CN102807612B - Polypeptide fragment and preparation method and application thereof - Google Patents
Polypeptide fragment and preparation method and application thereof Download PDFInfo
- Publication number
- CN102807612B CN102807612B CN201210271177.6A CN201210271177A CN102807612B CN 102807612 B CN102807612 B CN 102807612B CN 201210271177 A CN201210271177 A CN 201210271177A CN 102807612 B CN102807612 B CN 102807612B
- Authority
- CN
- China
- Prior art keywords
- polypeptide
- preparation
- application
- peptide
- pancreas
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 65
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 49
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 45
- 239000012634 fragment Substances 0.000 title abstract description 10
- 238000002360 preparation method Methods 0.000 title abstract description 8
- 238000013467 fragmentation Methods 0.000 title 1
- 238000006062 fragmentation reaction Methods 0.000 title 1
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 claims abstract description 20
- 210000000496 pancreas Anatomy 0.000 claims abstract description 13
- 102000004877 Insulin Human genes 0.000 claims abstract description 11
- 108090001061 Insulin Proteins 0.000 claims abstract description 11
- 239000003814 drug Substances 0.000 claims abstract description 10
- 229940125396 insulin Drugs 0.000 claims abstract description 10
- 230000004936 stimulating effect Effects 0.000 claims abstract description 8
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 2
- 239000000287 crude extract Substances 0.000 abstract description 8
- 238000004440 column chromatography Methods 0.000 abstract description 7
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 abstract description 4
- 125000000539 amino acid group Chemical group 0.000 abstract description 4
- 238000007710 freezing Methods 0.000 abstract description 4
- 230000008014 freezing Effects 0.000 abstract description 4
- 150000008104 phosphatidylethanolamines Chemical class 0.000 abstract description 4
- 238000004519 manufacturing process Methods 0.000 abstract description 3
- 150000003839 salts Chemical class 0.000 abstract description 2
- 230000000968 intestinal effect Effects 0.000 abstract 2
- 229940079593 drug Drugs 0.000 abstract 1
- 238000001035 drying Methods 0.000 abstract 1
- 102000004169 proteins and genes Human genes 0.000 abstract 1
- 108090000623 proteins and genes Proteins 0.000 abstract 1
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 18
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 15
- 239000000243 solution Substances 0.000 description 13
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 12
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 12
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 12
- 239000002244 precipitate Substances 0.000 description 12
- 102000023732 binding proteins Human genes 0.000 description 10
- 108091008324 binding proteins Proteins 0.000 description 10
- 238000005406 washing Methods 0.000 description 10
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 9
- 238000004108 freeze drying Methods 0.000 description 9
- 238000000926 separation method Methods 0.000 description 9
- 238000000967 suction filtration Methods 0.000 description 9
- 210000000936 intestine Anatomy 0.000 description 8
- 238000001556 precipitation Methods 0.000 description 8
- 150000001413 amino acids Chemical group 0.000 description 7
- 206010012601 diabetes mellitus Diseases 0.000 description 7
- 238000004128 high performance liquid chromatography Methods 0.000 description 7
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 6
- 229910000013 Ammonium bicarbonate Inorganic materials 0.000 description 6
- 235000012538 ammonium bicarbonate Nutrition 0.000 description 6
- 239000001099 ammonium carbonate Substances 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 5
- 239000008103 glucose Substances 0.000 description 5
- 239000003963 antioxidant agent Substances 0.000 description 4
- 230000003078 antioxidant effect Effects 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 238000012163 sequencing technique Methods 0.000 description 4
- 239000007864 aqueous solution Substances 0.000 description 3
- 238000009835 boiling Methods 0.000 description 3
- 239000000284 extract Substances 0.000 description 3
- 239000000706 filtrate Substances 0.000 description 3
- 238000007654 immersion Methods 0.000 description 3
- 230000003914 insulin secretion Effects 0.000 description 3
- 238000003756 stirring Methods 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 235000001014 amino acid Nutrition 0.000 description 2
- 238000003277 amino acid sequence analysis Methods 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 239000003292 glue Substances 0.000 description 2
- 102000052563 odorant-binding protein Human genes 0.000 description 2
- 108010000645 odorant-binding protein Proteins 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- YODZTKMDCQEPHD-UHFFFAOYSA-N thiodiglycol Chemical group OCCSCCO YODZTKMDCQEPHD-UHFFFAOYSA-N 0.000 description 2
- 229950006389 thiodiglycol Drugs 0.000 description 2
- 238000011282 treatment Methods 0.000 description 2
- 239000003643 water by type Substances 0.000 description 2
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 101710098119 Chaperonin GroEL 2 Proteins 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 208000025011 Distomatosis Diseases 0.000 description 1
- 101000624643 Homo sapiens M-phase inducer phosphatase 3 Proteins 0.000 description 1
- 101000580039 Homo sapiens Ras-specific guanine nucleotide-releasing factor 1 Proteins 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- 102100023330 M-phase inducer phosphatase 3 Human genes 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000013375 chromatographic separation Methods 0.000 description 1
- 238000004140 cleaning Methods 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 238000011221 initial treatment Methods 0.000 description 1
- 239000002085 irritant Substances 0.000 description 1
- 231100000021 irritant Toxicity 0.000 description 1
- 206010025482 malaise Diseases 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 230000009469 supplementation Effects 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
Images
Landscapes
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The invention provides polypeptide and a preparation method and application thereof. The polypeptide is a fragment in which phosphatidyl ethanolamine combined with protein is cut off and is composed of amino acid residues from the 93rd to 124th, and the amino acid sequence of the polypeptide is shown as follow: KGNDISSGTVLSDYVGSGPPKGTGLHRYVWLV. The invention further provides the preparation method of the polypeptide. The preparation method includes firstly extracting heatproof intestinal polypeptide from chitterlings, extracting crude peptide from the heatproof intestinal polypeptide then, dissolving the crude peptide into acetum to prepare peptide solution, isolating the peptide solution to obtain isolate by column chromatography, selecting a part having a function of stimulating pancreas to secrete insulin from the isolate, freezing and drying the part to obtain crude extracts, and purifying the crude extracts to obtain the polypeptide. Besides, the invention provides application of the polypeptide. The application includes that the polypeptide is acceptable to salt pharmaceutically and used for manufacturing drugs capable of stimulating the pancreas to secrete insulin.
Description
Technical field
The present invention relates to the fragment after a kind of phosphotidylethanolabinding binding protein brachymemma, this polypeptide fragment has the effect that stimulates excreting insulin, and the present invention also provides the preparation method of aforementioned polypeptides fragment simultaneously.
Background technology
Phosphotidylethanolabinding binding protein (PEBP) be a class can with the albumen of phosphatidylethanolamine (PE) combination, all members of this family are contained the conservative region of being combined with PE, PEBP family kind wide material sources, comprise the odorant binding protein (OBP) of fruit bat sense of touch, the antigen A g16 of the immune serum identification after the fluke infection of dish tailfiber, the factor CEN that suppresses CDC25 sudden change in yeast, in mammiferous in-vivo tissue enchylema.PEBP family member function is extensive, relates to opposing apoptosis, and film forms, the physiological function of the each side such as the maturation of sperm.
Diabetes are diseases of the easy overheap of glucose in a kind of blood.The external another name to it is " reticent killer " (Silent Killer), particularly " adult diabetes mellitus ".It is high especially that more than 40 years old middle-aged peoples catches rate, and in Japan, in 40 years old above population, sickness rate accounts for 10%, in the middle of ten people, just has a diabetic subject, once suffer from " diabetes ", will reduce 10 years more than life-span, and contingent complication spreads all over whole body.The medicine of primary treatment diabetes is all medicine and the direct supplementation with insulin that promotes insulin secretion at present, but these medicine effects are bad or can produce insulin resistance.So it is always underway to find the medicine of new treatment diabetes.
Summary of the invention
The invention provides a kind of polypeptide fragment, find afterwards that after testing it is the fragment after phosphotidylethanolabinding binding protein blocks, amino-acid residue by phosphotidylethanolabinding binding protein 93-124 position forms, and its aminoacid sequence is as follows: KGNDISSGTVLSDYVGSGPPKGTGLHRYVWLV.
The present invention also provides polypeptide as above approved modified polypeptide in biological medicine simultaneously.
The invention provides the preparation method of aforementioned polypeptides, comprise the following steps: (1), immerse in boiling water after will chitling road cleaning and soak 3~7 minutes, after immersion completes, taking-up is freezing and mince, then after enteron aisle being leached with acetic acid, filter to obtain leach liquor under 0~10 ° of C condition, with hydrochloric acid, the extract wash-out in leach liquor suction filtration are obtained to heat-resisting intestines polypeptide;
(2), heat-resisting intestines polypeptide is dissolved in the water, add antioxidant and sufficient isopropanol solution, the centrifugal precipitation of removing after sufficient standing under room temperature, and then add enough temperature be the aqueous isopropanol of-25 ℃~-15 ℃ and under-25 ℃~-15 ℃ conditions after sufficient standing suction filtration remove precipitation, the pH value of gained filtrate is adjusted to 5.8~6.1, under-25 ℃~-15 ℃ conditions, after sufficient standing, suction filtration obtains white precipitate again, after white precipitate is fully washed, makes thick peptide;
(3), the thick peptide making in step (2) is dissolved in acetum and makes peptide solution, peptide solution is crossed to column chromatography for separation and obtain isolate, choose the portion in isolate with stimulating pancreas excreting insulin function, its freeze-drying is obtained to crude extract;
(4), crude extract be dissolved in ammonium bicarbonate soln and stir, centrifugal rear removal precipitates to obtain supernatant liquor, gained supernatant liquor is crossed to column chromatography and adopt the ammonium bicarbonate soln that pH value is 8.0, concentration is 0.02mol/L to wash, the washes freeze-drying obtaining after washing, again by washes after twice high performance liquid chromatography separation, isolate freeze-drying is made to the polypeptide of aminoacid sequence described in claim 1.
In step (1), the concentration of acetic acid is 0.5mol/L, and the concentration of hydrochloric acid is 0.2mol/L.
In step (2), antioxidant is thiodiglycol, and addition is 1.2 milliliters; Washing is carried out at twice, and aqueous isopropanol is selected in washing for the first time, and diethyl ether solution is selected in washing for the second time, after having washed for the second time, white precipitate is put into vacuum environment ether is evaporated in a vacuum.
In twice high performance liquid chromatography separation in described step (4), the trifluoroacetic acid aqueous solution that separated eluant used is 0.1% for the first time, the acetonitrile solution of the trifluoroacetic acid that separated eluant used is 0.1% for the second time.
The present invention also provides the purposes of aforementioned polypeptides and pharmacy acceptable salt thereof simultaneously, for the manufacture of the medicine of stimulating pancreas excreting insulin.
Polypeptide provided by the invention with and in biological medicine approved modified polypeptide, effective stimulating pancreas emiocytosis Regular Insulin, adopt maximum height sugar to compare with current treatment diabetes medicament, the effect of polypeptide provided by the invention is more obvious.
Accompanying drawing explanation
Fig. 1 is the thick peptide chromatographic separation result figure in the embodiment of the present invention 1;
Fig. 2 is high performance liquid chromatography separating resulting figure for the second time in the embodiment of the present invention 1;
Fig. 3 is the aminoacid sequence figure of polypeptide provided by the invention;
Fig. 4 is the experimental result picture of pancreas irritant test provided by the invention.
Embodiment
Below in conjunction with specific embodiment, the present invention is done to detailed specific description.
In the present embodiment, adopt following preparation process:
(1), get 30 kilograms of fresh chitling, after chitling road is cleaned, immerse in boiling water and soak 4 minutes, after immersion completes, taking-up is freezing and mince, then after enteron aisle being leached with the acetic acid of 0.5mol/L, filter to obtain leach liquor under 5 ° of C conditions, then with the hydrochloric acid of 0.2mol/L, the extract wash-out in leach liquor suction filtration are obtained to approximately 30 grams of heat-resisting intestines polypeptide, the productive rate of heat-resisting intestines polypeptide is about 0.01% of chitling weight in wet base.
(2), 30 grams of heat-resisting intestines polypeptide are dissolved in 0.24L water, add 1.2 milliliters of antioxidant thiodiglycols and 1.08L aqueous isopropanol, the centrifugal precipitation of removing after standing 2 hours under room temperature, and then add 1.32L temperature for the aqueous isopropanol of-20 ℃ and under-20 ℃ of conditions after standing 24 hours suction filtration remove precipitation, the pH value of gained filtrate is adjusted to 6 with hydrochloric acid, under-20 ℃ of conditions, after sufficient standing, suction filtration obtains white precipitate again, white precipitate is washed at twice, aqueous isopropanol is selected in washing for the first time, diethyl ether solution is selected in washing for the second time, after having washed for the second time, white precipitate being put into vacuum environment evaporates ether to make 6.5 grams of thick peptides in a vacuum.
(3), 6.5 grams of the thick peptides making in step (2) are dissolved in the acetum of 300mL0.2mol/L and make peptide solution, peptide solution is crossed to column chromatography for separation and obtain isolate, choose the portion in isolate with stimulating pancreas excreting insulin function, its freeze-drying is obtained to crude extract, as shown in Figure 1, the portion of choosing institute's mark in Fig. 1 is target compound.
(4), crude extract be dissolved in the ammonium bicarbonate soln of 81.5mL0.01mol/L and stir 20 minutes, centrifugal rear removal precipitates to obtain supernatant liquor, gained supernatant liquor is crossed to column chromatography and adopt the ammonium bicarbonate soln that pH value is 8.0, concentration is 0.02mol/L to wash, the washes freeze-drying obtaining after washing, again by washes after twice high performance liquid chromatography separation, in twice described high performance liquid chromatography separation, the trifluoroacetic acid aqueous solution that separated eluant used is 0.1% for the first time; The acetonitrile solution of the trifluoroacetic acid that separated eluant used is 0.1% for the second time, collects gained precipitation after separated for the second time and freeze-drying makes the polypeptide of aminoacid sequence described in claim 1, and as shown in Figure 2, target compound is polypeptide provided by the present invention.
To the polypeptide of making in above-mentioned steps through SDS-PAGE glue purification.Carry out amino acid sequencing and do peptide sequence analysis with Edman edman degradation Edman.Applied Biosystems 477A instrument coupling 120 A analyzer, Milligen 6600, Waters 440 analysers, carry out amino acid sequence analysis.
Sequencing result is as shown in Figure 3:
Polypeptide: 1 KGNDISSGTVLSDYVGSGPPKGTGLHRYVWLV 32
With phosphotidylethanolabinding binding protein (sequence is:
90 VNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQ 127) there is very large similarity.Therefrom known, the polypeptide in the present invention is the polypeptide fragment that phosphotidylethanolabinding binding protein the 93rd to the 124th amino-acid residue forms.
The polypeptide performance making in the present invention is studied, and test is carried out the impact of the insulin secretion of glucose induction at isolated rat pancreas islet perfusion system.Male SD rat (200~250 grams of body weight) takes out pancreas after anesthesia, then uses collagenase digesting.Above-mentioned pancreas spends the night by RPMI 1640 culture medium culturing at 37 ℃, first group of glucose that is added with 3.3mM in described substratum, in second group, be added with the glucose of 16.7mM, be added with the glucose of 16.7mM and the phosphotidylethanolabinding binding protein 93-124 of 10nM in the 3rd group.With radio immunoassay, determine the amount of insulin that three pancreas discharge.As shown in Figure 4, phosphotidylethanolabinding binding protein 93-124 has the effect of obvious insulin secretion accelerating to measurement result as can be seen here.
Embodiment 2
In the present embodiment, adopt following preparation process:
(1), get 20 kilograms of fresh chitling, after chitling road is cleaned, immerse in boiling water and soak 6 minutes, after immersion completes, taking-up is freezing and mince, then after enteron aisle being leached with the acetic acid of 0.5mol/L, filter to obtain leach liquor under 8 ° of C conditions, then with the hydrochloric acid of 0.2mol/L, the extract wash-out in leach liquor suction filtration are obtained to approximately 19 grams of heat-resisting intestines polypeptide, the productive rate of heat-resisting intestines polypeptide is about 0.01% of chitling weight in wet base.
(2), 19 grams of heat-resisting intestines polypeptide are dissolved in 0.15L water, add 1 milliliter of antioxidant thiodiglycol and 0.7L aqueous isopropanol, the centrifugal precipitation of removing after standing 2 hours under room temperature, and then add 0.89L temperature for the aqueous isopropanol of-23 ℃ and under-20 ℃ of conditions after standing 24 hours suction filtration remove precipitation, the pH value of gained filtrate is adjusted to 6 with hydrochloric acid, under-18 ℃ of conditions, after sufficient standing, suction filtration obtains white precipitate again, white precipitate is washed at twice, aqueous isopropanol is selected in washing for the first time, diethyl ether solution is selected in washing for the second time, after having washed for the second time, white precipitate being put into vacuum environment evaporates ether to make 4.3 grams of thick peptides in a vacuum.
(3), 4.3 grams of the thick peptides making in step (2) are dissolved in the acetum of 200mL0.2mol/L and make peptide solution, peptide solution is crossed to column chromatography for separation and obtain isolate, choose the portion in isolate with stimulating pancreas excreting insulin function, its freeze-drying is obtained to crude extract.
(4), crude extract be dissolved in the ammonium bicarbonate soln of 54mL0.01mol/L and stir 20 minutes, centrifugal rear removal precipitates to obtain supernatant liquor, gained supernatant liquor is crossed to column chromatography and adopt the ammonium bicarbonate soln that pH value is 8.0, concentration is 0.02mol/L to wash, the washes freeze-drying obtaining after washing, again by washes after twice high performance liquid chromatography separation, in twice described high performance liquid chromatography separation, the trifluoroacetic acid aqueous solution that separated eluant used is 0.1% for the first time; The acetonitrile solution of the trifluoroacetic acid that separated eluant used is 0.1% for the second time, collects gained precipitation after separated for the second time and freeze-drying makes the polypeptide of aminoacid sequence described in claim 1.
To the polypeptide of making in above-mentioned steps through SDS-PAGE glue purification.Carry out amino acid sequencing
With Edman edman degradation Edman, do peptide sequence analysis.Applied Biosystems 477A instrument coupling 120 A analyzer, Milligen 6600, Waters 440 analysers, carry out amino acid sequence analysis.
Sequencing result is as shown in Figure 3:
Polypeptide: 1 KGNDISSGTVLSDYVGSGPPKGTGLHRYVWLV 32
With phosphotidylethanolabinding binding protein (sequence is:
90 VNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQ 127) there is very large similarity.Therefrom known, the polypeptide in the present invention is the polypeptide fragment that phosphotidylethanolabinding binding protein the 93rd to the 124th amino-acid residue forms.
Performance to the polypeptide making in the present embodiment is studied, and its result is identical with embodiment 1.
Claims (2)
1. a peptide species, its aminoacid sequence is as follows:
KGNDISSGTVLSDYVGSGPPKGTGLHRYVWLV。
2. the purposes of polypeptide in the medicine of preparing stimulating pancreas excreting insulin described in claim 1.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201210271177.6A CN102807612B (en) | 2012-08-01 | 2012-08-01 | Polypeptide fragment and preparation method and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201210271177.6A CN102807612B (en) | 2012-08-01 | 2012-08-01 | Polypeptide fragment and preparation method and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN102807612A CN102807612A (en) | 2012-12-05 |
CN102807612B true CN102807612B (en) | 2014-04-09 |
Family
ID=47231497
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201210271177.6A Expired - Fee Related CN102807612B (en) | 2012-08-01 | 2012-08-01 | Polypeptide fragment and preparation method and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN102807612B (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN103571803B (en) * | 2013-10-11 | 2018-05-11 | 中南民族大学 | VIII 52-69 of cytochrome c oxidase and preparation method thereof and function |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1308346C (en) * | 2002-08-19 | 2007-04-04 | 浙江大学免疫学研究所 | Novel human phosphotidylethanolamine binding protein, its coding sequence and application |
CN100364440C (en) * | 2005-12-31 | 2008-01-30 | 浙江大学 | Intestine nutrition peptide for piglings |
CN101812126B (en) * | 2009-02-25 | 2013-11-20 | 中国人民解放军第二军医大学 | Novel HLA-A2 restrictive epitope polypeptide coming from hPEBP4 protein and application thereof |
-
2012
- 2012-08-01 CN CN201210271177.6A patent/CN102807612B/en not_active Expired - Fee Related
Also Published As
Publication number | Publication date |
---|---|
CN102807612A (en) | 2012-12-05 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN104710511B (en) | Iron chelating peptide derived from hairtail fish protein and preparation method and application thereof | |
CN109293740B (en) | Oyster-derived ACE (angiotensin converting enzyme) inhibitory and antitumor active peptide | |
TW201528971A (en) | Method of combining pressure and enzyme to extract hydrolysate of cubilose | |
CN104530199B (en) | A kind of tumor protein p53 and its preparation method and application | |
CN108715600A (en) | A kind of oligopeptides and its preparation method and application promoting Intestinal epithelial cells proliferation and migration | |
JP5199919B2 (en) | Glucose level rise inhibitor comprising star decollagen peptide as active ingredient and method for producing dedecollagen peptide | |
CN108935912B (en) | Fish meat protein peptide with DPP-IV inhibition and anti-fatigue functions and preparation method thereof | |
CN109527270A (en) | Leech specific nutrient induces the extracting method of liquid and natural hirudin | |
CN106748923B (en) | A kind of method that alliin is extracted from black garlic | |
CN106110290B (en) | A kind of preparation method of animal testis extract | |
CN102807612B (en) | Polypeptide fragment and preparation method and application thereof | |
CN109206483A (en) | A kind of ACE in mussel source inhibits and anti-tumor activity peptide | |
CN102838669B (en) | Valosin fragment, and preparation method and application thereof | |
CN105440103A (en) | Anti-inflammatory peptide separated from haliotis discus hannai abalone visceral organ and use of anti-inflammatory peptide | |
CN110407917A (en) | A kind of octopus oligopeptides and the preparation method and application thereof promoting the synthesis of mammary gland casein | |
CN106699842B (en) | Novel anti-inflammatory small molecule polypeptide and application thereof | |
CN108752422A (en) | A kind of Cryptosporidum parvum detection TSP4 polypeptide sequences and purposes | |
CN100417662C (en) | Peptide for promoting insulin release of frog and its use in production of drugs | |
CN104975059A (en) | Method for preparing ACE (angiotensin converting enzyme) inhibitory peptide by using cod meat | |
CN111423495B (en) | Rapana venosa polypeptide with oxidative stress damage resistance and preparation method and application thereof | |
CN113845565A (en) | Earthworm bioactive small peptide and preparation method and application thereof | |
CN109438556B (en) | Active peptide, recombinant vector, recombinant cell, anti-inflammatory composition, and preparation method and application thereof | |
CN103305578B (en) | Method for preparing hypotensive substance by using abalone visceral connective tissues | |
CN105861474B (en) | Sipunculus nudus active protease with antithrombotic effect and preparation method and application thereof | |
CN101518645A (en) | Application of marine collagen peptide in preparing drugs, health care food or food for protecting renal function and delaying the process of chronic renal failure |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C14 | Grant of patent or utility model | ||
GR01 | Patent grant | ||
CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20140409 |