CN106699897A - Fusion protein used for screening MdmX inhibitor or testing inhibitory activity of MdmX inhibitor - Google Patents
Fusion protein used for screening MdmX inhibitor or testing inhibitory activity of MdmX inhibitor Download PDFInfo
- Publication number
- CN106699897A CN106699897A CN201611119574.6A CN201611119574A CN106699897A CN 106699897 A CN106699897 A CN 106699897A CN 201611119574 A CN201611119574 A CN 201611119574A CN 106699897 A CN106699897 A CN 106699897A
- Authority
- CN
- China
- Prior art keywords
- mdmx
- inhibitor
- sequence
- fusion protein
- binding
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 101150007128 MDM4 gene Proteins 0.000 title claims abstract description 164
- 108020001507 fusion proteins Proteins 0.000 title claims abstract description 113
- 102000037865 fusion proteins Human genes 0.000 title claims abstract description 113
- 239000003112 inhibitor Substances 0.000 title claims abstract description 100
- 238000012360 testing method Methods 0.000 title claims abstract description 45
- 238000012216 screening Methods 0.000 title claims abstract description 32
- 230000002401 inhibitory effect Effects 0.000 title claims abstract description 27
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 claims abstract description 74
- 230000027455 binding Effects 0.000 claims abstract description 66
- 238000009739 binding Methods 0.000 claims abstract description 65
- 239000012634 fragment Substances 0.000 claims abstract description 20
- 108010033276 Peptide Fragments Proteins 0.000 claims abstract description 4
- 102000007079 Peptide Fragments Human genes 0.000 claims abstract description 4
- 230000015572 biosynthetic process Effects 0.000 claims abstract description 4
- 108090000623 proteins and genes Proteins 0.000 claims description 19
- 230000009137 competitive binding Effects 0.000 claims description 18
- 102000004169 proteins and genes Human genes 0.000 claims description 18
- 239000002773 nucleotide Substances 0.000 claims description 10
- 125000003729 nucleotide group Chemical group 0.000 claims description 10
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 9
- 230000004927 fusion Effects 0.000 claims description 9
- 241000588724 Escherichia coli Species 0.000 claims description 6
- 239000013604 expression vector Substances 0.000 claims description 5
- 238000011144 upstream manufacturing Methods 0.000 claims description 5
- 239000000969 carrier Substances 0.000 claims description 2
- 238000000926 separation method Methods 0.000 claims description 2
- 238000012423 maintenance Methods 0.000 claims 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 abstract description 29
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 abstract description 28
- 150000001413 amino acids Chemical group 0.000 abstract description 17
- 230000005764 inhibitory process Effects 0.000 abstract description 7
- 238000000295 emission spectrum Methods 0.000 abstract description 2
- 239000008346 aqueous phase Substances 0.000 abstract 1
- BDUHCSBCVGXTJM-WUFINQPMSA-N 4-[[(4S,5R)-4,5-bis(4-chlorophenyl)-2-(4-methoxy-2-propan-2-yloxyphenyl)-4,5-dihydroimidazol-1-yl]-oxomethyl]-2-piperazinone Chemical compound CC(C)OC1=CC(OC)=CC=C1C1=N[C@@H](C=2C=CC(Cl)=CC=2)[C@@H](C=2C=CC(Cl)=CC=2)N1C(=O)N1CC(=O)NCC1 BDUHCSBCVGXTJM-WUFINQPMSA-N 0.000 description 44
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 30
- 150000001875 compounds Chemical class 0.000 description 23
- 150000003384 small molecules Chemical class 0.000 description 22
- 102000012199 E3 ubiquitin-protein ligase Mdm2 Human genes 0.000 description 21
- 108050002772 E3 ubiquitin-protein ligase Mdm2 Proteins 0.000 description 21
- 230000008859 change Effects 0.000 description 17
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical compound [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 15
- 239000000243 solution Substances 0.000 description 15
- 239000013612 plasmid Substances 0.000 description 14
- 229960000789 guanidine hydrochloride Drugs 0.000 description 13
- 230000029087 digestion Effects 0.000 description 12
- 239000000047 product Substances 0.000 description 12
- 241000894006 Bacteria Species 0.000 description 11
- 206010028980 Neoplasm Diseases 0.000 description 11
- 238000006243 chemical reaction Methods 0.000 description 11
- 230000000694 effects Effects 0.000 description 11
- 108090000765 processed proteins & peptides Proteins 0.000 description 11
- 108020004414 DNA Proteins 0.000 description 10
- 238000000034 method Methods 0.000 description 10
- 229920001184 polypeptide Polymers 0.000 description 10
- 102000004196 processed proteins & peptides Human genes 0.000 description 10
- 201000011510 cancer Diseases 0.000 description 9
- 210000004027 cell Anatomy 0.000 description 9
- 238000004448 titration Methods 0.000 description 9
- 238000011084 recovery Methods 0.000 description 8
- 238000013461 design Methods 0.000 description 7
- 238000002474 experimental method Methods 0.000 description 7
- 239000003292 glue Substances 0.000 description 7
- 230000002209 hydrophobic effect Effects 0.000 description 7
- 239000007788 liquid Substances 0.000 description 7
- 230000001629 suppression Effects 0.000 description 7
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 6
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- 229940083338 MDM2 inhibitor Drugs 0.000 description 6
- 239000012819 MDM2-Inhibitor Substances 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 239000007853 buffer solution Substances 0.000 description 6
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 6
- 239000001963 growth medium Substances 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 101100519158 Arabidopsis thaliana PCR2 gene Proteins 0.000 description 5
- 101100519159 Arabidopsis thaliana PCR3 gene Proteins 0.000 description 5
- 101150102573 PCR1 gene Proteins 0.000 description 5
- 238000005119 centrifugation Methods 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 238000010494 dissociation reaction Methods 0.000 description 5
- 230000005593 dissociations Effects 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 238000010257 thawing Methods 0.000 description 5
- FRXSZNDVFUDTIR-UHFFFAOYSA-N 6-methoxy-1,2,3,4-tetrahydroquinoline Chemical compound N1CCCC2=CC(OC)=CC=C21 FRXSZNDVFUDTIR-UHFFFAOYSA-N 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 101000702488 Rattus norvegicus High affinity cationic amino acid transporter 1 Proteins 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 239000013613 expression plasmid Substances 0.000 description 4
- 230000014509 gene expression Effects 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 239000008363 phosphate buffer Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 239000010453 quartz Substances 0.000 description 4
- 238000012163 sequencing technique Methods 0.000 description 4
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N silicon dioxide Inorganic materials O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 108010041986 DNA Vaccines Proteins 0.000 description 3
- 229940021995 DNA vaccine Drugs 0.000 description 3
- 108010078814 Tumor Suppressor Protein p53 Proteins 0.000 description 3
- 102000015098 Tumor Suppressor Protein p53 Human genes 0.000 description 3
- 101000980353 Xenopus laevis Protein Mdm4 Proteins 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 229910021529 ammonia Inorganic materials 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- -1 cationic amino acid Chemical class 0.000 description 3
- 238000000354 decomposition reaction Methods 0.000 description 3
- 239000003398 denaturant Substances 0.000 description 3
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 3
- 229910000397 disodium phosphate Inorganic materials 0.000 description 3
- 238000002875 fluorescence polarization Methods 0.000 description 3
- 238000002189 fluorescence spectrum Methods 0.000 description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 3
- 229930027917 kanamycin Natural products 0.000 description 3
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical class O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 3
- 238000004020 luminiscence type Methods 0.000 description 3
- 229910052757 nitrogen Inorganic materials 0.000 description 3
- 230000023603 positive regulation of transcription initiation, DNA-dependent Effects 0.000 description 3
- 238000004088 simulation Methods 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 230000003595 spectral effect Effects 0.000 description 3
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 3
- DWNBOPVKNPVNQG-LURJTMIESA-N (2s)-4-hydroxy-2-(propylamino)butanoic acid Chemical compound CCCN[C@H](C(O)=O)CCO DWNBOPVKNPVNQG-LURJTMIESA-N 0.000 description 2
- PXFBZOLANLWPMH-UHFFFAOYSA-N 16-Epiaffinine Natural products C1C(C2=CC=CC=C2N2)=C2C(=O)CC2C(=CC)CN(C)C1C2CO PXFBZOLANLWPMH-UHFFFAOYSA-N 0.000 description 2
- 102100027211 Albumin Human genes 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 101000589010 Homo sapiens Myomesin-1 Proteins 0.000 description 2
- 101000980354 Homo sapiens Protein Mdm4 Proteins 0.000 description 2
- 101000589013 Mus musculus Myomesin-1 Proteins 0.000 description 2
- 102100032971 Myomesin-1 Human genes 0.000 description 2
- 239000012505 Superdex™ Substances 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000022131 cell cycle Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 238000012875 competitive assay Methods 0.000 description 2
- 230000002860 competitive effect Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 230000005284 excitation Effects 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 238000002795 fluorescence method Methods 0.000 description 2
- 238000001506 fluorescence spectroscopy Methods 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 102000056819 human MDM4 Human genes 0.000 description 2
- 150000002460 imidazoles Chemical class 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 206010024627 liposarcoma Diseases 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 238000012856 packing Methods 0.000 description 2
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 238000004321 preservation Methods 0.000 description 2
- 239000012460 protein solution Substances 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 230000035939 shock Effects 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 238000001228 spectrum Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 230000009897 systematic effect Effects 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- SNBCLPGEMZEWLU-QXFUBDJGSA-N 2-chloro-n-[[(2r,3s,5r)-3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methyl]acetamide Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CNC(=O)CCl)[C@@H](O)C1 SNBCLPGEMZEWLU-QXFUBDJGSA-N 0.000 description 1
- TZFQICWZWFNIKU-KKUMJFAQSA-N Asn-Leu-Tyr Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 TZFQICWZWFNIKU-KKUMJFAQSA-N 0.000 description 1
- WNGZKSVJFDZICU-XIRDDKMYSA-N Asp-Leu-Trp Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC(=O)O)N WNGZKSVJFDZICU-XIRDDKMYSA-N 0.000 description 1
- FAUPLTGRUBTXNU-FXQIFTODSA-N Asp-Pro-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O FAUPLTGRUBTXNU-FXQIFTODSA-N 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 230000005778 DNA damage Effects 0.000 description 1
- 231100000277 DNA damage Toxicity 0.000 description 1
- 206010073135 Dedifferentiated liposarcoma Diseases 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- ZQPOVSJFBBETHQ-CIUDSAMLSA-N Gln-Glu-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O ZQPOVSJFBBETHQ-CIUDSAMLSA-N 0.000 description 1
- ZGHMRONFHDVXEF-AVGNSLFASA-N Gln-Ser-Phe Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O ZGHMRONFHDVXEF-AVGNSLFASA-N 0.000 description 1
- GZUKEVBTYNNUQF-WDSKDSINSA-N Gly-Ala-Gln Chemical compound NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(O)=O GZUKEVBTYNNUQF-WDSKDSINSA-N 0.000 description 1
- FZQLXNIMCPJVJE-YUMQZZPRSA-N Gly-Asp-Leu Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O FZQLXNIMCPJVJE-YUMQZZPRSA-N 0.000 description 1
- NTOWAXLMQFKJPT-YUMQZZPRSA-N Gly-Glu-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)CN NTOWAXLMQFKJPT-YUMQZZPRSA-N 0.000 description 1
- CSMYMGFCEJWALV-WDSKDSINSA-N Gly-Ser-Gln Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(N)=O CSMYMGFCEJWALV-WDSKDSINSA-N 0.000 description 1
- SOEGEPHNZOISMT-BYPYZUCNSA-N Gly-Ser-Gly Chemical compound NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O SOEGEPHNZOISMT-BYPYZUCNSA-N 0.000 description 1
- 102000001398 Granzyme Human genes 0.000 description 1
- 108060005986 Granzyme Proteins 0.000 description 1
- WYSJPCTWSBJFCO-AVGNSLFASA-N His-Met-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC1=CN=CN1)N WYSJPCTWSBJFCO-AVGNSLFASA-N 0.000 description 1
- PJLLMGWWINYQPB-PEFMBERDSA-N Ile-Asn-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N PJLLMGWWINYQPB-PEFMBERDSA-N 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 239000007836 KH2PO4 Substances 0.000 description 1
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 1
- HGCNKOLVKRAVHD-UHFFFAOYSA-N L-Met-L-Phe Natural products CSCCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 HGCNKOLVKRAVHD-UHFFFAOYSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- BABSVXFGKFLIGW-UWVGGRQHSA-N Leu-Gly-Arg Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCNC(N)=N BABSVXFGKFLIGW-UWVGGRQHSA-N 0.000 description 1
- FIYMBBHGYNQFOP-IUCAKERBSA-N Leu-Gly-Gln Chemical compound CC(C)C[C@@H](C(=O)NCC(=O)N[C@@H](CCC(=O)N)C(=O)O)N FIYMBBHGYNQFOP-IUCAKERBSA-N 0.000 description 1
- KGCLIYGPQXUNLO-IUCAKERBSA-N Leu-Gly-Glu Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCC(O)=O KGCLIYGPQXUNLO-IUCAKERBSA-N 0.000 description 1
- PBGDOSARRIJMEV-DLOVCJGASA-N Leu-His-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(O)=O PBGDOSARRIJMEV-DLOVCJGASA-N 0.000 description 1
- LXKNSJLSGPNHSK-KKUMJFAQSA-N Leu-Leu-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)O)N LXKNSJLSGPNHSK-KKUMJFAQSA-N 0.000 description 1
- XVZCXCTYGHPNEM-UHFFFAOYSA-N Leu-Leu-Pro Natural products CC(C)CC(N)C(=O)NC(CC(C)C)C(=O)N1CCCC1C(O)=O XVZCXCTYGHPNEM-UHFFFAOYSA-N 0.000 description 1
- ISSAURVGLGAPDK-KKUMJFAQSA-N Leu-Tyr-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O ISSAURVGLGAPDK-KKUMJFAQSA-N 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- ULUQBUKAPDUKOC-GVXVVHGQSA-N Lys-Glu-Val Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O ULUQBUKAPDUKOC-GVXVVHGQSA-N 0.000 description 1
- AIRZWUMAHCDDHR-KKUMJFAQSA-N Lys-Leu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O AIRZWUMAHCDDHR-KKUMJFAQSA-N 0.000 description 1
- YPLVCBKEPJPBDQ-MELADBBJSA-N Lys-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCCCN)N YPLVCBKEPJPBDQ-MELADBBJSA-N 0.000 description 1
- MXEASDMFHUKOGE-ULQDDVLXSA-N Met-His-Tyr Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O)N MXEASDMFHUKOGE-ULQDDVLXSA-N 0.000 description 1
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- MSSXKZBDKZAHCX-UNQGMJICSA-N Phe-Thr-Val Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O MSSXKZBDKZAHCX-UNQGMJICSA-N 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- KIPIKSXPPLABPN-CIUDSAMLSA-N Pro-Glu-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1 KIPIKSXPPLABPN-CIUDSAMLSA-N 0.000 description 1
- CPRLKHJUFAXVTD-ULQDDVLXSA-N Pro-Leu-Tyr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O CPRLKHJUFAXVTD-ULQDDVLXSA-N 0.000 description 1
- 238000011878 Proof-of-mechanism Methods 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- ZOHGLPQGEHSLPD-FXQIFTODSA-N Ser-Gln-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O ZOHGLPQGEHSLPD-FXQIFTODSA-N 0.000 description 1
- GYDFRTRSSXOZCR-ACZMJKKPSA-N Ser-Ser-Glu Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O GYDFRTRSSXOZCR-ACZMJKKPSA-N 0.000 description 1
- LGIMRDKGABDMBN-DCAQKATOSA-N Ser-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N LGIMRDKGABDMBN-DCAQKATOSA-N 0.000 description 1
- ABWNZPOIUJMNKT-IXOXFDKPSA-N Thr-Phe-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O ABWNZPOIUJMNKT-IXOXFDKPSA-N 0.000 description 1
- FQNUWOHNGJWNLM-QWRGUYRKSA-N Tyr-Cys-Gly Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CS)C(=O)NCC(O)=O FQNUWOHNGJWNLM-QWRGUYRKSA-N 0.000 description 1
- HFJJDMOFTCQGEI-STECZYCISA-N Tyr-Ile-Met Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N HFJJDMOFTCQGEI-STECZYCISA-N 0.000 description 1
- CVUDMNSZAIZFAE-TUAOUCFPSA-N Val-Arg-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@@H]1C(=O)O)N CVUDMNSZAIZFAE-TUAOUCFPSA-N 0.000 description 1
- CVUDMNSZAIZFAE-UHFFFAOYSA-N Val-Arg-Pro Natural products NC(N)=NCCCC(NC(=O)C(N)C(C)C)C(=O)N1CCCC1C(O)=O CVUDMNSZAIZFAE-UHFFFAOYSA-N 0.000 description 1
- WBAJDGWKRIHOAC-GVXVVHGQSA-N Val-Lys-Gln Chemical compound [H]N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(O)=O WBAJDGWKRIHOAC-GVXVVHGQSA-N 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 108010047495 alanylglycine Proteins 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 108010008355 arginyl-glutamine Proteins 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- UHOVQNZJYSORNB-UHFFFAOYSA-N benzene Substances C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000025084 cell cycle arrest Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 238000000695 excitation spectrum Methods 0.000 description 1
- 238000001215 fluorescent labelling Methods 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 238000009533 lab test Methods 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 108010068488 methionylphenylalanine Proteins 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000009149 molecular binding Effects 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 239000012452 mother liquor Substances 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 108010051242 phenylalanylserine Proteins 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108010026333 seryl-proline Proteins 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 108010045269 tryptophyltryptophan Proteins 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 229910021642 ultra pure water Inorganic materials 0.000 description 1
- 239000012498 ultrapure water Substances 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 208000022752 well-differentiated liposarcoma Diseases 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4746—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used p53
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/101—Plasmid DNA for bacteria
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicinal Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention discloses a fusion protein used for screening an MdmX inhibitor or testing the inhibitory activity of the MdmX inhibitor. The fusion protein comprises a test sequence, a binding sequence and a connecting arm sequence, wherein the test sequence is an MdmX sequence or an MdmX fragment containing a p53 binding structural domain in the p53 sequence; the binding sequence is a p53 sequence or a p53 fragment containing an MdmX binding structural domain in the p53 sequence; and the connecting arm sequence is a peptide fragment, the upper stream and the down stream of the connecting arm sequence are respectively connected with one of the test sequence and the binding sequence, an amino acid sequence of the connecting arm sequence does not participate in formation of a secondary structure of the fusion protein, and the length and flexibility of the connecting arm sequence are enough to enable any surface part of a space structure of the test sequence to be possibly in contact with any surface part of the space structure of the binding sequence in space. After the MdmX inhibitor competitively binds with the p53 binding structural domain in the binding sequence, released tryptophan in the binding sequence is completely exposed in an aqueous phase, tryptophan emission spectra in two states are different, and thus the inhibition degree of the MdmX inhibitor on MdmX can be effectively determined.
Description
Technical field
The invention belongs to biological technical field, it is related to a kind of suppression for screening MdmX inhibitor or test Mdmx inhibitor
The preparation and application of the recombinant protein of activity are made, a kind of p53 polypeptides and MdmX aminoterminals fusion protein and its class is more particularly to
Like the preparation and its application in the inhibitory activity of screening MdmX inhibitor or test MdmX inhibitor of thing.
Background technology
P53 is a kind of cancer suppressor protein, is sent out in the bioprocess such as cell-cycle arrest, DNA damage reparation and Apoptosis
The effect of waving, and turned into important cancer target.The suppression canceration activity of p53 is subject to intracellular overexpression MdmX and Mdm2
Suppression, it is related to more than half cancers.It is the target for developing novel cancer medicine to release suppression of the MdmX and Mdm2 to p53
Point.
MdmX and Mdm2 are the important controlling gene albumen in p53 downstreams, and MdmX and Mdm2 is homologous protein, and both structures are high
Degree is similar, but it is different to suppress the mechanism of p53.The screening and design of current Mdm2 inhibitor are more ripe, and many has been entered
Enter clinical investigation phase, such as nutlin-3a modifieds molecule RG7112 will enter II phase clinical researches (Ray-
CoquardI,Blay J Y,Italiano A,et al.Effect of the MDM2antagonist RG7112on the
P53pathway in patients with MDM2-amplified,well-differentiated or
dedifferentiated liposarcoma:an exploratory proof-of-mechanism study[J].The
lancet oncology,2012,13(11):1133-1140).But, the Effective selection and design progress of MdmX inhibitor delay
Slowly.Due to resistance problems (Lane D P, Cheok C F, the Lain S.p53-based cancer of Mdm2 inhibitor
therapy[J].Cold Spring Harbor perspectives in biology,2010,2(9):A001222.), cancer
MdmX in cell can further overexpression, the deterioration of aggravation cancer cell.Therefore, MdmX inhibitor is found, and with MdmX as base
Plinth and the MdmX/Mdm2 double inhibitors that design are the active drugs for treating nearly half cancer.
There is the binding domain of p53 in the N-terminal of MdmX, the p53 binding domain of MdmX can be with the transcriptional activation structure of p53 albumen
Domain combines, and forms p53/MdmX complexs, and the complex can suppress the transcriptional activity of p53, but does not mediate the degraded of p53,
Make p53 protein inactivations and induced tumor.
If a kind of compound, the transcriptional activity of p53 with p53-MdmX compound competitive bindings, can be discharged, or with competing
Striving property or irreversibility combine free MdmX, then this compound can be released or suppression of the past release MdmX to p53, be made
The effect that p53 plays suppression cancer is obtained, therefore, this compound can be considered the medicine for the treatment of or the alleviation of cancer.
Some are disclosed in the prior art by technical side that MdmX inhibitor is tested with p53 competitive bindings MdmX
Case.
Chinese patent literature CN105936646 (publication date：2016.09.14 the mini albumen of a class and its application) are disclosed.
The mini albumen with the 3 α helical bundles in albumin combination domain as skelemin, and in the three-dimensional structure table of the skelemin
In face, N-terminal, C-terminal at least one at introduce and have cationic amino acid, and be at least connected with p53 through the cationic amino acid
The key amino acid site combined with MDM2/MDMX.The mini albumen has concurrently into born of the same parents and is combined with albumin, MDM2/MDMX
Ability, and can well suppress the interaction between p53 and Mdm2/MdmX, can be used to prepare cancer therapy drug etc., can be used to advise
Modelling is produced and applied.The fluorescence polarization detection of the combination of little albumen and Mdm2/MdmX.
Chinese patent literature CN103923067 (publication date：2014.07.16 a kind of small molecule of MdmX/Mdm2) is disclosed
Inhibitor, also relates to a kind of preparation method of the micromolecular inhibitor of MdmX/Mdm2, the molecule inhibitor compounds energy
Suppress the interaction of MdmX protein and p53 albumen, can also suppress the interaction of Mdm2 protein and p53 albumen, the party
MdmX inhibitor screenings are determined using fluorescence polarization method in method.
Come with some shortcomings in the model of the inhibitor of above-mentioned detection MdmX：
1.p53 fragments are separately added into test system with MdmX fragments, and the mol ratio of the two is difficult to be accurately determined, will
Bring larger systematic error or random error.
2. p53 fragments are marked using fluorescein in scheme, this will make in each marking operation, fluorescein molecule and p53
The mol ratio of fragments molecules is not quite identical, can bring about larger random error, is just more difficult to carry out accurately quantitative study.
3. p53 fragments are marked using fluorescein in scheme, and fluorescein holds easy decomposition and degeneration and loses glimmering under visible light
Light function, this requires corresponding operating lucifuge, and photic decomposition can reduce the accuracy of detection method, it is desirable to which lucifuge can increase operation
Difficulty and experimental cost.
4., due to the hydrophobicity of fluorescein, the accuracy of detection method and data is reduced.
5.p53 fragments and MdmX need to prepare respectively, can increase the complexity of operation.
Although 6. MdmX and Mdm2 is homologous protein, both three-dimensional structures are highly similar, existing Mdm2 little molecules in inhibiting
Agent is very weak to the inhibition of MdmX.
7. MdmX inhibitor visibly different for amount of force is tested with same model, it is impossible to distinguish strong
MdmX inhibitor is in weak MdmX inhibitor, it is often more important that, the weaker MdmX inhibitor of active force may be due to can not be effectively
Competitive binding p53 domains are without detecting.
The content of the invention
Protein has a light absorbs phenomenon in the range of 270~300nm absorbing wavelengths, and this optical absorption property is mainly and comes from
Tryptophan, tyrosine and phenylalanine in protein, so the protein containing the amino acid has natural fluoresence property.
When not having tryptophan in protein, its maximum emission wavelength is about at 304nm, and the position of its fluorescence spectrum is not divided greatly
The influence of sub- conformation；When there is tryptophan in protein, the hydrophobic ring residing for its fluorescent emission maximum wavelength and tryptophan
Border degree has obvious relation, its fluorescence maximum emission wavelength in the range of 308~355nm (Vivian, J.T.Callis, P.R.,
Mechanisms of tryptophan fluorescence shifts in proteins.HYPERLINK"https://
Www.ncbi.nlm.nih.gov/pmc/articles/PMC1301402/ " Biophys J.2001,80 (5):2093–
2109), when tryptophan is imbedded in hydrophobic pocket completely, fluorescence emission wavelengths in 321nm or so, when being completely exposed to water phase,
Fluorescence emission wavelengths are in 350nm or so.
The complex crystal structure that the MdmX (23~111 sequence) for having parsed and p53 (15~29 sequence) is formed
(PDB ID:3DAB, referring to document：Popowicz G,Czarna A,Holak T.Structure of the human Mdmx
protein bound to the p53tumor suppressor transactivation domain[J].Cell
Cycle,2008, 7(15):2441-3.) show, the transcriptional activation domain (15~29 sequence) of p53 passes through 3 in alpha-helix form
Key amino acid (Phe19, Trp23 and Leu26) interacts with the N- ends hydrophobic region of MdmX.3 crucial works on MdmX
With site three binding pockets, i.e. F19 pockets, W23 pockets and L26 pockets are constituted together with its neighbouring amino acid.
N- terminal domains (23~111 sequence) corresponding domain of people source MdmX is referred to as p53 integrated structures herein
Domain (is defined as N-MdmX), is called that MdmX binding structural domains (are defined as by the corresponding domain of 15~29 sequences of people source p53
p53p)。
To solve at least the above technical problem, the present invention provides one kind and suppresses for screening MdmX inhibitor or test MdmX
The fusion protein of the inhibitory activity of agent.Its core idea is as mentioned below.
P53p is connected with N-MdmX by one section of linking arm amino acid sequence (being defined as XX), fusion protein is formed, should
(23 herein represent the tryptophan from the 23rd of wild-type p 53 protein to the tryptophan Trp23 of p53p fragments in fusion protein
Position, without representing the position in fusion protein, similarly hereinafter), it is both the key amino acid combined with N-MdmX, it is again that endogenous is glimmering
Light probe.(, its fluorescent emission maximum wavelength will reflect the binding ability of p53p fragments and N-MdmX.Because the tryptophan is buried
(Popowicz G, Czarna A, the Holak T.Structure of the human in N-MdmX binding pocket hydrophobic pockets
Mdmx protein bound to the p53tumor suppressor transactivation domain[J].Cell
Cycle,2008,7(15):2441-3.), its fluorescent emission maximum wavelength is in 321nm.When MdmX inhibitor competitively with this
After the p53 binding structural domains of the MdmX parts in fusion protein are combined, part or all of p53p will be separated with N-MdmX, this
When tryptophan Trp23 be completely exposed to water phase, the fluorescence signal intensity at 321nm will increase with inhibitor concentration and occur aobvious
Change is write, and there is certain mathematical, while fluorescence emission wavelengths are also to the red shift of 350nm directions.
Therefore, in MdmX inhibitor fore-and-aft survey fusion protein system to be measured is added 321nm launching lights Strength Changes,
Size of the MdmX inhibitor to the inhibitory activity/inhibition level of MdmX can be calculated, and then, the fusion protein serves screening
The effect of MdmX inhibitor or the effect of the inhibitory activity of test MdmX inhibitor.
Against existing technologies, the fusion protein at least has the following advantage：
MdmX binding structural domains in the p53 binding structural domains of MdmX and p53 due to being present on same peptide chain, they
Molal quantity be equal, be fixed with the relative amount of MdmX equivalent to the p53 parts competed with MdmX inhibitor, this will
Reduce the random error between batch operation.This 1：1 pattern also can more accurately reflect part and the p53p parts of screening
The ability of competitive binding MdmX protein surface hydrophobic pockets.
The fusion protein does not need mark fluorescent probe, the error that would not come because of the degree different band of fluorescence labeling.
Tryptophan in fusion protein does not meet with light decomposition yet, and tryptophan and the mol ratio of fusion protein are changeless, and
The emission spectrum of corresponding tryptophan is different when p53p is in combination or free state from the tryptophan that MdmX is combined.Therefore, no
Need in lucifuge equipment, and above-mentioned fusion protein, free tryptophan Trp23 is tied with free p53 parts and with MdmX parts
The MdmX inhibitor of conjunction (assumes initially that the mol ratio that MdmX inhibitor is combined with MdmX is 1：1) be it is equimolar, with reference to color
Propylhomoserin Trp23 and p53 parts are equimolar with the compound of MdmX parts, and corresponding launching light is 321nm or so, that is,
Say the situation of change of intensity for adding 321nm launching lights before and after MdmX inhibitor is with the degree of MdmX inhibitor competitive bindings
It is corresponding, compared with the prior art, there is smaller systematic error or random error.
To achieve these goals, this is used for the fusion of the inhibitory activity for screening MdmX inhibitor or test MdmX inhibitor
The core technology scheme of albumen is：
The fusion protein includes cycle tests, binding sequence and linking arm sequence；
The cycle tests is MdmX sequences or the MdmX fragments comprising the p53 binding structural domains in MdmX sequences；
The binding sequence be p53p sequences, the p53 fragments comprising the MdmX binding structural domains in p53 sequences or keep with
MdmX has the mutant of the p53 fragments comprising the MdmX binding structural domains in p53 sequences of binding activity；
The linking arm sequence is a peptide fragment, the upstream and downstream of the linking arm respectively with the cycle tests and the knot
Close the connection of one of sequence；The amino acid sequence of the linking arm is not involved in formation or the dimension of the secondary structure of the fusion protein
Hold；Any surface part and the combination of the length of the linking arm and the flexible space structure for being enough to make the cycle tests
Any surface part of the space structure of sequence spatially has an opportunity to be in contact.
Alternatively, the upstream or downstream of the fusion protein have the sequence label for Protein Separation and/or purifying.
Further, due to people source p53 (GenBank:AB082923.1 there are four tryptophans, only one of which color in)
Propylhomoserin falls into its MdmX binding structural domain；People source MdmX genes (GeneBank:AF007111.1 there are seven tryptophans in), not
Fall into p53 binding structural domains.Further technical scheme is, by the p53 domains of the MdmX domains of p53 and MdmX by connecting
Arm connection is connect, and tryptophan is not contained in linking arm.So, only have unique trp residue, the color ammonia in whole fusion protein
The fluorescence spectrum of acid changes with the environment of tryptophan.It is exactly specifically when p53 binding structural domains and MdmX binding structural domains
When being combined, the unique trp residue in fusion protein is ensconced in hydrophobic pocket, and fluorescence emission wavelengths are in 321nm or so.
After MdmX inhibitor is with the p53 binding structural domain combinations in MdmX, just by the unique color ammonia in part or all of fusion protein
Sour residue is exposed to water phase, and fluorescence emission wavelengths are in 350nm or so.In such cases, before and after MdmX inhibitor to be measured is added
The intensity of 321nm launching lights in measurement fusion protein system, avoids not combined with MdmX inhibitor and changing the characteristics of luminescence
Tryptophan tryptophan luminescent spectrum influence, also can just make experimental results sensitiveer.
Specifically, for above-mentioned purpose, the technical scheme is：
Fusion protein formula p53p-XX-N-MdmX is represented, it is characterised in that
P53p represents the binding sequence SEQ ID NO.1, specially：SQETFSDLWKLLPEN；
XX represents the linking arm sequence SEQ ID NO.2, specially：GSGSSENLYFQ；
N-MdmX represents the cycle tests SEQ ID NO.3, specially：
GSQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSP
LYDMLRKNLVTLAT；
In p53p-XX-N-MdmX fusion proteins, the primary structure of amino acid shows, a color ammonia is only existed in its sequence
Acid, and it also corresponds to the key amino acid that p53 polypeptides and N-MdmX interact, can be according to the endogenous fluorescence of tryptophan
Feature is screened and the micromolecular compound in p53p-XX-N-MdmX fusion proteins with p53 polypeptide competitive bindings MdmX.
For the convenience purified after expressing fusion protein, can be merged in fusion protein fused upstream His-Tag sequence
Histidine-tagged fusion protein sequence can be：
GSSHHHHHHGSSQETFSDLWKLLPENGSGSSENLYFQGSQINQVRPKLPLLKILHAAGAQGEMFTVKEV
MHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLAT
Different MdmX inhibitor has difference with the binding ability of MdmX, and the MdmX stronger for binding ability suppresses
Agent, its can fully with p53 partial competition combination MdmX parts.And the MdmX inhibitor weaker for binding ability, it can
The degree that detectable competitive binding occurs can be not enough to.Therefore above-mentioned fusion protein cannot effectively detect such MdmX
Inhibitor.
In order to further enable above-mentioned fusion protein detect the MdmX inhibitor of weak binding power, a kind of scheme is by prominent
Become MdmX binding structural domains, the adhesion between MdmX binding structural domains and p53 binding structural domains is died down, for example will be with MdmX
With reference to one of p53p key amino acids Phe19 or Leu26 (this 19 or 26 represent corresponding p53p in amino acid in wild type
Position, similarly hereinafter) mutation, MdmX binding structural domains and the combination of p53 binding structural domains is died down, to make adhesion weaker
MdmX inhibitor be able to MdmX binding structural domain competitive binding p53 binding structural domains, make fusion protein can be used in screening
The inhibitory activity of the weaker MdmX inhibitor of adhesion or the weaker MdmX inhibitor of test adhesion.Weakened using the two
Model can further screen micromolecular compound of the affinity in the range of micro-molar concentration.
Specifically, the technical scheme is：
The binding sequence that p53p is represented is sported：SQETASDLWKLLPEN.
The binding sequence that p53p is represented is sported：SQETFSDLWKLAPEN.
Present invention also offers a kind of nucleotide sequence, the nucleotide sequence can be expressed described in as above each scheme
Fusion protein for screening the inhibitory activity of MdmX inhibitor or test MdmX inhibitor.
Alternatively, above-mentioned nucleotides sequence is classified as SEQ ID NO.04 (the base sequences for expressing p53p-XX-N-MdmX
Row), SEQ ID NO.05 are (for expressing p53pF19AThe base sequence of-XX-N-MdmX) or SEQ ID NO.06 (for expressing
p53pL26AThe base sequence of-XX-N-MdmX) shown in sequence.
Present invention also offers a kind of fusion for screening the inhibitory activity of MdmX inhibitor or test MdmX inhibitor
The expression vector of albumen, the expression vector can suppress by described in host expresses as above each scheme for screening MdmX
The fusion protein of the inhibitory activity of agent or test MdmX inhibitor.
Alternatively, the carrier is pET28a carriers, and the host is e. coli bl21 (DE3).
Press down for screening MdmX inhibitor or test Mdmx present invention also offers described in a kind of as above each scheme
The fusion protein of the inhibitory activity of preparation screening MdmX inhibitor or test Mdmx inhibitor inhibitory activity purposes, its
In, the MdmX inhibitor is can be with the inhibitor of P53 competitive bindings MdmX.
More specifically, nutlin-3a also has certain as a kind of generally acknowledged stronger Mdm2 inhibitor to MdmX
Inhibitory action, the K of nutlin-3a and MdmX and Mdm2dValue be respectively 28 μM, 0.7 μM (Laurie N A, Donovan S L,
Shih C S,et al.Inactivation of the p53pathway in retinoblastoma.[J].Nature,
2006,444(7115):61-6).Using nutlin-3a as the generation for identifying p53p-XX-N-MdmX fusion protein model validations
Table small molecule is rational.
In addition, the 32 Mdm2 micromolecular inhibitors that can be obtained with business are further reflected to this model
It is fixed.
In order to realize above-mentioned purpose, present invention employs following technical measures：
The present invention constructs p53p-XX-N-MdmX, p53p using molecular cloningF19A- XX-N-MdmX and p53pL26A-XX-
N-MdmX fusion protein expression plasmids, and prepared using colibacillus engineering BL21 (DE3) expression, purifying.Using F-7000
Sepectrophotofluorometer analyzes the competitive knot of nutlin-3a and 32 Mdm2 inhibitor and p53p-XX-N-MdmX fusion proteins
Conjunction ability is verified with this model to screen the feasibility and validity of inhibitor with this.Afterwards by key amino acid Phe19 and
Leu26 sports Ala and constructs p53p respectivelyF19A- XX-N-MdmX and p53pL26ATwo fusion protein screening moulds of-XX-N-MdmX
Type, and the stability of mutation rear fusion protein is demonstrated using protein denaturant guanidine hydrochloride, as a result also demonstrate that crucial amino
P53p weakens with the binding ability of MdmX aminoterminals after acid mutation, afterwards, by the LS45/55 types fluorescence/phosphorus of PerkinElmer
Light/luminescence spectrophotometer screens nutlin-3a and 32 Mdm2 inhibitor simultaneously with three kinds of models, and the selection result shows,
The model for the improving inhibitor low to screening affinity is significantly more efficient.
Brief description of the drawings
Fig. 1 is p53p-XX-N-MdmX fusion protein tertiary structure figures.
Fig. 2 is that p53p-XX-N-MdmX fusion protein expression plasmids build three step PCR reaction conditions.
Fig. 3 be p53p-XX-N-MdmX fusion protein purifications during sample by SDS- after Ni-NTA chromatographies
PAGE glue figure (a), rear AKTA collection of illustrative plates (b) and SDS- are further purified by gel chromatographic columnses (75pg of Supredex 16/600)
PAGE glue figure (c).
Fig. 4 is p53p-XX-N-MdmX fusion proteins in λEXDuring for 278nm, λEMIt is glimmering in the range of 290nm~500nm
The light curve of spectrum (a) and in λEMDuring for 321nm, λEXIn excitation light spectral curve (b) of 245nm~300nm.
Fig. 5 is that nutlin-3a titration concentrations are OD280nmDuring=0.1 p53p-XX-N-MdmX fusion proteins, λEX
278nm, as nutlin-3a concentration increases, λEMIt is fluorescence intensity change curve (a) and λ in the range of 290nm~500nmEM
The matched curve (b) of peak fluorescence intensity trend at 321nm.
Fig. 6 is competitive binding ideographs of the nutlin-3a to p53p-XX-N-MdmX fusion proteins.
Fig. 7 is λEXIn 278nm, nutlin-3a (a) and p53p (b) are in λEMFluorescence in the range of 290nm~500nm
Spectral radiation curves.
Fig. 8 is that DMSO (without nutlin-3a) titration concentration is OD280nmDuring=0.1 p53p-XX-N-MdmX fusion proteins,
λEXDuring=278nm, as DMSO concentration increases, λEMIt is fluorescence intensity change curve (a) and λ in the range of 290nm~500nmEM
The matched curve (b) of peak fluorescence intensity at 321nm.
Fig. 9 is that nutlin-3a and 32 Mdm2 micromolecular inhibitor of contrast is to p53p- using nutlin-3a as control
The Competitive assays constant Ki values of XX-N-MdmX fusion proteins.
Figure 10 is p53pF19A- XX-N-MdmX (a) and p53pL26A- XX-N-MdmX (b) fusion proteins tertiary structure is simulated
Figure.
Figure 11 is that p53p-XX-N-MdmX fusion protein mutant expression plasmid builds three step PCR reaction conditions.
Figure 12 is p53pF19ADNA glue figures in-XX-N-MdmX fusion protein molecule cloning procedures.
Figure 13 is λEXIn 278nm, with the increase of concentration of guanidine hydrochloride, p53p-XX-N-MdmX (a), p53pF19A-XX-
N-MdmX (b) and p53pL26AThe fluorescence emission spectral curve of-XX-N-MdmX (c) fusion proteins is in λEM290nm~500nm's
Variation tendency.
Figure 14 is that three kinds of fusion proteins are respectively in λ as concentration of guanidine hydrochloride increasesmaxAt 321nm, 331nm and 330nm
Peak fluorescence intensity changing trend diagram.
Figure 15 be with p53p-XX-N-MdmX fusion proteins be control, use p53pF19A- XX-N-MdmX and p53pL26A-XX-
32 Mdm2 micromolecular inhibitors of N-MdmX fusion proteins model discrimination and nutlin-3a show mutation rear fusion protein to small
The change of molecule binding ability.
Specific embodiment
In order to preferably explain technical scheme, each implementation of the invention is discussed in detail below in conjunction with the accompanying drawings
Example.Following examples are used to further illustrate the present invention, but should not be construed as to fixation of the invention or limitation.If not referring in particular to
It is bright, in embodiment technical characteristic used could alternatively be with equivalent under the premise of without departing substantially from inventive concept or identity function or
Other techniques known in the art features of effect, any combination of disparate modules of the invention each falls within protection model of the invention
Enclose.
Embodiment 1：P53p-XX-N-MdmX fusion protein expression plasmids build
With the crystal of the MdmX binding structural domains p53p of p53 that has announced and the p53 binding structural domains of MdmX aminoterminals
Structure (PDB ID：(with reference to Structure of the human Mdmx protein bound to the based on 3DAB)
p53tumor suppressor transactivation domain,Popowicz,G.M.,Czarna,A.,Holak,T.A.
(2008)CellCycle7:2441-2443), we establish following p53p-XX-N-MdmX fusion proteins model.
The amino acid sequence of p53p-XX-N-MdmX fusion proteins is as follows (to remove albumen after label G SSHHHHHHGS
The tertiary structure of matter with PymolWin simulate simulation drawing is as shown in Figure 1)：
GSSHHHHHHGSSQETFSDLWKLLPENGSGSSENLYFQGSQINQVRPKLPLLKILHAAGAQGEMFTVKEV
MHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLAT
Wherein, MdmX binding structural domain sequences of the SQETFSDLWKLLPEN from p53,
GSQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSP
P53 binding structural domain sequences of the LYDMLRKNLVTLAT from MdmX, GSGSSENLYFQ is linking arm amino acid sequence.
GSSHHHHHHGS contributes to the sequence label that fusion protein is isolated and purified, and the GSS or GS of both end of which are flexible amino acid
Fragment.
It is inclined according to e. coli bl21 (DE3) codon in order to build above amino acid sequence by molecular cloning
Good property has synthesized the DNA sequence dna of N-MdmX, and its nucleotide coding sequence is as shown in SEQ ID NO.4.
By the nucleotides by Nco I and EcoR I double digestions, pET28a plasmids (the double enzymes of Nco I and EcoR I are connected to
Cut) on, by molecular cloning flow, the recombinant plasmid of the coded sequence containing N-MdmX is obtained, it is named as pET28a-N-
MdmX。
In order to build and expressing above fusion protein, according to the pET28a-N-MdmX plasmids for having built, following drawing is devised
Thing sequence：
Primer1:5'-CAT GCC ATG GGC AGC AGC CAT CAC CAT CAT CAC CAC GGC AGC-3'
Primer2:5'-GTT TCC ACA GAT CGC TAA AGG TTT CCT GGC TGC TGC CGT GGT
GAT GAT G-3'
Primer3:5'-TTA GCG ATC TGT GGA AAC TGC TGC CGG AAA ATG GCA GCG GCA
GCA GCG A-3'
Primer4:5'-CGG GAT CCC TGA AAA TAC AGG TTT TCG CTG CTG CCG CTG CCA-3'
Fragment amplification is carried out according to following system with the primer for designing.
PCR system 1:
PCR1 reaction conditions are as shown in Fig. 2-a；
PCR system 2:
PCR2 reaction conditions are as shown in Fig. 2-b；
PCR system 3:
PCR3 reaction conditions are as shown in fig. 2-c；
PCR3 product agents box is reclaimed, recovery product Nco I and the double digestions of BamH I, as Insert Fragment.
PCR recovery product digestion systems：
37 DEG C, 3h, digestion products kit (OMEGA, Plasmid Mini Kit I) is reclaimed.
In above three PCR reactions, masterplate, two primer base complementary pairings are not needed in PCR1 and PCR2 reaction systems
Extend, two sections of nucleotide sequences are formed, without recovery product.With PCR1 and PCR2 products as masterplate, fusion DNA vaccine experiment is carried out,
For PCR3 is tested.And then obtained containing histidine-tagged, p53p and XX fusion nucleotide sequences, by after digestion, being connected to
On pET28a-N-MdmX plasmids.
By pET28a-N-MdmX plasmids Nco I and the double digestions of BamH I, as carrier.
Plasmid vector digestion system：
37 DEG C, 3h, digestion products cut glue kit (health is century, Gel Extraction Kit) recovery.
It is 1 that coupled reaction presses carrier DNA with Insert Fragment DNA mol ratios:3 ratios mix, and add high with system identical
Effect DNA ligase (TOYOBO, Ligation high Ver.2), connects 3h by 16 DEG C.
Whole connection products are transferred in 50 μ l DH5 α (top10) Escherichia coli, the min of ice bath 30, after 42 DEG C of heat shock 90s
Ice bath is put back to immediately, and 2min adds the activation of 200 μ l LB fluid nutrient mediums, 37 DEG C, applied again after 200rpm shaken cultivations 1h recoveries
LB solid medium flat boards containing kanamycins, 37 DEG C are inverted 12~16h of culture, observe colony growth situation.
With the presence of single bacterium colony, bacterium solution PCR identifications are carried out, band is correct, upgrading grain pET28a-p53p-XX-N-MdmX, matter
Granzyme cuts identification, and band is correct, send plasmid order-checking, and sequencing result is correct, and preservation of bacteria strain is stand-by.
PET28a-p53p-XX-N-MdmX sequencing results nucleotide sequence is as shown in SEQ ID NO.4.
Embodiment 2：P53p-XX-N-MdmX expressing fusion proteins and purifying
PET28a-p53p-XX-N-MdmX plasmids are transferred to e. coli bl21 (DE3)；Choose single bacterium and fall 2ml LB K+(Kanamycin) culture medium, 37 DEG C, 200rpm incubated overnights；Take 500 μ l bacterium solutions and be transferred to 50ml LB K+Culture medium, 37 DEG C,
200rpm cultivates 3h；50ml bacterium solutions are transferred to 1L LB K entirely+Culture medium, 37 DEG C, 200rpm cultures, until cell concentration reaches
OD280nm=0.8 or so, IPTG (final concentration 0.4mM) inductions are added, (centrifuge parameters set about 20h collects thallines during collects thalline
Be set to 3500rpm, 30min, 4 DEG C).
Ultrasonic cell-break crusher machine cell.According to thalline volume：Buffer solution volume=1:5 ratio, adds
BuffeA buffer solutions (50mM Na2HPO4, 200mM NaCl, 10mM imidazoles, 1mM BME (beta -mercaptoethanol), pH8.0), parameter
It is set to：Total time 2min；Ultrasonic time 2s；Off time 4s；24 DEG C of temperature alarming；(the Ningbo Xin Zhisheng of ultrasonic power 40%
The JY92-IIN ultrasonic cell disruptors of thing Science and Technology Co., Ltd.).Repeat 2~3 times, until bacterial cell disruption is complete.Will
Clasmatosis liquid is dispensed with 50ml centrifuge tubes and balanced, centrifugation, 30min, 4 DEG C, 18000rpm, and supernatant, precipitation are collected in respectively
In reagent bottle (pipe).
Broken supernatant is crossed into Ni-NTA chromatographic columns (Fig. 3 a) and gel chromatographic columnses (Supredex 16/ by AKTA pure
60075pg or Superdex 26/60075pg, Fig. 3 b, c), collect the albumen of purifying, concentration, packing, every 200 μ l, liquid nitrogen
It is quick-frozen, freeze in -80 DEG C of refrigerators.
Embodiment 3：P53p-XX-N-MdmX fusion protein model spectrofluorimetries
The p53p-XX-N-MdmX albumen for the 200 μ l for freezing is taken, quick-thawing uses phosphate buffer diluted protein
Concentration is to OD280nm=0.1.400 μ l are taken in quartz colorimetric utensil, fluorescent scanning is carried out on F-7000 sepectrophotofluorometers.
Endogenous fluorescence feature according to tryptophan, takes λEXIt is 278nm, scans λEMFluorescence intensity in the range of 290nm~500nm, hair
Existing maximum fluorescence intensity is at 321nm (Fig. 4 a).Therefore determine λEMIt is 321nm, scans λEXIt is the fluorescence excitation spectrum of 245nm~300nm
Curve, as a result as shown in Figure 4 b, will also realize that in λEXIn 278nm, fluorescence intensity is maximum, therefore determines a length of 278nm of excitation light wave.
Embodiment 4：Using p53p-XX-N-MdmX fusion protein fluorescence spectrometry nutlin-3a and MdmX affinity
The p53p-XX-N-MdmX albumen frozen in -80 DEG C is taken, quick-thawing is diluted to albumen dense with phosphate buffer
It is OD to spend280nm=0.1,400 μ l are taken in quartz colorimetric utensil, take λ on F-7000 sepectrophotofluorometersEXIt is 278nm, λEM
Fluorescent scanning is carried out in 290nm~500nm scopes.It is dense according to nutlin-3a in such as table 1 below (mother liquor 2.5mM, be dissolved in DMSO)
Degree gradient is titrated (often nutlin-3a of addition will be well mixed).
The nutlin-3a of table 1 titrates p53p-XX-N-MdmX fusion protein concentration gradients
Nutlin-3a to the competitive binding ideograph of p53p-XX-N-MdmX fusion proteins, as shown in Figure 6.
It is as shown in Figure 5 a influence of the different nutlin-3a concentration to fusion protein fluorescence spectrum, with nutlin-3a drops
Determine the increase of concentration, the fluorescence intensity at maximum emission wavelength 321nm occurs significant changes.In figure 5b with nutlin-3a
For 0 μM of peak fluorescence intensity is standard, with nutlin-3a change in concentration, in the fluorescence intensity level variation tendency of 321nm
Figure, is fitted to trend curve according to equation below, and fitting result can obtain inhibition constants of the nutlin-3a to N-MdmX
(KiValue, competition binding dissociation constant), fitting result is as shown in Figure 5 b.
Fitting formula is：fi=I/ [I+Ki(1+LT/Kd)] (with reference to Chen Y, Prusoff W H.Relationship
between the inhibition constant and the concentration of an inhibitor that
Cause a 50%inhibition of an enzyme reaction [J] .Biochem Pharmacol, 1973,22:
3099-3108.)；Wherein, fiThe part inhibition level competed N-MdmX for inhibitor (is change in fluorescence relative intensity, specifically
Unit is percentage, sees below and illustrates).I is increased inhibitor concentration (μM) in Reverse transcriptase；Ki dissociates for competitive
The affine dissociation constant of constant, i.e. inhibitor and p53p competitive bindings N-MdmX；LTIt is the concentration (μ of p53p in fusion protein
M)；KdBe dissociation constant, i.e. the affine dissociation constant of p53p and N-MdmX.
And inhibitor is to N-MdmX Competitive assays degree fiCan be reflected by the pad value of fluorescence, i.e. fi=(A1-y)/
(A1-A2), wherein A1 is fluorescence intensity maximum in matched curve, and A2 is fluorescence intensity minimum value in matched curve, and y is fitting
Any point on curve, the formula after integration is：Y=A1-X (A1-A2)/[X+Ki (1+LT/Kd)]。
Can significantly judge to increase with the concentration of nutlin-3a from Fig. 5 a, there are two obvious peak shape ripples in figure
It is dynamic, λEMIt is 321nm and λEMIt is 350nm~450nm, wherein λEMAt 321nm to be peak that fluorescence intensity is gradually reduced, the above
Analyze with being clarified above, the change at the peak is the Strength Changes of the transmitting fluorescence of tryptophan.And in the range of 350nm~450nm
Side peak that a fluorescence intensity gradually increases, by individually respectively to small molecule nutlin-3a and p53p (synthesis containing 15
Individual amino acid polypeptide：SQETFSDLWKLLPEN it is) glimmering in phosphate system (without p53p-XX-N-MdmX, other are consistent)
The checking of luminous intensity peak value, it is by nutlin-3a glimmering in itself to judge that reason occurs in the side peak located in the range of 350nm~450nm
Light cause or with p53p competitive bindings after p53p is free causes.
P53p-XX-N-MdmX identical test conditions are titrated with nutlin-3a, λ is takenEXIt is 278nm, λEMFor 290~
500nm, as a result as shown in Fig. 7 a (nutlin-3a) and 7b (p53p).Shown in Fig. 7 a, λmaxIt is 375nm, shown in Fig. 7 b, λmaxFor
350nm, it may be determined that fluorescence emission wavelengths be 350nm~450nm at side peak be with the titration of nutlin-3a,
The fluorescence intensity that nutlin-3a is introduced, therefore can be to ignore irrespective in this experiment test and result of calculation.
Take 400 μ l phosphate buffers and be diluted to OD280nm=0.1 p53p-XX-N-MdmX albumen is done without nutlin-
The blank experiment of 3a, except without nutlin-3a, other experiment conditions are completely the same with above-mentioned.Such as Fig. 8 a are (glimmering for experimental result
Intensity variation) and Fig. 8 b (peak fluorescence intensity is with change in concentration) shown in.
Nutlin-3a titration results illustrate that nutlin-3a and p53p has competitive binding pass to the binding site of MdmX
System, just causes that transmitting peak fluorescence intensity reduction of the tryptophan at 321nm is obvious.The present invention will be tied further with known to 32
The micromolecular compound of conjunction ability makees further checking.
Embodiment 5：Using p53p-XX-N-MdmX fusion proteins fluorescence method and polarized fluorescence method (FP) screening small molecule
Compound storehouse
(1) inhibitor used is tested：
The Mdm2 micromolecular inhibitors that micromolecular compound storehouse can obtain comprising 32 business.Its structure can be found in table 2.
Compound structure and its two kinds of K in the micromolecular compound storehouse of table 2iMeasurement result
(2) p53p-XX-N-MdmX fusion proteins Fluorimetric screening test：
With reference to nutlin-3a titration schedules (details is referring to embodiment 4), with phosphate buffer by p53p-XX-N-MdmX
Albumen is diluted to OD280nm=0.1, take 400 μ l and be placed in quartz colorimetric utensil.By 32 small molecules each according to concentration in such as table 3 below
Gradient titration (32 small molecule mother liquid concentrations are 2.5mM, are dissolved in DMSO).
3 32 small molecule titration p53p-XX-N-MdmX fusion protein concentration gradients of table
Obtained after titration with little molecular concentration increase, in λEMFor at 321nm peak fluorescence intensity with change in concentration
Ki values (small molecule dissociation constant) carry out linear fit according to formula.The Ki values of specific each molecule are arranged referring to table 2 the 3rd.
The fitting Ki values of the fitting Ki values of 32 small molecules and nutlin-3a collect comparing, then compares them
Competition binding ability and nutlin-3a contrast.Comparing result is as shown in Figure 9.
(2) p53p and N-MdmX polarized fluorescences (FP) screening method：
P53p polypeptides (15~29 amino acids) are marked into (fluorescein- by fluorescein
GSGSSQETFSDLWKLLPEN,Flu-p53p)。
PET28a-N-MdmX plasmids are transferred to BL21 (DE3), 0.4mM IPTG induced expressions simultaneously purify (expression and purification
Method is with reference to embodiment 2), liquid nitrogen flash freezer is frozen in -80 DEG C of refrigerators.
The buffer solution of FP experiments is PBS (137mM NaCl；2.7mM KCl；10mM Na2HPO4；2mM KH2PO4；
PH7.4), 0.025%Tween-20；0.5%BSA；pH7.5.
32 micromolecular compounds and nutlin-3a are diluted to final concentration of 2mM with DMSO.
Micromolecular compound and nutlin-3a that 3 μ l are diluted with DMSO are taken, the buffer solution dilution small molecule of 47 μ l is added
Final concentration of 0.12mM.20 μ l micromolecular compounds are taken with liquid-transfering gun be placed in 96 orifice plates according to the order for having marked, each small point
Son does and once repeats, totally 66 hole.Using not plus micromolecular compound similarity condition DMSO as control, prepare 4 holes.
Take N-MdmX albumen quick-thawings, 14000rpm, 10min, 4 DEG C, centrifugation.
Prep solution 1 includes 15nM Flu-p53p polypeptides and OD280nm=0.1 N-MdmX protein solutions, solution 2 is included
The Flu-p53p polypeptide solutions of 15nM.
Solution 1 is added wherein holes in 66 holes for having micromolecular compound and the control wells for not adding micromolecular compound
(as negative control), per the μ l of hole 40；Solution 2 is added in 2 holes in control wells (as positive control), per the μ l of hole 40.
96 orifice plate 200g are centrifuged 2min, in the dark mixed at room temperature 30 minutes.
Detected using the EnVision multiple labeling micropores board detector of PerkinElmer, take exciting light for 555nm, fluorescence
For 632nm is detected.Analysis of test results formula is：(negative control-sample value)/(negative control-positive is right for inhibiting rate %=
According to) (Zhang Q, Lu H.Identification of small molecules affecting p53-MDM2/MDMX
interaction by fluorescence polarization[J].p53Protocols,2013:95-111.), as a result such as
Shown in the row of table 2 the 4th.
The following is the analysis of the result reflected to Fig. 9 and Biao 2.By taking Cpd20, Cpd23, Cpd28, Cpd31 as an example, this four
Individual compound is that, with Isosorbide-5-Nitrae-benzene phenodiazine -2,5- (1H, 4H)-diketone is a class compound of frame design (with the frame design
One class Mdm2 inhibitor, Novel Isosorbide-5-Nitraes-benzodiazepine-2,5-diones as Hdm2antagonists with
Improved cellular activity), and pass through their Ki values respectively 6.32 μM, 10.33 μ with MdmX that FP is measured
M, 3.58 μM, 10.63 μM, its result and the K that this four compounds fitting is screened with p53p-XX-N-MdmX fusion proteinsiValue
Respectively 5.90 μM, 9.79 μM, 2.07 μM, 8.29 μM it is basically identical.
By taking Cpd4 and CPd6 as an example, it can be seen that the K of Cpd4 and Cpd6 from figureiValue difference is not larger, is measured by FP
They are respectively 1.85 μM and 67.3 μM with the Ki values of MdmX, and pass through the fluorimetry of p53p-XX-N-MdmX fusion proteins
Ki is respectively 1.49 μM and 51.73 μM, and this illustrates fluorescent method of the invention and the K measured by FP methods of the prior arti
Value is also what is be consistent.
Although the comparative descriptions of result shown in table 2, existed with the titration experiments result of nutlin-3a and 32 small molecule
Certain error, but screened with this p53p-XX-N-MdmX fusion proteins model set up suitable micromolecular inhibitor with
FP methods measured result of the prior art is also what is substantially conformed to, illustrates that the fusion protein screening system is effective.
Embodiment 6：The plasmid construction of p53p-XX-N-MdmX fusion protein mutant
p53pF19A- XX-N-MdmX and p53pL26A- XX-N-MdmX is the mutant mould of p53p-XX-N-MdmX fusion proteins
Type, they be on the basis of p53p-XX-N-MdmX fusion proteins respectively the Phe19 on p53p peptide fragments sport Ala19,
Leu26 sports Ala26 (19 and 26 refer to position of the corresponding amino acid in wild type p53 polypeptide).It is incorporated into three combinations
Two amino acid in three critical amino acid residues of pocket are mutated respectively, to weaken p53p polypeptide segments and MdmX respectively
The binding ability of N-terminal domain, basis is provided to filter out the weaker new small molecule drug matrices of binding ability.
Two kinds of Mutant models set up as follows according to p53p-XX-N-MdmX fusion proteins model：
p53pF19A- XX-N-MdmX amino acid sequences are as follows, and (tertiary structure simulates to obtain simulation drawing with PymolWin
As shown in Figure 10 a, not including GSSHHHHHHGS)：GSSHHHHHHGSSQETASDLWKLLPENGSGSSENLYFQGSQINQVRP
KLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNL
VTLAT
p53pL26A- XX-N-MdmX amino acid sequences are as follows, and (tertiary structure simulates to obtain simulation drawing with PymolWin
As shown in fig. lob, not including GSSHHHHHHGS)：GSSHHHHHHGSSQETFSDLWKLAPENGSGSSENLYFQGSQINQVRP
KLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNL
VTLAT
In order to build above fusion protein model, according to existing plasmid pET28a-p53p-XX-N-MdmX, devise following
Primer sequence：
F19A-forward：5’-GGC AGC AGC CAG GAA ACC GCT AGC GAT CTG TGG AAA-3’
F19A-reverse：5’-TTT CCA CAG ATC GCT AGC GGT TTC CTG GCT GCT GCC-3’
L26A-forward:5’-AGC GAT CTG TGG AAA CTG GCG CCG GAA AAT GGC AGC-3’
L26A-reverse:5’-GCT GCC ATT TTC CGG CGC CAG TTT CCA CAG ATC GCT-3’
p53pF19A- XX-N-MdmX fusion protein constructions：
PCR system 1:
PCR1 reaction conditions are as shown in fig. 11a；
DNA glue figure is as figure 12 a shows；
PCR system 2:
PCR2 reaction conditions are as shown in figure 11b；
DNA glue figure is as shown in Figure 12b；
PCR system 3:
PCR3 reaction conditions are as shown in fig. 11c；
DNA glue figure is as shown in fig. 12 c；
PCR primer is reclaimed, recovery product Nco I and EcoR I double digestions, as Insert Fragment.
Here it is fusion DNA vaccine.PCR1 and PCR2 obtains two sections of nucleotide sequences, and PCR3 is fusion DNA vaccine, only to single amino
Acid mutation.
PCR recovery product digestion systems：
37 DEG C, 3h, digestion products kit is reclaimed.
By pET28a-N-MdmX plasmids Nco I and the double digestions of EcoR I, gel extraction, as carrier.
It is 1 that coupled reaction presses carrier DNA with Insert Fragment DNA mol ratios：3 ratios mix, and add high with system identical
Effect ligase (TOYOBO, Ligation high Ver.2), connects 3h by 16 DEG C.
Whole connection products are transferred in 50 μ l DH5 α (top10) Escherichia coli, ice bath 30min, after 42 DEG C of heat shock 90s
Ice bath is put back to immediately, and 2min adds the activation of 200 μ l LB fluid nutrient mediums, 37 DEG C, applied again after 200rpm shaken cultivations 1h recoveries
LB solid medium flat boards containing kanamycins, 37 DEG C are inverted 12~16h of culture, observe colony growth situation.Extracting
pET28a-p53pF19A- XX-N-MdmX plasmids, sequencing, sequencing result is correct, preservation of bacteria strain.p53pF19A- XX--N-MdmX with
p53pL26AThe molecular cloning process of-XX-N-MdmX is in addition to primer sequence during PCR, and other conditions are completely the same.
p53pF19AThe nucleic acid coding sequence of-XX-N-MdmX as shown in SEQ ID NO.5, p53pL26AThe core of-XX-N-MdmX
Coding sequences are as shown in SEQ ID NO.6.
Embodiment 7：p53pF19A- XX-N-MdmX fusion proteins and p53pL26AThe expression of-XX-N-MdmX fusion proteins with it is pure
Change
By pET28a-p53pF19A- XX-N-MdmX and pET28a-p53pL26AChemical conversion enters-XX-N-MdmX plasmids respectively
E. coli bl21 (DE3)；Choose single bacterium and fall 2ml LB K+Culture medium, 37 DEG C, 200rpm incubated overnights；500 μ l bacterium solutions are taken to turn
Enter 50ml LB K+Culture medium, 37 DEG C, 200rpm cultures 3h；50ml bacterium solutions are transferred to 1L LB K entirely+Culture medium, 37 DEG C,
200rpm is cultivated, until cell concentration reaches OD280=0.8 or so, IPTG (final concentration 0.4mM) inductions are added, about 20h receives bacterium
(during microorganism collection centrifuge parameters be set to 3500rpm, 30min, 4 DEG C).
Ultrasonic cell-break crusher machine cell.According to thalline volume：Buffer solution volume=1:5 ratio, adds
BuffeA buffer solutions (50mM Na2HPO4, 200mM NaCl, 10mM imidazoles, 1mM BME, PH8.0), parameter is set to：Total time
2min；Ultrasonic time 2s；Off time 4s；24 DEG C of temperature alarming；Ultrasonic power 40%.Repeat 2~3 times and (observe the broken of thalline
Sliminess after broken determines broken number of times), until bacterial cell disruption is complete.Clasmatosis liquid is dispensed with 50ml centrifuge tubes flat
Weighing apparatus, centrifugation, be collected in reagent bottle (pipe) respectively for supernatant, precipitation by 30min, 4 DEG C, 18000rpm.
Supernatant is crossed into Ni-NTA chromatographic columns and Gel-filtration (sSupredex 16/ by AKTA pure
60075pg or Superdex 26/60075pg), the albumen of purifying is collected, concentration, packing, every 200 μ l, liquid nitrogen flash freezer freezes
It is stored in -80 DEG C of refrigerators.
Embodiment 8：Checking p53p-XX-N-MdmX, p53pF19A- XX-N-MdmX and p53pL26A- XX-N-MdmX threes'
Stability difference
At room temperature, 3~4mol/L guanidine hydrochlorides can make protein can be made to be converted to denatured state from native state, generally increase
Plus denaturant concentration can improve denaturation degrees, usual 6mol/L guanidine hydrochlorides can make protein be completely transformed into denatured state.
Compared to p53p-XX-N-MdmX fusion proteins, p53pF19A- XX-N-MdmX fusion proteins and p53pL26A-XX-N-
MdmX fusion proteins be on the basis of p53p-XX-N-MdmX respectively the Phe19 on p53p polypeptide segments change into Ala19,
Leu26 changes into Ala26.Two amino acid being incorporated into three the three of binding pocket critical amino acid residues enter respectively
Row mutation, to weaken the binding ability of p53p and MdmX N-terminal domains respectively, weakens the stability of fusion protein, is come with this
The micromolecular inhibitor of the weak new framework structure of screening competition binding ability.
With the guanidine hydrochloride solution 100ml that ultra-pure water compound concentration is 8M.
Take 4 p53p-XX-N-MdmX (OD of 200 μ l/ branch280=1.0), 3 p53p of 200 μ l/ branchF19A-XX-N-
MdmX(OD280=1.38), 2 p53p of 200 μ l/ branchL26A-XX-N-MdmX(OD280=2.0) fusion protein quick-thawing, mixes
Close, 14000rpm, 10min, centrifugation.
According to table 4 below, table 5 and the ratio of table 6, be respectively configured p53p-XX-N-MdmX under different concentration of guanidine hydrochloride,
p53pF19A- XX-N-MdmX and p53pL26A- XX-N-MdmX fusion protein solution.
Solution of the p53p-XX-N-MdmX fusion proteins of table 4 under 0~4M concentration of guanidine hydrochloride
The p53p of table 5F19ASolution of-N-MdmX the fusion proteins under 0~4M concentration of guanidine hydrochloride
The p53p of table 6L26ASolution of-N-MdmX the fusion proteins under 0~4M concentration of guanidine hydrochloride
According to concentration of guanidine hydrochloride gradient, 400 μ l samples are taken in quartz colorimetric utensil, cuvette is put into F-7000 fluorescence point
Light photometer, takes λEXIt is 278nm, λEM290nm~500nm is taken, is changed according to concentration of guanidine hydrochloride, p53p-XX-N-MdmX,
p53pF19A- XX-N-MdmX and p53pL26A- XX-N-MdmX obtains figure of fluorescence intensity changes for example shown in Figure 13 a, b and c.
According to the change of peak fluorescence intensity, by three kinds of peak fluorescence intensities of fusion protein as concentration of guanidine hydrochloride changes
Result arrange as shown in figure 14：
According to Figure 13 a, 13b and 13c, the peak value of fluorescence emission wavelengths is respectively p53p-XX-N-MdmX：λEM=
321nm、p53pF19A-XX-N-MdmX：λEM=331nm and p53pL26A-XX-N-MdmX：λEM=330nm, according to fluorescent emission ripple
Peak value long may determine that the tryptophan on p53p combines the depth order in the hydrophobic pocket of N-MdmX and is followed successively by p53p-XX-
N-MdmX、p53pL26A-XX-N-MdmX、p53pF19A- XX-N-MdmX, you can with tentatively judge fusion protein stability it is strong
It is weak to be followed successively by：p53p-XX-N-MdmX、p53pL26A- XX-N-MdmX and p53pF19A-XX-N-MdmX。
Shown in Figure 14, three kinds of peak fluorescence intensities of fusion protein are with the change in concentration figure of protein denaturant guanidine hydrochloride
As can be seen that analysis of fluorescence intensity peak IC50It was found that, during peak fluorescence intensity reduction half, the concentration of required guanidine hydrochloride
It is followed successively by：p53p-XX-N-MdmX、p53pL26A-XX-N-MdmX、p53pF19A- XX-N-MdmX, you can further to judge
The power of the stability of fusion protein is followed successively by：p53p-XX-N-MdmX、p53pL26A- XX-N-MdmX and p53pF19A-XX-N-
MdmX。
Result illustrates p53pL26A- XX-N-MdmX and p53pF19A- XX-N-MdmX is more unstable than p53p-XX-N-MdmX structure
It is fixed, illustrate that the affinity between the former two domains is weaker, and then the former is easier by the weaker MdmX inhibitor of affinity
Institute's competitive binding.
This shows to use p53pL26A- XX-N-MdmX and p53pF19A- XX-N-MdmX is weak as screening model screening affinity
Small molecule is theoretically feasible.
Embodiment 9：With above-mentioned 32 small molecules and nutlin-3a to p53p-XX-N-MdmX, p53pF19A-XX-N-
MdmX and p53pL26A- XX-N-MdmX is titrated to verify the change of binding ability.
Fusion protein quick-thawing, 14000rpm, 10min, centrifugation discards the albumen precipitated because of denaturation.
Small molecule mother liquid concentration 10mM, takes 1 μ l small molecules mother liquors plus 9 μ l DMSO are diluted to 1mM.
According to final concentration of 10 μM of small molecule, protein concentration is OD280nm=0.5, solution is added according to this concentration
96 hole black microwell plates (to add the DMSO of same volume as blank), in 4 DEG C of refrigerator mixing 2h.With
PerkinElmer LS-45/55 fluorescent/phosphorescents/luminescence spectrophotometer reads 96 orifice plate fluorescence datas, first takes λEXIt is 278nm,
p53p-XX-N-MdmXλEMIt is 321nm, p53pF19A-XX-N-MdmXλEMIt is 331nm, p53pL26A-XX-N-MdmXλEMFor
330nm, excites grating 15nm, fluorescence grating 20nm, threshold value (cut off) 290nm, when can read exciting light for 278nm,
Three kinds of fluorescence intensity levels of fusion protein.Again with λEXIt is 278nm, p53p-XX-N-MdmX, p53pF19A-XXN-MdmX、
p53pL26A-N-MdmXλEMIt is 375nm, when threshold value (cut off) 350nm can respectively read exciting light for 278nm, three kinds
The fluorescence intensity level of fusion protein.Surveyed once every 4h, repeatedly twice every time.
96 orifice plates at most once can simultaneously test 32 inhibitor and nutlin-3a to three kinds of suppression effects of fusion protein
Really (one group of parallel laboratory test can be done).
By taking p53p-XX-N-MdmX fusion proteins as an example, in λEMIt is 321nm, the fluorescence that cut-off wavelength reads when being 290nm
Intensity is to add the fluorescence intensity level after small molecule, in λEMIt is 375nm, the fluorescence intensity that cut-off wavelength reads when being 350nm is
Nutlin-3a (or other compounds) introduced fluorescence intensity level, the difference of twi-read fluorescence intensity level is small point
Son add after tryptophan fluorescence intensity change value, using the DMSO for adding same volume after fluorescence intensity level as blank pair
According to the difference between the fluorescence intensity change value and blank of the tryptophan after addition small molecule is addition small molecule chemical combination
The free degree of the tryptophan caused with p53p competitive bindings after thing, negative value is bigger, illustrates that the free degree of tryptophan is bigger, i.e.,
The binding ability of the small molecule is stronger, and fixed this difference is ordinate, if as on the occasion of then explanation tryptophan combines enhancing, you can
Interaction can be there is makes N-MdmX domains more stablize, the affinity enhancing of p53p and N-MdmX.Numbered with small molecule
It is abscissa, this experiment is sequentially 1#-32# and nutlin-3a, arranges result as shown in figure 15.
Figure 15 results show that the result negative value of p53p-XX-N-MdmX is less than p53p for single small moleculeF19A-
XX-N-MdmX and p53pL26AThe negative value of-XX-N-MdmX, this same small molecule of explanation is competed in p53p-XX-N-MdmX
The ability of p53 parts is weaker than p53pF19A- XX-N-MdmX and p53pL26A- XX-N-MdmX, in this explanation p53p-XX-N-MdmX
P53 binding structural domains are bigger with the bond strength of MdmX binding structural domains, as a result meet purpose of design of the invention.
Meanwhile, same inhibitor molecules are to p53pF19A- XX-N-MdmX and p53pL26AN-MdmX portions in-XX-N-MdmX
The competitive binding ability divided is stronger, it is meant that p53pF19A- XX-N-MdmX and p53pL26A- XX-N-MdmX go for
The screening or test of the N-MdmX parts weaker micromolecular inhibitor of adhesion.This further illustrates result and meets of the invention setting
Meter purpose.And in Figure 15 p53p-XX-N-MdmX fusion proteins screening model showed with 32 parents of micromolecular inhibitor
What is reflected with power and Fig. 8 is also to match substantially, the further description validity of the model.
Each embodiment is only intended to further illustrate the present invention above, is not for limiting protection model of the invention
Enclose, every equivalents based on done by design of the invention and each technical scheme of the invention is obviously changed
It is dynamic, each fall within protection scope of the present invention.
SEQUENCE LISTING
<110>Hubei University Of Technology
<120>A kind of fusion protein for screening the inhibitory activity of MdmX inhibitor or test MdmX inhibitor
<130> 2016-12-07
<160> 6
<170> PatentIn version 3.5
<210> 1
<211> 15
<212> PRT
<213>Artificial sequence
<400> 1
Ser Gln Glu Thr Phe Ser Asp Leu Trp Lys Leu Leu Pro Glu Asn
1 5 10 15
<210> 2
<211> 11
<212> PRT
<213>Artificial sequence
<400> 2
Gly Ser Gly Ser Ser Glu Asn Leu Tyr Phe Gln
1 5 10
<210> 3
<211> 91
<212> PRT
<213>Artificial sequence
<400> 3
Gly Ser Gln Ile Asn Gln Val Arg Pro Lys Leu Pro Leu Leu Lys Ile
1 5 10 15
Leu His Ala Ala Gly Ala Gln Gly Glu Met Phe Thr Val Lys Glu Val
20 25 30
Met His Tyr Leu Gly Gln Tyr Ile Met Val Lys Gln Leu Tyr Asp Gln
35 40 45
Gln Glu Gln His Met Val Tyr Cys Gly Gly Asp Leu Leu Gly Glu Leu
50 55 60
Leu Gly Arg Gln Ser Phe Ser Val Lys Asp Pro Ser Pro Leu Tyr Asp
65 70 75 80
Met Leu Arg Lys Asn Leu Val Thr Leu Ala Thr
85 90
<210> 4
<211> 384
<212> DNA
<213>Artificial sequence
<400> 4
ggcagcagcc atcaccatca tcaccacggc agcagccagg aaacctttag cgatctgtgg 60
aaactgctgc cggaaaatgg cagcggcagc agcgaaaacc tgtattttca gggatcccag 120
attaaccagg tgcgtccgaa actgccgctg ctgaaaattc tgcatgcggc gggcgcgcag 180
ggcgaaatgt ttaccgtgaa agaagtgatg cattatctgg gccagtatat tatggtgaaa 240
cagctgtatg atcagcagga acagcacatg gtgtattgcg gcggcgatct gctgggcgaa 300
ctgctgggcc gtcagagctt tagcgtgaaa gatccgagcc cgctgtatga tatgctgcgt 360
aaaaacctgg tgaccctggc gacc 384
<210> 5
<211> 384
<212> DNA
<213>Artificial sequence
<400> 5
ggcagcagcc atcaccatca tcaccacggc agcagccagg aaaccgctag cgatctgtgg 60
aaactgctgc cggaaaatgg cagcggcagc agcgaaaacc tgtattttca gggatcccag 120
attaaccagg tgcgtccgaa actgccgctg ctgaaaattc tgcatgcggc gggcgcgcag 180
ggcgaaatgt ttaccgtgaa agaagtgatg cattatctgg gccagtatat tatggtgaaa 240
cagctgtatg atcagcagga acagcacatg gtgtattgcg gcggcgatct gctgggcgaa 300
ctgctgggcc gtcagagctt tagcgtgaaa gatccgagcc cgctgtatga tatgctgcgt 360
aaaaacctgg tgaccctggc gacc 384
<210> 6
<211> 384
<212> DNA
<213>Artificial sequence
<400> 6
ggcagcagcc atcaccatca tcaccacggc agcagccagg aaacctttag cgatctgtgg 60
aaactggcgc cggaaaatgg cagcggcagc agcgaaaacc tgtattttca gggatcccag 120
attaaccagg tgcgtccgaa actgccgctg ctgaaaattc tgcatgcggc gggcgcgcag 180
ggcgaaatgt ttaccgtgaa agaagtgatg cattatctgg gccagtatat tatggtgaaa 240
cagctgtatg atcagcagga acagcacatg gtgtattgcg gcggcgatct gctgggcgaa 300
ctgctgggcc gtcagagctt tagcgtgaaa gatccgagcc cgctgtatga tatgctgcgt 360
aaaaacctgg tgaccctggc gacc 384
Claims (8)
1. it is a kind of for screen MdmX inhibitor or test MdmX inhibitor inhibitory activity fusion protein, it is characterised in that
The fusion protein includes cycle tests, binding sequence and linking arm sequence；
The cycle tests is MdmX sequences or the MdmX fragments comprising the p53 binding structural domains in MdmX sequences；
The binding sequence is p53 sequences or the p53 fragments comprising the MdmX binding structural domains in p53 sequences；
The linking arm sequence is a peptide fragment, the upstream and downstream of the linking arm respectively with the cycle tests and the combination sequence
The connection of one of row；The amino acid sequence of the linking arm is not involved in the formation or maintenance of the secondary structure of the fusion protein；Institute
State the length of linking arm and any surface part and the binding sequence of the flexible space structure for being enough to make the cycle tests
Any surface part of space structure spatially have an opportunity to be in contact.
2. the fusion egg of the as claimed in claim 1 inhibitory activity for being used to screen MdmX inhibitor or test MdmX inhibitor
In vain, it is characterised in that the upstream or downstream of the fusion protein have the sequence label for Protein Separation and/or purifying.
3. the fusion of the inhibitory activity for being used to screen MdmX inhibitor or test MdmX inhibitor as claimed in claim 1 or 2
Albumen, fusion protein formula p53p-XX-N-MdmX is represented, it is characterised in that
P53p represents the binding sequence SEQ ID NO.1, specially：SQETFSDLWKLLPEN.
XX represents the linking arm sequence SEQ ID NO.2, specially：GSGSSENLYFQ；
N-MdmX represents the cycle tests SEQ ID NO.3, specially：
GSQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSP
LYDMLRKNLVTLAT。
4. a kind of nucleotide sequence, it is characterised in that the nucleotide sequence can be expressed such as any one of claim 1-3 institutes
The fusion protein of the inhibitory activity for screening MdmX inhibitor or test MdmX inhibitor stated.
5. nucleotide sequence as claimed in claim 4, it is characterised in that the nucleotide sequence is as shown in SEQ ID NO.4.
6. it is a kind of for screen MdmX inhibitor or test MdmX inhibitor inhibitory activity fusion protein expression vector, its
Be characterised by, the expression vector can by host expresses as any one of claim 1-3 for screening MdmX
The fusion protein of the inhibitory activity of inhibitor or test Mdmx inhibitor.
7. the fusion protein of the as claimed in claim 6 inhibitory activity for being used to screen MdmX inhibitor or test MdmX inhibitor
Expression vector, it is characterised in that the carrier is pET-28a carriers, and the host is e. coli bl21 (DE3).
8. as any one of claim 1-3 for screen MdmX inhibitor or test MdmX inhibitor inhibitory activity
Fusion protein screening MdmX inhibitor or test MdmX inhibitor inhibitory activity purposes, it is characterised in that it is described
MdmX inhibitor is can be with the inhibitor of p53 competitive bindings MdmX.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201611119574.6A CN106699897B (en) | 2016-12-07 | 2016-12-07 | Fusion protein for screening MdmX inhibitor or testing MdmX inhibitor inhibitory activity |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201611119574.6A CN106699897B (en) | 2016-12-07 | 2016-12-07 | Fusion protein for screening MdmX inhibitor or testing MdmX inhibitor inhibitory activity |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN106699897A true CN106699897A (en) | 2017-05-24 |
| CN106699897B CN106699897B (en) | 2020-10-20 |
Family
ID=58937592
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201611119574.6A Active CN106699897B (en) | 2016-12-07 | 2016-12-07 | Fusion protein for screening MdmX inhibitor or testing MdmX inhibitor inhibitory activity |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN106699897B (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107741503A (en) * | 2017-10-10 | 2018-02-27 | 天津市肿瘤医院 | A kind of experimental method for the interphase interaction for detecting albumen |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105936646A (en) * | 2015-02-09 | 2016-09-14 | 中国科学院苏州纳米技术与纳米仿生研究所 | Mini protein and application thereof |
-
2016
- 2016-12-07 CN CN201611119574.6A patent/CN106699897B/en active Active
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105936646A (en) * | 2015-02-09 | 2016-09-14 | 中国科学院苏州纳米技术与纳米仿生研究所 | Mini protein and application thereof |
Non-Patent Citations (3)
| Title |
|---|
| GRZEGORZ M. POPOWICZ等: "Structure of the human MdmX protein bound to the p53 tumor suppressor transactivation domain", 《CELL CYCLE》 * |
| RONG CHEN等: "A Fusion Protein of p53 Peptide and MdmX as an Efficient Model for Screening of Anticancer Prodrugs with Fluorescence Spectroscopy", 《BIOPHYSICAL JOURNAL》 * |
| SHVARTS,A.等: "MDM2-like p53-binding protein[Homo sapiens], Accession ID:AAB62928.1", 《GENBANK DATABASE》 * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107741503A (en) * | 2017-10-10 | 2018-02-27 | 天津市肿瘤医院 | A kind of experimental method for the interphase interaction for detecting albumen |
Also Published As
| Publication number | Publication date |
|---|---|
| CN106699897B (en) | 2020-10-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN110199019A (en) | It is analyzed using the macromolecular of nucleic acid encode | |
| CN101084237A (en) | Ubiquitin or gamma-crystalline conjugates for use in therapy, diagnosis and chromatography | |
| EP1869206A2 (en) | Enzyme sensors including environmentally sensitive or fluorescent labels and uses thereof | |
| EP2215115A1 (en) | Molecular affinity clamp technology and uses thereof | |
| CN103959063B (en) | The method being measured for the glycosylation of antagonist | |
| KR101535709B1 (en) | Method for Dectecting of Target Molecules Using PNA Aptamers | |
| EP3778650A1 (en) | Fluorescent probe for branched chain amino acids and use thereof | |
| WO2020117778A2 (en) | Reagents and methods for controlling protein function and interaction | |
| WO2016209773A1 (en) | Improved assays and methods for allergen detection | |
| CN106699897A (en) | Fusion protein used for screening MdmX inhibitor or testing inhibitory activity of MdmX inhibitor | |
| CN106632687A (en) | Fusion protein for screening weak MdmX inhibitor or testing inhibition activity of weak MdmX inhibitor | |
| JP6051438B2 (en) | Calcium sensor protein using red fluorescent protein | |
| US8323919B2 (en) | Assay methods for identifying glycogen synthase kinase 3 modulators | |
| Avignolo et al. | Internalization via Antennapedia protein transduction domain of an scFv antibody toward c‐Myc protein | |
| US8709981B2 (en) | Isolated Australian coral reef fluorescent proteins and cell-based kinase or phosphatase platforms for cancer drug development | |
| CN102712948A (en) | FRET-based method for the determination of protein phosphatase and kinase activity | |
| US9354175B2 (en) | Lucigen yellow (LucY), a yellow fluorescent protein | |
| CN102477096B (en) | Human creatine kinase single-chain antibody with molecular chaperone function | |
| US9625466B2 (en) | Signal amplification methods for the imaging of protein synthesis and neurotransmitter transport | |
| AU764578B2 (en) | Monitor protein for measuring protein phosphorylation | |
| Berglund | Analyzing binding motifs for WW, MATH, and MAGE domains using Proteomic Peptide Phage Display | |
| Izquierdo-Martinez et al. | DipM controls multiple autolysins and mediates two regulatory feedback loops promoting cell constriction in C. crescentus | |
| CN114854694A (en) | Luciferase complementation system for high-throughput screening of new crown drugs and construction method and application thereof | |
| Sinisi | Biomolecules as recognition elements for bioactive polyphenols in coffee | |
| JPWO2004113530A1 (en) | Polynucleotide for labeling protein synthesis |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| CB03 | Change of inventor or designer information | ||
| CB03 | Change of inventor or designer information |
Inventor after: Su Zhengding Inventor after: Chen Rong Inventor after: Cheng Xiyao Inventor before: Su Zhengding Inventor before: Yang Fei Inventor before: Zhang Huashan Inventor before: Cheng Xiyao |
|
| GR01 | Patent grant | ||
| GR01 | Patent grant |