CN103063836B - Detect the reagent of mycobacterial infections, method and kit - Google Patents
Detect the reagent of mycobacterial infections, method and kit Download PDFInfo
- Publication number
- CN103063836B CN103063836B CN201110315979.8A CN201110315979A CN103063836B CN 103063836 B CN103063836 B CN 103063836B CN 201110315979 A CN201110315979 A CN 201110315979A CN 103063836 B CN103063836 B CN 103063836B
- Authority
- CN
- China
- Prior art keywords
- cell
- polypeptide
- analog
- reagent
- albumen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Abstract
The invention provides the reagent, method and the kit that detect mycobacterial infections.SEQ is comprised in reagent? ID? NO? albumen representated by 1-5, polypeptide or analog.Method is contacted with host T cell by reagent, detects and determines whether T cell identifies described albumen, polypeptide or analog, thus judge mycobacterial infections state.Kit comprises above-mentioned for detecting mycobacterial infections reagent.The susceptibility that reagent of the present invention, detection method and kit detect, specificity are high, and sensing range is wide and easily manufactured, with low cost.
Description
Technical field
The invention belongs to biomedical inspection field, relate to a kind of microbial molecules biological detection method, particularly relate to the reagent, method and the kit that detect tuberculosis infection.
Background technology
Tuberculosis is a current main public health problem, and its pathogen is tubercle bacillus, belongs to Mycobacterium.The annual nearly 800-1000 Wan Xinfa tuberculosis case in the whole world, have 200-300 ten thousand people therefore to lose one's life every year, tuberculosis is the No.1 infectious disease causing adult's death.According to WHO, the population (about 2,000,000,000) in the whole world 1/3rd has infected tubercle bacillus, and if do not taken measures, 300,000,000 people that also will have an appointment in nearly 10 years are by mycobacterium tuberculosis infection.According to the 4th national epidemiology survey display, China more than 400,000,000, has 130,000 people to die from tuberculosis by mycobacterium tuberculosis infection number every year, and be one of 22 tuberculosis high burden countries in the whole world, tuberculosis patient numerical digit occupies the second in the world.
Directly to supervise and guide treatment implementing in full DOTS() after strategy, declining does not appear in the tuberculosis rate of China as expected, this is not diagnosed relevant by the latent infection diagnosed and the negative tuberculosis patient of phlegm bacterium with potential in time in a large number, these the infecteds are huge tuberculosis pathogeny storehouses, DOTS plan for the lunger of morbidity, and can only not contributed for the patient eliminating the patient of latent infection or the atypical symptom of phlegm bacterium feminine gender.Now, developed country has given one's full attention to this phenomenon, starts the intervention to latent infection patient before 7 years even more already.A strategy of whole world Control is in people at highest risk, implement effective screening programme, can identifying the patient that those have latent infection like this, preventing tuberculosis by treating them.And wherein most distinct issues how accurately promptly to find latent infection person and people at highest risk and controlled.
In current diagnosis tubercular, the main method adopted has: chest x-ray sheet, smear for microscopic examination, cultivation, TST skin test etc.Wherein X-ray cannot Timeliness coverage in early days; Smear method Sensitivity Specificity is poor; Cultivation length consuming time, needs 4-8 time-of-week; TST skin test tests then poor specificity, accurately cannot distinguish BCG (Bacille Calmette-Guerin) inoculator and tuberculosis patient.
Specific antigen diagnosis is confirm and assess pathogenic infection and infection state method comparatively reliably always, and has early diagnosis to be worth, and obtains a wide range of applications in the diagnosis of the diseases such as HBV, HCV, HIV.Because human body is in the infection of Antituberculous bacillus, cellular immunity serves critical effect, so the T cell antigen finding tubercle bacillus specific has become with detection t cell immune response the focus studied this year.The T-SPOT reagent had been reported in the world uses specific antigen ESAT-6 and CFP-10 of tubercle bacillus just, with Elispot method diagnosis of tuberculosis early infection (China Patent Publication No.: 1350546).
But these two antigens of ESAT-6, Cfp-10 belong to tubercle bacillus Early insulin secretion albumen, in tuberculosis persistent infection, secretory volume reduces, and causes the susceptibility deficiency detected, has limited to the popularization of this reagent.Have on the other hand research display T-SPOT reagent unsatisfactory in the effect of developing country, supposition may be relevant with developing country non-tuberculous mycobacteria infection rate height.T-SPOT reagent is expensive in addition, and each person-portion is roughly equal to 80 U.S. dollars, is difficult to promote in developing country.
Summary of the invention
In order to solve above-mentioned the problems of the prior art, the object of this invention is to provide specificity high, can applied range be detected and the reagent of detection tuberculosis infection with low cost, method and kit.
An object of the present invention is to provide the reagent detecting mycobacterial infections, comprises any one or multiple in the albumen representated by SEQIDNO1-5, polypeptide or analog in described reagent.
SEQID1:vnsplvvgflacftliaaig
SEQID2:atpvrlaevlvtcaaftfl
SEQID3:wfatlgfgagrlrglftnpg
SEQID4:lrglftnpgswrildgliav
SEQID5:vnsplvvgflacftliaaigaqnafvlrqgiqrehvlpvvalctvsdivliaagiagfgaligahpralnvvkfggaafligygllaarrawrpvalipsgatpvrlaevlvtcaaftflnphvyldtvvllgalanehsdqrwlfglgavtasavwfatlgfgagrlrglftnpgswrildgliavmmvalgisltvt
In the preferred embodiment, described analog comprises similar peptide or by the MHCII molecule aggregation polymerizable molecular together of biotin/streptavidin system by multiple similar peptide, described similar peptide and the amino acid sequence homologous representated by SEQIDNO1-5.
Another object of the present invention is to provide a kind of method applying mentioned reagent detection mycobacterium, comprises the following steps:
Step 1, makes reagent according to claim 1 contact with host T cell, comprises any one or multiple in the albumen representated by SEQIDNO1-5, polypeptide or its analog in described reagent;
Step 2, after being contacted with albumen, polypeptide or analog by mensuration T cell, whether state changes, thus determines whether T cell identifies described albumen, polypeptide or analog:
Described albumen, polypeptide or analog can be identified, to be then judged to be the positive, to infect mycobacterium;
Can not identify and then be judged to be described albumen, polypeptide or analog feminine gender, do not infect mycobacterium.
In another preferred embodiment of the present invention, the change in described step 2 comprises T cell and starts secrete cytokines or secretory volume increase, the change of T cell size, quantity (propagation) or surface marker.
Detect the method for mycobacterium as claimed in claim 3, it is characterized in that, described T cell can the peripheral blood of host, bronchoalveolar lavage fluid, pleural effusion, lymph node, lymph liquid and other comprise in T cell tissue and detect.
In another preferred embodiment of the present invention, described T cell is CD4
+t cell, CD8
+t cell or gamma delta T cells.
In another preferred embodiment of the present invention, described step 2 comprises and adds antibody in advance and be combined with described cell factor; Detected by the existence measuring antibody or antibody complex and determine that described T cell starts secrete cytokines or secretory volume increases.
In another preferred embodiment of the present invention, described cell factor comprises IFN-γ, IL-2, IP-10, IL-12, TNF-α.
Another object of the present invention is to provide a kind of kit detecting mycobacterium for said method, comprises the reagent detecting mycobacterial infections as claimed in claim 1.
In another preferred embodiment of the present invention, kit also comprises vacuum calparine pipe, detects the instrument of IFN-γ, the packing box of packaging reagent and bottle for ELISA experiment; Described instrument comprises plant agglutinin of blood (PHA), ELISA Plate, IFN-gamma antibodies, washes plate liquid, sample diluting liquid, IgG primary antibodie, enzyme coupling two are anti-, nitrite ion and stop buffer.
Susceptibility, specificity that reagent of the present invention, detection method and kit detect are high, can either the tubercular of detected activity, the tubercular that can detect again latency and healthy population, sensing range is wide and easily manufactured, with low cost.
Accompanying drawing explanation
It is the value that the reagent containing the protein/polypeptide shown in SEQIDNO1 is measured at IFN-γ host being detected to gained shown in Fig. 1.
It is the value that the reagent containing the protein/polypeptide shown in SEQIDNO2 is measured at IFN-γ host being detected to gained shown in Fig. 2.
It is the value that the reagent containing the protein/polypeptide shown in SEQIDNO3 is measured at IFN-γ host being detected to gained shown in Fig. 3.
It is the value that the reagent containing the protein/polypeptide shown in SEQIDNO4 is measured at IFN-γ host being detected to gained shown in Fig. 4.
Embodiment
Below with reference to embodiment, detailed explaination is done to the present invention.
The present invention is applied to mycobacterium tuberculosis infection.Mycobacterium tuberculosis infection is commonly referred to as the crowd suffering from activity or latent tuberculosis bacillus.Also can be healthy contactee, it be exposed in tubercle bacillus.Therefore, the present invention also can be used for investigating healthy exposed population group by tuberculosis infection situation.
A kind of any one or multiple detected in the reagent of mycobacterial infections in albumen, polypeptide or the analog comprised representated by SEQIDNO1-5 of the present invention.
The amino acid sequence represented by SEQID1-5 of the present invention, the complete or albumen that partly comes from coded by M. tuberculosis genes Rv1986.Further, relating to all amino acid sequences in the present invention all holds C to hold from N.
Proteins and peptides in the present invention can be natural separation, also can be Prof. Du Yucang.Preferred method is, is prepared or produced through physics or chemical cracking by other polypeptide by longer fusion.
In other embodiments, polypeptide used also can be synthesized by solid phase formylation synthesizer.
Analog in the present invention, refers to that its characteristic is identical with above-mentioned albumen or polypeptide, comprises it and can specificly be combined with T cell or antibody equally.Preferably this analog be of similar shape, size, pliability, electronic configuration etc.
Typical analog is similar peptide.It can with the amino acid sequence homologous representated by SEQID1-5.With the peptide of another peptide homology, there is the homology of at least 75% usually, preferably the homology of at least 90%, 95%.Generally, the difference of homeopeptide comes from the replacement of amino acid residue, insertion, disappearance and modification.It can occur in sequence N end, C end or other any positions on.Preferably analog can be incorporated on identical major histocompatibility complex (MHC) molecule, and to be in amino acid in equivalent locations in analog with those in homeopeptide be identical or conservative.
Above-mentioned modification, is commonly referred to as natural posttranscriptional modification or manually modified.Modification can provide the change of chemical part, comprises amino, acetyl group, hydroxyl, halogen group and carbohydrate group.The preferably modification of amino acid side chain, namely forms one or more alpha-non-natural amino acid.
Another kind of representational analog be a kind of by biotin/streptavidin system by multiple major histocompatibility complex (MHC) II molecule aggregation polymerizable molecular together in conjunction with homeopeptide or similar peptide.The combination of this analog typically peptide for inhibiting/mhc class ii compound and φt cell receptor, or can compound is special therewith antibody combine.
A kind of method applying mentioned reagent detection mycobacterium of the present invention, comprises the following steps:
Step 1, makes reagent according to claim 1 contact with host T cell, comprises any one or multiple in the albumen representated by SEQIDNO1-5, polypeptide or its analog in described reagent;
Step 2, after being contacted with albumen, polypeptide or analog by mensuration T cell, whether state changes, thus determines whether T cell identifies described albumen, polypeptide or analog:
Described albumen, polypeptide or analog can be identified, to be then judged to be the positive, to infect mycobacterium;
Can not identify and then be judged to be described albumen, polypeptide or analog feminine gender, do not infect mycobacterium.
T cell in the present invention usually in vivo by the antigen presensitization from tubercle bacillus, these T cell can the peripheral blood of host, bronchoalveolar lavage fluid, pleural effusion, lymph node, lymph liquid and other comprise in T cell tissue and be detected.Further, T cell can be untreated, also can be in in-vitro separation or body.Preferably adopt comprise T cell, not separated periphery anticoagulated whole blood.
In other examples, the monocyte (PBMC) be separated from blood or other samples can also be used, comprising T cell and APC.APC is antigen presenting cell, can by antigenic peptides submission to T cell.APC can be natural generation or artificial APC.Typical APC is the new cell that is separated or through cultured cells in vitro.
Check to determine that the method for T cell identification albumen or polypeptide carrys out monitor peptide identification in vivo by the appearance of delayed allergy (delayedtypehypersensitivity, DTH) in preferred a kind of body, such as, check sclerosis, erythema or oedema etc.Usually polynucleotide of the present invention are expressed by injecting the present invention in body or being applied to.
In addition, the identification in the present invention, the change normally contacting rear T cell state by measuring T cell with the present invention is determined.This change is mainly due to MHC/ peptide complexes and the special combination of TCR (φt cell receptor) and the activation of the T cell of bringing out, can be that T cell starts secrete cytokines or secretory volume increases, also can be the change of T cell size, quantity (propagation) or surface marker.The described T cell factor comprises IFN-γ, IL-2, IP-10, IL-12, TNF-α etc., preferably detects T cell factor IFN-γ.
In one embodiment of the invention, employing adds antibody in advance and combines with the cell factor that T cell is secreted, and the existence then by measuring antibody or antibody complex detects the described factor.Antibody can be monoclonal antibody or polyclonal antibody, also can be that commercialization is bought or uses standard technique to prepare.The method that the method measuring cell factor is normally commonly used in field, as external enzyme linked immunoassay method (Elisa), ELISpot test method(s) (Elispot) or Western blot (Immunoblotting) etc.
In an embodiment of the present invention, the cell factor of detection is the IFN-γ of T cell secretion.The detection system used is external enzyme linked immunoassay (ELISA) analysis.Then IFN-γ and the IFN-gamma antibodies specific bond be fixed on solid phase carrier are with enzyme connection mark the 2nd IFN-gamma antibodies specific bond primary antibodie compound.Also the 2nd IFN-gamma antibodies of biotin coupling can be used in conjunction with primary antibodie compound, then use streptavidin and the biotin specific bond of enzyme connection.Chromogenic substrate finally by enzyme forms coloured solution, detects T cell secretion of gamma-IFN by the change of absorbance, uses the IFN-γ of concentration known to carry out quantitatively as standard items simultaneously.
In another embodiment, the detection system of use may also be ELISpot test (ELISPOT).
Meanwhile, the detection T cell in the present invention and the combination of reagent of the present invention also can by FACS(flow cytometers) instrument carries out.Usually be 10 in the frequency of occurrences of the T cell contacted
-3-10
-6if be sorted the frequency of cell higher than normal control values, then quantitatively can determine that cell has contacted this antigen.
In addition, in the process detecting mycobacterium, the time length that albumen of the present invention, polypeptide or analog contact with T cell can change to some extent according to measured recognition methods.The typical time period that T cell is hatched together with albumen or polypeptide be 6 hours to 5 days not etc., preferably, being 20-24 hour when using whole blood, and being 3-5 days during whole blood after using 1:5 or 1:10 to dilute, is 2-3 days when detecting in body.The concentration adding albumen or polypeptide is 0.1-100ug/ml.Wherein, the polypeptide solution of 10ug/ml is preferably used.
A kind of kit of the present invention, it comprises vacuum calparine pipe to comprise one or more albumen of the present invention or polypeptide or analog.In other embodiments, also can comprise plant agglutinin of blood (PHA), ELISA Plate, IFN-gamma antibodies, wash plate liquid, sample diluting liquid, IgG primary antibodie, enzyme coupling two is anti-, nitrite ion, stop buffer etc. detect IFN-γ for ELISA experiment instrument, and for the packing box of packing mentioned reagent and bottle.
Multiple protein in kit or polypeptide can be used alone, and also can mix, use continuously, to improve the susceptibility of detection.Positive control and negative control is also comprised in kit.Antigen selected by positive control all can produce response, as commercially available PHA (phytohemagglutin phytolectin) to most individual T cell.Negative control does not add antigenic component usually, selects nutrient culture media or other damping fluids.
Elaborate to protein/polypeptide reagent of the present invention, method below with reference to specific embodiment, specific embodiment carries out in kit of the present invention.
embodiment 1
Secretion from periphery whole blood test IFN-γ:
1) take anticoagulant heparin venous blood in heparin tube;
2) adding polypeptide/protein solution of the present invention to final concentration is 10ug/ml, cover lid, 37 degree of incubators cultivate 24 hours, select 5ug/ml phytohemagglutin phytolectin (phytohaemagglutinin, PHA) as positive control and nutrient culture media as negative control;
3) the centrifugal 10min of 3000rpm under taking-up room temperature, Aspirate supernatant.
ELISA method is used to carry out the quantitative of IFN-γ:
1. bag quilt: IFN-gamma antibodies is dissolved in bag and is buffered in liquid, add in 96 hole ELISA Plate (Nunc), 100ul/ hole, 4 DEG C are spent the night;
2. wash plate: cleansing solution 200ul/ hole, wash 2 times;
3. close: confining liquid, 300ul/ hole, incubated at room 2h;
4. wash plate: cleansing solution 300ul/ hole, wash 3 times;
5. add whole blood cell culture supernatant: add the primary antibodie 100ul/ hole after dilution, incubated at room 1h;
6. wash plate: cleansing solution 300ul/ hole, wash 5 times;
7. add ELIAS secondary antibody: horseradish peroxidase (horseradishperoxidase, HRP) the labelled antibody 100ul/ hole of diluted fresh, incubated at room 1h;
8. wash plate: cleansing solution 300ul/ hole, wash 5 times;
9. develop the color: 3,3', 5,5'-tetramethyl benzidine (TMB) nitrite ions of fresh configuration, 100ul/ hole, room temperature, 5-10min;
10. stop: 2MH
2sO
4, 50ul/ hole;
11. measure: microplate reader detects 450nm, to survey each hole OD value after first blank phosphate buffer (PBS) control wells zeroing.
Statistics and decision method:
As shown in Fig. 1 to 4, the value that the reagent of the protein/polypeptide shown in the SEQIDNO1-5 of comprising of the present invention is measured at IFN-γ host being detected to gained.Wherein, what black triangles and round dot showed is tuberculosis infection (TB) group, Healthy People (Control) control group of square point display; What ordinate showed is that IFN-γ measures.
Take control group as research contrast, the IFN-γ amount that antigen hole deducts negative control hole carries out recipient's operating characteristic curve analysis (ROC), selects optimal value as the threshold value judging tuberculosis infection.In the present embodiment, through calculating, threshold value is 12.5pg/ml, if the IFN-γ amount that antigen hole deducts negative control hole is greater than threshold value and the IFN-γ being greater than negative control hole measure, is namely judged as the positive, infection Much's bacillus; Otherwise for feminine gender, do not infect Much's bacillus.
Utilize SPSS(StatisticsPackageforSocialScience) between two groups, carry out statistical study, non-matching grouping t-inspection (independentgroupt-test) is adopted to carry out the significance test of difference between group, if P<0.05, for sample room exists significant difference.
Tuberculosis infection group and control group were recruited at Huashan Hospital Affiliated To Fudan Univ tissue from 2010.The blood sample extracted from testee is through heparin or EDTA anti-freezing process.Tubercular is: clinical Much's bacillus is cultivated positive, and clinical examination conforms to X-ray examination result, and connects subject time-histories and be less than three weeks.Control group is FUO patient to be checked, after clarify a diagnosis and get rid of the case of tuberculosis infection, HIV is detected as feminine gender.
The Clinical results of protein/polypeptide:
Result is as shown in table 1, and the response rate of tuberculosis infected students to antigen is significantly higher than control group.And control group is lower to antigen protein generation positive response, specificity is all greater than 95%.
Table 1: two groups of crowd's whole bloods are to the response result of polypeptide/albumen
| Polypeptide/albumen | SEG 1 | SEG 2 | SEG 3 | SEG 4 | SEG 5 |
| Tuberculosis infected students (positive number/total number of persons) | 3/33 | 11/44 | 3/36 | 3/36 | 4/12 |
| Positive rate | 9% | 25% | 8% | 8% | 33% |
| Control group (positive number/total number of persons) | 0/14 | 1/23 | 0/35 | 0/35 | 0/10 |
| Positive rate | 0% | 4% | 0% | 0% | 0% |
embodiment 2
Separating monocytic cell (PBMC) from peripheral blood:
4) take venous blood 5ml to 10ml in heparin tube;
5) by the centrifugal 10min of 3000rpm under heparin tube room temperature, draw middle layer white cell, be resuspended in 8ml cell culture medium RPMI1640 (being purchased from Gibco company);
6) in 15ml centrifuge tube, add 4mlFicoll (being purchased from Amresco company) lymphocyte separation medium, above-mentioned cell suspension is added lymphocyte separation medium upper strata gently.The centrifugal 20min of 3000rpm room temperature;
7) draw centrifugal after intermediate layer cell in new centrifuge tube, it is resuspended to add RPMI1640, mixing, the centrifugal 5min of 2000rpm;
8) abandon supernatant, add 5ml erythrocyte cracked liquid (being purchased from Invitrogen company), incubated at room 10min.
9) add RPMI1640 resuspended, mixing, the centrifugal 5min of 2000rpm, abandons supernatant;
10) re-suspended cell (is purchased from Gibco) in 1mlAIV-M nutrient culture media, gets cell and typanblue(trypan blue) 1:1 mixes, adds blood cell counting plate and count;
11) according to count results, nutrient culture media diluting cells is used.
The secretion of IFN-γ is detected by ELISPOT method:
1) on 96 hole PVDF plates (being purchased from Millipore company), use 10ug/mlIFN-γ mAB is pre-coated spends the night;
2) wash 2 times with nutrient culture media RPMI1640, use RPMI1640+10%FBS (hyclone) 4 DEG C to close 1 hour;
3) adding 100ul concentration in every hole is 5 × 10
5the PBMC cell of individual/ml.Albumen or polypeptide are added respectively in hand-hole respectively in experimental group, final concentration is 10ug/ml; The PHA that final concentration is 5ug/ml is added in Positive control wells; 100ulAIV-M is added in negative control hole;
4) 37 DEG C, hatch 22 hours in 5%CO2 incubator;
5) abandon cell liquid, wash dull and stereotyped 5 times with containing 0.05%Tween20PBS, each 250ul/ hole;
6) biotinylation anti-IFN-γ Mab (monoclonal antibody) of 100ul1ug/ml is added, incubated at room 2 hours;
7) wash plate 5 times with containing 0.05%Tween20PBS damping fluid again, add the avidin enzyme chain element-horseradish peroxidase thing of 1:1000, hatch 1 hour for 37 DEG C;
8) wash plate 5 times with PBS damping fluid again, dry;
9) HRP substrate solution 50ul/ hole is finally added, left at room temperature reaction 5-25min.Distilled water washs 2 times, dries;
10) count spot number under microscope, accurate spot is read and is advised adopting area of computer aided Image analysis system to carry out with counting.
Result judges:
Positive findings: spot number >=6, and be greater than 2 times of negative control hole spot numbers.
Negative findings: spot number≤6, or be less than 2 times of negative control hole spot numbers.
Usually, before accurate metering with the naked eye or magnifier observe, directly judge positive or negative result by spot number.The positive is infection Much's bacillus; Feminine gender is and does not infect Much's bacillus.
Be described in detail specific embodiments of the invention above, but it is just as example, the present invention is not restricted to specific embodiment described above.To those skilled in the art, any equivalent modifications that the present invention is carried out and substituting also all among category of the present invention.Therefore, equalization conversion done without departing from the spirit and scope of the invention and amendment, all should contain within the scope of the invention.
SEQUENCELISTING
<110> Huashan Hospital Affiliated To Fudan Univ
<120> detects the reagent of mycobacterial infections, method and kit
<160>5
<170>PatentInversion3.5
<210>1
<211>20
<212>PRT
<213> tubercle bacillus (Mycobacteriumtuberculosis)
<400>1
ValAsnSerProLeuValValGlyPheLeuAlaCysPheThrLeuIle
151015
AlaAlaIleGly
20
<210>2
<211>19
<212>PRT
<213> tubercle bacillus (Mycobacteriumtuberculosis)
<400>2
AlaThrProValArgLeuAlaGluValLeuValThrCysAlaAlaPhe
151015
ThrPheLeu
<210>3
<211>20
<212>PRT
<213> tubercle bacillus (Mycobacteriumtuberculosis)
<400>3
TrpPheAlaThrLeuGlyPheGlyAlaGlyArgLeuArgGlyLeuPhe
151015
ThrAsnProGly
20
<210>4
<211>20
<212>PRT
<213> tubercle bacillus (Mycobacteriumtuberculosis)
<400>4
LeuArgGlyLeuPheThrAsnProGlySerTrpArgIleLeuAspGly
151015
LeuIleAlaVal
20
<210>5
<211>199
<212>PRT
<213> tubercle bacillus (Mycobacteriumtuberculosis)
<400>5
ValAsnSerProLeuValValGlyPheLeuAlaCysPheThrLeuIle
151015
AlaAlaIleGlyAlaGlnAsnAlaPheValLeuArgGlnGlyIleGln
202530
ArgGluHisValLeuProValValAlaLeuCysThrValSerAspIle
354045
ValLeuIleAlaAlaGlyIleAlaGlyPheGlyAlaLeuIleGlyAla
505560
HisProArgAlaLeuAsnValValLysPheGlyGlyAlaAlaPheLeu
65707580
IleGlyTyrGlyLeuLeuAlaAlaArgArgAlaTrpArgProValAla
859095
LeuIleProSerGlyAlaThrProValArgLeuAlaGluValLeuVal
100105110
ThrCysAlaAlaPheThrPheLeuAsnProHisValTyrLeuAspThr
115120125
ValValLeuLeuGlyAlaLeuAlaAsnGluHisSerAspGlnArgTrp
130135140
LeuPheGlyLeuGlyAlaValThrAlaSerAlaValTrpPheAlaThr
145150155160
LeuGlyPheGlyAlaGlyArgLeuArgGlyLeuPheThrAsnProGly
165170175
SerTrpArgIleLeuAspGlyLeuIleAlaValMetMetValAlaLeu
180185190
GlyIleSerLeuThrValThr
195
Claims (6)
1. detect the purposes of reagent in preparation detection mycobacterium preparation for mycobacterial infections, wherein, in described reagent, comprise any one or multiple in the albumen representated by SEQIDNO1-4, polypeptide or analog; Wherein, described analog comprises similar peptide or by the MHCII molecule aggregation polymerizable molecular together of biotin/streptavidin system by multiple similar peptide, described similar peptide and the amino acid sequence homologous representated by SEQIDNO1-4; It is characterized in that, comprise the following steps:
Step 1, makes described reagent contact with host T cell, comprises any one or multiple in the albumen representated by SEQIDNO1-4, polypeptide or its analog in described reagent;
Step 2, after being contacted with albumen, polypeptide or analog by mensuration T cell, whether state changes, thus determines whether T cell identifies described albumen, polypeptide or analog:
Described albumen, polypeptide or analog can be identified, to be then judged to be the positive, to infect mycobacterium;
Can not identify and then be judged to be described albumen, polypeptide or analog feminine gender, do not infect mycobacterium.
2. purposes as claimed in claim 1, is characterized in that, the change in described step 2 comprises T cell and starts secrete cytokines or secretory volume increases, the change of T cell size, quantity (propagation) or surface marker.
3. purposes as claimed in claim 1, is characterized in that, described T cell can the peripheral blood of host, bronchoalveolar lavage fluid, pleural effusion, lymph node, lymph liquid and other comprise in T cell tissue and detect.
4. purposes as claimed in claim 3, it is characterized in that, described T cell is CD4
+t cell, CD8
+t cell or gamma delta T cells.
5. purposes as claimed in claim 2, is characterized in that, described step 2 comprises and adds antibody in advance and be combined with described cell factor; Detected by the existence measuring antibody or antibody complex and determine that described T cell starts secrete cytokines or secretory volume increases.
6. purposes as described in claim 2 or 5, is characterized in that, described cell factor comprises IFN-γ, IL-2, IP-10, IL-12, TNF-α.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201110315979.8A CN103063836B (en) | 2011-10-18 | 2011-10-18 | Detect the reagent of mycobacterial infections, method and kit |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201110315979.8A CN103063836B (en) | 2011-10-18 | 2011-10-18 | Detect the reagent of mycobacterial infections, method and kit |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN103063836A CN103063836A (en) | 2013-04-24 |
| CN103063836B true CN103063836B (en) | 2016-03-30 |
Family
ID=48106547
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201110315979.8A Active CN103063836B (en) | 2011-10-18 | 2011-10-18 | Detect the reagent of mycobacterial infections, method and kit |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN103063836B (en) |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103382473B (en) * | 2013-07-24 | 2015-04-01 | 重庆医科大学 | Nucleotide mts 90 and use thereof in tuberculosis diagnosis |
| GB201401603D0 (en) * | 2014-01-30 | 2014-03-19 | Proteinlogic Ltd | Biomarkers |
| CN106349350A (en) * | 2015-07-16 | 2017-01-25 | 广东体必康生物科技有限公司 | Protein capable of specifically detecting mycobacterium tuberculosis infection |
| CN106053783A (en) * | 2016-06-03 | 2016-10-26 | 广州市丰华生物工程有限公司 | Quick time-resolved fluorescence immunoassay kit for detection of T cells infected with tuberculosis and detection method of kit |
| CN113025729B (en) * | 2020-12-24 | 2022-11-04 | 复旦大学 | Gene mutation site related to resistance of mycobacterium tuberculosis to aminosalicylic acid and application of gene mutation site |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0479971A1 (en) * | 1990-03-27 | 1992-04-15 | Aktiebolaget Astra | New proteins, peptides and corresponding dna or rna sequences and probes useful for diagnosing tuberculosis |
| WO2000020027A2 (en) * | 1998-10-05 | 2000-04-13 | M & E Biotech A/S | Methods for therapeutic vaccination |
| EP1200459A1 (en) * | 1999-07-12 | 2002-05-02 | Genesis Research & Development Corporation Limited | Compounds for treatment of infectious and immune system disorders and methods for their use |
| CN101294964A (en) * | 2007-11-27 | 2008-10-29 | 复旦大学附属华山医院 | Reagent and method for detecting active tuberculosis and tuberculosis dormant infection |
| CN101419237A (en) * | 2008-09-03 | 2009-04-29 | 深圳市东湖医院 | ELISA fleck diagnosis kit for tubercle bacillus infect and method for preparing specific antigen |
| CN101446585A (en) * | 2008-12-29 | 2009-06-03 | 中山大学 | Reagent for detecting tubercle bacillus infection in vitro and method thereof |
| CN102004155A (en) * | 2010-02-12 | 2011-04-06 | 复旦大学附属华山医院 | Kit and method for detecting mycobacterium tuberculosis infection and application |
-
2011
- 2011-10-18 CN CN201110315979.8A patent/CN103063836B/en active Active
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0479971A1 (en) * | 1990-03-27 | 1992-04-15 | Aktiebolaget Astra | New proteins, peptides and corresponding dna or rna sequences and probes useful for diagnosing tuberculosis |
| WO2000020027A2 (en) * | 1998-10-05 | 2000-04-13 | M & E Biotech A/S | Methods for therapeutic vaccination |
| EP1200459A1 (en) * | 1999-07-12 | 2002-05-02 | Genesis Research & Development Corporation Limited | Compounds for treatment of infectious and immune system disorders and methods for their use |
| CN101294964A (en) * | 2007-11-27 | 2008-10-29 | 复旦大学附属华山医院 | Reagent and method for detecting active tuberculosis and tuberculosis dormant infection |
| CN101419237A (en) * | 2008-09-03 | 2009-04-29 | 深圳市东湖医院 | ELISA fleck diagnosis kit for tubercle bacillus infect and method for preparing specific antigen |
| CN101446585A (en) * | 2008-12-29 | 2009-06-03 | 中山大学 | Reagent for detecting tubercle bacillus infection in vitro and method thereof |
| CN102004155A (en) * | 2010-02-12 | 2011-04-06 | 复旦大学附属华山医院 | Kit and method for detecting mycobacterium tuberculosis infection and application |
Non-Patent Citations (1)
| Title |
|---|
| 索引号：P64904;Garnier,T. et al.;《Swiss-Port Database》;20041011;全文 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN103063836A (en) | 2013-04-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2128612B1 (en) | IP-10 based immunological monitoring | |
| CN101294964B (en) | Reagent and method for detecting active tuberculosis and tuberculosis dormant infection | |
| CN102004155B (en) | Kit and method for detecting mycobacterium tuberculosis infection and application | |
| CN103063836B (en) | Detect the reagent of mycobacterial infections, method and kit | |
| CN106461675B (en) | For diagnosing phthisical method | |
| CN104597239B (en) | Antigen stimulant and kit for detecting mycobacterium tuberculosis infection, and application of antigen stimulant | |
| CN104628833B (en) | A kind of tuberculosis infection cellular immunization detectable antigens composition and application thereof | |
| CN104020297B (en) | Test kit for m tuberculosis infection detection and clinical therapeutic efficacy monitoring and application thereof | |
| CN102246040A (en) | Method and device for diagnosing tuberculosis | |
| van Hooij et al. | Prototype multi-biomarker test for point-of-care leprosy diagnostics | |
| CN106501530A (en) | A kind of biomarker of diagnosing tubercle bacillus infection and its related kit | |
| CN101419237B (en) | ELISA fleck diagnosis kit for tubercle bacillus infect and method for preparing specific antigen | |
| CN103063837B (en) | Reagent, method and kit for detecting mycobacterial infection | |
| CN101446585B (en) | Reagent for detecting tubercle bacillus infection in vitro and method thereof | |
| CN104662170A (en) | Rapid assays for t-cell activation by rna measurements using flow cytometry | |
| Basha et al. | Poor memory B cell generation contributes to non-protective responses to DTaP vaccine antigens in otitis-prone children | |
| CN106939035B (en) | Mycobacterium tuberculosis T cell epitope polypeptide and application thereof | |
| CN108828226A (en) | A method of improving peripheral white blood cells secrete cytokines verification and measurement ratio | |
| CN109813903A (en) | The method for being used for diagnosis of tuberculosis mycobacterial infections based on Flow cytometry tuberculosis Specific T cell immunity phenotype | |
| KR102132964B1 (en) | Method for Diagnosing Scrub Typhus Using Exosome derived from Orientia tsutsugamushi | |
| CN104628834B (en) | A kind of tuberculosis infection T cell immunodetection antigen and application thereof | |
| CN102305855A (en) | Reagent and method for detecting Mycobacterium tuberculosis infection in vitro | |
| Škoberne et al. | Human peripheral blood lymphocytes sensitised to PPD respond to in vitro stimulation with increased expression of CD69 and CD134 activation antigens and production of Th-1 type cytokines | |
| Bloch et al. | A 22 year follow-up study on lymphatic filariasis in Tanzania: analysis of immunological responsiveness in relation to long-term infection pattern | |
| CN103525829A (en) | Preparation method of recombinant antigen of mycobacterium tuberculosis capable of being used for diagnosing tuberculosis infection |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| C14 | Grant of patent or utility model | ||
| GR01 | Patent grant |