CN105001319A - Polypeptide, detection device including polypeptide, and detection kit - Google Patents
Polypeptide, detection device including polypeptide, and detection kit Download PDFInfo
- Publication number
- CN105001319A CN105001319A CN201410168766.0A CN201410168766A CN105001319A CN 105001319 A CN105001319 A CN 105001319A CN 201410168766 A CN201410168766 A CN 201410168766A CN 105001319 A CN105001319 A CN 105001319A
- Authority
- CN
- China
- Prior art keywords
- polypeptide
- malaria
- present
- detection
- solid carrier
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Peptides Or Proteins (AREA)
Abstract
The invention mainly relates to a polypeptide, a detection device including the polypeptide, and a detection kit, and belongs to the biotechnical field. The polypeptide is formed by the following amino acid sequence represented SEQIDNO:1: KRNFSLYKTAFEYLKQKWDKYKELNFSSIF. The detection device comprises a solid carrier, and the polypeptide connected to the solid carrier. The detection kit comprises the polypeptide or the detection device. The polypeptide, the detection device including the polypeptide, and the detection kit are useful in malaria diagnosis.
Description
Technical field
The present invention relates generally to polypeptide, comprises the detection means of this polypeptide and detection kit, belongs to biological technical field.
Background technology
Malaria is a kind of acute infectious disease, and be mosquito matchmaker Protozool diseases the most serious to mankind's harm in the world at present, pathogenic agent is plasmodium, and symptom is heating of periodically feeling cold.Because plasmodial life cycle is complicated, antigen has the features such as phasic specificity, and the control of malaria becomes international one of difficult problem.Wherein, pernicious malaria infects 3-5 hundred million people every year, the life of claims millions people.In November, 2011, World Health Organization's recent statistics have 2.16 hundred million case survey of malarias occur, mortality ratio up to 655,000 people.Plasmodium is mainly distributed in the earth torrid zone, subtropics various countries, and namely the area such as Africa, South East Asia, South America, about has 2,000,000,000 populations still to live in epidemic-stricken area, die from the children about 1,000,000 of malaria every year.China in south China, the certain areas, particularly Yunnan in Central China and Hainan Province is district occurred frequently.Therefore, malaria also seriously hampers the Economic development of developing country.
Due to the singularity of malaria treatment medicine, accurately diagnosis fast can not only Timeliness coverage treat malaria patients, greatly reducing case fatality rate, also by getting rid of malaria in early days, saving the life having infected other communicable disease patient in time.With this simultaneously, accurately early diagnosis fast is also the necessary means to the real-time prevailing disease monitor and forecast of malaria.At present, the classical way of Malaria Diagnosis is still blood smear microscopy, the method to the technical ability of proofer and survey requirement very high, the overwhelming majority in Africa and the developing country such as South America cannot be met far away and live in the needs of patient from far-off regions.
Summary of the invention
A kind of polypeptide useful to the diagnosis of malaria, the antibody of this polypeptide anti-, the detection means comprising this polypeptide, the detection kit comprising this polypeptide or this detection means and this polypeptide is the object of the present invention is to provide to detect the purposes in the disease (such as malaria) that plasmodium causes, this polypeptide for the preparation of the purposes detected in the test kit of the disease (such as malaria) that plasmodium causes or detection means.
That is, the present invention comprises following technical proposals:
1. the polypeptide be made up of the aminoacid sequence shown in SEQ ID NO:1.
2. a detection means, it comprises:
Solid carrier, and
Be connected to the polypeptide described in item 1 on this solid carrier.
3. the detection means according to item 2, wherein, described solid carrier is SJ modified silica-gel.
4. a detection kit, it comprises the polypeptide described in item 1 or the detection means described in item 2 or 3.
5. the antibody of the polypeptide described in anti-item 1.
6. the polypeptide described in 1 is for the preparation of the purposes detected in the test kit of the disease that plasmodium causes or detection means.
7. the purposes described in 6, wherein, described disease is malaria.
8. the purposes described in 6 or 7, wherein, described plasmodium is subtertian malaria.
9. the nucleic acid of the polypeptide of coding described in item 1.
10. comprise the expression vector of the nucleic acid described in item 9.
11. host cells having imported the expression vector described in item 10.
Polypeptide of the present invention is applied to the diagnosis of the disease (such as malaria) that plasmodium causes, gratifying effect can be obtained.
Accompanying drawing explanation
Polypeptide is fixed on the schematic diagram on SJ modified silica-gel surface by Fig. 1 by chemical covalent.
The schematic diagram that the making processes of Fig. 2 to SJ modified silica-gel (iPDMS film) is described.
The figure that Fig. 3 is described polypeptide microarrays chemistry fixation procedure.
Fig. 4 illustrates the schematic diagram of polypeptide microarrays spot sample mode.
Fig. 5 is the photo of display to the result that healthy normal people or non-malaria disease human serum detect.
Fig. 6 is the photo of display to the result that malaria disease human serum detects.
Embodiment
Polypeptide of the present invention
Polypeptide of the present invention is 30 peptides.30 peptides of the present invention are made up of the aminoacid sequence shown in SEQ ID NO:1, that is: KRNFSLYKTAFEYLKQKWDKYKELNFSSIF.As shown in the Examples, it is positive to the serum of malaria patient, and to be negative reaction to healthy normal people or non-malaria disease human serum.Therefore, the diagnostic tool of disease (such as malaria) that this 30 peptide causes as plasmodium (such as subtertian malaria) is useful.
Polypeptide of the present invention, when having commercially available, can use commercially available product, and in addition, can also be suitable for adopting the known method such as (1) chemical synthesis process or (2) enzyme reaction synthetic method to obtain, wherein chemosynthesis is more easy.In chemosynthesis polypeptide situation of the present invention, undertaken by using peptide synthesizer synthesis or this polypeptide semi-synthetic.As chemical synthesis process, such as peptide solid-phase synthesis etc. can be listed.The peptide of such synthesis can adopt conventional means such as ion-exchange chromatography, reverse phase high performance liquid chromatogram, affinity chromatography etc. to carry out purifying.Such peptide solid phase synthesis process with and subsequent peptide purification be all well-known in the art.
In addition, when producing polypeptide of the present invention by enzyme reaction, the method such as described in No. WO2004/011653, International Publication brochure can be adopted.Namely; can produce like this: by the amino acid of a side or the C-terminal of dipeptides is esterified or amidation and the amino acid that obtains or dipeptides, the amino acid (amino acid of such as carboxy protective) that is in unbound state with amino acid react under the existence of peptide synthetase, the dipeptides of generation or tripeptides.As peptide synthetase, can list: there is the culture of microorganism of the ability generating peptide, the bacterial disposing thing of the microbial cells be separated by this culture or this microorganism or this microbe-derived peptide synthetase.
And except above-mentioned enzyme method, chemical synthesis process, in some cases, polypeptide of the present invention may be also natural existence (but not being separated).In naturally occurring situation, can also be separated.
nucleic acid of the present invention, expression vector host cell, and the antibody of anti-polypeptide of the present invention
The invention still further relates to the nucleic acid (nucleic acid of the present invention) of this polypeptide of coding, comprise the expression vector (expression vector of the present invention) of this nucleic acid, imported the host cell (host cell of the present invention) of this expression vector, they preferably can be used for producing polypeptide of the present invention.Nucleic acid of the present invention, expression vector, host cell can adopt the method for well known to a person skilled in the art to prepare.The invention still further relates to the antibody of anti-polypeptide of the present invention, it can be used for detecting antibody of the present invention.Antibody of the present invention can adopt the method for well known to a person skilled in the art to prepare.
detection means of the present invention
The invention still further relates to a kind of detection means (detection means of the present invention), it comprises solid carrier and is connected to the polypeptide of the present invention on this solid carrier.
In the present invention, solid carrier is not particularly limited, as long as the carrier of solid or insoluble material (be such as can pass through filtration, material that precipitation, magnetic resolution etc. are separated from reaction mixture).
The material forming solid carrier includes but not limited to: silica gel (polydimethylsiloxane, PDMS), Mierocrystalline cellulose, teflon TM, Nitrocellulose, agarose, dextran, chitosan, polystyrene, polyacrylamide, polyester, polycarbonate, polymeric amide, polypropylene, nylon, poly(vinylidene fluoride), latex, silicon-dioxide, glass, glass fibre, gold, platinum, silver, copper, iron, stainless steel, ferrite, silicon wafer, polyethylene, polymine, poly(lactic acid), resin, polyose, albumen (albumin etc.), carbon or their combination etc.
The shape of solid carrier comprises but is not limited to: pearl, magnetic bead, film, microcapillary, filter membrane, plate, micro plate, carbon nanotube, sensor chip etc.Just as known in the art, the solid carrier that film or plate etc. are smooth can be arranged bottom pit, groove, filter membrane etc.
In the present invention, magnetic bead can have the sphere diameter of about 25nm ~ about 1mm scope.In a preferred embodiment, magnetic bead has the diameter of about 50nm ~ about 10 μm scope.The size of magnetic bead can be selected according to specific purposes.
In the present invention, the pearl be made up of the contour crosslinked spherical agarose of Sepharose has the diameter of about 24 μm ~ about 165 μm of scopes.Preferably, high crosslinked spherical sepharose 4B has the diameter of about 24 μm ~ about 44 μm of scopes.The size of high crosslinked spherical sepharose 4B can be selected according to specific purposes.
The example with the solid carrier of water repellent surface comprises can from Polysciences, Warrington, PA or Spherotech, the polystyrene latex beads such as the goods that Liberville, IL buy.
The example of the solid carrier of silicon-dioxide (SiO2)-process or silicon-dioxide (SiO2) base comprises can from Polysciences, Warrington, the extraordinary magnetic silica pearl etc. that PA buys, it may be used for catching nucleic acid (such as DNA).Or, the M-280 etc. that can buy from Dynal Biotech can also be used.
The magnetic bead with hydrophilic surface can be used for the bacterial cell of seizure proliferation period, nucleic acid and other composition.As the example of this magnetic bead, Polysciences can be listed, Warrington, the pearl (title: Biomag (registered trademark) carboxyl) that PA sells or Bangs Laboratory, Inc., the name of Fishers, IN is called the pearl of MC02N/2928.Or, the M-270 etc. that Dynal Biotech sells can be used.
In a preferred embodiment of the present invention, described solid carrier is SJ modified silica-gel.The microarray solid support material (iPDMS film, see Chinese patent CN101265329A) of a kind of silicon rubber material of Suzhou Siju Biomaterials Co., Ltd.'s exploitation.This material is based on the conventional PDMS of biological study, add specific initiator composition (making this material realize surface-functionalized modification by surface initiated polymerization (SIP)) wherein, obtain through polyethylene glycol methacrylate-styrene polymer (poly (oligo (ethylene glycol) methacrylate), pOEGMA) finishing again.SJ modified silica-gel has outstanding anti-protein non-specific adsorption (Nonspecific protein adsorption, NPA) ability, non-specific protein absorption in complicated protein immunization can being detected controls to close to " absolute 0 " level (being near or below the limit of detection of instrument), not only can exempt the trouble closed and repeatedly clean, can also by the susceptibility using stronger amplification of signal means to improve protein microarray.And the essence of its silicon rubber imparts the stronger mechanical property of this material and good operability.Suzhou Yvonne gathers the combination assay microarray ELISA kit that SJ modified silica-gel has successfully been applied to 11 tumor markers compositions by company, achieve high-throughput and high-sensitive detection, demonstrating this material is a kind of outstanding protein microarray solid support material.Meanwhile, this material also has the adjustable characteristic of surface properties, can adjust its surface topography within the specific limits by the controlled modification reaction times.
The connection of polypeptide of the present invention and solid carrier can adopt the method for attachment that well known to a person skilled in the art polypeptide and solid carrier to carry out.Such as, for the connection on protein/polypeptide and modified silica-gel surface, 1-ethyl-3-(3-dimethyl aminopropyl)-carbodiimide can be passed through
[1-ethyl-3-(3-dimethyl ami-nopropyl) carbodiimide, EDC] and N-hydroxy-succinamide (N-hydroxysuccinimide, NHS) reaction by modified silica-gel surface macromolecular chain on carboxyl (-COOH) group change activating group into, this activating group can with protein/polypeptide on amino (-NH2) react thus realize protein/polypeptide being fixed on solid carrier surface (see Fig. 1).
Concentration for polypeptide of the present invention in the sampling liquid used during point sample is not particularly limited, and those skilled in the art can conventionally select, and is preferably 1 μ g ~ 1000 μ g/mL, more preferably 10 μ g ~ 500 μ g/mL.In addition, the density distributed on a solid support for polypeptide of the present invention is not particularly limited, and those skilled in the art can conventionally select, and is preferably 1 ~ 100 points/10mm
2, more preferably 5 ~ 50 points/10mm
2.
Detection means of the present invention may be used for detecting the disease (such as malaria) that causes of plasmodium or for the preparation of the test kit detecting the disease (such as malaria) that plasmodium causes.
detection kit of the present invention
The invention still further relates to a kind of detection kit (detection kit of the present invention), it comprises polypeptide of the present invention or detection means.This detection kit is preferred for the disease (such as malaria) that detection plasmodium causes.
Detection means of the present invention or polypeptide of the present invention are the important documents of detection kit of the present invention.Detection kit of the present invention can also comprise:
1. the serum dilution prepared or serum dilution component solution: serum dilution, such as, have the Sample dilution (production code member 070021-S2) of Sai Chi bio tech ltd, Beijing, the application of sample variable color Sample dilution (production code member bwj010103) etc. of Bo Weijia bio tech ltd, Zhengzhou.This serum dilution is used for dilute serum, and the serum that test kit detects will dilute suitable multiple, such as 2 ~ 200 times, preferably 10 ~ 100 times.
Detection kit of the present invention can also comprise:
2. concentrated washing lotion: after solid carrier surface hatches serum and ELIAS secondary antibody, the unconjugated antibody of solid carrier surface and ELIAS secondary antibody need be washed by washing lotion.Concentrated washing lotion is such as the polysorbas20 aqueous solution of 1%, need dilute 2 ~ 40 times, preferably 5 ~ 20 times during use.
Detection kit of the present invention can also comprise:
3. ELIAS secondary antibody solution: the plasmodium autoantibody in disease (such as malaria) patients serum that plasmodium causes can be combined by the polypeptide of the present invention on solid carrier (such as SJ modified silica-gel), two anti-can with antibodies, and two markers resisted can react with luminous substrate, thus send detectable light.ELIAS secondary antibody can be the goat anti-human igg of such as horseradish peroxidase-labeled.As ELIAS secondary antibody solution, the Goat anti human IgG (H+L) of the horseradish peroxidase-labeled that Beijing Bioisystech Co., Ltd of Zhong Shan Golden Bridge produces can be listed, production code member ZB-2304.Being not particularly limited the concentration of ELIAS secondary antibody in ELIAS secondary antibody solution, can be such as 1ng ~ 1000ng/mL.
Detection kit of the present invention can also comprise:
4. luminescent solution component solution: luminescent solution can react with the two anti-upper horseradish peroxidases marked, and makes to react the chemical light sending instrument and can detect.Luminescent solution is mixed by two kinds of solution, is A liquid-superoxol respectively, and B liquid-luminol solution.Luminol (luminol,3-aminophthalic acid cyclic hydrazide) only has crosses just meeting luminescence by oxidizer treatment.The mixed aqueous solution of usual use hydrogen peroxide and a kind of hydroxide bases is as exciting agent.Under horseradish peroxidase enzyme catalytic, decomposing hydrogen dioxide solution is oxygen G&W:
2H
2O
2→O
2+2H
2O
Luminol,3-aminophthalic acid cyclic hydrazide and oxyhydroxide generate a pairs of anion when reacting, the dioxygen oxidation that it can be gone out by peroxide decomposition, and product is an organo-peroxide.This superoxide is very unstable, decomposites nitrogen immediately, generates the 3-aminophthalic acid of excited state.During excited state to ground state transforms, the energy of release exists with the form of photon, and wavelength is positioned at the blue light components of visible ray.The SuperSignal of the example such as Thermo Seientific company of luminescent solution component solution
eLISA Femto Maximum Sensitivity Substrate, article No. 37074.
Detection kit of the present invention can also comprise:
5. one or more reaction cavity (such as Chinese patent Granted publication CN202054829U).
Detection kit of the present invention can also comprise:
6. other detection molecules (such as polypeptide, protein, nucleic acid etc.) of disease (such as malaria) for detecting plasmodium and causing.
Detection kit of the present invention can also comprise:
7. working instructions.
Embodiment
Below, by embodiment, more specific description is carried out to the present invention, but be not the restriction to the technology of the present invention scope.By the record of this specification sheets, those skilled in the art can be easy to modify the present invention/change, and these are included in technical scope of the present invention.
the preparation of 1.30 peptides and confirmation
30 peptides used in embodiment have the aminoacid sequence shown in SEQ ID NO:1, and by Shanghai gill, biochemical company limited synthesizes, and the sign of this polypeptide confirms to have synthesized described polypeptide by hydrogen spectrum and mass spectrum.Liquid phase chromatography detects purity: 97.37% (area normalization method): mass spectroscopy detects: calculate molecular weight: 3823.41, test value 3823.56
2. the preparation of detection means
Detection chip be with SJ modified silica-gel (iPDMS film) for solid support material, be prepared from by point sample immobilized polypeptide solution thereon.Modified silica-gel be add in traditional polydimethyl siloxane material band olefin-terminal, the initiator of surface initiated polymerization, and be fixed in the three-dimensional structure of polydimethylsiloxane by heat cross-linking (si-h bond bonding), obtain a kind of new material and SJ modified silica-gel.Its making processes as shown in Figure 2.
A and B is wherein two components of polydimethylsiloxane, polydimethylsiloxane (Poly (dimethylsiloxane), Sylgard184) buy from Dow corning (DowCorning) company, comprise liquid composition A (composition is metallic platinum catalyst and the diformazan siloxanes polymer precursor mixture being with vinyl) and crosslinking agent B (composition is the dimethyl siloxane precursor with vinyl and Si-H group) two kinds of compositions.C is the initiator of end strips vinyl, is purchased from Hangzhou Dong Wei company.Polymer on finally modifying is that oligomeric ethylene glycol methacrylate monomer (Oligo (ethylene glycol) methacrylate, hereinafter referred to as OEGMA, molecular weight Mw=526) is bought in Aldrich.Polydimethylsiloxane precursor A and crosslinking agent B are fully mixed with A:B:C=10:1:0.5 ratio with the initiator C of band vinyl end.Make transparent elastic silicone rubber by curing reaction, then carry out finishing by sip technique and can obtain SJ modified silica-gel.Experiment shows, the surface of SJ modified silica-gel have enough highdensity, by the initiator of covalently immobolization, it can pass through surface initiated polymerization (SIP), and to realize surface macromolecule modified.The surface that reaction acquisition polyoxyethylene glycol (Polyethylene Glycol, PEG) is modified is carried out in use poly (OEGMA) (polyethylene glycol methacrylate-styrene polymer), realizes the ability of stronger anti-albumen non-specific adsorption.
The SJ modified silica-gel film made need be kept in 4 DEG C of refrigerators.
Adopt brilliant core
personalArrayerTM16 people's point sample instrument prepares polypeptide microarrays on modified silica-gel, and process is:
1) pre-treatment
By SJ modified silica-gel thin slice (15 × 15mm
2) be immersed in activation solution, take out with deionized water drip washing 3 times after 30min, dry up with nitrogen, be used for point sample at once.
2) point sample
Sampling liquid is diluted and gets well and transfer in the corresponding micropore of 384 orifice plate, 384 orifice plates of band sample are placed on point sample instrument base station, pretreated modified silica-gel thin slice are placed on the base station of point sample instrument simultaneously, carry out point sample at once.Point sample envrionment conditions is room temperature (25 DEG C), and humidity set is 50%.On the polypeptide microarrays made, the point sample amount of each point is about 0.6nL, and sampling point radius is 200 μm.
3) chemistry is fixing
The polypeptide microarrays just made will be placed on fixing at least 6h in climatic chamber (26 DEG C, 60% humidity).Chemistry fixation procedure as shown in Figure 3.
First by point sample instrument by include catch peptide molecule damping fluid point on modified silica-gel film, then damping fluid starts evaporation, catch peptide molecule and the surface intimate contact interacting of SJ modified silica-gel, by Chemical bond, the high molecular end-COOH of ploy (OEGMA) on modified silica-gel surface and peptide molecule-NH
2formed and stablize covalent linkage, and then chemically active peptide molecule will be had to be fixed on SJ modified silica-gel surface.
5) assemble
The polypeptide microarrays of fixing 6h must assemble in two days.First by gum, SJ modified silica-gel thin slice is attached on special reaction column, covers reaction cavity.A reactor is made up of two reaction columns and a reaction cavity.
6) preserve
The polypeptide microarrays assembled, needs to vacuumize sealing, is kept in the refrigerator of 4 DEG C, for subsequent use.
3. detect by detection means
Checking procedure
1, before starting to detect, concentrated cleaning solutions is added purified water in the ratio of 1:10 or distilled water dilutes, diluted rear direct use.Use liquid-transfering gun that 2mL scavenging solution is added to chip surface, soak chip 3 minutes, ensure that chip surface is fully wet out.
2, test serum sample Sample dilution is mixed according to 1:40 dilution.
3, discard the scavenging solution soaking chip, under the state that chip surface is completely moistening, the serum after each serum sample draws 200 μ L dilutions joins in chip reactor.
4, chip reactor is put into chip permanent seat, be put on shaking table, open shaking table, frequency 150 revs/min, incubated at room 30 minutes.
5, the serum sample in chip reactor is discarded, with 15mL washing lotion cleaning reaction cavity and chip surface 3 times.
6, after having cleaned, each chip reactor adds 200 μ L enzyme labelled antibody solution respectively, chip reactor is put into chip permanent seat, is put on shaking table, opens shaking table, frequency 150 revs/min, incubated at room 30 minutes.
7, the enzyme labelled antibody solution in chip reactor is discarded, with 15mL washing lotion cleaning reaction cavity and chip surface 3 times.
8, after having cleaned, take off reaction cavity, each chip surface adds 15 μ L luminous substrate liquid respectively, makes luminescent solution can be laid on chip surface uniformly.
9, the chip adding luminescent solution is placed in gel imaging instrument chemiluminescence imaging, and sentence read result.
Serum and other disease patient's serum samples of the malaria patient that subtertian malaria causes are provided by chain hospital.Serum is transported by related personnel with parcels such as ice cube/dry ice or is handed to laboratory soon.
Negative control has PBS damping fluid (namely to hatch without test serum in the 3rd step, and hatch by PBS solution, all the other steps are identical) contrast, the contrast of serum dilution, and the contrast of patients with negative (referring to Healthy People and non-malaria patient) serum.
The spot sample mode of polypeptide microarrays as shown in Figure 4.Wherein, the sample of leg-of-mutton 20 points is human IgG, as the locating point of experiment; The sample of foursquare 4 points is PB sampling liquid, as the blank of experiment; The sample polypeptides of star point is polypeptide SEQ ID NO:1 of the present invention, and it is malaria autoantigen protein polypeptide, can produce response to malaria patients' serum; Circular point sample be other malaria autoantigen protein polypeptide, as the Testing index (these polypeptide have response to illustrate detect in serum have malaria autoantibody) of experiment.
Experimental result is as shown in Fig. 5 ~ 6.Wherein, Fig. 5 shows the detected result of negative control, only has the sample of the point shown in trilateral to have response.Fig. 6 shows the detected result of malaria disease human serum, and the sample of trilateral, star point and circle has response.It should be noted that, instrument records signal value from low to high, and corresponding signaling point color is by black-white gradual change.
Sequence table
Sequence table
<110> Suzhou Institute of Nano-tech. and Nano-bionics, Chinese Academy of Sciences
<120> polypeptide, the detection means comprising this polypeptide and detection kit
<130> S25-028
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 30
<212> PRT
<213> artificial sequence
<220>
<223> malaria antigen polypeptide
<400> 1
Lys Arg Asn Phe Ser Leu Tyr Lys Thr Ala Phe Glu Tyr Leu Lys Gln
1 5 10 15
Lys Trp Asp Lys Tyr Lys Glu Leu Asn Phe Ser Ser Ile Phe
20 25 30
Claims (9)
1. a peptide species, its aminoacid sequence as shown in SEQ ID NO:1, that is: KRNFSLYKTAFEYLKQKWDKYKELNFSSIF.
2. a detection means, it comprises:
Solid carrier, and
Be connected to the polypeptide according to claim 1 on this solid carrier.
3. detection means according to claim 2, wherein, described solid carrier is SJ modified silica-gel.
4. a detection kit, it comprises the detection means described in polypeptide according to claim 1 or Claims 2 or 3.
5. the antibody of anti-polypeptide according to claim 1.
6. the purposes of polypeptide according to claim 1 in the test kit or detection means of the disease caused for the preparation of detection plasmodium.
7. purposes according to claim 6, wherein, described disease is malaria.
8. the purposes described in claim 6 or 7, wherein, described plasmodium is subtertian malaria.
9. encode polypeptide according to claim 1 nucleic acid, comprise described nucleic acid expression vector, imported the host cell of described expression vector.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201410168766.0A CN105001319A (en) | 2014-04-24 | 2014-04-24 | Polypeptide, detection device including polypeptide, and detection kit |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201410168766.0A CN105001319A (en) | 2014-04-24 | 2014-04-24 | Polypeptide, detection device including polypeptide, and detection kit |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN105001319A true CN105001319A (en) | 2015-10-28 |
Family
ID=54374214
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201410168766.0A Withdrawn CN105001319A (en) | 2014-04-24 | 2014-04-24 | Polypeptide, detection device including polypeptide, and detection kit |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN105001319A (en) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101265329A (en) * | 2007-03-16 | 2008-09-17 | 马雄明 | Polydimethylsiloxane with initiator on surface and its preparation method and use |
| CN103260641A (en) * | 2010-11-09 | 2013-08-21 | 沃尔特及伊莱萨霍尔医学研究院 | Treatment and prevention of malaria |
-
2014
- 2014-04-24 CN CN201410168766.0A patent/CN105001319A/en not_active Withdrawn
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101265329A (en) * | 2007-03-16 | 2008-09-17 | 马雄明 | Polydimethylsiloxane with initiator on surface and its preparation method and use |
| CN103260641A (en) * | 2010-11-09 | 2013-08-21 | 沃尔特及伊莱萨霍尔医学研究院 | Treatment and prevention of malaria |
Non-Patent Citations (1)
| Title |
|---|
| HALL,N.ET AL.: "erythrocyte binding antigen-165[Plasmodium falciparum 3D7]", 《GENBANK登记号XP_001351546》 * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN103965321B (en) | Polypeptide, the detection device comprising this polypeptide and detection kit | |
| CN103965313B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
| CN103965333A (en) | Polypeptide, detection device containing polypeptide, and detection kit containing polypeptide | |
| CN103965311A (en) | Polypeptide, detection device containing polypeptide, and detection kit containing polypeptide | |
| CN103965314B (en) | Polypeptide, the detection device comprising this polypeptide and detection kit | |
| CN103965338B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
| CN103965329B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
| CN103965334B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
| CN103965325A (en) | Polypeptide, detective device and detective kit containing the polypeptide | |
| CN103965319A (en) | Polypeptide, detection device and detection kit containing the polypeptide | |
| CN103965323A (en) | Polypeptide as well as detection device and detection reagent kit comprising polypeptide | |
| CN103965312A (en) | Polypeptide, detection device containing polypeptide, and detection kit containing polypeptide | |
| CN103965324A (en) | Polypeptide as well as detection device and detection reagent kit comprising polypeptide | |
| CN105001319A (en) | Polypeptide, detection device including polypeptide, and detection kit | |
| CN105017402A (en) | Polypeptide, as well as detector and detection kit containing polypeptide | |
| CN105566479A (en) | Polypeptide as well as detection device and detection kit comprising same | |
| CN105566477A (en) | Polypeptide as well as detection device and detection kit comprising same | |
| CN105566478A (en) | Polypeptide as well as detection device and detection kit comprising same | |
| CN105566480A (en) | Polypeptide as well as detection device and detection kit comprising same | |
| CN105566481A (en) | Polypeptide as well as detection device and detection kit comprising same | |
| CN103965322B (en) | Polypeptide, the detection device comprising this polypeptide and detection kit | |
| CN105646687A (en) | Polypeptide, and a detection device and a detection kit containing polypeptide | |
| CN105646689A (en) | Polypeptide and detection device and detection kit containing polypeptide | |
| CN105646688A (en) | Polypeptide and detection device and detection kit containing polypeptide | |
| CN105646692A (en) | Polypeptide, detection device containing polypeptide and detection kit |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20151028 |