CN102994511B - Cloning and application for bovine slaughter trait related gene CMYA4 - Google Patents
Cloning and application for bovine slaughter trait related gene CMYA4 Download PDFInfo
- Publication number
- CN102994511B CN102994511B CN201210462180.6A CN201210462180A CN102994511B CN 102994511 B CN102994511 B CN 102994511B CN 201210462180 A CN201210462180 A CN 201210462180A CN 102994511 B CN102994511 B CN 102994511B
- Authority
- CN
- China
- Prior art keywords
- cmya4
- gene
- bovine
- snp
- marker
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Images
Landscapes
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The invention relates to cloning and an application for bovine slaughter trait related gene CMYA4. An SNP (single nucleotide polymorphism) marker site related to bovine slaughter trait is formed at the 8th exon 1092bp of the gene CMYA4, which is subjected to T/C mutation. The cloning preparation for the gene CMYA4 comprises the following steps of: obtaining the mRNA (messenger ribonucleic acid) sequence of the gene CMYA4; performing chromosomal localization, genetic structure analysis and protein characteristics analysis for the gene CMYA4; designing a primer to amplify a genomic DNA (deoxyribonucleic acid) containing the SNP site; and performing RFLP-PCR (restriction fragment length polymorphism-polymerase chain reaction) polymorphism detection, and taking the SNP marker related to bovine slaughter trait in the gene CMYA4 as a breeding and genetic marker for Simmental beef molecules. Via the cloning for the bovine slaughter trait related gene CMYA4 disclosed by the invention, new information is provided for a bovine genome database, and reference is provided for utilization for high-quality trait genes; and via the application for the SNP polymorphic site disclosed by the invention, a new technical index is provided for bovine slaughter trait detection, and a new marker is provided for bovine marker-assisted breeding.
Description
Technical field
The invention belongs to gene engineering technology field, be specifically related to clone and the application of a kind of ox slaughter trait genes involved CMYA4.
Background technology
Muscle in animal body can be divided into three major types: skeletal muscle, cardiac muscle and unstriated muscle.The 40-60% of skeletal muscle percentage of liveweight, is determining the meat yield of domestic animal.Skeletal muscle is comprised of a large amount of myofiber (myofiber), and each myofiber is exactly a myocyte.Myofiber can be divided into according to metabolic characteristic: red muscle fiber (slowly aerobic shrinkage type) and white muscle fiber (fast glycolytic shrinkage type), also have in addition the contained enzyme activity of a kind of myofiber to occupy between this two classes myofiber, pinkiness is intermediate muscle fiber.The composition of the muscle tissue of CMYA family gene and animal has close relationship.The process of growth of skeletal muscle relates to the expression of large quantities of genes and transcribes the regulation and control with translation skill, and the expression regulation of the meat-producing traits difference of Different Individual or different breeds of cattle and embryonic stage and raw late gene is closely related.CMYA is primary cardiomyopathy associated protein (cardiomyopathy associated protein, CMYA), and the research about CMYA family gene at present mainly concentrates on the interaction to this gene and myoprotein.
CMYA4 gene has another name called UNC-45B(unc-45homolog B) or skeletal muscle UNC-45(Skeletalmuscle UNC-45).By genetic experiment, show that this gene is relevant with the assembling of crin, find that it has the effect of molecular chaperones.Nematode UNC-45 molecular size range is 107kDa, and aminoterminal contains 34 amino acid whose tumor-necrosis factor glycoproteinss, the central zone of about 400 amino-acid residues and UNC-45/Cro1/She4p (UCS) structural domain.UNC-45 expresses in muscle tissue, and immunofluorescence dyeing shows that it and heavy meromyosin are positioned muscle of trunk A-band crin altogether.Research finds in mammalian body, to have 2 kinds of UNC-45 albumen, is respectively GC UNC-45 and SM UNC-45.Homology 74% left and right of these two kinds of gal4 amino acids generally, and mouse and people are the highest, reach respectively 95% and 98%.Detected respectively them organizes in the distribution situation demonstration GC of adult mice different tissues UNC-45 wide expression in each, and SM UNC-45 is only at skeletal muscle and Expression in Myocardium, and utilize hybridization in situ technique to detect them in the expression of embryo different development stage, result demonstration SM UNC-45 gene is only expressed in beginning in the 8.75th day of Mouse Embryo Development in heart, and GC UNC-45 gene is in the wide expression that just starts for the 8th day of fetal development.In the C2C12 clone of cultivating, GC-UNC45 gene is the highest at proliferation period expression amount, and SM UNC-45 expressed in differential period, participates in myocyte's maturation and the formation of myotube.By above result author, show that SM UNC-45 plays an important role in muscle development.After zebra fish is knocked out to SM UNC-45 gene, occur the abnormal of paralysis and heart function, further research finds that paralysis is the shortage due to myosin filament in muscle of trunk sarcomere.Above experimental result further illustrates the vital role of SM UNC-45 in muscle development.
In real work, people attempt to find a kind of method of easy evaluation carcass quality, and to reduce financial loss, therefore large quantity research is devoted to find the optimum prediction index that trunk forms.And development and the application of DNA molecular marker technology at present, for the rapid evaluation of carcass quality has been opened up new way.Therefore molecular genetic marker may overcome this shortcoming and earlier kind of an ox be selected, and suitable genetic marker, for carrying out marker assisted selection, is accelerated genetic progress, and finally to realize molecular breeding be extremely important.In addition, the polymorphism of research mutational site in colony, and carry out the strong means that proterties association analysis is research gene function.In colony, by proterties association analysis, find the gene relevant to ox important economical trait, carry out molecular breeding and be all the time the important and difficult task of of breeder.
CMYA4 gene is an important muscle growth development related gene, this gene is used in the selection of molecule aid mark significant, separating clone ox slaughter trait genes involved CMYA4 also carries out the association analysis of its polymorphism and slaughter trait, can develop the new technology for detection of ox slaughter trait index, for the marker-assisted breeding of ox provides new mark.
By the retrieval to domestic patent document, do not retrieve the Patents document with ox slaughter trait genes involved CMYA4 technology.
Summary of the invention
The object of the invention is to Separation of Bovine slaughter trait genes involved CMYA4, obtain CMYA4 gene mRNA sequence, the clone of realization to ox slaughter trait genes involved CMYA4, by the RFLP polymorphic detection to clone gene, the association analysis of RFLP polymorphism and carcass trait, set up RFLP polymorphism for detection of the technology of ox slaughter trait index, and provide new mark for the marker-assisted breeding of ox.
The present invention solves its technical problem and takes following technical scheme to realize:
An ox slaughter trait genes involved CMYA4, has a SNP marker site relevant to ox slaughter trait at the 8th exons 1 092bp place of CMYA4 gene, is T/C sudden change.
A clone of ox slaughter trait genes involved CMYA4, preparation process is as follows:
The first step, by inquiry ncbi database (
http:// www.ncbi.nlm.nih.gov/guide/) and Ensembl database (
http:// asia.ensembl.org/index.html) utilize comparative genomics method to obtain CMYA4 gene mRNA sequence:
(1) Query Database obtains Homo sapiens cardiomyopathy-associated protein 4 (CMYA4), mRNA sequence NM_173167.2 and Mus musculus cardiomyopathy-associatedprotein 4 (CMYA4), mRNA sequence NM_178680.4;
(2) utilize NCBI BLAST instrument to utilize Highly similar sequences (megablast) comparison ox expressed sequence tag EST, choose the expressed sequence tag sequence .EDY048664.1 that homology is greater than 80%, EE373716.1, EE381791.1, EE376524.1, DV933195.1, DV930911.1, DV797178.1, CB438141.1, by DNAstar(Madison, WI, USA) program splicing acquisition CMYA4mRNA full length sequence 3430bp;
Second step, according to CMYA4 gene mRNA sequence, utilizes the method for comparing to carry out chromosomal localization and gene structure analysis and the albumen characteristic analysis of CMYA4 gene:
The 3rd step, finds out the SNP site of CMYA4 gene, and design primer amplification is containing the genomic dna in SNP site;
(1) find out a SNP site of CMYA4 gene;
(2) according to gene order design primer amplification, go out the nucleotide fragments at SNP to be measured place;
The 4th step, RFLP-PCR polymorphic detection.
And (2) the of described preparation process the 3rd step designs the primer sequence of nucleotide fragments that primer amplification goes out SNP to be measured place in step as shown in SEQ ID NO:3 ~ 4.
An application of ox slaughter trait genes involved CMYA4 is using SNP mark relevant to ox slaughter trait in gene C MYA4 as beef molecular breeding genetic marker.
And, SNP mark relevant to ox slaughter trait in gene C MYA4 is as follows as the step of ox molecular breeding genetic marker:
The first step, the association analysis of ox CMYA4 gene HindIII-RFLP genotype and Part Traits;
Second step, determines that gene C MYA4 and SNP site thereof are for detection of carcass traits such as individual gross weight, carcass weight, trunk is long, trunk is dark, tare weights.
Advantage of the present invention and effect are:
1, Separation of Bovine slaughter trait genes involved CMYA4 of the present invention; utilize comparative genomics method to obtain CMYA4 gene mRNA sequence; and the chromosomal localization of definite CMYA4 gene and the structure of gene; can be for cow genome group database provides new information, for the utilization of high-quality character gene provides reference.
2, CMYA4 gene is an important muscle growth development related gene, this gene is used in the selection of molecule aid mark significant, the present invention chooses a SNP site of CMYA4 gene, the nucleotide fragments that goes out SNP to be measured place according to gene order design primer amplification, carries out RFLP-PCR with HindIII.In the cows of analyzing, utilize pair of primers for mutational site, by PCR-RFLP, detect genotype and the gene frequency in SNP site.And for Simmental, carry out proterties association analysis with 130 13 months large F3, and confirm available ox molecular breeding genetic marker, can develop the new technology for detection of ox slaughter trait index, for the marker-assisted breeding of ox provides new mark.
Accompanying drawing explanation
Fig. 1 is used online software in the present invention
http:// cn.expasy.org/tools/the prediction CMYA4 protein function territory figure that predicts the outcome;
Fig. 2 is T1092-C1092 loci gene type demonstration figure of the present invention.
Embodiment
Below in conjunction with specific embodiments, the present invention is further described, and its specific embodiments is only construed as illustrating, and is not determinate, can not illustrate to limit protection scope of the present invention with following.
Technological line of the present invention is: by inquiry ncbi database and Ensembl data base manipulation comparative genomics method, obtained CMYA4 gene mRNA sequence, utilized the method for comparing to carry out chromosomal localization and gene structure analysis and the albumen characteristic analysis of CMYA4 gene, design primer amplification containing the association analysis of genomic dna, RFLP polymorphic detection, RFLP polymorphism and the carcass trait in SNP site, confirmation can be used as beef molecular breeding genetic marker SNP site.
Clone's step of a kind of ox slaughter trait genes involved CMYA4 is as follows:
The first step, by inquiry ncbi database (
http:// www.ncbi.nlm.nih.gov/guide/) and Ensembl database (
http:// asia.ensembl.org/index.html) utilize comparative genomics method to obtain CMYA4 gene mRNA sequence:
(1) Query Database obtains Homo sapiens cardiomyopathy-associated protein 4 (CMYA4), mRNA sequence NM_173167.2 and Mus musculus cardiomyopathy-associatedprotein 4 (CMYA4), mRNA sequence NM_178680.4;
(2) utilize NCBI BLAST instrument to utilize Highly similar sequences (megablast) comparison ox expressed sequence tag EST, choose the expressed sequence tag sequence that homology is greater than 80%.EDY048664.1, EE373716.1, EE381791.1, EE376524.1, DV933195.1, DV930911.1, DV797178.1, CB438141.1, passes through DNAstar(Madison, WI, USA) program splicing acquisition CMYA4mRNA full length sequence 3430bp, sequence is as shown in SEQ ID NO:1
CMYA4mRNA sequence: SEQ ID NO:1 is as follows:
ctgggggttcacacacagaggagccgcaccccaggaggactgaccgagaacattgtccttgagagaaaatggccgaggcggaagcgatgcagctgaaggagga
ggggaatcagcatttccagctccaggactacaaggctgccaccaaaagctacagccaggccctgaagctgaccaaggataaggccctgctggccacactctatcg
gaaccgggcggcctgtggcctgaaaatggagagctatgttcaggcggcttctgatgcctcaagagccattgatatcaactcctcggacatcaaggctctgtaccggc
gatgccaggcactggagcacctgggcaagctggaccaggccttcaaggatgtgcagcgctgtgccactctggagccacagaaccagagcttccaggagacactg
aggaggctcaataccagcatccaggagaagctccgtgtgcagttctccactgactcgagggttcagacgatgtttgagattctcctggacagaaacagtgaagcggat
aaactagagaaggccgccaacaacctcattgtcctcagccgtgaggaagcgggggccgagaggatcttccagaacaacggcgtggccctgctgatgcagcttttg
gacacgaagaggcctgagctgatgctggctgccgtgcggaccttgtcaggcgtgtgcagtagccaccgagctagggccacagcgaccctccacgcagtccggat
agaccgaatctgcagcctcatggcggtggagagcgaggagatgtctctggccgtctgcaacctgctgcagggcatcatcgacgctctgtctggagaggacaaacag
gagcatcgggggaaggaagaggccctggttctggactccaagaaggacctgaagcagatcaccaaccacctgctcgacatgctggtcagtaagaaggtgtctggc
cagggtagggatcaggccctgaacctgctcaataagaacgtccccaggaaggacctcgccattcacgacaactcccgcaccatctacgtggttgataacggcctaa
ggaagatcctgaaggtggtgggacaggtcccagatctgccgtcctgcctgcccttgaccgacaacacccgcatgctggcctcaatcctcatcaacaagctttacgac
gacctgcgctgtgaccccgagcgcgaccacttccgcaagatctgcgaggagcacatcacgggcacgtttgacccccaggacatggacaagaatgtgattgccatcc
agacggtgtcggggatcctgcagggcccctttgacctgggcaatcagctgctgggactgaaaggtgtgatggagatgatggtggctctgtgcggctcggagcgtga
gacggaccagctggtggccgtggaggccctcatccacgcctccaccaagctcagccgtgccaccttcatcatcaccaacggtgtgtcactgctcaaagagatctaca
agaccaccaaaaacgagaagatcaagatccgcgcactggtgggactctgtaaacttggctcggcgggcggcacagattacgctctcaggcagtttgctgaaggctc
aacagaaaagctggccaaacagtgtcgcaagtggctgtgcaatgcatccatagacacccggacccggaaatgggcagtggagggcctggcctacctcacgctgg
acgccgacgtgaaggacgactttgttcaggacatccctgccctgcaggccatgttcgagctggccaagacccccgacaagaccatcctgtactcggtggccaccac
cctggtgaactgcaccaacagctacgatgtcaaggaggtcatccccgagctggtgcagctggccaagttctccaagcagcatgtgcctgaggagcaccccaagga
caagaaggactttgtggacatgcgagtgaagcggcttctgaaggccggcgtcacctcggcgctggtctgcatggtgaaagcagacaatgccatcctcactgaccag
accaaagagctgctggccagggtattcctggcactgtgtgacaacccaaaggaccgaggcaccattgtggctcaaggtggtggtaaggccctgattcccctggcttt
ggagggcacagacgtgggcaaggtgaaggcagcccacgccctagcgaagatcgccgcggtctccaacccagacatcgccttccccggggagcgggtgtacga
ggtggtgcggcccctcgtgagtctcctgaacacacagagggatggcctccagaactatgaggctctcctaggcctcaccaacctgtctgggcggagtgacaagctc
cgaaagaagatctttaaggagaaggccttgccggacattgagaactacatgtttgagaaccatgaccagctgcggcaggcggccactgagtgcatgtgcaacatggt
ggtgaacaaggaggtacaggagaggttcctggccgatggcaacgaccggctgaagctggtggtgctgctctgtggcgaggatgacgacaagctgcagaacgcgg
ctgcgggggccctggccatgctgacagcagcgcataagaagctgtgcttcaagatgactgaagtgacaactcagtggttggagattctacagcggctttgcttgcatg
accggctgtcagttcaacaccggggcctggtcattgcctacaacctgctggcggctgatgctgagttggctaagaagctggtggagagtgagctgctggagatcctg
acggtggtgggcaagcaagagccggacgagaagcgggcagcagtggttcagacagctcgggaatgtctcatcaaatgcatggattatggcttcattaaaccagtgg
cttagacaggggcccagagggagactggggctgctcctgtaactgtgcagagttccgaactgagaactcttggggtgtcagttccattagggatcattgcaaccacga
tgaggtgtccatgtaaaagaaggactgtggatagtcccctgagttgtacatcttgccttttgttctaggaaagtttgcatatttcattagctctcttgctccttaacatctgtcaa
gttgcagaaattcctagaataattttcatctgtgattaggaagacaggttggataattctttctgtacccattccaaaggccgggataatgggctggagttctttacattttgg
aaaatagattgtgtggtgaagtaggagctaacaggtcctactttaaatatgtaaagtagtgtgactataaagtttagtgctggtgtacctggatgctgatctgtctggttttta
tatcctgtttcccctgctgtttgactgcggctgcctggaaatgcatgtttcagcagcagtgcccgtcccagacgcgtgcgcattcctttcacttaactatgatggaaataca
gctgatgttcagt
Second step, according to CMYA4 gene mRNA sequence, utilizes the method for comparing to carry out chromosomal localization and gene structure analysis and the albumen characteristic analysis of CMYA4 gene:
The genome sketch of ox is completed, and we have obtained CMYA4 gene mRNA sequence, so we have utilized the method for comparison to carry out the structural analysis of chromosomal localization and the gene of CMYA4 gene;
(1) CMYA4 is positioned at karyomit(e) Chromosome 19:15233409-15265756bp, there are 18 introns of nineteen exon, the long 929residues of the long 3430bp aminoacid sequence of transcript, the isoelectric points of proteins of deriving (Isoelectric point): 7.7698, molecular weight (Molecular weight): 103,549.83g/mol.CMYA4 protein sequence: sequence as shown in SEQ ID NO:2,
CMYA4 protein sequence: SEQ ID NO:2 is as follows:
MAEAEAMQLKEEGNQHFQLQDYKAATKSYSQALKLTKDKALLATLYRNRAACGLKMESYVQAASDAS
RAIDINSSDIKALYRRCQALEHLGKLDQAFKDVQRCATLEPQNQSFQETLRRLNTSIQEKLRVQFSTDSRV
QTMFEILLDRNSEADKLEKAANNLIVLSREEAGAERIFQNNGVALLMQLLDTKRPELMLAAVRTLSGVCS
SHRARATATLHAVRIDRICSLMAVESEEMSLAVCNLLQGIIDALSGEDKQEHRGKEEALVLDSKKDLKQIT
NHLLDMLVSKKVSGQGRDQALNLLNKNVPRKDLAIHDNSRTIYVVDNGLRKILKVVGQVPDLPSCLPLT
DNTRMLASILINKLYDDLRCDPERDHFRKICEEHITGTFDPQDMDKNVIAIQTVSGILQGPFDLGNQLLGL
KGVMEMMVALCGSERETDQLVAVEALIHASTKLSRATFIITNGVSLLKEIYKTTKNEKIKIRALVGLCKLGS
AGGTDYALRQFAEGSTEKLAKQCRKWLCNASIDTRTRKWAVEGLAYLTLDADVKDDFVQDIPALQAMFE
LAKTPDKTILYSVATTLVNCTNSYDVKEVIPELVQLAKFSKQHVPEEHPKDKKDFVDMRVKRLLKAGVTS
AVCMVKADNAILTDQTKELLARVFLALCDNPKDRGTIVAQGGGKALIPLALEGTDVGKVKAAHALAKI
AAVSNPDIAFPGERVYEVVRPLVSLLNTQRDGLQNYEALLGLTNLSGRSDKLRKKIFKEKALPDIENYMFE
NHDQLRQAATECMCNMVVNKEVQERFLADGNDRLKLVVLLCGEDDDKLQNAAAGALAMLTAHKKL
CFKMTEVTTQWLEILQRLCLHDRLSVQHRGLVIAYNLLAADAELAKKLVESELLEILTVVGKQEPDEKRA
AVVQTARECLIKCMDYGFIKPVA
(2) use online software
http:// cn.expasy.org/tools/prediction CMYA4 protein function territory:
As shown in Figure 1, gene structure territory predictive display CMYA 4 albumen contain a TPR-like superfamily structural domain, and an ARM repeats superfamily structural domain, and a myosin is in conjunction with division center territory.
The 3rd step, finds out the SNP site of CMYA4 gene, and design primer amplification is containing the genomic dna in SNP site;
(1) find out two SNP sites of CMYA4 gene:
A SNP site SNP:rs109057450 who chooses CMYA4 gene by inquiry ncbi database, is positioned at Chromosome 19:15250730bp, and CMYA4 gene the 8th exons 1 092bp, is T/C same sense mutation site (T1092-C1092);
(2) according to gene order design primer amplification, go out the nucleotide fragments at SNP to be measured place:
1. primer sequence is as follows:
SEQ?ID?NO:37450-F?GCTGACGGTGCCGTTTCTGTG
SEQ?ID?NO:47450-R?GGCCGGCATCTTACGCTTGCT
2. pcr amplification condition:
PCR reaction cumulative volume 20 μ L, wherein the about 100ng of cow genome group DNA, contains 1 * buffer (Promega); 1:5mmol/L MgCl2; dNTP final concentration is 150 μ mol/L, and primer final concentration is 0:2 μ mol/L, 2U Taq archaeal dna polymerase (Promega).Pcr amplification program is: 94 ℃ of 4min, and the 94 ℃ of 45s that circulate 5 times, 62 ℃ of 45s, 72 ℃ of 1min, and then 30 94 ℃ of 45s of circulation, 57 ℃ of 45s, 72 ℃ of 1min, last 72 ℃ are extended 5min.PCR reaction product detects with 2% agarose gel electrophoresis, obtains the long object fragment of 467bp;
The 4th step, RFLP-PCR polymorphic detection:
(1) for SNP site, select suitable restriction endonuclease to carry out RFLP-PCR:
RFLP-PCR is carried out with HindIII in T1092-C1092 site, and PCR product endonuclease reaction volume is 15 μ L, 1 * buffer, 1.5 μ L wherein, and PCR product 3 ~ 5 μ L, restriction enzyme is 0.5 μ L (5U), uses H
2o supplies 15 μ L, and by centrifugal after sample blending, 37 ℃ of water-bath 4h, detect enzyme with 2% agarose gel electrophoresis and cut result, record genotype, under ultraviolet lamp, take pictures, and T1092-C1092 loci gene type as shown in Figure 2;
(2) to single nucleotide polymorphism, the distribution in cows is added up:
In the cows of analyzing, utilize pair of primers for mutational site, by PCR-RFLP, detect genotype and the gene frequency in SNP site, statistics is as shown in table 1;
Table 1.SNP rs109057450 (T1092-C1092) allelotrope gene frequency
By table, can find out T1092-C1092 site, in cows body, CC type is higher than CT type and TT type, and C allelotrope is protogene, and its frequency is greater than T allelotrope.
An application of ox slaughter trait genes involved CMYA4, step is as follows:
First, we determine that proterties association analysis carries out for Simmental with 130 13 months large F3, cows are raised a farm in Horqin, the Inner Mongol according to national feeding standard NY/T 815-2004, the raising term harmonization of all oxen, trunk and Meat Quality are surveyed and are carried out according to national beef segmentation standard GB/T 17238-2008
The association analysis of ox CMYA4 gene HindIII-RFLP genotype and Part Traits:
Utilize the clone of ox slaughter trait genes involved CMYA4, the HindIII-RFLP genotype detection result obtaining, target cows are carried out to the association analysis between genotype and carcass trait and Meat Quality, eliminating kind, butcher batch and sex between difference after, between genotype, simple mean and the standard error analysis of proterties the results are summarized in table 2, found that, SNP rs109057450 has proterties associated with ox part slaughter trait: SNP rs109057450 and gross weight (kg) utmost point significant correlation (p=0.008<0.01), the CT type gross weight utmost point is significantly higher than TT type, exceed 36.8Kg, with carcass weight (kg) significant correlation (P=0.033<0.05), CT type carcass weight is significantly higher than TT type, exceeds 17.3Kg, with long (cm) significant correlation (P=0.023<0.05) of trunk, CT type trunk length is significantly higher than TT type, exceeds 3.3cm, with dark (cm) significant correlation (P=0.016<0.05) of trunk, CT type trunk is significantly higher than TT type deeply, exceeds 2.02cm, with tare weight (kg) significant correlation (P=0.023<0.05), CT type tare weight is significantly higher than TT type, exceeds 3.01Kg, SNP rs109057450 can be used as the genetic marker of ox molecular breeding, according to the 1092nd Nucleotide of CMYA4 gene the 8th exon, be C or T, thereby determine that this individuality is in the allelotype in this mutational site, and with this, assess the difference of the proterties such as this individuality gross weight, carcass weight, trunk are long, trunk is dark, tare weight, can be applied in the middle of the molecular mark of ox,
Table 2.SNP rs 109057450 proterties association analysiss
Note: in table, between different genotype, lowercase mark represents significant difference, P<0.05; Capitalization mark represents that difference is extremely remarkable, P<0.01.
In sum, the carcass traits such as ox slaughter trait genes involved CMYA4 of the present invention and SNP site thereof can be used for detecting individual gross weight, carcass weight, trunk is long, trunk is dark, tare weight, thereby for the molecular breeding of ox provides a new genetic marker, and will in the breeding of ox, play a significant role.
Claims (2)
1. an application of ox slaughter trait genes involved CMYA4, is characterized in that: using sequence, be that C1092T SNP site mark relevant to ox slaughter trait in the gene C MYA4 of SEQ ID NO:1 is as Simmental molecular breeding genetic marker.
2. the application of ox slaughter trait genes involved CMYA4 according to claim 1, is characterized in that: C1092T SNP site mark relevant to ox slaughter trait in gene C MYA4 is used for to the individual gross weight of Simmental, carcass weight, trunk length, trunk deeply and the detection of tare weight.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201210462180.6A CN102994511B (en) | 2012-11-15 | 2012-11-15 | Cloning and application for bovine slaughter trait related gene CMYA4 |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201210462180.6A CN102994511B (en) | 2012-11-15 | 2012-11-15 | Cloning and application for bovine slaughter trait related gene CMYA4 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN102994511A CN102994511A (en) | 2013-03-27 |
| CN102994511B true CN102994511B (en) | 2014-03-19 |
Family
ID=47923621
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201210462180.6A Active CN102994511B (en) | 2012-11-15 | 2012-11-15 | Cloning and application for bovine slaughter trait related gene CMYA4 |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN102994511B (en) |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104059963B (en) * | 2013-11-29 | 2015-07-08 | 吉林大学 | Detection method of Chinese simmental cattle carcass and meat quality trait genetic markers |
| CN114058711A (en) * | 2021-09-06 | 2022-02-18 | 广东海洋大学 | Method for evaluating pH value of 45min after slaughter and cooking loss rate in quality characters of Sichuan yak meat |
| CN113862380A (en) * | 2021-11-22 | 2021-12-31 | 广东海洋大学 | Molecular marker related to pH of slaughtered meat of yak Wnt3a gene and application |
| CN115044680B (en) * | 2022-04-22 | 2023-03-14 | 四川省畜牧科学研究院 | SNP molecular marker related to slaughter traits of meat rabbits as well as detection primer group, detection kit and application thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1978640A (en) * | 2005-11-29 | 2007-06-13 | 华中农业大学 | Pig backfat thickness gene CMYA1 cloning and its use |
| CN101633943A (en) * | 2009-05-25 | 2010-01-27 | 吉林大学 | Identification method taking growth hormone receptor gene as Chinese grassland red bull excellent slaughter trait molecular marker and application thereof |
| CN102168136A (en) * | 2011-02-11 | 2011-08-31 | 中国农业大学 | Application of LHCGR gene of Chinese Holstein cow used as molecular marker |
-
2012
- 2012-11-15 CN CN201210462180.6A patent/CN102994511B/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1978640A (en) * | 2005-11-29 | 2007-06-13 | 华中农业大学 | Pig backfat thickness gene CMYA1 cloning and its use |
| CN101633943A (en) * | 2009-05-25 | 2010-01-27 | 吉林大学 | Identification method taking growth hormone receptor gene as Chinese grassland red bull excellent slaughter trait molecular marker and application thereof |
| CN102168136A (en) * | 2011-02-11 | 2011-08-31 | 中国农业大学 | Application of LHCGR gene of Chinese Holstein cow used as molecular marker |
Non-Patent Citations (6)
| Title |
|---|
| Accession Number: XM_615458.3.Accession Number: XM_615458.3.《GenBank》.2011, |
| Accession Number: XM_615458.3;Accession Number: XM_615458.3;《GenBank》;20111129 * |
| SNP rs109057450.SNP rs109057450.《GenBank》.2011, |
| SNP rs109057450;SNP rs109057450;《GenBank》;20111201 * |
| 张永宏 等.草原红牛IGFBP3基因多态性及与部分屠宰性状的相关性分析.《中国兽医学报》.2010,第30卷(第04期),549-551. |
| 草原红牛IGFBP3基因多态性及与部分屠宰性状的相关性分析;张永宏 等;《中国兽医学报》;20100430;第30卷(第04期);549-551 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN102994511A (en) | 2013-03-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN110257529B (en) | SNP molecular marker related to lean meat percentage, eye muscle area and eye muscle thickness on pig No. 6 chromosome and application | |
| CN110218798B (en) | SNP molecular marker located on pig chromosome 7 and related to eye muscle area and eye muscle thickness and application | |
| Mullen et al. | Associations between novel single nucleotide polymorphisms in the Bos taurus growth hormone gene and performance traits in Holstein-Friesian dairy cattle | |
| CN102994511B (en) | Cloning and application for bovine slaughter trait related gene CMYA4 | |
| CN109234403B (en) | Method for identifying sheep lumbar vertebra number correlation property and special primer | |
| CN112195253B (en) | SNP (Single nucleotide polymorphism) locus for increasing content of fatty acid C14:0 in chicken and method for breeding high-quality chicken strain by using SNP locus | |
| CN112176070B (en) | UCP3 gene related to pig intramuscular fat character, molecular marker and application thereof | |
| CN100564526C (en) | The clone of pig carcass character GFAT 1 gene and application | |
| CN110468217B (en) | SNP molecular marker related to pH and drip loss traits of pig muscle and application thereof | |
| CN114150070A (en) | SNP molecular marker related to chicken growth and slaughter traits, detection primer, kit and breeding method | |
| KR100784166B1 (en) | DNA marker for detecting increase of pig musclecell number | |
| CN112941198B (en) | SNP marker for detecting pig eye muscle area and application thereof | |
| JP2002521068A (en) | Melanocortin-4 receptor gene and use as a marker for lipid content, weight gain and / or food consumption in animals | |
| Xu et al. | Genome-wide association analysis reveals 6 copy number variations associated with the number of cervical vertebrae in Pekin ducks | |
| CN113249492A (en) | SNP marker for evaluating pig eye muscle area and application method thereof | |
| Carmo et al. | Association of MYF5 gene allelic variants with production traits in pigs | |
| CN113322333B (en) | CNV molecular marker combination related to Guangxi hemp chicken body size and slaughter traits based on whole genome sequencing screening and application | |
| Zhou et al. | Meat quality and carcass traits in relation to HGD-BstXI and HGD-HaeIII PCR–RFLP polymorphism in Chinese red cattle | |
| Singh et al. | Molecular characterization and phylogeny based analysis of complete coding sequence of myostatin (MSTN) gene in Indian goat breeds | |
| CN101955931A (en) | Molecular marker of gene Nudt6 related to pig leaf fat rate, lactone rate and leg breech meat-bone rate and application thereof | |
| CN112176073B (en) | PROS1 gene molecular marker related to chicken carcass traits and application | |
| Kim et al. | Molecular characterization and chromosomal mapping of porcine adipose differentiation‐related protein (ADRP) | |
| CN110438237B (en) | SNP (single nucleotide polymorphism) site related to posttendinosus and fashion head weight on chromosome 6 of meat Simmental cattle and application | |
| CN113355427B (en) | SNP (single nucleotide polymorphism) marker related to pig backfat thickness and utilization method thereof | |
| CN113699248A (en) | SNP molecular marker related to pig backfat thickness and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant |