CN106749588B - A kind of imitative stichopus japonicus peptidoglycan recognition protein and its preparation method and application with bactericidal activity - Google Patents

A kind of imitative stichopus japonicus peptidoglycan recognition protein and its preparation method and application with bactericidal activity Download PDF

Info

Publication number
CN106749588B
CN106749588B CN201611143071.2A CN201611143071A CN106749588B CN 106749588 B CN106749588 B CN 106749588B CN 201611143071 A CN201611143071 A CN 201611143071A CN 106749588 B CN106749588 B CN 106749588B
Authority
CN
China
Prior art keywords
stichopus japonicus
pgrp
recognition protein
peptidoglycan recognition
imitative stichopus
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
CN201611143071.2A
Other languages
Chinese (zh)
Other versions
CN106749588A (en
Inventor
孔令明
丛海燕
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Shandong University
Original Assignee
Shandong University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Shandong University filed Critical Shandong University
Priority to CN201611143071.2A priority Critical patent/CN106749588B/en
Publication of CN106749588A publication Critical patent/CN106749588A/en
Application granted granted Critical
Publication of CN106749588B publication Critical patent/CN106749588B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70—Vectors or expression systems specially adapted for E. coli
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00—Nucleic acids vectors
    • C12N2800/10—Plasmid DNA
    • C12N2800/101—Plasmid DNA for bacteria

Landscapes

  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Abstract

The invention belongs to molecular biology fields and gene engineering technology field, specifically disclose a kind of imitative stichopus japonicus peptidoglycan recognition protein and its preparation method and application with bactericidal activity.The present invention obtains imitative stichopus japonicus peptidoglycan recognition protein AJ-PGRP using in-vitro recombination expression technology for the first time, imitates stichopus japonicus peptidoglycan recognition protein (AJ-PGRP) as shown in amino acid sequence in sequence table SEQ ID NO.1.The recombinant protein has agglutination to staphylococcus aureus and Escherichia coli, it is inhibited to staphylococcus aureus, Escherichia coli, Vibrio splindidus and bacillus subtilis, develop wide-spectrum antiseptic medicine object exploitation and in terms of have potential using value.

Description

A kind of imitative stichopus japonicus peptidoglycan recognition protein with bactericidal activity and preparation method thereof and Using
Technical field
The invention belongs to molecular biology fields and gene engineering technology field, and in particular to a kind of with bactericidal activity Imitative stichopus japonicus peptidoglycan recognition protein and its preparation method and application.
Background technique
Imitative stichopus japonicus (Apostichopus japonicus) belongs to Echinodermata (Echinodermata), Holothuroidea (Holothuroidea) , Parapet hand mesh (Aspidochirotida), Stichopodidae (Stichopodidae), is mainly distributed on north latitude 35 °~44 ° of northwest Pacific is littoral, and Shandong, Liaoning and Hebei are the main culture zones that China imitates stichopus japonicus.Imitative stichopus japonicus is ranked First of " Hai Bazhen ", have very high nutritive value and pharmaceutical value.In recent years, with the raising of people's social life condition and The enhancing of health perception, imitative stichopus japonicus market demand increase year by year, constantly cultivation scale are stimulated to increase, therefore imitative stichopus japonicus becomes me The single maximum breed variety of the output value in state's culture fishery.But the disease problem encountered in breeding process is always to perplex to produce The important restriction factor that industry further develops.The weight that disease prevention and cure increasingly cause people is carried out using the means of biotechnology Depending on.
Peptide glycan (Peptidoglycan) is to be present in one of Gram-positive and negative bacterial cell wall glycoconjugate Class.Main chain is the n-acetylglucosamine and the alternate heteroglycan of -acetylmuramic acid of β -1,4- glucosides key connection.Peptide glycan is The main component of many bacteria cell walls, especially in gram-positive bacterium, contained by peptide glycan account for cell wall dry weight 50~80%.
Peptidoglycan recognition protein (Peptidoglycan recognition protein, PGRP) is identification and binding peptide The pattern recognition molecule of glycan.By the peptide glycan of identification invasion bacterium opportunistic pathogen, and then activate Toll signal path (Toll-like Receptors) the immune signals access such as approach and immune deficiency (Immune Deficiency, IMD) approach and mediate phagocytosis work With, therefore play an important role during resisting cause of disease invasion.
1996, Yoshida H had found peptidoglycan recognition protein in silkworm hemolymph for the first time, then in fish, software It is also found in succession in animal and some vertebrates.According to their sequential structure feature, peptidoglycan recognition protein can divide For two hypotypes, i.e. elongated peptidoglycan recognition protein (PGRP-L) and short peptidoglycan recognition protein (PGRP-S).And it is right at present It is not yet had been reported that in imitative stichopus japonicus peptidoglycan recognition protein.The functional gene for excavating imitative stichopus japonicus, prepares biological antibiotic drug, facilitates It solves the problems, such as antibiotic resistant in current cultivation, therefore there is highly important theoretical and realistic meaning.
Summary of the invention
In view of the deficiencies of the prior art, the application provides a kind of imitative stichopus japonicus peptidoglycan recognition protein with bactericidal activity Preparation and application.
To achieve the above object, The technical solution adopted by the invention is as follows:
A kind of imitative stichopus japonicus peptidoglycan recognition protein with bactericidal activity is imitated stichopus japonicus peptidoglycan recognition protein (AJ-PGRP) For shown in amino acid sequence in sequence table SEQ ID NO.1.
Peptidoglycan recognition protein (AJ-PGRP) the preparation method comprises the following steps:
(1) using imitative stichopus japonicus cDNA as template, PCR amplification is carried out with primers F 1 and R1, for use；
(2) it is attached after PCR product is purified with carrier pEASY-E1 carrier, connection product converts Escherichia coli, surveys Sequence identifies recon；
(3) above-mentioned expression vector pEASY-AJ-PGRP is transferred to Trans BL21 (DE3) Competent cell, screened Transformant is inoculated in the LB culture medium containing ampicillin, with IPTG inducing expression, then uses affinity chromatography by transformant Column purification recombinant protein to get the amino acid sequence into sequence table SEQ ID No.1 peptidoglycan recognition protein AJ-PGRP.
The primer is respectively as follows: F1:5 '-ATGGATGAACCGCCGCGTGCCTT-3 ', R1:5 '-ATGGTGATGTAT AATTTCTTG-3’。
The invention also discloses the application of imitative stichopus japonicus peptidoglycan recognition protein, amino in the sequence table SEQ ID NO.1 The AJ-PGRP of acid sequence is used to prepare broad-spectrum antiseptic class preparation or feed addictive.
The invention also discloses the imitative stichopus japonicus peptidoglycan recognition proteins to be used to prepare anti-Staphylococcus aureus, large intestine bar Bacterium, Vibrio splindidus and bacillus subtilis preparation.
The present invention has the advantage that: the present invention obtains imitative stichopus japonicus peptide glycan using in-vitro recombination expression technology for the first time and identifies Albumin A J-PGRP, which has agglutination to staphylococcus aureus and Escherichia coli, to Staphylococcus aureus Bacterium, Escherichia coli, Vibrio splindidus and bacillus subtilis are inhibited, in the exploitation of exploitation wide-spectrum antiseptic medicine object and raise Feed additives etc. have potential using value.
The imitative stichopus japonicus peptidoglycan recognition protein AJ-PGRP that the present invention obtains has gram-positive bacteria, Gram-negative bacteria There is agglutination, while there is obvious inhibiting effect to gram-positive bacteria, Gram-negative bacteria, in exploitation New-type wide-spectrum antibacterial Drug development and feed addictive etc. have potential using value.
Detailed description of the invention
Fig. 1 is the protein expression figure that SDS-PAGE is detected, wherein 1 is the destination protein of inducing expression, 2 be MARKER；
Fig. 2 is the agglutination figure provided in an embodiment of the present invention to bacterium；
Fig. 3 is bacteriostatic activity figure provided in an embodiment of the present invention.
Specific embodiment
Further detailed description is done to the present invention below with reference to embodiment, embodiments of the present invention are not limited thereto.
Embodiment 1: the pronuclear recombination expression of the imitative code area stichopus japonicus AJ-PGRP, the specific steps are as follows:
1. the building of pronuclear recombination expression vector
The present invention uses the pEASY-E1 protokaryon of Beijing Quan Shijin biotechnology (TransGen Biotech) Co., Ltd Expression vector.Utilize whole code areas of specific primer PCR amplification AJ-PGRP.The setting of PCR response procedures are as follows: 1. 94 DEG C it is pre- It is denaturalized 4min, 2. 94 DEG C of denaturation 30s；3. 52 DEG C of renaturation 30s；4. 72 DEG C of extension 1min.5. 72 DEG C extend 10min eventually.By step 3. 2. 4. carrying out 40 circulations.PCR product is subjected to purification and recovery, is connect with pEASY-E1 carrier.Connection product converts large intestine Bacillus Trans BL21 (DE3) selects 5~10 single bacterium colonies and is inoculated in LB liquid medium, and sequencing company is sent to be sequenced, with The correctness of reading frame is verified, the specific primer is respectively as follows: F1:5 '-ATGGATGAACCGCCGCGT GCCTT-3 ', R1: 5’-ATGGTGATGTAT AATTTCTTG-3’。
The expression of recombinant protein: correct strain inoculated will be verified in the LB liquid medium of 50mL, be placed in shaken cultivation In case, is cultivated 12~16 hours in 37 DEG C of 200rpm, then this culture solution is inoculated in the 200mL of new LB with the ratio of 1:100 In fluid nutrient medium, 37 DEG C of cultures to OD600=0.8.IPTG is added, is allowed to final concentration and reaches 1mM, 18 DEG C to continue culture 10 small When.It using His.Bind purifying resin recombinant protein, is eluted under pH gradient, amino in sequence table SEQ ID NO.1 can be obtained The albumen of acid sequence.
SEQ ID NO.1
MDEPPRAFPITLVVLGIILAMSCADKSAYAKTDAACPVIVSRSDWQAKPPKNRTDMATPVPFVILHHTL WDECYDFESCCAEMRKIQDFHQGNRSWDDIGYNFCVGQDGRIYEGRGWDTVGAHAPWYNLRSIGICIMGNFTVKLPN QKSVDAVSSLIKCAIEENKLKDSYILYGHRQVRDTGCPGDALFKEIQSWPHWKPGQHYPPNQSKPVSQQEIIHHH
Sequence signature:
Length: 221 amino acid
Type: amino acid
Chain: single-stranded
Topological structure: line style
Feature: molecular weight 25.07kDa, isoelectric point 6.54 have a conservative PGRP structural domain.
Source: imitative stichopus japonicus
Embodiment 2: the Bacterial agglutinative activity analysis of the prokaryotic recombinant protein of the imitative code area stichopus japonicus AJ-PGRP
To bacillus subtilis (Bacillus subtilis), staphylococcus aureus (Staphylococcus aureus)(G+Bacterium) and Vibrio splindidus (Vibrio splendidus), Escherichia coli (Escherichia coli) (G-Bacterium) Agglutination experiment
Bacillus subtilis, staphylococcus aureus, Escherichia coli are inoculated into LB liquid medium, 37 DEG C of cultures are extremely OD value to 0.6, cultivated at 25 DEG C to OD value to 0.6, then with normal saline dilution to OD using TCBS culture medium by Vibrio splindidus Value is 0.001, and then 5000rpm is centrifuged 10 minutes collection bacterial sediments, with ZnCL containing 10mM2TBS buffer wash twice After be resuspended, so that bacteria concentration is adjusted to 2 × 109A cell/mL.20 μ L recombinant proteins are separately added into 96 orifice plates, 10 μ are then added L bacterium solution, is incubated at room temperature 1h, and negative control group replaces recombinant protein with bovine serum albumin(BSA) (BSA).As a result, it has been found that recombinant protein Above-mentioned 4 kinds of detections bacterium can be aggregated.
Experiment shows that gram-positive bacteria and Gram-negative bacteria can be effectively aggregated by recombinating AJ-PGRP albumen.
Embodiment 3: the bacteriostatic activity analysis of imitative stichopus japonicus AJ-PGRP prokaryotic recombinant protein
To staphylococcus aureus, bacillus subtilis (G+Bacterium) and Vibrio splindidus, Escherichia coli (G-Bacterium) growth inhibition Experiment
Bacillus subtilis, staphylococcus aureus and Escherichia coli are inoculated into LB liquid medium, 37 DEG C of cultures To OD value to 0.6, Vibrio splindidus is inoculated into TCBS culture medium in 25 DEG C of cultures to OD value to 0.6, and 200uL culture solution is taken to be added to Prior high-temperature sterilization is cooled in 50 DEG C of 35ML LB solid medium, is poured into the glass dish of 90mm, completely solidifying to it Gu after, the hole that 2 diameters are 5mm is made a call to punch, the empty carrier expression albumen and recombinant protein for being separately added into 45uL are (containing 20uM ZnCl2).30 DEG C of plate are cultivated 48 hours.Observation discovery forms apparent inhibition zone around the hole for having added recombinant protein, It is bigger than Gram-negative bacteria to the inhibition zone of gram-positive bacteria.Only add and has not formed inhibition zone around the hole of empty vectors.
Experiment shows that gram-positive bacteria can effectively be inhibited by recombinating AJ-PGRP albumen, also be had Gram-negative bacteria bright Aobvious inhibiting effect.
The above embodiment is a preferred embodiment of the present invention, but embodiments of the present invention are not by above-described embodiment Limitation, those skilled in the art should understand that, based on the technical solutions of the present invention, those skilled in the art do not need The various modifications or changes that can be made are made the creative labor still in protection scope of the present invention.
SEQUENCE LISTING
<110>Shandong University
<120>a kind of imitative stichopus japonicus peptidoglycan recognition protein and its preparation method and application with bactericidal activity
<130>
<160> 1
<170> PatentIn version 3.3
<210> 1
<211> 221
<212> PRT
<213>stichopus japonicus (Apostichopus japonicus) is imitated
<400> 1
Met Asp Glu Pro Pro Arg Ala Phe Pro Ile Thr Leu Val Val Leu Gly
1 5 10 15
Ile Ile Leu Ala Met Ser Cys Ala Asp Lys Ser Ala Tyr Ala Lys Thr
20 25 30
Asp Ala Ala Cys Pro Val Ile Val Ser Arg Ser Asp Trp Gln Ala Lys
35 40 45
Pro Pro Lys Asn Arg Thr Asp Met Ala Thr Pro Val Pro Phe Val Ile
50 55 60
Leu His His Thr Leu Trp Asp Glu Cys Tyr Asp Phe Glu Ser Cys Cys
65 70 75 80
Ala Glu Met Arg Lys Ile Gln Asp Phe His Gln Gly Asn Arg Ser Trp
85 90 95
Asp Asp Ile Gly Tyr Asn Phe Cys Val Gly Gln Asp Gly Arg Ile Tyr
100 105 110
Glu Gly Arg Gly Trp Asp Thr Val Gly Ala His Ala Pro Trp Tyr Asn
115 120 125
Leu Arg Ser Ile Gly Ile Cys Ile Met Gly Asn Phe Thr Val Lys Leu
130 135 140
Pro Asn Gln Lys Ser Val Asp Ala Val Ser Ser Leu Ile Lys Cys Ala
145 150 155 160
Ile Glu Glu Asn Lys Leu Lys Asp Ser Tyr Ile Leu Tyr Gly His Arg
165 170 175
Gln Val Arg Asp Thr Gly Cys Pro Gly Asp Ala Leu Phe Lys Glu Ile
180 185 190
Gln Ser Trp Pro His Trp Lys Pro Gly Gln His Tyr Pro Pro Asn Gln
195 200 205
Ser Lys Pro Val Ser Gln Gln Glu Ile Ile His His His
210 215 220

Claims (4)

1. a kind of imitative stichopus japonicus peptidoglycan recognition protein with bactericidal activity, which is characterized in that the imitative stichopus japonicus peptide glycan identification Albumin A J-PGRP is shown in amino acid sequence in sequence table SEQ ID NO.1.
2. a kind of preparation method of peptidoglycan recognition protein AJ-PGRP as described in claim 1, which is characterized in that preparation side Method is as follows:
(1) using imitative stichopus japonicus cDNA as template, PCR amplification is carried out with primers F 1 and R1, for use；
(2) it is attached after PCR product is purified with carrier pEASY-E1 carrier, connection product converts Escherichia coli, sequencing mirror Determine recon；
(3) expression vector pEASY-AJ-PGRP is transferred to Trans BL21 (DE3) Competent cell, screens transformant, it will Transformant is inoculated in the LB culture medium containing ampicillin, with IPTG inducing expression, then uses affinity chromatography column purification weight Histone to get the amino acid sequence into sequence table SEQ ID No.1 peptidoglycan recognition protein AJ-PGRP；
The primer is respectively as follows: F1:5 '-ATGGATGAACCGCCGCGTGCCTT-3 ', R1:5 '-ATGGTGATGTAT AATTTCTTG-3’。
3. a kind of application of the imitative stichopus japonicus peptidoglycan recognition protein with bactericidal activity as described in claim 1, feature exist In the AJ-PGRP of amino acid sequence is used to prepare broad-spectrum antiseptic class preparation or feed addition in the sequence table SEQ ID NO.1 Agent.
4. a kind of application of the imitative stichopus japonicus peptidoglycan recognition protein with bactericidal activity as described in claim 1, feature exist In the AJ-PGRP of amino acid sequence is used to prepare anti-Staphylococcus aureus, large intestine bar in the sequence table SEQ ID NO.1 Bacterium, Vibrio splindidus and bacillus subtilis preparation.
CN201611143071.2A 2016-12-07 2016-12-07 A kind of imitative stichopus japonicus peptidoglycan recognition protein and its preparation method and application with bactericidal activity Active CN106749588B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN201611143071.2A CN106749588B (en) 2016-12-07 2016-12-07 A kind of imitative stichopus japonicus peptidoglycan recognition protein and its preparation method and application with bactericidal activity

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201611143071.2A CN106749588B (en) 2016-12-07 2016-12-07 A kind of imitative stichopus japonicus peptidoglycan recognition protein and its preparation method and application with bactericidal activity

Publications (2)

Publication Number Publication Date
CN106749588A CN106749588A (en) 2017-05-31
CN106749588B true CN106749588B (en) 2019-03-29

Family

ID=58880473

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201611143071.2A Active CN106749588B (en) 2016-12-07 2016-12-07 A kind of imitative stichopus japonicus peptidoglycan recognition protein and its preparation method and application with bactericidal activity

Country Status (1)

Country Link
CN (1) CN106749588B (en)

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110066330B (en) * 2019-04-23 2020-06-09 山东大学 Apostichopus japonicus glucan binding protein and preparation method and application thereof
CN110904184A (en) * 2019-12-23 2020-03-24 上海海洋大学 Application of sea cucumber oligopeptide in bacteriostasis
CN111909947B (en) * 2020-08-04 2022-06-07 辽宁省海洋水产科学研究院 Preparation and application of apostichopus japonicus beta-thymosin
CN116143903A (en) * 2023-03-03 2023-05-23 沈阳药科大学 Peptidoglycan recognition protein-3, preparation method and application thereof

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
XP_011680358.1;无;《GENBANK》;20150324;全文

Also Published As

Publication number Publication date
CN106749588A (en) 2017-05-31

Similar Documents

Publication Publication Date Title
CN106749588B (en) A kind of imitative stichopus japonicus peptidoglycan recognition protein and its preparation method and application with bactericidal activity
Müller et al. The black soldier fly, Hermetia illucens–a promising source for sustainable production of proteins, lipids and bioactive substances
Suarez et al. Expression of a plant‐derived peptide harboring water‐cleaning and antimicrobial activities
Jin et al. Two antibacterial C-type lectins from crustacean, Eriocheir sinensis, stimulated cellular encapsulation in vitro
Badosa et al. Derivatives of the antimicrobial peptide BP100 for expression in plant systems
JP7156726B2 (en) Biosynthetic amyloid-based materials that display functional protein sequences
Orlov et al. Redesigning arenicin-1, an antimicrobial peptide from the marine polychaeta Arenicola marina, by strand rearrangement or branching, substitution of specific residues, and backbone linearization or cyclization
Shi et al. A new type antimicrobial peptide astacidin functions in antibacterial immune response in red swamp crayfish Procambarus clarkii
Soman et al. Discovery of Anas platyrhynchos avian β-defensin 2 (Apl_AvBD2) with antibacterial and chemotactic functions
CN109963578A (en) For the new antimicrobial of staphylococcus aureus
CN107857803A (en) Natural antibacterial peptide and its application
CN106636050A (en) Broad-spectrum endolysin derived from methicillin-resistant staphylococcus aureus bacteriophage and application thereof
Wang et al. A novel C-type lectin from the sea cucumber Apostichopus japonicus (AjCTL-2) with preferential binding of D-galactose
Hu et al. Identification and characterization of a novel short-type peptidoglycan recognition protein in Apostichopus japonicus
Wang et al. A lysin motif-containing protein (SpLysMD3) functions as a PRR involved in the antibacterial responses of mud crab, Scylla paramamosain
Stambuk et al. Big defensin from the scallop Argopecten purpuratus ApBD1 is an antimicrobial peptide which entraps bacteria through nanonets formation
CN106046173B (en) A kind of method that N-terminal fusion poly hexapeptide improves pig lysozyme antibiotic performance
CN101319216B (en) Preparation for recombined cultivated silkworm antimicrobial peptide CM4 and purification process
WO2007033529A1 (en) A gene encoding antibacterial protein of fenneropenaeus chinensis and its recombination expression method and uses
CN103772494B (en) Antibacterial peptide secreted by clostridium butyricum as well as preparation method and application thereof
CN110066330B (en) Apostichopus japonicus glucan binding protein and preparation method and application thereof
CN108026155A (en) New antimicrobial peptide, their variation and purposes
Wang et al. A novel ML domain-containing protein (SpMD2) functions as a potential LPS receptor involved in anti-Vibrio immune response
CN108794613B (en) Ostrea hongkongensis LysM protein with bacteriostatic activity and coding gene and application thereof
Stambuk et al. Big Defensin Ap BD1 from the scallop Argopecten purpuratus is an antimicrobial peptide which entraps bacteria through nanonets formation

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant