr Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala

530 535 540

Gly Tyr Pro Val Met Val Asn Ala Thr Ser Asp Leu Asn Phe Phe Ala

545 550 555 560

Phe Gly Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser

565 570 575

Lys Asp Asn Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala

580 585 590

Phe Pro Arg Ser Ala Lys Asp Ile Glu Asn Leu Ile Lys Ser Gln Ser

595 600 605

Glu Ser Tyr Phe Val Asp Ala Gln Pro Gln Gln Lys Glu Glu Gly Asn

610 615 620

Lys Gly Arg Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

625 630 635

<210> 74

<211> 621

<212> PRT

<213>Manually

<220>

<223> Gly m 5 Glyma10g39150.1 BLAST 622aa

<400> 74

Met Met Arg Ala Arg Phe Pro Leu Leu Leu Leu Gly Val Val Phe Leu

1 5 10 15

Ala Ser Val Ser Val Ser Phe Gly Ile Ala Tyr Trp Glu Lys Gln Asn

20 25 30

Pro Ser His Asn Lys Cys Leu Arg Ser Cys Asn Ser Glu Lys Asp Ser

35 40 45

Tyr Arg Asn Gln Ala Cys His Ala Arg Cys Asn Leu Leu Lys Val Glu

50 55 60

Glu Glu Glu Glu Cys Glu Glu Gly Gln Ile Pro Arg Pro Arg Pro Gln

65 70 75 80

His Pro Glu Arg Glu Arg Gln Gln His Gly Glu Lys Glu Glu Asp Glu

85 90 95

Gly Glu Gln Pro Arg Pro Phe Pro Phe Pro Arg Pro Arg Gln Pro His

100 105 110

Gln Glu Glu Glu His Glu Gln Lys Glu Glu His Glu Trp His Arg Lys

115 120 125

Glu Glu Lys His Gly Gly Lys Gly Ser Glu Glu Glu Gln Asp Glu Arg

130 135 140

Glu His Pro Arg Pro His Gln Pro His Gln Lys Glu Glu Glu Lys His

145 150 155 160

Glu Trp Gln His Lys Gln Glu Lys His Gln Gly Lys Glu Ser Glu Glu

165 170 175

Glu Glu Glu Asp Gln Asp Glu Asp Glu Glu Gln Asp Lys Glu Ser Gln

180 185 190

Glu Ser Glu Gly Ser Glu Ser Gln Arg Glu Pro Arg Arg His Lys Asn

195 200 205

Lys Asn Pro Phe His Phe Asn Ser Lys Arg Phe Gln Thr Leu Phe Lys

210 215 220

Asn Gln Tyr Gly His Val Arg Val Leu Gln Arg Phe Asn Lys Arg Ser

225 230 235 240

Gln Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser

245 250 255

Lys Pro Asn Thr Leu Leu Leu Pro His His Ala Asp Ala Asp Tyr Leu

260 265 270

Ile Val Ile Leu Asn Gly Thr Ala Ile Leu Thr Leu Val Asn Asn Asp

275 280 285

Asp Arg Asp Ser Tyr Asn Leu Gln Ser Gly Asp Ala Leu Arg Val Pro

290 295 300

Ala Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asp Glu Asn Leu

305 310 315 320

Arg Met Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu

325 330 335

Ser Phe Phe Leu Ser Ser Thr Gln Ala Gln Gln Ser Tyr Leu Gln Gly

340 345 350

Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu

355 360 365

Ile Asn Lys Val Leu Phe Gly Arg Glu Glu Gly Gln Gln Gln Gly Glu

370 375 380

Glu Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Lys Gln Ile

385 390 395 400

Arg Glu Leu Ser Lys His Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser

405 410 415

Ser Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser

420 425 430

Asn Lys Leu Gly Lys Leu Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln

435 440 445

Leu Arg Asp Leu Asp Val Phe Leu Ser Val Val Asp Met Asn Glu Gly

450 455 460

Ala Leu Phe Leu Pro His Phe Asn Ser Lys Ala Ile Val Val Leu Val

465 470 475 480

Ile Asn Glu Gly Glu Ala Asn Ile Glu Leu Val Gly Ile Lys Glu Gln

485 490 495

Gln Gln Arg Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr

500 505 510

Arg Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr

515 520 525

Pro Val Val Val Asn Ala Thr Ser Asp Leu Asn Phe Phe Ala Phe Gly

530 535 540

Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Lys Asp

545 550 555 560

Asn Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Pro

565 570 575

Gly Ser Ala Lys Asp Ile Glu Asn Leu Ile Lys Ser Gln Ser Glu Ser

580 585 590

Tyr Phe Val Asp Ala Gln Pro Gln Gln Lys Glu Glu Gly Asn Lys Gly

595 600 605

Arg Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr

610 615 620

<210> 75

<211> 5

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 75

Cys Asn Leu Leu Lys

1 5

<210> 76

<211> 19

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 76

Glu Glu Asp Glu Asp Glu Gln Pro Arg Pro Ile Pro Phe Pro Arg Pro

1 5 10 15

Gln Pro Arg

<210> 77

<211> 7

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 77

Glu Glu Gln Glu Trp Pro Arg

1 5

<210> 78

<211> 11

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 78

Gln Phe Pro Phe Pro Arg Pro Pro His Gln Lys

1 5 10

<210> 79

<211> 11

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 79

Glu Ser Glu Glu Ser Glu Asp Ser Glu Leu Arg

1 5 10

<210> 80

<211> 9

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 80

Asn Pro Phe Leu Phe Gly Ser Asn Arg

1 5

<210> 81

<211> 6

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 81

Phe Glu Thr Leu Phe Lys

1 5

<210> 82

<211> 8

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 82

Ser Pro Gln Leu Gln Asn Leu Arg

1 5

<210> 83

<211> 8

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 83

Leu Gln Ser Gly Asp Ala Leu Arg

1 5

<210> 84

<211> 19

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 84

Val Pro Ser Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asn Glu

1 5 10 15

Asn Leu Arg

<210> 85

<211> 21

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 85

Phe Glu Ser Phe Phe Leu Ser Ser Thr Glu Ala Gln Gln Ser Tyr Leu

1 5 10 15

Gln Gly Phe Ser Arg

20

<210> 86

<211> 6

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 86

Phe Glu Glu Ile Asn Lys

1 5

<210> 87

<211> 5

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 87

Val Leu Phe Ser Arg

1 5

<210> 88

<211> 12

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 88

Thr Ile Ser Ser Glu Asp Lys Pro Phe Asn Leu Arg

1 5 10

<210> 89

<211> 7

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 89

Asp Pro Ile Tyr Ser Asn Lys

1 5

<210> 90

<211> 8

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 90

Phe Phe Glu Ile Thr Pro Glu Lys

1 5

<210> 91

<211> 20

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 91

Ala Ile Val Ile Leu Val Ile Asn Glu Gly Asp Ala Asn Ile Glu Leu

1 5 10 15

Val Gly Leu Lys

20

<210> 92

<211> 16

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 92

Glu Gln Gln Gln Glu Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg

1 5 10 15

<210> 93

<211> 32

<212> PRT

<213>Artificial sequence

<220>

<223>Artificial sequence

<400> 93

Asn Phe Leu Ala Gly Ser Gln Asp Asn Val Ile Ser Gln Ile Pro Ser

1 5 10 15

Gln Val Gln Glu Leu Ala Phe Pro Gly Ser Ala Gln Ala Val Glu Lys

20 25 30

<210> 94

<211> 10

<212> PRT

<213>Manually

<220>

<223>The feature peptides of Gly m 5

<400> 94

Glu Ser Tyr Phe Val Asp Ala Gln Pro Lys

1 5 10

<210> 95

<211> 495

<212> PRT

<213>Manually

<220>

<223> Gly m 6 G1 Ping CAA26723.1 495aa

<400> 95

Met Ala Lys Leu Val Phe Ser Leu Cys Phe Leu Leu Phe Ser Gly Cys

1 5 10 15

Cys Phe Ala Phe Ser Ser Arg Glu Gln Pro Gln Gln Asn Glu Cys Gln

20 25 30

Ile Gln Lys Leu Asn Ala Leu Lys Pro Gly Asn Arg Ile Glu Ser Glu

35 40 45

Gly Gly Leu Ile Glu Thr Trp Asn Pro Asn Asn Lys Pro Phe Gln Cys

50 55 60

Ala Gly Val Ala Leu Ser Arg Cys Thr Leu Asn Arg Asn Ala Leu Arg

65 70 75 80

Arg Pro Ser Tyr Thr Asn Gly Pro Gln Glu Ile Tyr Ile Gln Gln Gly

85 90 95

Lys Gly Ile Phe Gly Met Ile Tyr Pro Gly Cys Ser Ser Thr Phe Glu

100 105 110

Glu Pro Gln Gln Pro Gln Gln Arg Gly Gln Ser Ser Arg Pro Gln Asp

115 120 125

Arg His Gln Lys Ile Tyr Asn Ser Arg Glu Gly Asp Leu Ile Ala Val

130 135 140

Pro Thr Gly Val Ala Trp Trp Met Tyr Asn Asn Glu Asp Thr Pro Val

145 150 155 160

Val Ala Val Ser Ile Ile Asp Thr Asn Ser Leu Glu Asn Gln Leu Asp

165 170 175

Gln Met Pro Arg Arg Phe Tyr Leu Ala Gly Asn Gln Glu Gln Glu Phe

180 185 190

Leu Lys Tyr Gln Gln Glu Gln Gly Gly His Gln Ser Gln Lys Gly Lys

195 200 205

His Gln Gln Glu Glu Glu Asn Glu Gly Gly Ser Ile Leu Ser Gly Phe

210 215 220

Thr Leu Glu Phe Leu Glu His Ala Phe Ser Val Asp Lys Gln Ile Ala

225 230 235 240

Lys Asn Leu Gln Gly Glu Asn Glu Gly Glu Asp Lys Gly Ala Ile Val

245 250 255

Thr Val Lys Gly Gly Leu Ser Val Ile Lys Pro Pro Thr Asp Glu Gln

260 265 270

Gln Gln Arg Pro Gln Glu Glu Glu Glu Glu Glu Glu Asp Glu Lys Pro

275 280 285

Gln Cys Lys Gly Lys Asp Lys His Cys Gln Arg Pro Arg Gly Ser Gln

290 295 300

Ser Lys Ser Arg Arg Asn Gly Ile Asp Glu Thr Ile Cys Thr Met Arg

305 310 315 320

Leu Arg His Asn Ile Gly Gln Thr Ser Ser Pro Asp Ile Tyr Asn Pro

325 330 335

Gln Ala Gly Ser Val Thr Thr Ala Thr Ser Leu Asp Phe Pro Ala Leu

340 345 350

Ser Trp Leu Arg Leu Ser Ala Gly Phe Gly Ser Leu Arg Lys Asn Ala

355 360 365

Met Phe Val Pro His Tyr Asn Leu Asn Ala Asn Ser Ile Ile Tyr Ala

370 375 380

Leu Asn Gly Arg Ala Leu Ile Gln Val Val Asn Cys Asn Gly Glu Arg

385 390 395 400

Val Phe Asp Gly Glu Leu Gln Glu Gly Arg Val Leu Ile Val Pro Gln

405 410 415

Asn Phe Val Val Ala Ala Arg Ser Gln Ser Asp Asn Phe Glu Tyr Val

420 425 430

Ser Phe Lys Thr Asn Asp Thr Pro Met Ile Gly Thr Leu Ala Gly Ala

435 440 445

Asn Ser Leu Leu Asn Ala Leu Pro Glu Glu Val Ile Gln His Thr Phe

450 455 460

Asn Leu Lys Ser Gln Gln Ala Arg Gln Ile Lys Asn Asn Asn Pro Phe

465 470 475 480

Lys Phe Leu Val Pro Pro Gln Glu Ser Gln Lys Arg Ala Val Ala

485 490 495

<210> 96

<211> 20

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 96

Leu Val Phe Ser Leu Cys Phe Leu Leu Phe Ser Gly Cys Cys Phe Ala

1 5 10 15

Phe Ser Ser Arg

20

<210> 97

<211> 12

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 97

Glu Gln Pro Gln Gln Asn Glu Cys Gln Ile Gln Lys

1 5 10

<210> 98

<211> 17

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 98

Arg Pro Ser Tyr Thr Asn Gly Pro Gln Glu Ile Tyr Ile Gln Gln Gly

1 5 10 15

Lys

<210> 99

<211> 29

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 99

His Gln Gln Glu Glu Glu Asn Glu Gly Gly Ser Ile Leu Ser Gly Phe

1 5 10 15

Thr Leu Glu Phe Leu Glu His Ala Phe Ser Val Asp Lys

20 25

<210> 100

<211> 6

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 100

His Cys Gln Arg Pro Arg

1 5

<210> 101

<211> 34

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 101

His Asn Ile Gly Gln Thr Ser Ser Pro Asp Ile Tyr Asn Pro Gln Ala

1 5 10 15

Gly Ser Val Thr Thr Ala Thr Ser Leu Asp Phe Pro Ala Leu Ser Trp

20 25 30

Leu Arg

<210> 102

<211> 12

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 102

Ala Leu Ile Gln Val Val Asn Cys Asn Gly Glu Arg

1 5 10

<210> 103

<211> 10

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 103

Val Phe Asp Gly Glu Leu Gln Glu Gly Arg

1 5 10

<210> 104

<211> 32

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 104

Thr Asn Asp Thr Pro Met Ile Gly Thr Leu Ala Gly Ala Asn Ser Leu

1 5 10 15

Leu Asn Ala Leu Pro Glu Glu Val Ile Gln His Thr Phe Asn Leu Lys

20 25 30

<210> 105

<211> 6

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 105

Asn Asn Asn Pro Phe Lys

1 5

<210> 106

<211> 10

<212> PRT

<213>Manually

<220>

<223>The G1 feature peptides of Gly m 6

<400> 106

Phe Leu Val Pro Pro Gln Glu Ser Gln Lys

1 5 10

<210> 107

<211> 485

<212> PRT

<213>Manually

<220>

<223> Gly m 6 G2 Ping CAA26575.1 485aa

<400> 107

Met Ala Lys Leu Val Leu Ser Leu Cys Phe Leu Leu Phe Ser Gly Cys

1 5 10 15

Phe Ala Leu Arg Glu Gln Ala Gln Gln Asn Glu Cys Gln Ile Gln Lys

20 25 30

Leu Asn Ala Leu Lys Pro Gly Asn Arg Ile Glu Ser Glu Gly Gly Phe

35 40 45

Ile Glu Thr Trp Asn Pro Asn Asn Lys Pro Phe Gln Cys Ala Gly Val

50 55 60

Ala Leu Ser Arg Cys Thr Leu Asn Arg Asn Ala Leu Arg Arg Pro Ser

65 70 75 80

Tyr Thr Asn Gly Pro Gln Glu Ile Tyr Ile Gln Gln Gly Asn Gly Ile

85 90 95

Phe Gly Met Ile Phe Pro Gly Cys Pro Ser Thr Tyr Gln Glu Pro Gln

100 105 110

Glu Ser Gln Gln Arg Gly Arg Ser Gln Arg Pro Gln Asp Arg His Gln

115 120 125

Lys Val His Arg Phe Arg Glu Gly Asp Leu Ile Ala Val Pro Thr Gly

130 135 140

Val Ala Trp Trp Met Tyr Asn Asn Glu Asp Thr Pro Val Val Ala Val

145 150 155 160

Ser Ile Ile Asp Thr Asn Ser Leu Glu Asn Gln Leu Asp Gln Met Pro

165 170 175

Arg Arg Phe Tyr Leu Ala Gly Asn Gln Glu Gln Glu Phe Leu Lys Tyr

180 185 190

Gln Gln Gln Gln Gln Gly Gly Ser Gln Ser Gln Lys Gly Lys Gln Gln

195 200 205

Glu Glu Glu Asn Glu Gly Ser Asn Ile Leu Ser Gly Phe Ala Pro Glu

210 215 220

Phe Leu Lys Glu Ala Phe Gly Val Asn Met Gln Ile Val Arg Asn Leu

225 230 235 240

Gln Gly Glu Asn Glu Glu Glu Asp Ser Gly Ala Ile Val Thr Val Lys

245 250 255

Gly Gly Leu Arg Val Thr Ala Pro Ala Met Arg Lys Pro Gln Gln Glu

260 265 270

Glu Asp Asp Asp Asp Glu Glu Glu Gln Pro Gln Cys Val Glu Thr Asp

275 280 285

Lys Gly Cys Gln Arg Gln Ser Lys Arg Ser Arg Asn Gly Ile Asp Glu

290 295 300

Thr Ile Cys Thr Met Arg Leu Arg Gln Asn Ile Gly Gln Asn Ser Ser

305 310 315 320

Pro Asp Ile Tyr Asn Pro Gln Ala Gly Ser Ile Thr Thr Ala Thr Ser

325 330 335

Leu Asp Phe Pro Ala Leu Trp Leu Leu Lys Leu Ser Ala Gln Tyr Gly

340 345 350

Ser Leu Arg Lys Asn Ala Met Phe Val Pro His Tyr Thr Leu Asn Ala

355 360 365

Asn Ser Ile Ile Tyr Ala Leu Asn Gly Arg Ala Leu Val Gln Val Val

370 375 380

Asn Cys Asn Gly Glu Arg Val Phe Asp Gly Glu Leu Gln Glu Gly Gly

385 390 395 400

Val Leu Ile Val Pro Gln Asn Phe Ala Val Ala Ala Lys Ser Gln Ser

405 410 415

Asp Asn Phe Glu Tyr Val Ser Phe Lys Thr Asn Asp Arg Pro Ser Ile

420 425 430

Gly Asn Leu Ala Gly Ala Asn Ser Leu Leu Asn Ala Leu Pro Glu Glu

435 440 445

Val Ile Gln His Thr Phe Asn Leu Lys Ser Gln Gln Ala Arg Gln Val

450 455 460

Lys Asn Asn Asn Pro Phe Ser Phe Leu Val Pro Pro Gln Glu Ser Gln

465 470 475 480

Arg Arg Ala Val Ala

485

<210> 108

<211> 17

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 108

Leu Val Leu Ser Leu Cys Phe Leu Leu Phe Ser Gly Cys Phe Ala Leu

1 5 10 15

Arg

<210> 109

<211> 12

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 109

Glu Gln Ala Gln Gln Asn Glu Cys Gln Ile Gln Lys

1 5 10

<210> 110

<211> 40

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 110

Arg Pro Ser Tyr Thr Asn Gly Pro Gln Glu Ile Tyr Ile Gln Gln Gly

1 5 10 15

Asn Gly Ile Phe Gly Met Ile Phe Pro Gly Cys Pro Ser Thr Tyr Gln

20 25 30

Glu Pro Gln Glu Ser Gln Gln Arg

35 40

<210> 111

<211> 7

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 111

Ser Gln Arg Pro Gln Asp Arg

1 5

<210> 112

<211> 21

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 112

Gln Gln Glu Glu Glu Asn Glu Gly Ser Asn Ile Leu Ser Gly Phe Ala

1 5 10 15

Pro Glu Phe Leu Lys

20

<210> 113

<211> 11

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 113

Glu Ala Phe Gly Val Asn Met Gln Ile Val Arg

1 5 10

<210> 114

<211> 22

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 114

Lys Pro Gln Gln Glu Glu Asp Asp Asp Asp Glu Glu Glu Gln Pro Gln

1 5 10 15

Cys Val Glu Thr Asp Lys

20

<210> 115

<211> 9

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 115

Leu Ser Ala Gln Tyr Gly Ser Leu Arg

1 5

<210> 116

<211> 22

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 116

Asn Ala Met Phe Val Pro His Tyr Thr Leu Asn Ala Asn Ser Ile Ile

1 5 10 15

Tyr Ala Leu Asn Gly Arg

20

<210> 117

<211> 12

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 117

Ala Leu Val Gln Val Val Asn Cys Asn Gly Glu Arg

1 5 10

<210> 118

<211> 23

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 118

Val Phe Asp Gly Glu Leu Gln Glu Gly Gly Val Leu Ile Val Pro Gln

1 5 10 15

Asn Phe Ala Val Ala Ala Lys

20

<210> 119

<211> 32

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 119

Thr Asn Asp Arg Pro Ser Ile Gly Asn Leu Ala Gly Ala Asn Ser Leu

1 5 10 15

Leu Asn Ala Leu Pro Glu Glu Val Ile Gln His Thr Phe Asn Leu Lys

20 25 30

<210> 120

<211> 16

<212> PRT

<213>Manually

<220>

<223>The G2 feature peptides of Gly m 6

<400> 120

Asn Asn Asn Pro Phe Ser Phe Leu Val Pro Pro Gln Glu Ser Gln Arg

1 5 10 15

<210> 121

<211> 20

<212> PRT

<213>Manually

<220>

<223>The G3 feature peptides of Gly m 6

<400> 121

Leu Val Leu Ser Leu Cys Phe Leu Leu Phe Ser Gly Cys Cys Phe Ala

1 5 10 15

Phe Ser Phe Arg

20

<210> 122

<211> 12

<212> PRT

<213>Manually

<220>

<223>The G3 feature peptides of Gly m 6

<400> 122

Glu Gln Pro Gln Gln Asn Glu Cys Gln Ile Gln Arg

1 5 10

<210> 123

<211> 28

<212> PRT

<213>Manually

<220>

<223>The G3 feature peptides of Gly m 6

<400> 123

Gln Gln Glu Glu Glu Asn Glu Gly Gly Ser Ile Leu Ser Gly Phe Ala

1 5 10 15

Pro Glu Phe Leu Glu His Ala Phe Val Val Asp Arg

20 25

<210> 124

<211> 10

<212> PRT

<213>Manually

<220>

<223>The G3 feature peptides of Gly m 6

<400> 124

Leu Gln Gly Glu Asn Glu Glu Glu Glu Lys

1 5 10

<210> 125

<211> 28

<212> PRT

<213>Manually

<220>

<223>The G3 feature peptides of Gly m 6

<400> 125

Gly Gly Leu Ser Val Ile Ser Pro Pro Thr Glu Glu Gln Gln Gln Arg

1 5 10 15

Pro Glu Glu Glu Glu Lys Pro Asp Cys Asp Glu Lys

20 25

<210> 126

<211> 7

<212> PRT

<213>Manually

<220>

<223>The G3 feature peptides of Gly m 6

<400> 126

His Cys Gln Ser Gln Ser Arg

1 5

<210> 127

<211> 9

<212> PRT

<213>Manually

<220>

<223>The G3 feature peptides of Gly m 6

<400> 127

Leu Ser Ala Gln Phe Gly Ser Leu Arg

1 5

<210> 128

<211> 23

<212> PRT

<213>Manually

<220>

<223>The G3 feature peptides of Gly m 6

<400> 128

Val Phe Asp Gly Glu Leu Gln Glu Gly Gln Val Leu Ile Val Pro Gln

1 5 10 15

Asn Phe Ala Val Ala Ala Arg

20

<210> 129

<211> 32

<212> PRT

<213>Manually

<220>

<223>The G3 feature peptides of Gly m 6

<400> 129

Thr Asn Asp Arg Pro Ser Ile Gly Asn Leu Ala Gly Ala Asn Ser Leu

1 5 10 15

Leu Asn Ala Leu Pro Glu Glu Val Ile Gln Gln Thr Phe Asn Leu Arg

20 25 30

<210> 130

<211> 299

<212> PRT

<213>Manually

<220>

<223>The G4 consensus sequences of Gly m 6

<400> 130

Met Gly Lys Pro Phe Thr Leu Ser Leu Ser Ser Leu Cys Leu Leu Leu

1 5 10 15

Leu Ser Ser Ala Cys Phe Ala Ile Ser Ser Ser Lys Leu Asn Glu Cys

20 25 30

Gln Leu Asn Asn Leu Asn Ala Leu Glu Pro Asp His Arg Val Glu Ser

35 40 45

Glu Gly Gly Leu Ile Gln Thr Trp Asn Ser Gln His Pro Glu Leu Lys

50 55 60

Cys Ala Gly Val Thr Val Ser Lys Leu Thr Leu Asn Arg Asn Gly Leu

65 70 75 80

His Leu Pro Ser Tyr Ser Pro Tyr Pro Arg Met Ile Ile Ile Ala Gln

85 90 95

Gly Lys Gly Ala Leu Gly Val Ala Ile Pro Gly Cys Pro Glu Thr Phe

100 105 110

Glu Glu Pro Gln Glu Gln Ser Asn Arg Arg Gly Ser Arg Ser Gln Lys

115 120 125

Gln Gln Leu Gln Asp Ser His Gln Lys Ile Arg His Phe Asn Glu Gly

130 135 140

Asp Val Leu Val Ile Pro Pro Gly Val Pro Tyr Trp Thr Tyr Asn Thr

145 150 155 160

Gly Asp Glu Pro Val Val Ala Ile Ser Leu Leu Asp Thr Ser Asn Phe

165 170 175

Asn Asn Gln Leu Asp Gln Thr Pro Arg Val Phe Tyr Leu Ala Gly Asn

180 185 190

Pro Asp Ile Glu Tyr Pro Glu Thr Met Gln Gln Gln Gln Gln Gln Lys

195 200 205

Ser His Gly Gly Arg Lys Gln Gly Gln His Gln Gln Glu Glu Glu Glu

210 215 220

Glu Gly Gly Ser Val Leu Ser Gly Phe Ser Lys His Phe Leu Ala Gln

225 230 235 240

Ser Phe Asn Thr Asn Glu Asp Ile Ala Glu Lys Leu Gln Ser Pro Asp

245 250 255

Asp Glu Arg Lys Gln Ile Val Thr Val Glu Gly Gly Leu Ser Val Ile

260 265 270

Ser Pro Lys Trp Gln Glu Gln Gln Asp Glu Asp Glu Asp Glu Asp Glu

275 280 285

Asp Asp Glu Asp Glu Gln Ile Pro Ser His Pro

290 295

<210> 131

<211> 563

<212> PRT

<213>Manually

<220>

<223> Gly m 6 G4 Ping CAA60533.1 563aa

<400> 131

Met Gly Lys Pro Phe Thr Leu Ser Leu Ser Ser Leu Cys Leu Leu Leu

1 5 10 15

Leu Ser Ser Ala Cys Phe Ala Ile Ser Ser Ser Lys Leu Asn Glu Cys

20 25 30

Gln Leu Asn Asn Leu Asn Ala Leu Glu Pro Asp His Arg Val Glu Ser

35 40 45

Glu Gly Gly Leu Ile Gln Thr Trp Asn Ser Gln His Pro Glu Leu Lys

50 55 60

Cys Ala Gly Val Thr Val Ser Lys Leu Thr Leu Asn Arg Asn Gly Leu

65 70 75 80

His Leu Pro Ser Tyr Ser Pro Tyr Pro Arg Met Ile Ile Ile Ala Gln

85 90 95

Gly Lys Gly Ala Leu Gly Val Ala Ile Pro Gly Cys Pro Glu Thr Phe

100 105 110

Glu Glu Pro Gln Glu Gln Ser Asn Arg Arg Gly Ser Arg Ser Gln Lys

115 120 125

Gln Gln Leu Gln Asp Ser His Gln Lys Ile Arg His Phe Asn Glu Gly

130 135 140

Asp Val Leu Val Ile Pro Pro Gly Val Pro Tyr Trp Thr Tyr Asn Thr

145 150 155 160

Gly Asp Glu Pro Val Val Ala Ile Ser Leu Leu Asp Thr Ser Asn Phe

165 170 175

Asn Asn Gln Leu Asp Gln Thr Pro Arg Val Phe Tyr Leu Ala Gly Asn

180 185 190

Pro Asp Ile Glu Tyr Pro Glu Thr Met Gln Gln Gln Gln Gln Gln Lys

195 200 205

Ser His Gly Gly Arg Lys Gln Gly Gln His Gln Gln Glu Glu Glu Glu

210 215 220

Glu Gly Gly Ser Val Leu Ser Gly Phe Ser Lys His Phe Leu Ala Gln

225 230 235 240

Ser Phe Asn Thr Asn Glu Asp Ile Ala Glu Lys Leu Gln Ser Pro Asp

245 250 255

Asp Glu Arg Lys Gln Ile Val Thr Val Glu Gly Gly Leu Ser Val Ile

260 265 270

Ser Pro Lys Trp Gln Glu Gln Gln Asp Glu Asp Glu Asp Glu Asp Glu

275 280 285

Asp Asp Glu Asp Glu Gln Ile Pro Ser His Pro Pro Arg Arg Pro Ser

290 295 300

His Gly Lys Arg Glu Gln Asp Glu Asp Glu Asp Glu Asp Glu Asp Lys

305 310 315 320

Pro Arg Pro Ser Arg Pro Ser His Gly Lys Arg Glu Gln Asp Gln Asp

325 330 335

Gln Asp Glu Asp Glu Asp Glu Asp Glu Asp Gln Pro Arg Lys Ser Arg

340 345 350

Glu Trp Arg Ser Lys Lys Thr Gln Pro Arg Arg Pro Arg Gln Glu Glu

355 360 365

Pro Arg Glu Arg Gly Cys Glu Thr Arg Asn Gly Val Glu Glu Asn Ile

370 375 380

Cys Thr Leu Lys Leu His Glu Asn Ile Ala Arg Pro Ser Arg Ala Asp

385 390 395 400

Phe Tyr Asn Pro Lys Ala Gly Arg Ile Ser Thr Leu Asn Ser Leu Thr

405 410 415

Leu Pro Ala Leu Arg Gln Phe Gln Leu Ser Ala Gln Tyr Val Val Leu

420 425 430

Tyr Lys Asn Gly Ile Tyr Ser Pro His Trp Asn Leu Asn Ala Asn Ser

435 440 445

Val Ile Tyr Val Thr Arg Gly Gln Gly Lys Val Arg Val Val Asn Cys

450 455 460

Gln Gly Asn Ala Val Phe Asp Gly Glu Leu Arg Arg Gly Gln Leu Leu

465 470 475 480

Val Val Pro Gln Asn Phe Val Val Ala Glu Gln Ala Gly Glu Gln Gly

485 490 495

Phe Glu Tyr Ile Val Phe Lys Thr His His Asn Ala Val Thr Ser Tyr

500 505 510

Leu Lys Asp Val Phe Arg Ala Ile Pro Ser Glu Val Leu Ala His Ser

515 520 525

Tyr Asn Leu Arg Gln Ser Gln Val Ser Glu Leu Lys Tyr Glu Gly Asn

530 535 540

Trp Gly Pro Leu Val Asn Pro Glu Ser Gln Gln Gly Ser Pro Arg Val

545 550 555 560

Lys Val Ala

<210> 132

<211> 563

<212> PRT

<213>Manually

<220>

<223> Gly m 6 G4 UniProt Q9SB11 G4 563aa

<400> 132

Met Gly Lys Pro Phe Thr Leu Ser Leu Ser Ser Leu Cys Leu Leu Leu

1 5 10 15

Leu Ser Ser Ala Cys Phe Ala Ile Ser Ser Ser Lys Leu Asn Glu Cys

20 25 30

Gln Leu Asn Asn Leu Asn Ala Leu Glu Pro Asp His Arg Val Glu Ser

35 40 45

Glu Gly Gly Leu Ile Gln Thr Trp Asn Ser Gln His Pro Glu Leu Lys

50 55 60

Cys Ala Gly Val Thr Val Ser Lys Leu Thr Leu Asn Arg Asn Gly Leu

65 70 75 80

His Leu Pro Ser Tyr Ser Pro Tyr Pro Arg Met Ile Ile Ile Ala Gln

85 90 95

Gly Lys Gly Ala Leu Gly Val Ala Ile Pro Gly Cys Pro Glu Thr Phe

100 105 110

Glu Glu Pro Gln Glu Gln Ser Asn Arg Arg Gly Ser Arg Ser Gln Lys

115 120 125

Gln Gln Leu Gln Asp Ser His Gln Lys Ile Arg His Phe Asn Glu Gly

130 135 140

Asp Val Leu Val Ile Pro Pro Gly Val Pro Tyr Trp Thr Tyr Asn Thr

145 150 155 160

Gly Asp Glu Pro Val Val Ala Ile Ser Leu Leu Asp Thr Ser Asn Phe

165 170 175

Asn Asn Gln Leu Asp Gln Thr Pro Arg Val Phe Tyr Leu Ala Gly Asn

180 185 190

Pro Asp Ile Glu Tyr Pro Glu Thr Met Gln Gln Gln Gln Gln Gln Lys

195 200 205

Ser His Gly Gly Arg Lys Gln Gly Gln His Gln Gln Glu Glu Glu Glu

210 215 220

Glu Gly Gly Ser Val Leu Ser Gly Phe Ser Lys His Phe Leu Ala Gln

225 230 235 240

Ser Phe Asn Thr Asn Glu Asp Ile Ala Glu Lys Leu Gln Ser Pro Asp

245 250 255

Asp Glu Arg Lys Gln Ile Val Thr Val Glu Gly Gly Leu Ser Val Ile

260 265 270

Ser Pro Lys Trp Gln Glu Gln Gln Asp Glu Asp Glu Asp Glu Asp Glu

275 280 285

Asp Asp Glu Asp Glu Gln Ile Pro Ser His Pro Pro Arg Arg Pro Ser

290 295 300

His Gly Lys Arg Glu Gln Asp Glu Asp Glu Asp Glu Asp Glu Asp Lys

305 310 315 320

Pro Arg Pro Ser Arg Pro Ser Gln Gly Lys Arg Glu Gln Asp Gln Asp

325 330 335

Gln Asp Glu Asp Glu Asp Glu Asp Glu Asp Gln Pro Arg Lys Ser Arg

340 345 350

Glu Trp Arg Ser Lys Lys Thr Gln Pro Arg Arg Pro Arg Gln Glu Glu

355 360 365

Pro Arg Glu Arg Gly Cys Glu Thr Arg Asn Gly Val Glu Glu Asn Ile

370 375 380

Cys Thr Leu Lys Leu His Glu Asn Ile Ala Arg Pro Ser Arg Ala Asp

385 390 395 400

Phe Tyr Asn Pro Lys Ala Gly Arg Ile Ser Thr Leu Asn Ser Leu Thr

405 410 415

Leu Pro Ala Leu Arg Gln Phe Gln Leu Ser Ala Gln Tyr Val Val Leu

420 425 430

Tyr Lys Asn Gly Ile Tyr Ser Pro His Trp Asn Leu Asn Ala Asn Ser

435 440 445

Val Ile Tyr Val Thr Arg Gly Gln Gly Lys Val Arg Val Val Asn Cys

450 455 460

Gln Gly Asn Ala Val Phe Asp Gly Glu Leu Arg Arg Gly Gln Leu Leu

465 470 475 480

Val Val Pro Gln Asn Phe Val Val Ala Glu Gln Ala Gly Glu Gln Gly

485 490 495

Phe Glu Tyr Ile Val Phe Lys Thr His His Asn Ala Val Thr Ser Tyr

500 505 510

Leu Lys Asp Val Phe Arg Ala Ile Pro Ser Glu Val Leu Ala His Ser

515 520 525

Tyr Asn Leu Arg Gln Ser Gln Val Ser Glu Leu Lys Tyr Glu Gly Asn

530 535 540

Trp Gly Pro Leu Val Asn Pro Glu Ser Gln Gln Gly Ser Pro Arg Val

545 550 555 560

Lys Val Ala

<210> 133

<211> 517

<212> PRT

<213>Manually

<220>

<223> Gly m 6 G4 Ping CAA55977.1 517aa

<400> 133

Met Gly Lys Pro Phe Phe Thr Leu Ser Leu Ser Ser Leu Cys Leu Leu

1 5 10 15

Leu Leu Ser Ser Ala Cys Phe Ala Ile Thr Ser Ser Lys Phe Asn Glu

20 25 30

Cys Gln Leu Asn Asn Leu Asn Ala Leu Glu Pro Asp His Arg Val Glu

35 40 45

Ser Glu Gly Gly Leu Ile Glu Thr Trp Asn Ser Gln His Pro Glu Leu

50 55 60

Gln Cys Ala Gly Val Thr Val Ser Lys Arg Thr Leu Asn Arg Asn Gly

65 70 75 80

Leu His Leu Pro Ser Tyr Ser Pro Tyr Pro Gln Met Ile Ile Val Val

85 90 95

Gln Gly Lys Gly Ala Ile Gly Phe Ala Phe Pro Gly Cys Pro Glu Thr

100 105 110

Phe Glu Lys Pro Gln Gln Gln Ser Ser Arg Arg Gly Ser Arg Ser Gln

115 120 125

Gln Gln Leu Gln Asp Ser His Gln Lys Ile Arg His Phe Asn Glu Gly

130 135 140

Asp Val Leu Val Ile Pro Pro Gly Val Pro Tyr Trp Thr Tyr Asn Thr

145 150 155 160

Gly Asp Glu Pro Val Val Ala Ile Ser Leu Leu Asp Thr Ser Asn Phe

165 170 175

Asn Asn Gln Leu Asp Gln Asn Pro Arg Val Phe Tyr Leu Ala Gly Asn

180 185 190

Pro Asp Ile Glu His Pro Glu Thr Met Gln Gln Gln Gln Gln Gln Lys

195 200 205

Ser His Gly Gly Arg Lys Gln Gly Gln His Gln Gln Gln Glu Glu Glu

210 215 220

Gly Gly Ser Val Leu Ser Gly Phe Ser Lys His Phe Leu Ala Gln Ser

225 230 235 240

Phe Asn Thr Asn Glu Asp Thr Ala Glu Lys Leu Arg Ser Pro Asp Asp

245 250 255

Glu Arg Lys Gln Ile Val Thr Val Glu Gly Gly Leu Ser Val Ile Ser

260 265 270

Pro Lys Trp Gln Glu Gln Glu Asp Glu Asp Glu Asp Glu Asp Glu Glu

275 280 285

Tyr Glu Gln Thr Pro Ser Tyr Pro Pro Arg Arg Pro Ser His Gly Lys

290 295 300

His Glu Asp Asp Glu Asp Glu Asp Glu Glu Glu Asp Gln Pro Arg Pro

305 310 315 320

Asp His Pro Pro Gln Arg Pro Ser Arg Pro Glu Gln Gln Glu Pro Arg

325 330 335

Gly Arg Gly Cys Gln Thr Arg Asn Gly Val Glu Glu Asn Ile Cys Thr

340 345 350

Met Lys Leu His Glu Asn Ile Ala Arg Pro Ser Arg Ala Asp Phe Tyr

355 360 365

Asn Pro Lys Ala Gly Arg Ile Ser Thr Leu Asn Ser Leu Thr Leu Pro

370 375 380

Ala Leu Arg Gln Phe Gly Leu Ser Ala Gln Tyr Val Val Leu Tyr Arg

385 390 395 400

Asn Gly Ile Tyr Ser Pro His Trp Asn Leu Asn Ala Asn Ser Val Ile

405 410 415

Tyr Val Thr Arg Gly Lys Gly Arg Val Arg Val Val Asn Cys Gln Gly

420 425 430

Asn Ala Val Phe Asp Gly Glu Leu Arg Arg Gly Gln Leu Leu Val Val

435 440 445

Pro Gln Asn Phe Val Val Ala Glu Gln Gly Gly Glu Gln Gly Leu Glu

450 455 460

Tyr Val Val Phe Lys Thr His His Asn Ala Val Ser Ser Tyr Ile Lys

465 470 475 480

Asp Val Phe Arg Ala Ile Pro Ser Glu Val Leu Ser Asn Ser Tyr Asn

485 490 495

Leu Gly Gln Ser Gln Val Arg Gln Leu Lys Tyr Gln Gly Asn Ser Gly

500 505 510

Pro Leu Val Asn Pro

515

<210> 134

<211> 516

<212> PRT

<213>Manually

<220>

<223> Gly m 6 G4 Ping AAA33964.1 516aa

<400> 134

Met Gly Lys Pro Phe Phe Thr Leu Ser Leu Ser Ser Leu Cys Leu Leu

1 5 10 15

Leu Leu Ser Ser Ala Cys Phe Ala Ile Thr Ser Ser Lys Phe Asn Glu

20 25 30

Cys Gln Leu Asn Asn Leu Asn Ala Leu Glu Pro Asp His Arg Val Glu

35 40 45

Ser Glu Gly Gly Leu Ile Glu Thr Trp Asn Ser Gln His Pro Glu Leu

50 55 60

Gln Cys Ala Gly Val Thr Val Ser Lys Arg Thr Leu Asn Arg Asn Gly

65 70 75 80

Ser His Leu Pro Ser Tyr Leu Pro Tyr Pro Gln Met Ile Ile Val Val

85 90 95

Gln Gly Lys Gly Ala Ile Gly Phe Ala Phe Pro Gly Cys Pro Glu Thr

100 105 110

Phe Glu Lys Pro Gln Gln Gln Ser Ser Arg Arg Gly Ser Arg Ser Gln

115 120 125

Gln Gln Leu Gln Asp Ser His Gln Lys Ile Arg His Phe Asn Glu Gly

130 135 140

Asp Val Leu Val Ile Pro Leu Gly Val Pro Tyr Trp Thr Tyr Asn Thr

145 150 155 160

Gly Asp Glu Pro Val Val Ala Ile Ser Pro Leu Asp Thr Ser Asn Phe

165 170 175

Asn Asn Gln Leu Asp Gln Asn Pro Arg Val Phe Tyr Leu Ala Gly Asn

180 185 190

Pro Asp Ile Glu His Pro Glu Thr Met Gln Gln Gln Gln Gln Gln Lys

195 200 205

Ser His Gly Gly Arg Lys Gln Gly Gln His Arg Gln Gln Glu Glu Glu

210 215 220

Gly Gly Ser Val Leu Ser Gly Phe Ser Lys His Phe Leu Ala Gln Ser

225 230 235 240

Phe Asn Thr Asn Glu Asp Thr Ala Glu Lys Leu Arg Ser Pro Asp Asp

245 250 255

Glu Arg Lys Gln Ile Val Thr Val Glu Gly Gly Leu Ser Val Ile Ser

260 265 270

Pro Lys Trp Gln Glu Gln Glu Asp Glu Asp Glu Asp Glu Asp Glu Glu

275 280 285

Tyr Gly Arg Thr Pro Ser Tyr Pro Pro Arg Arg Pro Ser His Gly Lys

290 295 300

His Glu Asp Asp Glu Asp Glu Asp Glu Glu Glu Asp Gln Pro Arg Pro

305 310 315 320

Asp His Pro Pro Gln Arg Pro Ser Arg Pro Glu Gln Gln Glu Pro Arg

325 330 335

Gly Arg Gly Cys Gln Thr Arg Asn Gly Val Glu Glu Asn Ile Cys Thr

340 345 350

Met Lys Leu His Glu Asn Ile Ala Arg Pro Ser Arg Ala Asp Phe Tyr

355 360 365

Asn Pro Lys Ala Gly Arg Ile Ser Thr Leu Asn Ser Leu Thr Leu Pro

370 375 380

Ala Leu Arg Gln Phe Gly Leu Ser Ala Gln Tyr Val Val Leu Tyr Arg

385 390 395 400

Asn Gly Ile Tyr Ser Pro Asp Trp Asn Leu Asn Ala Asn Ser Val Thr

405 410 415

Met Thr Arg Gly Lys Gly Arg Val Arg Val Val Asn Cys Gln Gly Asn

420 425 430

Ala Val Phe Asp Gly Glu Leu Arg Arg Gly Gln Leu Leu Val Val Pro

435 440 445

Gln Asn Pro Ala Val Ala Glu Gln Gly Gly Glu Gln Gly Leu Glu Tyr

450 455 460

Val Val Phe Lys Thr His His Asn Ala Val Ser Ser Tyr Ile Lys Asp

465 470 475 480

Val Phe Arg Val Ile Pro Ser Glu Val Leu Ser Asn Ser Tyr Asn Leu

485 490 495

Gly Gln Ser Gln Val Arg Gln Leu Lys Tyr Gln Gly Asn Ser Gly Pro

500 505 510

Leu Val Asn Pro

515

<210> 135

<211> 17

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 135

Leu Asn Glu Cys Gln Leu Asn Asn Leu Asn Ala Leu Glu Pro Asp His

1 5 10 15

Arg

<210> 136

<211> 8

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 136

Cys Ala Gly Val Thr Val Ser Lys

1 5

<210> 137

<211> 5

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 137

Leu Thr Leu Asn Arg

1 5

<210> 138

<211> 8

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 138

Met Ile Ile Ile Ala Gln Gly Lys

1 5

<210> 139

<211> 23

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 139

Gly Ala Leu Gly Val Ala Ile Pro Gly Cys Pro Glu Thr Phe Glu Glu

1 5 10 15

Pro Gln Glu Gln Ser Asn Arg

20

<210> 140

<211> 9

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 140

Gln Gln Leu Gln Asp Ser His Gln Lys

1 5

<210> 141

<211> 23

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 141

Val Phe Tyr Leu Ala Gly Asn Pro Asp Ile Glu Tyr Pro Glu Thr Met

1 5 10 15

Gln Gln Gln Gln Gln Gln Lys

20

<210> 142

<211> 21

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 142

Gln Gly Gln His Gln Gln Glu Glu Glu Glu Glu Gly Gly Ser Val Leu

1 5 10 15

Ser Gly Phe Ser Lys

20

<210> 143

<211> 16

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 143

His Phe Leu Ala Gln Ser Phe Asn Thr Asn Glu Asp Ile Ala Glu Lys

1 5 10 15

<210> 144

<211> 15

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 144

Gln Ile Val Thr Val Glu Gly Gly Leu Ser Val Ile Ser Pro Lys

1 5 10 15

<210> 145

<211> 26

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 145

Trp Gln Glu Gln Gln Asp Glu Asp Glu Asp Glu Asp Glu Asp Asp Glu

1 5 10 15

Asp Glu Gln Ile Pro Ser His Pro Pro Arg

20 25

<210> 146

<211> 6

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 146

Arg Pro Ser His Gly Lys

1 5

<210> 147

<211> 22

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 147

Glu Gln Asp Glu Asp Glu Asp Glu Asp Glu Asp Lys Pro Arg Pro Ser

1 5 10 15

Arg Pro Ser Gln Gly Lys

20

<210> 148

<211> 5

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 148

Gln Glu Glu Pro Arg

1 5

<210> 149

<211> 11

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 149

Asn Gly Val Glu Glu Asn Ile Cys Thr Leu Lys

1 5 10

<210> 150

<211> 10

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 150

Leu His Glu Asn Ile Ala Arg Pro Ser Arg

1 5 10

<210> 151

<211> 13

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 151

Ile Ser Thr Leu Asn Ser Leu Thr Leu Pro Ala Leu Arg

1 5 10

<210> 152

<211> 13

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 152

Gln Phe Gln Leu Ser Ala Gln Tyr Val Val Leu Tyr Lys

1 5 10

<210> 153

<211> 20

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 153

Asn Gly Ile Tyr Ser Pro His Trp Asn Leu Asn Ala Asn Ser Val Ile

1 5 10 15

Tyr Val Thr Arg

20

<210> 154

<211> 4

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 154

Asp Val Phe Arg

1

<210> 155

<211> 14

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 155

Ala Ile Pro Ser Glu Val Leu Ala His Ser Tyr Asn Leu Arg

1 5 10

<210> 156

<211> 8

<212> PRT

<213>Manually

<220>

<223>The G4 feature peptides of Gly m 6

<400> 156

Gln Ser Gln Val Ser Glu Leu Lys

1 5

Claims

1. it is a kind of to select the candidate feature peptide to be used for quantitative known allergen and potential allergen from the sample based on plant Method, including：

D () is based on from the consensus sequence of selection in step (c) or the sequence alignment of representative series and computer digestion data Conservative region or domain, it is determined that multiple candidate feature peptide；With

E () is based on the measurement of the feature peptide, the described at least one known allergen in the quantitative sample based on plant With the amount of potential allergen.

2. the method for claim 1 wherein the quantification steps use column chromatography and mass spectrum.

3. the method for claim 1 wherein the quantification steps include being surveyed using high-resolution accurate mass mass spectrum (HRAM MS) Measure the multiple candidate feature peptide.

4. include being calculated from mass spectrum the corresponding peak height of the candidate feature peptide the method for claim 1 wherein the quantification steps Degree or peak area.

5. the method for claim 1 wherein the quantification steps include will be from mass spectrographic fragmentation mode high and low fragmentation mode Data be compared.

6. the method for claim 1 wherein at least one known allergen includes Gly m 1, Gly m 3, Gly m 4, Gly m 5 (beta-conglycinin), Gly m 6 (glycinin) G1, Gly m 6) G2, (the soybean ball eggs of Gly m 6 G3 in vain), Gly m 6 (glycinin) G4 or Gly m 6 (glycinin) precursor.

7. the method for claim 1 wherein the potential allergen includes at least one sequence being selected from the group：

A () is SEQ ID NO for Gly m 1:12 and 30-35；

B () is SEQ ID NO for Gly m 3:13 and 39-40；

C () is SEQ ID NO for Gly m 4:14 and 43-51；

D () is SEQ ID NO for Gly m 5:15 and 62-74；

E () is SEQ ID NO for the G1 of Gly m 6:16 and 95；

F () is SEQ ID NO for the G2 of Gly m 6:17 and 107；

G () is SEQ ID NO for the G3 of Gly m 6:18；

H () is SEQ ID NO for the G4 of Gly m 6:19 and 131-134；With

I () is SEQ ID NO for the precursors of Gly m 6:20.

8. the method for claim 1 wherein the candidate feature peptide includes at least one sequence being selected from the group：

A () is SEQ ID NO for Gly m 1:1,36 and 37；

B () is SEQ ID NO for Gly m 3:2 and 41；

C () is SEQ ID NO for Gly m 4:52-57；

D () is SEQ ID NO for Gly m 5:3 and 75-94；

E () is SEQ ID NO for the G1 of Gly m 6:96-106；

F () is SEQ ID NO for the G2 of Gly m 6:4 and 108-120；

G () is SEQ ID NO for the G3 of Gly m 6:5 and 121-129；

H () is SEQ ID NO for the G4 of Gly m 6:135-156 and 58；With

I () is SEQ ID NO for the precursors of Gly m 6:6,59 and 60.

9. the method for claim 1 wherein part of the sample based on plant comprising soya seeds or soya seeds.

10. a kind of for quantitative one or more target protein with known amino acid sequence in the sample based on plant System, the system includes：

C () is used for the separation module of isolated peptides in a single step；

(d) selecting module, for being at least one known allergen and the multiple feature peptides of potential allergen selection；With

E () is used to measure the mass spectrum of multiple feature peptides.

The system of 11. claims 10, wherein the separation module includes column chromatography.

The system of 12. claims 11, wherein the column chromatography includes LCC.

The system of 13. claims 10, wherein the mass spectrum includes high-resolution accurate mass mass spectrum (HRAM MS).

The system of 14. claims 10, wherein the selecting module uses method according to claim 1.

The system of 15. claims 10, wherein at least one known allergen includes Gly m 1, Gly m 3, Gly m 4, Gly m 5 (beta-conglycinin), Gly m 6 (glycinin) G1, Gly m 6) G2, (the soybean ball eggs of Gly m 6 G3 in vain), Gly m 6 (glycinin) G4 or Gly m 6 (glycinin) precursor.

The system of 16. claims 10, wherein the potential allergen includes being selected from following at least one sequence：

The SEQ ID NO of (a) Gly m 1:12 and 30-35；

The SEQ ID NO of (b) Gly m 3:13 and 39-40；

The SEQ ID NO of (c) Gly m 4:14 and 43-51；

The SEQ ID NO of (d) Gly m 5:15 and 62-74；

The SEQ ID NO of the G1 of (e) Gly m 6:16 and 95；

The SEQ ID NO of the G2 of (f) Gly m 6:17 and 107；

The SEQ ID NO of the G3 of (g) Gly m 6:18；

The SEQ ID NO of the G4 of (h) Gly m 6:19 and 131-134；With

The SEQ ID NO of the precursors of (i) Gly m 6:20.

The system of 17. claims 10, wherein the feature peptide includes at least one sequence being selected from the group：

The SEQ ID NO of (a) Gly m 1:1,36 and 37；

The SEQ ID NO of (b) Gly m 3:2 and 41；

The SEQ ID NO of (c) Gly m 4:52-57；

The SEQ ID NO of (d) Gly m 5:3 and 75-94；

The SEQ ID NO of the G1 of (e) Gly m 6:96-106；

The SEQ ID NO of the G2 of (f) Gly m 6:4 and 108-120；

The SEQ ID NO of the G3 of (g) Gly m 6:5 and 121-129；

The SEQ ID NO of the G4 of (h) Gly m 6:135-156 and 58；With

The SEQ ID NO of the precursors of (i) Gly m 6:6,59 and 60.

The system of 18. claims 10, wherein the sample based on plant includes the part of soya seeds or soya seeds.

19. a kind of at least one allergens with known amino acid sequence quantitative in the sample based on plant and homologous potential The high throughput method of allergen, including the system that usage right requires 10.