CN102725413B - Use the method and composition of FGF23 fused polypeptide - Google Patents
Use the method and composition of FGF23 fused polypeptide Download PDFInfo
- Publication number
- CN102725413B CN102725413B CN201180007622.1A CN201180007622A CN102725413B CN 102725413 B CN102725413 B CN 102725413B CN 201180007622 A CN201180007622 A CN 201180007622A CN 102725413 B CN102725413 B CN 102725413B
- Authority
- CN
- China
- Prior art keywords
- seqidno
- polypeptide
- klotho
- fused polypeptide
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 638
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 614
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 610
- 239000000203 mixture Substances 0.000 title claims abstract description 46
- 238000000034 method Methods 0.000 title abstract description 74
- 102100024802 Fibroblast growth factor 23 Human genes 0.000 title 1
- 101001051973 Homo sapiens Fibroblast growth factor 23 Proteins 0.000 title 1
- 238000011282 treatment Methods 0.000 claims abstract description 99
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 claims abstract description 86
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 claims abstract description 86
- 230000008859 change Effects 0.000 claims abstract description 50
- 210000002966 serum Anatomy 0.000 claims abstract description 49
- 239000012634 fragment Substances 0.000 claims abstract description 48
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 144
- 150000001413 amino acids Chemical class 0.000 claims description 139
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 71
- 239000008194 pharmaceutical composition Substances 0.000 claims description 57
- 108020004707 nucleic acids Proteins 0.000 claims description 50
- 102000039446 nucleic acids Human genes 0.000 claims description 50
- 150000007523 nucleic acids Chemical class 0.000 claims description 50
- 239000003814 drug Substances 0.000 claims description 34
- 230000002265 prevention Effects 0.000 claims description 26
- 101100444898 Mus musculus Egr1 gene Proteins 0.000 claims description 14
- 230000012010 growth Effects 0.000 claims description 14
- 201000005991 hyperphosphatemia Diseases 0.000 claims description 14
- 230000001965 increasing effect Effects 0.000 claims description 10
- 208000001132 Osteoporosis Diseases 0.000 claims description 9
- 206010040799 Skin atrophy Diseases 0.000 claims description 8
- 206010014561 Emphysema Diseases 0.000 claims description 7
- 208000034189 Sclerosis Diseases 0.000 claims description 7
- 210000001367 artery Anatomy 0.000 claims description 7
- 230000003143 atherosclerotic effect Effects 0.000 claims description 7
- 238000004904 shortening Methods 0.000 claims description 7
- 238000002360 preparation method Methods 0.000 claims description 6
- 239000003102 growth factor Substances 0.000 claims description 4
- 208000029663 Hypophosphatemia Diseases 0.000 claims description 2
- 201000001981 dermatomyositis Diseases 0.000 claims description 2
- 200000000007 Arterial disease Diseases 0.000 claims 1
- 230000003328 fibroblastic effect Effects 0.000 claims 1
- 230000008018 melting Effects 0.000 claims 1
- 238000002844 melting Methods 0.000 claims 1
- 210000003462 vein Anatomy 0.000 claims 1
- 108090000569 Fibroblast Growth Factor-23 Proteins 0.000 abstract description 171
- 102000004042 Fibroblast Growth Factor-23 Human genes 0.000 abstract description 170
- 230000004927 fusion Effects 0.000 abstract description 116
- 230000005714 functional activity Effects 0.000 abstract description 59
- 208000030159 metabolic disease Diseases 0.000 abstract description 37
- 108091005804 Peptidases Proteins 0.000 abstract description 10
- 239000004365 Protease Substances 0.000 abstract description 10
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 abstract description 10
- 238000005520 cutting process Methods 0.000 abstract description 9
- 102100020686 Klotho Human genes 0.000 description 350
- 108050004036 Klotho Proteins 0.000 description 288
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 188
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 185
- 229940126864 fibroblast growth factor Drugs 0.000 description 175
- 235000001014 amino acid Nutrition 0.000 description 145
- 229940024606 amino acid Drugs 0.000 description 138
- 108090000623 proteins and genes Proteins 0.000 description 102
- 210000004027 cell Anatomy 0.000 description 81
- 102000004169 proteins and genes Human genes 0.000 description 78
- 235000018102 proteins Nutrition 0.000 description 76
- 101001139093 Homo sapiens Klotho Proteins 0.000 description 68
- 230000000694 effects Effects 0.000 description 60
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 52
- 239000002773 nucleotide Substances 0.000 description 46
- 125000003729 nucleotide group Chemical group 0.000 description 46
- 201000010099 disease Diseases 0.000 description 41
- 102100020683 Beta-klotho Human genes 0.000 description 38
- 101710104526 Beta-klotho Proteins 0.000 description 38
- 241001465754 Metazoa Species 0.000 description 38
- 125000000539 amino acid group Chemical group 0.000 description 38
- 241000699666 Mus <mouse, genus> Species 0.000 description 37
- 208000024827 Alzheimer disease Diseases 0.000 description 35
- 238000012360 testing method Methods 0.000 description 30
- 230000004913 activation Effects 0.000 description 29
- 102100031734 Fibroblast growth factor 19 Human genes 0.000 description 28
- 101000846394 Homo sapiens Fibroblast growth factor 19 Proteins 0.000 description 28
- 239000003636 conditioned culture medium Substances 0.000 description 26
- 108090000376 Fibroblast growth factor 21 Proteins 0.000 description 25
- 238000012217 deletion Methods 0.000 description 25
- 230000037430 deletion Effects 0.000 description 25
- 102000003973 Fibroblast growth factor 21 Human genes 0.000 description 24
- 208000024891 symptom Diseases 0.000 description 23
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 20
- 239000005089 Luciferase Substances 0.000 description 19
- 108700008625 Reporter Genes Proteins 0.000 description 19
- 229960002897 heparin Drugs 0.000 description 19
- 229920000669 heparin Polymers 0.000 description 19
- 206010028980 Neoplasm Diseases 0.000 description 17
- 238000010171 animal model Methods 0.000 description 17
- 208000020832 chronic kidney disease Diseases 0.000 description 17
- 201000000585 muscular atrophy Diseases 0.000 description 17
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 16
- 238000002560 therapeutic procedure Methods 0.000 description 16
- 208000023105 Huntington disease Diseases 0.000 description 15
- 239000003795 chemical substances by application Substances 0.000 description 15
- 230000006870 function Effects 0.000 description 15
- 238000009396 hybridization Methods 0.000 description 15
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 15
- 208000004434 Calcinosis Diseases 0.000 description 14
- 102000003974 Fibroblast growth factor 2 Human genes 0.000 description 14
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 14
- -1 SEQIDNO:31) Proteins 0.000 description 14
- 239000000523 sample Substances 0.000 description 14
- 239000007788 liquid Substances 0.000 description 13
- 230000008569 process Effects 0.000 description 13
- 238000012545 processing Methods 0.000 description 13
- 238000001890 transfection Methods 0.000 description 13
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 12
- 208000022831 chronic renal failure syndrome Diseases 0.000 description 12
- 206010012601 diabetes mellitus Diseases 0.000 description 12
- 239000001963 growth medium Substances 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 12
- 230000026731 phosphorylation Effects 0.000 description 12
- 238000006366 phosphorylation reaction Methods 0.000 description 12
- 230000001225 therapeutic effect Effects 0.000 description 12
- 210000001519 tissue Anatomy 0.000 description 12
- 206010006187 Breast cancer Diseases 0.000 description 11
- 208000026310 Breast neoplasm Diseases 0.000 description 11
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 11
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 11
- 230000033228 biological regulation Effects 0.000 description 11
- 210000004556 brain Anatomy 0.000 description 11
- 201000011510 cancer Diseases 0.000 description 11
- 230000009467 reduction Effects 0.000 description 11
- 241000894007 species Species 0.000 description 11
- 241000699660 Mus musculus Species 0.000 description 10
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 10
- 229960003957 dexamethasone Drugs 0.000 description 10
- 208000035475 disorder Diseases 0.000 description 10
- 230000035772 mutation Effects 0.000 description 10
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 239000004615 ingredient Substances 0.000 description 9
- 230000001575 pathological effect Effects 0.000 description 9
- 230000001105 regulatory effect Effects 0.000 description 9
- 238000001262 western blot Methods 0.000 description 9
- 108020004414 DNA Proteins 0.000 description 8
- 108091008794 FGF receptors Proteins 0.000 description 8
- 102000044168 Fibroblast Growth Factor Receptor Human genes 0.000 description 8
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 8
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 8
- 102000004877 Insulin Human genes 0.000 description 8
- 108090001061 Insulin Proteins 0.000 description 8
- 241000282560 Macaca mulatta Species 0.000 description 8
- 235000019197 fats Nutrition 0.000 description 8
- 230000006698 induction Effects 0.000 description 8
- 229940125396 insulin Drugs 0.000 description 8
- 230000004048 modification Effects 0.000 description 8
- 238000012986 modification Methods 0.000 description 8
- 238000011830 transgenic mouse model Methods 0.000 description 8
- 238000003146 transient transfection Methods 0.000 description 8
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 7
- 230000001093 anti-cancer Effects 0.000 description 7
- 230000037396 body weight Effects 0.000 description 7
- 230000001276 controlling effect Effects 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 239000008103 glucose Substances 0.000 description 7
- 230000013632 homeostatic process Effects 0.000 description 7
- 238000007918 intramuscular administration Methods 0.000 description 7
- 210000003205 muscle Anatomy 0.000 description 7
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 7
- 230000008093 supporting effect Effects 0.000 description 7
- 206010008190 Cerebrovascular accident Diseases 0.000 description 6
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 6
- 108060001084 Luciferase Proteins 0.000 description 6
- 241000124008 Mammalia Species 0.000 description 6
- 239000002202 Polyethylene glycol Substances 0.000 description 6
- 206010060862 Prostate cancer Diseases 0.000 description 6
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 6
- 208000006011 Stroke Diseases 0.000 description 6
- 230000002159 abnormal effect Effects 0.000 description 6
- 230000001684 chronic effect Effects 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 150000001875 compounds Chemical class 0.000 description 6
- 239000000470 constituent Substances 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 201000001421 hyperglycemia Diseases 0.000 description 6
- 238000001990 intravenous administration Methods 0.000 description 6
- 235000005772 leucine Nutrition 0.000 description 6
- 208000002780 macular degeneration Diseases 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 230000002981 neuropathic effect Effects 0.000 description 6
- 201000001119 neuropathy Diseases 0.000 description 6
- 230000007823 neuropathy Effects 0.000 description 6
- 208000033808 peripheral neuropathy Diseases 0.000 description 6
- 229920001223 polyethylene glycol Polymers 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 230000000717 retained effect Effects 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 5
- 208000002177 Cataract Diseases 0.000 description 5
- 206010011878 Deafness Diseases 0.000 description 5
- 206010012289 Dementia Diseases 0.000 description 5
- 206010020772 Hypertension Diseases 0.000 description 5
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 5
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 5
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 5
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 5
- 208000001145 Metabolic Syndrome Diseases 0.000 description 5
- 229910019142 PO4 Inorganic materials 0.000 description 5
- 208000018737 Parkinson disease Diseases 0.000 description 5
- 206010062237 Renal impairment Diseases 0.000 description 5
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 5
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 description 5
- 230000032683 aging Effects 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 230000006907 apoptotic process Effects 0.000 description 5
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 238000013270 controlled release Methods 0.000 description 5
- 230000034994 death Effects 0.000 description 5
- 238000006471 dimerization reaction Methods 0.000 description 5
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 230000036541 health Effects 0.000 description 5
- 230000010370 hearing loss Effects 0.000 description 5
- 231100000888 hearing loss Toxicity 0.000 description 5
- 208000016354 hearing loss disease Diseases 0.000 description 5
- 230000001900 immune effect Effects 0.000 description 5
- 238000010255 intramuscular injection Methods 0.000 description 5
- 239000007927 intramuscular injection Substances 0.000 description 5
- 230000000670 limiting effect Effects 0.000 description 5
- 230000033001 locomotion Effects 0.000 description 5
- 230000004060 metabolic process Effects 0.000 description 5
- 210000005036 nerve Anatomy 0.000 description 5
- 239000003921 oil Substances 0.000 description 5
- 235000019198 oils Nutrition 0.000 description 5
- 210000000056 organ Anatomy 0.000 description 5
- 201000008482 osteoarthritis Diseases 0.000 description 5
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 5
- 239000010452 phosphate Substances 0.000 description 5
- 231100000857 poor renal function Toxicity 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 239000000725 suspension Substances 0.000 description 5
- 230000009261 transgenic effect Effects 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 230000037303 wrinkles Effects 0.000 description 5
- 208000000044 Amnesia Diseases 0.000 description 4
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 4
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 4
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 4
- 240000007049 Juglans regia Species 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 102000019149 MAP kinase activity proteins Human genes 0.000 description 4
- 108040008097 MAP kinase activity proteins Proteins 0.000 description 4
- 208000026139 Memory disease Diseases 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 208000008589 Obesity Diseases 0.000 description 4
- 241000288906 Primates Species 0.000 description 4
- 208000026214 Skeletal muscle atrophy Diseases 0.000 description 4
- 239000000443 aerosol Substances 0.000 description 4
- 230000002776 aggregation Effects 0.000 description 4
- 238000004220 aggregation Methods 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 230000003321 amplification Effects 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 239000002775 capsule Substances 0.000 description 4
- 230000036755 cellular response Effects 0.000 description 4
- 230000008878 coupling Effects 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- 230000006378 damage Effects 0.000 description 4
- 230000002950 deficient Effects 0.000 description 4
- 238000003745 diagnosis Methods 0.000 description 4
- 239000006160 differential media Substances 0.000 description 4
- VYFYYTLLBUKUHU-UHFFFAOYSA-N dopamine Chemical compound NCCC1=CC=C(O)C(O)=C1 VYFYYTLLBUKUHU-UHFFFAOYSA-N 0.000 description 4
- 238000011156 evaluation Methods 0.000 description 4
- 210000002683 foot Anatomy 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 229920000159 gelatin Polymers 0.000 description 4
- 235000019322 gelatine Nutrition 0.000 description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 4
- 235000004554 glutamine Nutrition 0.000 description 4
- 230000013595 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 230000006872 improvement Effects 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 229960000310 isoleucine Drugs 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 210000003141 lower extremity Anatomy 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 230000006984 memory degeneration Effects 0.000 description 4
- 208000023060 memory loss Diseases 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 210000000107 myocyte Anatomy 0.000 description 4
- 238000003199 nucleic acid amplification method Methods 0.000 description 4
- 235000020824 obesity Nutrition 0.000 description 4
- 238000007911 parenteral administration Methods 0.000 description 4
- 230000007170 pathology Effects 0.000 description 4
- 235000008729 phenylalanine Nutrition 0.000 description 4
- 239000002953 phosphate buffered saline Substances 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 230000006798 recombination Effects 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 230000008054 signal transmission Effects 0.000 description 4
- 230000025185 skeletal muscle atrophy Effects 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 229940124597 therapeutic agent Drugs 0.000 description 4
- 108091005703 transmembrane proteins Proteins 0.000 description 4
- 102000035160 transmembrane proteins Human genes 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- 239000013598 vector Substances 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- 208000037259 Amyloid Plaque Diseases 0.000 description 3
- 206010003694 Atrophy Diseases 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108700024394 Exon Proteins 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 206010022489 Insulin Resistance Diseases 0.000 description 3
- DEFJQIDDEAULHB-IMJSIDKUSA-N L-alanyl-L-alanine Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(O)=O DEFJQIDDEAULHB-IMJSIDKUSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- 102000001253 Protein Kinase Human genes 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 3
- 206010044565 Tremor Diseases 0.000 description 3
- 208000027418 Wounds and injury Diseases 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 206010064930 age-related macular degeneration Diseases 0.000 description 3
- 108010056243 alanylalanine Proteins 0.000 description 3
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 3
- 230000037444 atrophy Effects 0.000 description 3
- 230000027455 binding Effects 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 210000005013 brain tissue Anatomy 0.000 description 3
- 230000001149 cognitive effect Effects 0.000 description 3
- 238000004040 coloring Methods 0.000 description 3
- 239000002131 composite material Substances 0.000 description 3
- 210000000805 cytoplasm Anatomy 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 230000002349 favourable effect Effects 0.000 description 3
- 239000000796 flavoring agent Substances 0.000 description 3
- 235000019634 flavors Nutrition 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycylglycine Chemical compound [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 3
- 108010033706 glycylserine Proteins 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 208000014674 injury Diseases 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 208000032839 leukemia Diseases 0.000 description 3
- 238000003670 luciferase enzyme activity assay Methods 0.000 description 3
- 210000001161 mammalian embryo Anatomy 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 238000010172 mouse model Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 230000004770 neurodegeneration Effects 0.000 description 3
- 208000015122 neurodegenerative disease Diseases 0.000 description 3
- 210000002682 neurofibrillary tangle Anatomy 0.000 description 3
- 210000002569 neuron Anatomy 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 230000004481 post-translational protein modification Effects 0.000 description 3
- 108060006633 protein kinase Proteins 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 3
- 238000005215 recombination Methods 0.000 description 3
- 210000000664 rectum Anatomy 0.000 description 3
- 210000000697 sensory organ Anatomy 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 229960002930 sirolimus Drugs 0.000 description 3
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 238000001228 spectrum Methods 0.000 description 3
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 235000000346 sugar Nutrition 0.000 description 3
- 239000012730 sustained-release form Substances 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- HSINOMROUCMIEA-FGVHQWLLSA-N (2s,4r)-4-[(3r,5s,6r,7r,8s,9s,10s,13r,14s,17r)-6-ethyl-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]-2-methylpentanoic acid Chemical compound C([C@@]12C)C[C@@H](O)C[C@H]1[C@@H](CC)[C@@H](O)[C@@H]1[C@@H]2CC[C@]2(C)[C@@H]([C@H](C)C[C@H](C)C(O)=O)CC[C@H]21 HSINOMROUCMIEA-FGVHQWLLSA-N 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 2
- BRMWTNUJHUMWMS-UHFFFAOYSA-N 3-Methylhistidine Natural products CN1C=NC(CC(N)C(O)=O)=C1 BRMWTNUJHUMWMS-UHFFFAOYSA-N 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 206010003591 Ataxia Diseases 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- 229920002261 Corn starch Polymers 0.000 description 2
- 241000699802 Cricetulus griseus Species 0.000 description 2
- 229920000858 Cyclodextrin Polymers 0.000 description 2
- 241000252212 Danio rerio Species 0.000 description 2
- 206010017577 Gait disturbance Diseases 0.000 description 2
- 241000287828 Gallus gallus Species 0.000 description 2
- 206010018341 Gliosis Diseases 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- 125000000998 L-alanino group Chemical group [H]N([*])[C@](C([H])([H])[H])([H])C(=O)O[H] 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 241000282553 Macaca Species 0.000 description 2
- 101100390675 Mus musculus Fgf15 gene Proteins 0.000 description 2
- JDHILDINMRGULE-LURJTMIESA-N N(pros)-methyl-L-histidine Chemical compound CN1C=NC=C1C[C@H](N)C(O)=O JDHILDINMRGULE-LURJTMIESA-N 0.000 description 2
- 241000244206 Nematoda Species 0.000 description 2
- 102000004108 Neurotransmitter Receptors Human genes 0.000 description 2
- 108090000590 Neurotransmitter Receptors Proteins 0.000 description 2
- 241000289371 Ornithorhynchus anatinus Species 0.000 description 2
- 241000282577 Pan troglodytes Species 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- ZSJLQEPLLKMAKR-UHFFFAOYSA-N Streptozotocin Natural products O=NN(C)C(=O)NC1C(O)OC(CO)C(O)C1O ZSJLQEPLLKMAKR-UHFFFAOYSA-N 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 102000004338 Transferrin Human genes 0.000 description 2
- 108090000901 Transferrin Proteins 0.000 description 2
- 102000006275 Ubiquitin-Protein Ligases Human genes 0.000 description 2
- 108010083111 Ubiquitin-Protein Ligases Proteins 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 229930003316 Vitamin D Natural products 0.000 description 2
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 2
- 241000269368 Xenopus laevis Species 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 239000000853 adhesive Substances 0.000 description 2
- 230000001070 adhesive effect Effects 0.000 description 2
- 239000000556 agonist Substances 0.000 description 2
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 230000003078 antioxidant effect Effects 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 230000035578 autophosphorylation Effects 0.000 description 2
- 230000006399 behavior Effects 0.000 description 2
- 210000000941 bile Anatomy 0.000 description 2
- 239000003613 bile acid Substances 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 230000037058 blood plasma level Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 230000024245 cell differentiation Effects 0.000 description 2
- 230000006037 cell lysis Effects 0.000 description 2
- 235000013339 cereals Nutrition 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 239000008120 corn starch Substances 0.000 description 2
- 229940099112 cornstarch Drugs 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000007547 defect Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 208000016097 disease of metabolism Diseases 0.000 description 2
- 229960003638 dopamine Drugs 0.000 description 2
- 230000003291 dopaminomimetic effect Effects 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N ethylene glycol Natural products OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 235000003599 food sweetener Nutrition 0.000 description 2
- 230000005021 gait Effects 0.000 description 2
- 230000007387 gliosis Effects 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 101150113725 hd gene Proteins 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 150000002460 imidazoles Chemical class 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 230000001771 impaired effect Effects 0.000 description 2
- 239000007943 implant Substances 0.000 description 2
- 239000012535 impurity Substances 0.000 description 2
- 238000013383 initial experiment Methods 0.000 description 2
- 238000011813 knockout mouse model Methods 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 230000013016 learning Effects 0.000 description 2
- 230000037356 lipid metabolism Effects 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 208000012804 lymphangiosarcoma Diseases 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 238000007726 management method Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 239000010445 mica Substances 0.000 description 2
- 229910052618 mica group Inorganic materials 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 230000007659 motor function Effects 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 230000002232 neuromuscular Effects 0.000 description 2
- 210000004940 nucleus Anatomy 0.000 description 2
- 238000011580 nude mouse model Methods 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 230000036542 oxidative stress Effects 0.000 description 2
- FIKAKWIAUPDISJ-UHFFFAOYSA-L paraquat dichloride Chemical compound [Cl-].[Cl-].C1=C[N+](C)=CC=C1C1=CC=[N+](C)C=C1 FIKAKWIAUPDISJ-UHFFFAOYSA-L 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 150000002994 phenylalanines Chemical class 0.000 description 2
- 230000035479 physiological effects, processes and functions Effects 0.000 description 2
- 239000002504 physiological saline solution Substances 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 229920001606 poly(lactic acid-co-glycolic acid) Polymers 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 230000002062 proliferating effect Effects 0.000 description 2
- 230000004853 protein function Effects 0.000 description 2
- 239000013014 purified material Substances 0.000 description 2
- 102220058139 rs372082751 Human genes 0.000 description 2
- 230000004434 saccadic eye movement Effects 0.000 description 2
- 238000009938 salting Methods 0.000 description 2
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 239000002002 slurry Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 238000005728 strengthening Methods 0.000 description 2
- 229960001052 streptozocin Drugs 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 239000003765 sweetening agent Substances 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 210000001550 testis Anatomy 0.000 description 2
- 230000017423 tissue regeneration Effects 0.000 description 2
- 238000003325 tomography Methods 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 239000012581 transferrin Substances 0.000 description 2
- 241001515965 unidentified phage Species 0.000 description 2
- 210000001364 upper extremity Anatomy 0.000 description 2
- 210000001215 vagina Anatomy 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- 235000019166 vitamin D Nutrition 0.000 description 2
- 239000011710 vitamin D Substances 0.000 description 2
- 150000003710 vitamin D derivatives Chemical class 0.000 description 2
- 229940046008 vitamin d Drugs 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- BHQCQFFYRZLCQQ-UHFFFAOYSA-N (3alpha,5alpha,7alpha,12alpha)-3,7,12-trihydroxy-cholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 BHQCQFFYRZLCQQ-UHFFFAOYSA-N 0.000 description 1
- VRYALKFFQXWPIH-PBXRRBTRSA-N (3r,4s,5r)-3,4,5,6-tetrahydroxyhexanal Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)CC=O VRYALKFFQXWPIH-PBXRRBTRSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- LDVVTQMJQSCDMK-UHFFFAOYSA-N 1,3-dihydroxypropan-2-yl formate Chemical compound OCC(CO)OC=O LDVVTQMJQSCDMK-UHFFFAOYSA-N 0.000 description 1
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 1
- CZMRCDWAGMRECN-UHFFFAOYSA-N 2-{[3,4-dihydroxy-2,5-bis(hydroxymethyl)oxolan-2-yl]oxy}-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound OCC1OC(CO)(OC2OC(CO)C(O)C(O)C2O)C(O)C1O CZMRCDWAGMRECN-UHFFFAOYSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-M 4-hydroxybenzoate Chemical compound OC1=CC=C(C([O-])=O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-M 0.000 description 1
- QCVGEOXPDFCNHA-UHFFFAOYSA-N 5,5-dimethyl-2,4-dioxo-1,3-oxazolidine-3-carboxamide Chemical compound CC1(C)OC(=O)N(C(N)=O)C1=O QCVGEOXPDFCNHA-UHFFFAOYSA-N 0.000 description 1
- 101150037123 APOE gene Proteins 0.000 description 1
- 108010022579 ATP dependent 26S protease Proteins 0.000 description 1
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 101100230376 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) celI gene Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 206010000871 Acute monocytic leukaemia Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 208000036762 Acute promyelocytic leukaemia Diseases 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 206010001541 Akinesia Diseases 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 102100029470 Apolipoprotein E Human genes 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 206010003571 Astrocytoma Diseases 0.000 description 1
- 208000009017 Athetosis Diseases 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 102000007527 Autoreceptors Human genes 0.000 description 1
- 108010071131 Autoreceptors Proteins 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 201000004569 Blindness Diseases 0.000 description 1
- 208000020084 Bone disease Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 206010006100 Bradykinesia Diseases 0.000 description 1
- 208000003170 Bronchiolo-Alveolar Adenocarcinoma Diseases 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- 206010006895 Cachexia Diseases 0.000 description 1
- 241000244203 Caenorhabditis elegans Species 0.000 description 1
- 101100028791 Caenorhabditis elegans pbs-5 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000282461 Canis lupus Species 0.000 description 1
- 102000004031 Carboxy-Lyases Human genes 0.000 description 1
- 108090000489 Carboxy-Lyases Proteins 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 208000009132 Catalepsy Diseases 0.000 description 1
- 102000003908 Cathepsin D Human genes 0.000 description 1
- 108090000258 Cathepsin D Proteins 0.000 description 1
- PTHCMJGKKRQCBF-UHFFFAOYSA-N Cellulose, microcrystalline Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC)C(CO)O1 PTHCMJGKKRQCBF-UHFFFAOYSA-N 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- LRBQNJMCXXYXIU-PPKXGCFTSA-N Chinese gallotannin Chemical compound OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-PPKXGCFTSA-N 0.000 description 1
- 108090000943 Cholesterol 7-alpha-monooxygenases Proteins 0.000 description 1
- 102000004410 Cholesterol 7-alpha-monooxygenases Human genes 0.000 description 1
- 239000004380 Cholic acid Substances 0.000 description 1
- 208000005243 Chondrosarcoma Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 206010008748 Chorea Diseases 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 206010009696 Clumsiness Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102100033780 Collagen alpha-3(IV) chain Human genes 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 206010010774 Constipation Diseases 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- 102000004420 Creatine Kinase Human genes 0.000 description 1
- 108010042126 Creatine kinase Proteins 0.000 description 1
- 102100038637 Cytochrome P450 7A1 Human genes 0.000 description 1
- KDXKERNSBIXSRK-RXMQYKEDSA-N D-lysine Chemical compound NCCCC[C@@H](N)C(O)=O KDXKERNSBIXSRK-RXMQYKEDSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 108010093668 Deubiquitinating Enzymes Proteins 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 208000012661 Dyskinesia Diseases 0.000 description 1
- 206010013931 Dyslalia Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 208000009386 Experimental Arthritis Diseases 0.000 description 1
- 101150021185 FGF gene Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 108091092584 GDNA Proteins 0.000 description 1
- 239000001828 Gelatine Substances 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 208000008069 Geographic Atrophy Diseases 0.000 description 1
- 241000026944 Giovanella Species 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 241000288105 Grus Species 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 229920002971 Heparan sulfate Polymers 0.000 description 1
- 206010056328 Hepatic ischaemia Diseases 0.000 description 1
- 241000175212 Herpesvirales Species 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 108700014808 Homeobox Protein Nkx-2.2 Proteins 0.000 description 1
- 101000710873 Homo sapiens Collagen alpha-3(IV) chain Proteins 0.000 description 1
- 101000957672 Homo sapiens Cytochrome P450 7A1 Proteins 0.000 description 1
- 206010020651 Hyperkinesia Diseases 0.000 description 1
- 208000000269 Hyperkinesis Diseases 0.000 description 1
- 208000006083 Hypokinesia Diseases 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 208000012659 Joint disease Diseases 0.000 description 1
- 102000011782 Keratins Human genes 0.000 description 1
- 108010076876 Keratins Proteins 0.000 description 1
- 125000000393 L-methionino group Chemical group [H]OC(=O)[C@@]([H])(N([H])[*])C([H])([H])C(SC([H])([H])[H])([H])[H] 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- OYHQOLUKZRVURQ-HZJYTTRNSA-N Linoleic acid Chemical compound CCCCC\C=C/C\C=C/CCCCCCCC(O)=O OYHQOLUKZRVURQ-HZJYTTRNSA-N 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- 206010024612 Lipoma Diseases 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 206010025280 Lymphocytosis Diseases 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 108700029942 Megaloblastic Anemia due to Dihydrofolate Reductase Deficiency Proteins 0.000 description 1
- 244000246386 Mentha pulegium Species 0.000 description 1
- 235000016257 Mentha pulegium Nutrition 0.000 description 1
- 235000004357 Mentha x piperita Nutrition 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 208000035489 Monocytic Acute Leukemia Diseases 0.000 description 1
- 101100281002 Mus musculus Fgf23 gene Proteins 0.000 description 1
- 101100460498 Mus musculus Nkx2-2 gene Proteins 0.000 description 1
- 208000021642 Muscular disease Diseases 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- 201000009623 Myopathy Diseases 0.000 description 1
- 102000003505 Myosin Human genes 0.000 description 1
- 108060008487 Myosin Proteins 0.000 description 1
- OTCCIMWXFLJLIA-UHFFFAOYSA-N N-acetyl-DL-aspartic acid Natural products CC(=O)NC(C(O)=O)CC(O)=O OTCCIMWXFLJLIA-UHFFFAOYSA-N 0.000 description 1
- OTCCIMWXFLJLIA-BYPYZUCNSA-N N-acetyl-L-aspartic acid Chemical compound CC(=O)N[C@H](C(O)=O)CC(O)=O OTCCIMWXFLJLIA-BYPYZUCNSA-N 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 102000011931 Nucleoproteins Human genes 0.000 description 1
- 108010061100 Nucleoproteins Proteins 0.000 description 1
- 201000010133 Oligodendroglioma Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 206010031127 Orthostatic hypotension Diseases 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 1
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- 229920002845 Poly(methacrylic acid) Polymers 0.000 description 1
- 241000135309 Processus Species 0.000 description 1
- 102000003946 Prolactin Human genes 0.000 description 1
- 108010057464 Prolactin Proteins 0.000 description 1
- 208000033826 Promyelocytic Acute Leukemia Diseases 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- 101100281003 Rattus norvegicus Fgf23 gene Proteins 0.000 description 1
- 102000004278 Receptor Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000873 Receptor Protein-Tyrosine Kinases Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108700005075 Regulator Genes Proteins 0.000 description 1
- 108010052090 Renilla Luciferases Proteins 0.000 description 1
- 208000017442 Retinal disease Diseases 0.000 description 1
- 206010038923 Retinopathy Diseases 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- BUGBHKTXTAQXES-UHFFFAOYSA-N Selenium Chemical compound [Se] BUGBHKTXTAQXES-UHFFFAOYSA-N 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- 206010070834 Sensitisation Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 244000000231 Sesamum indicum Species 0.000 description 1
- 235000003434 Sesamum indicum Nutrition 0.000 description 1
- 206010040954 Skin wrinkling Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- 208000033040 Somatoform disorder pregnancy Diseases 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102000002070 Transferrins Human genes 0.000 description 1
- 108010015865 Transferrins Proteins 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 208000014070 Vestibular schwannoma Diseases 0.000 description 1
- 101710097943 Viral-enhancing factor Proteins 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 206010047853 Waxy flexibility Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000001785 acacia senegal l. willd gum Substances 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 150000008065 acid anhydrides Chemical class 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 208000017733 acquired polycythemia vera Diseases 0.000 description 1
- BAPJBEWLBFYGME-UHFFFAOYSA-N acrylic acid methyl ester Natural products COC(=O)C=C BAPJBEWLBFYGME-UHFFFAOYSA-N 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 108091006088 activator proteins Proteins 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 206010003119 arrhythmia Diseases 0.000 description 1
- 210000000544 articulatio talocruralis Anatomy 0.000 description 1
- 239000000596 artificial lung surfactant Substances 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 208000020538 atrophic muscular disease Diseases 0.000 description 1
- 210000000467 autonomic pathway Anatomy 0.000 description 1
- 229920005601 base polymer Polymers 0.000 description 1
- 238000005452 bending Methods 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 125000000188 beta-D-glucosyl group Chemical group C1([C@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 150000001576 beta-amino acids Chemical group 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 230000036772 blood pressure Effects 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 230000002308 calcification Effects 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 235000020827 calorie restriction Nutrition 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 235000019416 cholic acid Nutrition 0.000 description 1
- BHQCQFFYRZLCQQ-OELDTZBJSA-N cholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 BHQCQFFYRZLCQQ-OELDTZBJSA-N 0.000 description 1
- 229960002471 cholic acid Drugs 0.000 description 1
- 208000012601 choreatic disease Diseases 0.000 description 1
- 210000002987 choroid plexus Anatomy 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 210000001726 chromosome structure Anatomy 0.000 description 1
- 208000024207 chronic leukemia Diseases 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000009060 clear cell adenocarcinoma Diseases 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 230000019771 cognition Effects 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000008119 colloidal silica Substances 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000010835 comparative analysis Methods 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 239000007891 compressed tablet Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000001143 conditioned effect Effects 0.000 description 1
- 208000015806 constitutional megaloblastic anemia with severe neurologic disease Diseases 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 208000029078 coronary artery disease Diseases 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- KXGVEGMKQFWNSR-UHFFFAOYSA-N deoxycholic acid Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 KXGVEGMKQFWNSR-UHFFFAOYSA-N 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 210000005064 dopaminergic neuron Anatomy 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 239000003651 drinking water Substances 0.000 description 1
- 235000020188 drinking water Nutrition 0.000 description 1
- 238000001647 drug administration Methods 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 239000013583 drug formulation Substances 0.000 description 1
- 210000001951 dura mater Anatomy 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 238000004043 dyeing Methods 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 229960001484 edetic acid Drugs 0.000 description 1
- 230000008144 egg development Effects 0.000 description 1
- 235000014103 egg white Nutrition 0.000 description 1
- 210000000969 egg white Anatomy 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000000750 endocrine system Anatomy 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 208000010932 epithelial neoplasm Diseases 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000035558 fertility Effects 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 235000013312 flour Nutrition 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- NBVXSUQYWXRMNV-UHFFFAOYSA-N fluoromethane Chemical compound FC NBVXSUQYWXRMNV-UHFFFAOYSA-N 0.000 description 1
- 101150046266 foxo gene Proteins 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 230000007661 gastrointestinal function Effects 0.000 description 1
- 238000012637 gene transfection Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 210000004907 gland Anatomy 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 230000004153 glucose metabolism Effects 0.000 description 1
- 230000004190 glucose uptake Effects 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 229940075507 glyceryl monostearate Drugs 0.000 description 1
- 230000012447 hatching Effects 0.000 description 1
- 208000025750 heavy chain disease Diseases 0.000 description 1
- 201000002222 hemangioblastoma Diseases 0.000 description 1
- 229920001519 homopolymer Polymers 0.000 description 1
- 235000001050 hortel pimenta Nutrition 0.000 description 1
- 235000003642 hunger Nutrition 0.000 description 1
- 208000013403 hyperactivity Diseases 0.000 description 1
- 230000003483 hypokinetic effect Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 230000003914 insulin secretion Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 210000004347 intestinal mucosa Anatomy 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 208000017169 kidney disease Diseases 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 150000002614 leucines Chemical class 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- OYHQOLUKZRVURQ-IXWMQOLASA-N linoleic acid Natural products CCCCC\C=C/C\C=C\CCCCCCCC(O)=O OYHQOLUKZRVURQ-IXWMQOLASA-N 0.000 description 1
- 235000020778 linoleic acid Nutrition 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 208000018769 loss of vision Diseases 0.000 description 1
- 231100000864 loss of vision Toxicity 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 230000001592 luteinising effect Effects 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 230000027939 micturition Effects 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000037230 mobility Effects 0.000 description 1
- 239000003147 molecular marker Substances 0.000 description 1
- 239000001788 mono and diglycerides of fatty acids Substances 0.000 description 1
- 230000002969 morbid Effects 0.000 description 1
- 210000002200 mouth mucosa Anatomy 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 201000006938 muscular dystrophy Diseases 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 230000001272 neurogenic effect Effects 0.000 description 1
- 230000016273 neuron death Effects 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 230000036963 noncompetitive effect Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 231100000862 numbness Toxicity 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- 210000000287 oocyte Anatomy 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 239000006174 pH buffer Substances 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 210000002990 parathyroid gland Anatomy 0.000 description 1
- 208000035824 paresthesia Diseases 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 230000008447 perception Effects 0.000 description 1
- 210000000578 peripheral nerve Anatomy 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Substances [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 1
- 210000004224 pleura Anatomy 0.000 description 1
- 229920000191 poly(N-vinyl pyrrolidone) Polymers 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 208000037244 polycythemia vera Diseases 0.000 description 1
- 206010036067 polydipsia Diseases 0.000 description 1
- 229920000570 polyether Polymers 0.000 description 1
- 108010040003 polyglutamine Proteins 0.000 description 1
- 229920000155 polyglutamine Polymers 0.000 description 1
- 108010094020 polyglycine Proteins 0.000 description 1
- 229920000232 polyglycine polymer Polymers 0.000 description 1
- 239000004926 polymethyl methacrylate Substances 0.000 description 1
- 210000004896 polypeptide structure Anatomy 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 229940097325 prolactin Drugs 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- ULWHHBHJGPPBCO-UHFFFAOYSA-N propane-1,1-diol Chemical class CCC(O)O ULWHHBHJGPPBCO-UHFFFAOYSA-N 0.000 description 1
- 230000004952 protein activity Effects 0.000 description 1
- 230000004845 protein aggregation Effects 0.000 description 1
- 238000003498 protein array Methods 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000012207 quantitative assay Methods 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000011514 reflex Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 210000001525 retina Anatomy 0.000 description 1
- 210000003583 retinal pigment epithelium Anatomy 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- 210000003497 sciatic nerve Anatomy 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- 229910052711 selenium Inorganic materials 0.000 description 1
- 239000011669 selenium Substances 0.000 description 1
- 230000008313 sensitization Effects 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 235000010413 sodium alginate Nutrition 0.000 description 1
- 239000000661 sodium alginate Substances 0.000 description 1
- 229940005550 sodium alginate Drugs 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 229940079827 sodium hydrogen sulfite Drugs 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 208000027765 speech disease Diseases 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 230000003068 static effect Effects 0.000 description 1
- 210000001562 sternum Anatomy 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 210000003684 theca cell Anatomy 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 210000000115 thoracic cavity Anatomy 0.000 description 1
- 230000002992 thymic effect Effects 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 230000001646 thyrotropic effect Effects 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000004393 visual impairment Effects 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/50—Fibroblast growth factor [FGF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/12—Ophthalmic agents for cataracts
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/16—Otologicals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/12—Drugs for disorders of the metabolism for electrolyte homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/08—Plasma substitutes; Perfusion solutions; Dialytics or haemodialytics; Drugs for electrolytic or acid-base disorders, e.g. hypovolemic shock
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2405—Glucanases
- C12N9/2434—Glucanases acting on beta-1,4-glucosidic bonds
- C12N9/2445—Beta-glucosidase (3.2.1.21)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/93—Ligases (6)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01021—Beta-glucosidase (3.2.1.21)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01031—Beta-glucuronidase (3.2.1.31)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y602/00—Ligases forming carbon-sulfur bonds (6.2)
- C12Y602/01—Acid-Thiol Ligases (6.2.1)
- C12Y602/01003—Long-chain-fatty-acid-CoA ligase (6.2.1.3)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/32—Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Wood Science & Technology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Diabetes (AREA)
- Physical Education & Sports Medicine (AREA)
- Neurology (AREA)
- Toxicology (AREA)
- Hematology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Neurosurgery (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Obesity (AREA)
- Cardiology (AREA)
- Rheumatology (AREA)
Abstract
Disclosure relates to method, kit and the composition for preventing or treat age related conditions or metabolic disorder herein. The fused polypeptide of disclosure comprises FGF23 or its active fragment herein. In one embodiment, fused polypeptide comprises: the polypeptide that (a) comprises fibroblast growth factor 23 (FGF23), or its functional activity variant or derivative, wherein a place or the many places of FGF23 in position Q156, C206 and C244 have sudden change; And (b) there is the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase, or the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen, or its functional activity variant or derivative; And optionally, (c) connexon. Klotho fusion treatment with prevent the relevant patient's condition of multiple age and metabolic disorder in be useful. In another embodiment, fused polypeptide comprises FGF (for example FGF23) or its functional activity variant or derivative; And modified Fc fragment or its functional activity variant or derivative. In the numerous embodiments of fused polypeptide, FGF23 has the sudden change of the cutting that reduces gathering and protease mediation.
Description
The application requires the senior interest of the U. S. application sequence number No.12/696693 submitting on January 29th, 2010, and the content of this application by reference entirety is incorporated to herein.
1. background
Fibroblast growth factor (FGF) is formed in the family (Ornitz and Itoh, GenomeBiol.2:reviews, 3005.1-3005.12 (2001)) of the homeopeptide growth factor of expressing in a lot of biologies. In invertebrate species, FGF is high conservative on gene structure and amino acid sequence, has the amino acid homogeneity of 13-71% between mutually. In people, have 22 known FGF family members (FGF15 be the mouse of people FGF19 directly to autoploid, therefore nobody FGF15). In growing in early days, FGF regulating cell propagation, migration and differentiation, but in adult organism, FGF keeps homeostasis, brings into play function and reply damage in tissue repair.
FGF by conjunction with and thus activating cell surface FGF acceptor be used as growth factor performance function. FGF acceptor (FGFR) is tyrosine kinase receptor, and they carry out activation signals transduction by phosphorylation and the activation Egr-1 (early growth replys-1) of autophosphorylation, FRS2 (FGF receptor substrate 2) and the ERK1/2 (protein kinases 1/2 of extracellular signal regulation and control) of FGFR. FGF also has the high-affinity for sulfate-proteoglycan. When in the time that FGF is combined, heparin sulfate strengthens the activation of FGFR.
The single-pass with extracellular domain and short cytoplasm domain of α-Klotho gene code 130kDa is crossed (singlepass) I type transmembrane protein. The extracellular domain of α-Klotho albumen comprises two subdomains that are called as KL-D1 and KL-D2. The β-glucosyl enzym of these two subdomains and bacterium and plant is enjoyed sequence homology. The extracellular domain of α-Klotho albumen can be combined with cell surface by membrane spaning domain, maybe can be cut and be discharged into extracellular environment. The cutting of extracellular domain seems by the low extracellular Ca in part2+Concentration is assisted.
Except α-Klotho, the autoploid of α-Klotho, β-Klotho is identified (Ito etc., Mech.Dev.98:115-9 (2000)) also. β-Klotho is also that the single-pass with extracellular KL-D1 and KL-D2 subdomain is crossed I type transmembrane protein.
In mammal, show that the adjusting that α-Klotho expresses has produced old and feeble relevant feature. The mouse of isozygotying of losing function mutation in α-Klotho gene has developed similar mankind aging's feature, life-span, atrophoderma, the flesh that comprises shortening is subdued, artery sclerosis, pulmonary emphysema and osteoporosis (Kuro-o etc., Nature, 390:45-51 (1997)). On the contrary, with respect to wild-type mice, α-Klotho gene crossing in mouse expressed and extended the life-span, and increased resistance (Kurosu etc., Science309:1829-1833 (2005) to oxidative stress; Yamamoto etc., J.Biol.Chem.280:38029-38034 (2005)).
Recent research shows between FGF23 deficient mice and α-Klotho deficient mice, have surprising similar biological property (Shimada etc., J.Clin.Invest.113:561-568 (2004); The Endocrinology143:683-689 such as Yoshida (2002)), this shows between FGF23 and α-Klotho, there is function sex-intergrade perception (crosstalk). These researchs cause transmitting this by its association (cognate) FGF receptors bind and signal aspect two, α-Klotho are accredited as to the essential partner (Urakawa etc., Nature22:1524-6 (2007)) of FGF23. α-Klotho gene is mainly expressed in kidney, parathyroid gland and choroid plexus. The activation of FGF23 signal transmission is limited to those tissues by the tissue specific expression that proposes hypothesis: α-Klotho.
Similar to FGF23/ α-Klotho, transmitting by their associated FGF receptor signals separately and in conjunction with this aspect two, β-Klotho is essential partner (Ogawa etc., the Proc.Natl.Acad.Sci.USA104:7432-7 (2007) of FGF19 and FGF21; Lin etc., J.BiolChem.282:27227-84 (2007); With Wu etc., J.Biol.Chem.282:29069-72 (2007)). This type of research also shows, and β-Klotho relates to the regulation and control of tissue specificity metabolic activity. Initial demonstration β-Klotho plays a role together with FGF21 as confactor, for regulating and controlling carbohydrate and the lipid metabolism of adipose tissue. Bile acid biosynthesis in β-Klotho associating FGF19 regulation and control liver, has explained the bile raising in β-Klotho deficient mice synthetic (Ito etc., JClinInvest.2005Aug thus; 115 (8): 2202-8).
U.S. Patent No. 6,579,850 have described the polypeptide and the composition that comprise α-Klotho polypeptide. α-Klotho polypeptide of people and mouse is disclosed. This patent is also open: the composition that comprises described polypeptide is useful in similar syndrome, treatment AD and the containment aging of crossing presenility for the treatment of.
U.S. Patent No. 7,223,563 have described the nucleic acid of separated coding FGF23 peptide sequence or the recombinant cell that comprises this type of separated nucleic acid. This patent also relates to the method for diagnosis and treatment hypophosphatemia and hyperphosphatemia illness, osteoporosis, dermatomyositis and coronary artery disease.
U.S. Patent No. 7,259,248 have described the nucleic acid of separated coding FGF21 peptide sequence. This patent also relates to the method for diagnosis and treatment liver disease, the patient's condition relevant to thymus function, and treats the method for the testis patient's condition.
2. summary of the invention
Disclosure relates to the method, purposes, kit and the composition that use fused polypeptide or the prevention of solvable polypeptide or treatment age related conditions or metabolic disorder herein. The fused polypeptide of disclosure for example, by FGF (FGF23) herein; And Klotho albumen or its active fragment (for example sKlotho) and/or Fc fragment (for example FcLALA); And optionally, connexon forms. In some embodiments, FGF23 is suddenlyd change. In some embodiments, disclosure provides following Klotho fused polypeptide herein, and it comprises Klotho albumen or its active fragment and fibroblast growth factor or its active fragment. In some embodiments, fused polypeptide comprises Klotho polypeptide, FGF (for example FGF23) and modified Fc fragment. For example Fc fragment can have serum half life minimizing and combination Fc-γ-acceptor and increase. The fusion that comprises sKlotho, FGF23 and FcLALA (having the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase) has been described in SEQIDNO.46,47,48 and 49. In some embodiments, fused polypeptide or protein comprise FGF (for example, FGF23), or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions); And modified Fc fragment, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions). In SEQIDNO.50,51,52 and 53, the fusion that comprises FGF23 and FcLALA is described. In some embodiments, fused polypeptide has one or more sudden changes in FGF23, and described sudden change has reduced the cutting of gathering and/or protease mediation.
Aspect first, disclosure provides and has had at least one extracellular subdomain of Klotho albumen and fused polypeptide or its active fragment of fibroblast growth factor herein. In some embodiments, fusion also comprises modified Fc fragment, and described fragment has the compatibility to Fc-γ-acceptor (for example, the Ka of minimizing or the Kd of increase) of minimizing and/or the serum half life increasing. Klotho extracellular domain can come from α or β Klotho isoform. In addition, although the FGF component of Klotho fused polypeptide is mainly described with reference to FGF-19, fibroblast growth factor-21 and FGF-23, consider that any in 23 kinds of known FGF can use in disclosure herein in practice. The application's reader can think: all independently and particularly considered for every kind in every kind of combination of α or β extracellular domain and every kind of people FGF albumen or its active fragment.
According to this paper disclosure, the extracellular domain of Klotho albumen can comprise the KL-D1 of Klotho albumen and KL-D2 domain one of or both, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions). In some embodiments, the Klotho fused polypeptide of disclosure has at least two extracellular subdomains of Klotho albumen herein, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions). For example, described at least two extracellular subdomains can be at least two KL-D1 domains of series connection repetition, at least two KL-D2 domains that series connection repeats, or at least one KL-D1 domain and at least one KL-D2 domain. In numerous embodiments, the amino acid 28-292 that the fused polypeptide of disclosure comprises total length α Klotho albumen herein, or amino acid 28-982 (SEQIDNO:7). In another embodiment, the amino acid 52-997 that the fused polypeptide of disclosure comprises total length β Klotho albumen herein.
In a kind of embodiment of this paper disclosure, the component of fused polypeptide comprises: the polypeptide that (a) comprises fibroblast growth factor 23 (FGF23), or its functional activity variant or derivative are (for example, the variant that comprises at least one conserved amino acid replacement and/or an amino acid deletions), wherein, a place or the many places of FGF23 in position Q156, C206 and C244 have sudden change; And (b) there is the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase, or the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions); And, optionally (c) connexon. For example, component can connect or meet frame fusion by peptide bond by chemistry. They also can connect via connexon. The limiting examples of polypeptide connexon is SEQIDNO:11,12,13,14,15,16,17 and 18. This type of connexon can comprise SEQIDNO:11,12,13,14,15,16,17 and 18 at least one and approximately 30 repetitions at the most. In another nonrestrictive embodiment, fusion comprises (2) FGF or its active fragment, and (3) modified Fc fragment. The various ingredients of fusion can effectively connect with any order; Polypeptide (1) can effectively be connected to the N-end of the polypeptide of (2) or (3); (2) polypeptide can effectively be connected to the N-end of the polypeptide of (1) or (3); (3) polypeptide can effectively be connected to the N-end of the polypeptide of (1) or (2).
According to this paper disclosure, the extracellular subdomain of Klotho albumen, fibroblast growth factor and the modified Fc fragment that (optional) has the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase can effectively be connected mutually with mode with multiple orientation. For example, the extracellular subdomain of Klotho albumen can effectively be connected with the N-end of fibroblast growth factor, or alternatively fibroblast growth factor can effectively be connected with the N-end of the extracellular subdomain of Klotho albumen.
In one embodiment, herein disclosure provides the sKlotho that comprises Klotho albumen and the fused polypeptide of connexon. In another embodiment, herein disclosure provides the sKlotho that comprises α Klotho albumen and the fused polypeptide of connexon. In another embodiment, herein disclosure provides the sKlotho that comprises β Klotho albumen and the fused polypeptide of connexon. In another embodiment, disclosure provides people FGF albumen or its active fragment (for example, there is no signal peptide) and connexon herein. In one embodiment, herein disclosure provides fusion, nucleic acid molecules or pharmaceutical composition, and they are for therapy or as the medicament of the treatment for pathology illness. Comprising the pharmaceutical composition of the fusion of disclosure is herein used for the treatment of with them or prevents the purposes of the relevant patient's condition of age or metabolic disease to be also encompassed in this paper disclosure. In some embodiments, fusion also comprises modified Fc fragment, and described Fc fragment has the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
In one embodiment, herein disclosure provides following fused polypeptide, and described fused polypeptide comprises and has sKlotho signal peptide, α Klotho albumen, and its (directly or indirect via connexon) merges to FGF-23. In another embodiment, herein disclosure provides following fused polypeptide, and described fused polypeptide comprises and do not have sKlotho signal peptide, α Klotho albumen, and its (directly or indirect via connexon) merges to FGF-23. In another embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises and has sKlotho signal peptide, α Klotho albumen, and its (directly or indirect via connexon) merges to the FGF-23 without signal peptide. In another embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises and does not have sKlotho signal peptide, α Klotho albumen, and its (directly or indirect via connexon) merges to the FGF-23 without signal peptide. In some embodiments, fusion also comprises modified Fc fragment, and described Fc fragment has the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
In one embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises and has sKlotho signal peptide, α Klotho albumen, and its (directly or indirect via connexon) merges the variant to FGF-23 (R179Q). In another embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises and does not have sKlotho signal peptide, α Klotho albumen, and its (directly or indirect via connexon) merges the variant to FGF-23 (R179Q). In another embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises and has sKlotho signal peptide, α Klotho albumen, and its (directly or indirect via connexon) merges to FGF-23 (R179Q) variant without signal peptide. In another embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises and does not have sKlotho signal peptide, α Klotho albumen, and its (directly or indirect via connexon) merges to FGF-23 (R179Q) variant without signal peptide. In some embodiments, fusion also comprises modified Fc fragment, and described Fc fragment has the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
In one embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises: the polypeptide that (a) comprises fibroblast growth factor 23 (FGF23), or its functional activity variant or derivative are (for example, the variant that comprises at least one conserved amino acid replacement and/or an amino acid deletions), wherein, a place or the many places of FGF23 in position Q156, C206 and C244 have sudden change; And (b) there is the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase, or the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions); And (c) connexon optionally. In SEQIDNO:54,55,56,57,58,59,60,61,62,63,64,65,66,67 and 68, this type of fused polypeptide is disclosed.
In one embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises: (1) has sKlotho signal peptide, α Klotho albumen, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions); (2) connexon; (3) do not there is FGF-23 (R179Q) variant of signal peptide, or its functional activity variant or derivative (for example, comprise at least one conserved amino acid is replaced and/or a kind of variant of amino acid deletions). In another embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises: (1) does not have sKlotho signal peptide, α Klotho albumen, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions); (2) connexon; (3) do not there is FGF-23 (R179Q) variant of signal peptide, or its functional activity variant or derivative (for example, comprise at least one conserved amino acid is replaced and/or a kind of variant of amino acid deletions). In some embodiments, the fused polypeptide of disclosure is glycosylated herein. In some embodiments, fusion also comprises modified Fc fragment, and described Fc fragment has the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
In one embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises: (1) has sKlotho signal peptide, α Klotho albumen (SEQIDNO:44 or SEQIDNO:45), or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions); (2) connexon that comprises SEQIDNO:11; (3) do not there is FGF-23 (R179Q) variant (SEQIDNO:43) of signal peptide, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or a kind of amino acid deletions). In another embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises: (1) does not have sKlotho (SEQIDNO:7) signal peptide, α Klotho albumen, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions); (2) connexon that comprises SEQIDNO:11; (3) do not there is FGF-23 (R179Q) variant (SEQIDNO:43) of signal peptide, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or a kind of amino acid deletions). In one embodiment, herein disclosure provides the fused polypeptide that comprises SEQIDNO:19,20,40 or 41 amino acid sequence. In some embodiments, the fused polypeptide of disclosure is glycosylated herein.
In one embodiment, disclosure provides following fused polypeptide herein, described fused polypeptide comprises and has sKlotho signal peptide, α Klotho albumen (SEQIDNO:44 or SEQIDNO:45), or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions); With the connexon that comprises SEQIDNO:11. In another embodiment, disclosure provides following fused polypeptide herein, and described fused polypeptide comprises: do not have sKlotho (SEQIDNO:7) signal peptide, α Klotho albumen; With the connexon that comprises SEQIDNO:11. In some embodiments, the fused polypeptide of disclosure is glycosylated herein. In some embodiments, fusion also comprises modified Fc fragment, and described Fc fragment has the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
In one embodiment, herein disclosure provides following fused polypeptide, and described fused polypeptide comprises people FGF albumen or its active fragment (for example, do not have signal peptide); And the connexon that comprises SEQIDNO:11. In some embodiments, the fused polypeptide of disclosure is glycosylated herein. In some embodiments, fusion also comprises modified Fc fragment, and described Fc fragment has the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
In one embodiment, herein disclosure provides following fused polypeptide, and described fused polypeptide comprises people FGF albumen (for example, FGF23) or its active fragment (for example, do not have signal peptide); Connexon (connexon that for example, comprises SEQIDNO:11); And sKlotho (thering is or do not have signal peptide), or its functional activity variant or derivative are (for example, the variant that comprises at least one conserved amino acid replacement and/or a kind of amino acid deletions) or Fc-γ-acceptor (for example, FcLALA); Wherein said FGF (for example, FGF23) has a place or many places sudden change at these residue places of R179, Q156, C206 and/or C244. In numerous embodiments, sudden change is R179Q, Q156A, C206S and/or C244S. Although these sudden changes are conservative in people, rhesus macaque, ox, Mouse and rat FGF23, suddenling change, they can not hinder FGF23 activity. On the contrary, these amino acid that suddenly change are assembled, reduce the cutting of undesired protease induction and increased the protein production from cell by reduction, have unexpectedly strengthened the quality of albumen. In numerous embodiments, the fusion that comprises one or more FGF23 sudden changes is glycosylated.
In one embodiment, disclosure provides and (has for example comprised herein, as independent active constituents of medicine) following fused polypeptide is (for example, glycosylated or nonglycosylated) pharmaceutical composition (for example, using intramuscular administration form) purposes with described pharmaceutical composition in therapy or (for example treat and/or prevent the relevant patient's condition of age as the purposes of the medicament for the treatment of pathological disorders, for example amyotrophia), described fused polypeptide comprises: (1) does not have FGF-23 (R179Q) variant (SEQIDNO:43) of signal peptide, or the variant of the additional mutations that comprises the cutting that reduces gathering and/or protease mediation, or its functional activity variant or derivative are (for example, the variant that comprises at least one conserved amino acid replacement and/or an amino acid deletions), (2) connexon that optionally, comprises SEQIDNO:11, (3) there is sKlotho signal peptide, α Klotho albumen (SEQIDNO:44 or SEQIDNO:45), or its functional activity variant or derivative are (for example, comprise that at least one conserved amino acid is replaced and/or the variant of an amino acid deletions), or there is the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. in another embodiment, disclosure provides and (has for example comprised herein, as independent active constituents of medicine) following fused polypeptide is (for example, glycosylated or nonglycosylated) pharmaceutical composition (for example, using intramuscular administration form) purposes with described pharmaceutical composition in therapy or (for example treat and/or prevent the relevant patient's condition of age as the purposes of the medicament for the treatment of pathological disorders, for example amyotrophia), described fused polypeptide comprises: (1) does not have FGF-23 (R179Q) variant (SEQIDNO:43) of signal peptide, or the variant of the additional mutations that comprises the cutting that reduces gathering and/or protease mediation, or its functional activity variant or derivative are (for example, the variant that comprises at least one conserved amino acid replacement and/or an amino acid deletions), (2) connexon that comprises SEQIDNO:11, (3) do not there is sKlotho (SEQIDNO:7) signal peptide, α Klotho albumen, or its functional activity variant or derivative are (for example, the variant that comprises at least one conserved amino acid replacement and/or a kind of amino acid deletions), or there is the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or a kind of amino acid deletions). in one embodiment, disclosure provides and (has for example comprised herein, as independent active constituents of medicine) following fused polypeptide is (for example, glycosylated or nonglycosylated) pharmaceutical composition (for example, using intramuscular administration form) purposes with described pharmaceutical composition in therapy or (for example treat and/or prevent the relevant patient's condition of age as the purposes of the medicament for the treatment of pathological disorders, for example amyotrophia), described fused polypeptide comprises SEQIDNO:19,20,40 or 41 amino acid sequence.
In one embodiment, herein disclosure provide comprise (for example, as independent active constituents of medicine) following fused polypeptide (for example glycosylated or nonglycosylated) pharmaceutical composition (for example, with intramuscular administration form) and described pharmaceutical composition be used for the treatment of and/or prevent the purposes of age related conditions (for example amyotrophia), described fused polypeptide comprises: have sKlotho signal peptide, α Klotho albumen (SEQIDNO:44 or SEQIDNO:45); And the connexon that comprises SEQIDNO:11. In another embodiment, disclosure provides and (has for example comprised herein, as independent active constituents of medicine) following fused polypeptide is (for example, glycosylated or nonglycosylated) pharmaceutical composition (for example, using intramuscular administration form) purposes with described pharmaceutical composition in therapy or (for example treat and/or prevent the relevant patient's condition of age as the purposes of the medicament for the treatment of pathological disorders, for example amyotrophia), described fused polypeptide comprises and does not have sKlotho (SEQIDNO:7) signal peptide, α Klotho albumen; And the connexon that comprises SEQIDNO:11. In some embodiments, fusion also comprises modified Fc fragment.
In one embodiment, herein disclosure provides the pharmaceutical composition that comprises (for example, as independent active constituents of medicine) following fused polypeptide (for example glycosylated or nonglycosylated), and described fused polypeptide comprises people FGF albumen or its active fragment (for example not having signal peptide); With the connexon that comprises SEQIDNO:11.
Purposes in therapy of the pharmaceutical composition that comprises the fusion of disclosure herein and they or (the relevant patient's condition of for example treatment or prevention age (for example as the purposes of the medicament for the treatment of pathological disorders, amyotrophia) or metabolic disorder (for example, diabetes)) be also encompassed in this paper disclosure.
In one embodiment, disclosure provides the fused polypeptide with SEQIDNO:19 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% homogeneity herein. In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:20 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% homogeneity herein.
In one embodiment, disclosure provides the fused polypeptide with SEQIDNO:40 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% homogeneity herein. In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:41 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% homogeneity herein.
In one embodiment, disclosure provides the fused polypeptide with SEQIDNO:46 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein. In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:47 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In one embodiment, disclosure provides the fused polypeptide with SEQIDNO:48 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein. In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:49 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In one embodiment, disclosure provides the fused polypeptide with SEQIDNO:50 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein. In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:51 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In one embodiment, disclosure provides the fused polypeptide with SEQIDNO:52 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein. In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:53 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:54 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:55 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:56 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:57 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:58 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:59 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:60 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:61 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:62 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:63 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:64 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:65 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:66 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:67 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In another embodiment, disclosure provides the fused polypeptide with SEQIDNO:68 with at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homogeneity herein.
In one embodiment, this paper disclosure provides and has comprised (direct or indirect via connexon) and FGF-19 or its active fragment fused polypeptide that merge, sKlotho that have signal peptide, β Klotho albumen. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. In another embodiment, this paper disclosure provides and has comprised (direct or indirect via connexon) and FGF-19 or its active fragment fused polypeptide that merge, sKlotho that do not have signal peptide, β Klotho albumen. In another embodiment, this paper disclosure provides and has comprised (direct or indirect via connexon) and FGF-21 or its active fragment fused polypeptide that merge, sKlotho that have signal peptide, β Klotho albumen. In another embodiment, this paper disclosure provides and has comprised (direct or indirect via connexon) and FGF-21 or its active fragment fused polypeptide that merge, sKlotho that do not have signal peptide, β Klotho albumen.
Disclosure provides the nucleotide sequence of any Klotho fused polypeptide described herein of encoding and the host cell that contains described nucleic acid herein. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
Disclosure also provides the composition with any Klotho fused polypeptide of considering herein herein. The composition of disclosure can also comprise heparin herein. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
Disclosure also provides for the method at individuality treatment or prevention age related conditions herein. To individuality (for example, people) administering therapeutic effective dose of medicine compositions is with treatment or prevent the relevant patient's condition of age, described pharmaceutical composition contains Klotho fused polypeptide, described fused polypeptide has at least one extracellular subdomain and fibroblast growth factor or its active fragment of Klotho albumen (for example, α Klotho albumen). In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. Especially, disclosure provides the method that treatment or prevention flesh are subdued herein, described method comprises that for example, described fused polypeptide has at least one extracellular subdomain and the fibroblast growth factor (or its active fragment) of α Klotho albumen to the fused polypeptide of individual (people) administering therapeutic effective dose.
In addition, disclosure provides the method for the treatment of or preventing metabolic disorder in individuality herein. For example, to individual (people) administering therapeutic effective dose of medicine compositions with treatment metabolic disorder, described pharmaceutical composition contains the fused polypeptide of disclosure herein, and described fused polypeptide has at least one extracellular subdomain and the fibroblast growth factor (or its active fragment) of Klotho albumen. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. Especially, at least one extracellular subdomain with β-Klotho albumen of disclosure and the fused polypeptide of FGF2 1 are useful for treatment metabolic disorder herein.
The Klotho-FGF23 fused polypeptide of disclosure can be used in treatment or prevention hyperphosphatemia or calcinosis in individuality herein. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. Use pharmaceutical composition pharmacology effective dose, that contain this paper at least one extracellular subdomain with Klotho albumen of disclosure and the Klotho fused polypeptide of fibroblast growth factor, to treat or to prevent hyperphosphatemia or calcinosis. Especially, at least one extracellular subdomain with α Klotho albumen of disclosure and the Klotho fused polypeptide of fibroblast growth factor 23 are useful for treatment hyperphosphatemia or calcinosis herein.
The Klotho-FGF23 fused polypeptide of disclosure can be used in treatment or preventing chronic ephrosis or chronic renal failure in individuality herein. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. Pharmaceutical composition administering therapeutic effective dose, that contain this paper at least one extracellular subdomain for example, with Klotho albumen (α Klotho albumen) of disclosure and the Klotho fused polypeptide of fibroblast growth factor, to treat or preventing chronic ephrosis or chronic renal failure.
The Klotho-FGF23 fused polypeptide of disclosure can be used in treatment or pre-anti-cancer (for example breast cancer) in individuality herein. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. Pharmaceutical composition administering therapeutic effective dose, that contain this paper at least one extracellular subdomain for example, with Klotho albumen (α Klotho albumen) of disclosure and the Klotho fused polypeptide of fibroblast growth factor, to treat or pre-anti-cancer or breast cancer.
Disclosure provides the fused polypeptide for medicine, at least one extracellular subdomain that described fused polypeptide comprises Klotho albumen and FGF or its active fragment herein. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. In one embodiment, this paper disclosure provides and has been used for the treatment of or has prevented at least one extracellular subdomain and FGF or its active fragment that amyotrophic fused polypeptide, described fused polypeptide comprise Klotho albumen. Disclosure also provides the method for the treatment of or prevention age related conditions (for example amyotrophia) herein, and described method comprises to the pharmaceutical composition individual administering therapeutic effective dose, that comprise solvable Klotho albumen that has needs.
Disclosure also provides above-mentioned peptide and comprised described peptide herein fused polypeptide or pharmaceutical composition, they are for therapy, as medicament or for for example, treatment to pathology illness (patient's condition, metabolic disorder, hyperphosphatemia or calcinosis, chronic kidney disease or chronic renal failure that the age is relevant) or pre-anti-cancer or breast cancer at individuality. In addition, herein disclosure also provides the purposes in polypeptide of the present invention, nucleic acid or pharmaceutical composition be used for the treatment of pathological disorders (especially for the above-mentioned illness for the treatment of, preferably, the relevant patient's condition of age is as amyotrophia) medicament in manufacture.
Disclosure also comprises for the illness individuality is treated or the prevention age is relevant or the kit of metabolic disorder herein. Kit comprises operation instructions and purified Klotho fused polypeptide, and described fused polypeptide has at least one extracellular subdomain and fibroblast growth factor of Klotho albumen. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
Disclosure also provides the kit for the production of the Klotho fused polypeptide of this paper disclosure herein. The kit of disclosure comprises that operation instruction and coding have the nucleic acid of at least one extracellular subdomain of Klotho albumen and the Klotho fused polypeptide of fibroblast growth factor herein. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
In a kind of embodiment of this paper disclosure, fused polypeptide comprises: the polypeptide that (a) comprises fibroblast growth factor, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or an amino acid deletions); (b) there is the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase, or its functional activity variant or derivative (variant that for example, comprises at least one conserved amino acid replacement and/or a kind of amino acid deletions).
In a kind of embodiment of this paper disclosure, polypeptide (a) and polypeptide (b) link by polypeptide connexon. Connexon can repeat 1 to 30 time, or more times.
In a kind of embodiment of this paper disclosure, the amino acid sequence that polypeptide connexon comprises the group that is selected from SEQIDNO:11, SEQIDNO:12, SEQIDNO:13, SEQIDNO:14, SEQIDNO:15, SEQIDNO:16, SEQIDNO:17 and SEQIDNO:18 formation.
In a kind of embodiment of this paper disclosure, polypeptide (a) is linked to the N-end of described polypeptide connexon by peptide bond, and polypeptide (b) is linked to the C-end of described polypeptide connexon by peptide bond.
In a kind of embodiment of this paper disclosure, fused polypeptide also comprises signal peptide.
In a kind of embodiment of this paper disclosure, signal peptide is IgG signal peptide.
In a kind of embodiment of this paper disclosure, fibroblast growth factor is FGF-23 or FGF-23 variant (R179Q).
In a kind of embodiment of this paper disclosure, fibroblast growth factor is FGF-19 or fibroblast growth factor-21.
In a kind of embodiment of this paper disclosure, fused polypeptide comprises the amino acid sequence with the amino acid sequence of SEQIDNO:51 or SEQIDNO:53 with 95% or more homogeneity.
In a kind of embodiment of this paper disclosure, the amino acid sequence that fused polypeptide comprises SEQIDNO:51 or SEQIDNO:53.
In a kind of embodiment of this paper disclosure, fused polypeptide comprises FcLALA.
3. accompanying drawing summary
Fig. 1 illustrates the some different embodiments of the Klotho fused polypeptide of disclosure herein. The fused polypeptide illustrating comprises the one or more Klotho extracellular subdomain being effectively connected with fibroblast growth factor. The polypeptide that contains one or more Klotho extracellular subdomain comprises, for example, and the active fragment of the extracellular subdomain of Klotho (for example, the aa1 to 982 of people Klotho) or Klotho.
Fig. 2 illustrates some Klotho fused polypeptide of disclosure and amino acid sequence and the nucleotide sequence of component (for example Klotho extracellular domain, FGF) herein. The fusion that comprises sKlotho, FGF23 and FcLALA (having the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase) has been described in SEQIDNO.46,47,48 and 49. In SEQIDNO.50,51,52 and 53, the fusion that comprises FGF23 and FcLALA is described.
Fig. 3 A-3C has described the protein expression of sKlotho-FGF23 fusion. Fig. 3 A shows, by carrying out Western blot hybridization with anti-FGF23 antibody, sKlotho-FGF23 fusion detected in conditioned medium. Fig. 3 B shows, by SDS-PAGE and Coomassie blue stain, sKlotho-FGF23 fusion detected in conditioned medium. Fig. 3 C shown analyze by SDS-PAGE and Coomassie blue stain through highly purified sKlotho-FGF23-6xHis fusion.
Fig. 4 illustrates the result of Egr-1 luciferase assay, described mensuration compared in the time not there is not or exist heparin (20 μ g/ml) with contain Klotho fused polypeptide, only FGF23 polypeptide, only solvable Klotho (sKlotho) polypeptide and with the cell of the conditioned medium processing of the solvable Klotho polypeptide of FGF23 polypeptides in combination in the activation levels of Egr-1.
Fig. 5 A-5B has described the result of Egr-1 luciferase assay, and described mensuration has compared the activation levels with Egr-1 in the cell of purified Klotho fused polypeptide, FGF23 polypeptide or the processing of solvable Klotho polypeptide in the time not existing or have heparin. Fig. 5 A has shown relatively in the time not there is not or exist heparin (20 μ g/ml) result with the experiment of the activation levels of Egr-1 in the cell of the combined treatment of FGF23, sKlotho-His (10nM or 20nM) or FGF23 and sKlotho-His (10nM or 20nM) only. Fig. 5 B has shown the activity of Egr-1 luciferase reporter gene in the cell of processing by sKlotho-FGF23-His fusion (0nM, 0.6nM, 1.21nM, 2.41nM, 4.83nM, 9.65nM and 19.3nM).
Fig. 6 A-6B illustrates the effect of the processing of being undertaken by purified sKlotho fused polypeptide to C2C12 myocyte. Fig. 6 A has shown the measurement of the myotube diameter in the C2C12 myocyte who processes by IGF-1 (10nM), FGF2 (20ng/ml) or purified Klotho fused polypeptide (20nM) in the time not there is not or exist dexamethasone (100 μ M). Fig. 6 B has shown in the time not there is not or exist rapamycin (40nM) by the phosphorylation of signaling pathways protein in the C2C12 myocyte of IGF-1 (10nM), FGF2 (20ng/ml) or purified Klotho fused polypeptide (20nM).
Fig. 7 has shown by the activation of the EGR-1-luc reporter of sKlotho-FGF23 (R179Q)-FcLALA fusion.
Fig. 8 has shown by the activation of the EGR-1-luc reporter of FGF23 (R179Q)-FcLALA albumen.
Fig. 9 has shown the pharmacokinetics spectrum of FGF23 (R179Q) to FGF23 (R179Q)-FcLALAv2.
Figure 10 A and 10B have shown effect in the body that sKlotho-FGF23 fusion enhancing flesh is grown after the amyotrophia of induced by dexamethasone.
Figure 11. The figure illustrates by the activation of the EGR-1-luc reporter of FGF23 (R179Q)-FcLALA and Q156A, C206S, C244S and C206S/C244S mutant.
Figure 12 has shown protein quality and the dimerization of WT (wild type), Q156A, C206S, C244S and the C206S/C244S mutant of FGF23 (R179Q)-FcLaLa.
4. detailed Description Of The Invention
Disclosure relates to method, kit and the composition for preventing or treat the relevant patient's condition of age or metabolic disorder herein; And relate to described composition in therapy, as medicament or its purposes for the treatment of pathological disorders. The fused polypeptide of disclosure comprises Klotho albumen or its active fragment herein. In some embodiments, the fused polypeptide of disclosure comprises the Klotho albumen or its active fragment that are effectively connected with fibroblast growth factor polypeptide or its active fragment herein. In some embodiments, fusion also comprises the modified Fc fragment with stability in the ability of combination FcRn of minimizing and/or the serum of increase. In another embodiment, fused polypeptide comprise FGF (for example, FGF23) and there is the ability of combination FcRn of minimizing and/or the serum of increase in the modified Fc fragment of stability.
The fusion of disclosure or sKlotho comprise that in treatment and prevention muscle reduces disease herein, atrophoderma, flesh is subdued, encephalatrophy, atherosclerotic, artery sclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, immunologic incompetence (immunologicincompetence), hypertension, dull-witted, Huntington's disease, Alzheimer's disease, cataract, the macular degeneration that age is relevant, prostate cancer, apoplexy, the life expectancy shortening, lose memory, wrinkle, the multiple age related conditions of the hearing loss that impaired renal function is relevant with the age and comprise type ii diabetes, metabolic syndrome, in hyperglycaemia and fat metabolic disorder, be useful.
Disclosure is at least partly based on following discovery herein: for example, although there is physical constraint (, the large scale of Klotho and FGF polypeptide), Klotho-FGF fused polypeptide is highly effective in activation FGF acceptor. Consider that the fusion of these two kinds of protein may disturb allos dimerization, thereby fusion may be upset the activity of protein (for example binding domains of proteins), if or put albumen together with " cis (cis) " form may be by spatial orientation mistakenly, this discovery is unexpected.
Fused polypeptide described herein is favourable, because they allow to use than using separately Klotho or FGF or using together the active single therapeutic protein with enhancing as the polypeptide separating. Be used as Klotho and the FGF of single fused polypeptide, but not use two polypeptide that separate (, Klotho polypeptide and the FGF polypeptide separating), more effective on activation FGF acceptor.
Definition
" Klotho polypeptide ", " Klotho albumen " or " Klotho " comprise active fragment, derivative, analogies, variant and compound or its crossbred through chemical modification of wild type " Klotho " while use in this article. Klotho active fragment has the ability of being combined with FGF polypeptide. Conventionally, Klotho active peptides at least contains Klotho subdomain (for example, KL-D1 and KL-D2). Wild type Klotho has the amino acid sequence as found at occurring in nature. Be applicable to the Klotho polypeptide example of disclosure herein and comprise α-Klotho (SEQIDNO:2) and β-Klotho (SEQIDNO:4). The nucleotides of α-Klotho and β-Klotho and amino acid sequence are shown in respectively the accession number No.NM_004795 in GenBank database; NP_004786 and NM_175737; NP__783864. Klotho polypeptide comprises U.S. Patent No. 6,579, those that describe in 850, and the content of this patent is incorporated to herein with its entirety by reference. Klotho polypeptide also comprises from those of other species outside people, comprises from α-Klotho of mouse (NP_038851), rat (NP_112626), rabbit (NP_001075692) with from β-Klotho of mouse (NP_112457). The species of the predicted α of having-Klotho comprise chimpanzee (XP_522655), macaque (XP_001101127), horse (XP_001495662), cow (XP_001252500), platypus (XP_001510981) and chicken (XP_417105). The species of the predicted β of having-Klotho comprise chimpanzee (XP_526550), macaque (XP_001091413), horse (XP_001495248), dog (XP_536257), rat (XP_001078178), platypus (XP_001512722) and chicken (XP_423224). Klotho polypeptide has the essentially identical amino acid sequence of amino acid sequence with SEQIDNO:2 or SEQIDNO:4,, there is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homogeneity with the amino acid sequence of SEQIDNO:2 or SEQIDNO:4 or its active fragment.
When being used in this article, " fused polypeptide " or " fusion " comprise representing and non-natural is present in two or more different polypeptide in phase homopolypeptide or the polypeptide of its active fragment. In some embodiments, be effectively connected to together, for example, chemistry connects or meets frame fusion by peptide bond the polypeptid covalence that two or more are different. While use in this article, " Klotho fused polypeptide " is the fused polypeptide comprising from the amino acid sequence of Klotho polypeptide or its active fragment. As limiting examples, fused polypeptide can comprise: Klotho (for example, sKlotho), FGF (for example, and (optionally) modified Fc fragment (for example, thering is the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase) FG23). The example of the fused polypeptide of this type is shown in SEQIDNO.46 to 49. In another embodiment, fusion comprises FGF (for example, FGF23) and modified Fc (for example, FcLALA). The fusion that comprises FGF23 and FcLALA is described in SEQIDNO.50,51,52 and 53. FcLALA is the Fc fragment with LALA sudden change (L234A, L235A), and its initiation has the ADCC of the efficiency of reduction, and the combination of weak ground and activation people complement. The 2007Nature449:101-104 such as Hessell.
" fibroblast growth factor " and " FGF " is used interchangeably in this article, and will be illustrated in animal, comprises regulating cell propagation in people experimenter, migration, differentiation, homeostasis, tissue repair and the polypeptide of replying to damage. FGF has and is combined into bfgf receptor and regulates and controls its active ability, comprise the autophosphorylation of FGFR, the phosphorylation of FRS2 (FGF receptor substrate 2) and ERK1/2 (protein kinases 1/2 of extracellular signal regulation and control), with activation Egr-1 (early growth replys-1). term " FGF " comprises the active fragment of wild type " FGF ", derivative, analogies, the compound of variant and chemical modification or its crossbred, for example known in the art, with as U.S. Patent No. 7, 223, 563 and United States Patent (USP) U.S.PatentNo.7, 259, in 248, describe, its content by reference entirety is incorporated to herein. wild type FGF has the amino acid sequence of being found as occurring in nature. be applicable to the fibroblast growth factor example of disclosure herein and comprise FGF-19 (FGF19, SEQIDNO:31), fibroblast growth factor-21 (FGF21, and FGF-23 (FGF23 SEQIDNO:33), SEQIDNO:35). FGF polypeptide comprises from those of other species outside people, comprises mouse FGF. conventionally, FGF polypeptide has and the essentially identical amino acid sequence of amino acid sequence of SEQIDNO:31, SEQIDNO:33 or SEQIDNO:35, , there is the amino acid sequence with the amino acid sequence of SEQIDNO:31, SEQIDNO:33 or SEQIDNO:35 or its active fragment with at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more or 100% homogeneity. at the aa1002-1228 of SEQIDNO:47, the aa1002-1228 of SEQIDNO:49, in the aa1-251 of SEQIDNO:51 and the aa1-251 of SEQIDNO:53, and have in the sequence of at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more or 100% homogeneity the FGF other limiting examples of (particularly FGF23) is provided with these sequences. the nucleotides of these sequences of coding is provided in SEQIDNO:46,48,50 and 52.
Term " FGF " comprises the active fragment of full-length polypeptide. Can be known in the art in conjunction with the active FGF fragment of its corresponding FGF acceptor, and also be considered for disclosure herein. Based on sequence disclosed herein, it will be appreciated by those skilled in the art that, can use standard recombinant technique, (1989, MolecularCloning:ALaboratoryManual, the ColdSpringHarborLaboratoryPress such as such as Sambrook, and Ausubel etc. (1997 NewYork), CurrentProtocolsinMolecularBiology, Green&Wiley, NewYork) in the overlapping fragments of the generation FGF that describes. Based on disclosure shown in this article, it will be understood by those skilled in the art that and can, by the BA of method test FGF fragment well known in the art and described herein, comprise the combination with FGF acceptor. Similarly, the transfection of available FGF fragment has the cell culture model of necessary FGF signal transduction mechanism (, FGF acceptor), and tests subsequently FGF signal and transmit the variation with respect to wild type FGF.
Based on the homology of FGF core homology domain (about 120 amino acid longs), FGF is grouped into seven subfamilies, described domain flank is N-and the C-end sequence (Goetz etc. at equal alterable height aspect length and primary sequence (particularly between different FGF subfamilies), MolecularandCellularBiology, 2007, the 27th volume, 3417-3428). Usually FGF active peptides at least contains FGF core homology domain. In some embodiments, except FGF core homology domain, FGF active peptides also can contain can be given in conjunction with the extra specific flanking sequence of FGF acceptor. FGF19, FGF21 and FGF23 are grouped the subfamily into FGF19, because for other FGF, the nucleus of these parts is shared sequence homogeneity highly, and (FGF19 is to FGF21:38% homogeneity; FGF19 is to FGF23:36% homogeneity). The FGF19 subfamily member in a similar fashion signal transmission molecule of Endocrine system plays a role, and regulation and control uncommon different physiology course (for example, FGF19: energy and bile acid homeostasis for classical FGF; FGF21: glucose and lipid metabolism; And FGF23: phosphate and vitamin D homeostasis).
" fibroblast growth factor acceptor " and " FGFR " refers to arbitrary FGFR1-4 known in the art or its splice variant (for example, FGFR1c) in this article. Be applicable to the example of the fibroblast growth factor acceptor of disclosure herein and comprise that fibroblast growth factor acceptor-19 (for example, FGFR4-β Klotho), fibroblast growth factor acceptor-21 (for example, FGFR1c-α Klotho) and fibroblast growth factor acceptor-23 (for example, FGFR1c-α Klotho, FGFR3-α Klotho, FGFR4-α Klotho).
" extracellular domain " refers to the fragment (for example, not comprising in cell or cross-film region) outside cell that is present in of transmembrane protein while use in this article. " extracellular domain of Klotho albumen ", " solvable Klotho " or " sKLotho " (for example SEQIDNO:7; SEQIDNO:3) refer to the extracellular domain of Klotho polypeptide, it can be combined into fibroblast growth factor, and/or by being combined into fibroblast growth factor, fibroblast growth factor can be combined with fibroblast growth factor acceptor. Klotho extracellular domain is corresponding to the amino acid residue 28-982 of total length α Klotho sequence (SEQIDNO:2) and the amino acid residue 52-997 of total length β Klotho sequence (SEQIDNO:4).
" the extracellular subdomain of Klotho albumen " and " the extracellular subdomain of Klotho albumen " is used interchangeably in this article, they refer to the following region in the extracellular domain of Klotho polypeptide, described region can be combined into fibroblast growth factor, and/or by being combined into fibroblast growth factor, fibroblast growth factor can be combined with fibroblast growth factor acceptor. In numerous embodiments, fusion comprises: the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen; The polypeptide that comprises fibroblast growth factor; Optionally, there is the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. Klotho extracellular domain has the subdomain of two homologies of repetition, i.e. KL-D1 (SEQIDNO:5) and KL-D2 (SEQIDNO:6). KL-D1 and KL-D2 are respectively corresponding to amino acid residue 58-506 and the 517-953 of total length α Klotho polypeptide (SEQIDNO:2), and respectively corresponding to amino acid residue 77-508 and the 571-967 of total length β Klotho polypeptide (SEQIDNO:4), and they are applicable to disclosure herein. Conventionally the polypeptide that, contains at least one Klotho subdomain is Klotho active peptides. Can be the α Klotho or the β KlothoKL-D1 domain that have respectively with the essentially identical amino acid sequence of amino acid sequence of SEQIDNO:5 or SEQIDNO:37 for the Klotho extracellular subdomain of the polypeptide of disclosure herein. In addition, KlothoKL-D1 domain can have the amino acid sequence with the amino acid sequence of SEQIDNO:5 or SEQIDNO:37 with at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homogeneity. Klotho extracellular subdomain also can be respectively the essentially identical α of amino acid sequence or the β Klotho polypeptide KL-D2 domain with SEQIDNO:6 or SEQIDNO:38. In other embodiments, KL-D2 domain has the amino acid sequence with the amino acid sequence of SEQIDNO:6 or SEQIDNO:38 with at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homogeneity. In some embodiments, at least two extracellular subdomains (for example, KL-D1 and KL-D2 that fusion comprises Klotho albumen; KL-D1 and KL-D1 that series connection repeats; KL-D2 and KL-D2 that series connection repeats, etc.).
" modified Fc fragment " represents the antibody Fc fragment that comprises modified sequence while use in this article. Fc fragment is the part of the antibody that comprises CH2, CH3 and part hinge area. Modified Fc fragment can come from, for example IgG1, IgG2, IgG3 or IgG4. FcLALA is the modified Fc fragment with LALA sudden change (L234A, L235A), and its initiation has the ADCC of the efficiency of reduction, and the combination of weak ground and activation people complement. The 2007Nature449:101-104 such as Hessell. For example, in U.S. Patent No. 7,217, the extra modification to Fc fragment is described in 798. For example,, in multiple modified Fc fragment: (a) amino acid residue 250 is glutamic acid, and amino acid residue 428 is phenylalanines; Or (b) amino acid residue 250 is glutamine, and amino acid residue 428 is phenylalanines; Or (c) amino acid residue 250 is glutamine, and amino acid residue 428 is leucines. In some embodiments, that glutamic acid or glutamine and amino acid residue 428 are leucine or phenylalanine by amino acid residue 250, amino acid residue 250 and 428 is different from the residue being present in not modified Fc-fusion, and wherein amino acid residue is numbered by EU numbering system, as U.S. Patent No. 7, in 217,798, describe. In some embodiments, modified Fc-fusion compatibility ratio to FcRn under pH6.0 is higher under pH8.0. Preferably, modified Fc fragment has the compatibility to FcRn of minimizing and/or the serum half life of increase. The nonrestrictive example of modified Fc fragment comprises aa (amino acid) 1234-1459 of SEQIDNO:47; The aa1234 to 1450 of SEQIDNO:49; The aa257 to 482 of SEQIDNO:51; Aa257 to 473 with SEQIDNO:53; And there is the sequence of at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more or 100% homogeneity with these sequences. The nucleotides of these sequences of encoding is provided in SEQIDNO:46,48,50 and 52.
" signal peptide " is transported to the peptide chain (3-60 amino acid long) of endoplasmic reticulum after representing to instruct protein translation while use in this article, and can be cut. Be applicable to the signal peptide example of disclosure herein and comprise Klotho signal peptide (SEQIDNO:19) and IgG signal peptide (SEQIDNO:20). Attention: after being secreted and cut by production clone, signal peptide (for example, corresponding to the peptide of SEQIDNO:19 and SEQIDNO:20) is cut. Therefore,, after by the secretion of production clone and cleavable signal peptide, the peptide of SEQIDNO:19 will generate the peptide of SEQIDNO:41.
When using in this article, " connexon ", by representing, two or more polypeptide or nucleic acid covalency are tied to functional group that they are interlinked (for example, chemistry or polypeptide). While use in this article, " peptide connexon " for example represents, for two protein are coupled to one or more amino acid (, the extracellular domain of coupling Klotho and FGF-23) together. Being applicable to the peptide connexon of disclosure herein includes but not limited to: the polypeptide with the amino acid sequence shown in SEQIDNO:8, SEQIDNO:9, SEQIDNO:10, SEQIDNO:11, SEQIDNO:12, SEQIDNO:13, SEQIDNO:14, SEQIDNO:15, SEQIDNO:16, SEQIDNO:17 and SEQIDNO:18. Polypeptide connexon can comprise at least 1 of any these amino acid sequences to and about 30 repetitions at the most.
When being used in this article, " effectively connection " by representing the connection of two or more biomolecule, the biological function associated with biomolecule, activity and/or structure are at least retained. While mentioning polypeptide, this term represents that the connection of two or more polypeptide causes having produced fused polypeptide, and described fused polypeptide has at least retained every peptide species component some activity of individuality separately. Two or more polypeptide can directly connect or connect via connexon. While mentioning nucleic acid, this term represents Article 1 polynucleotides to be placed on Article 2 polynucleotides adjacent place, for example, when suitable molecule (Activator protein) is in the time that Article 2 polynucleotides are combined, Article 2 polynucleotides instruct transcribing of Article 1 polynucleotides.
When using in this article, " specific binding " will refer to because first molecule is taked to contribute in the ability that forms the special structure of noncovalent interaction between himself and other target molecules, the ability that the target molecule in the many dissimilar molecule that first molecule can be exposed to it is combined. First molecule is combined with target, forms stable complex, and identification between the first molecule and any other non-specific molecules, contacts or complex forms substantially still less.
" polypeptide variants " or " protein variant " refers to following polypeptide while use in this article, wherein replaced by different aminoacids than the one or more amino acid of canonical sequence. Well known in the art, some amino acid can be had by other amino acid substitution of the character of broadly similar, and do not change the active essence (conservative replacement) of polypeptide, as mentioned below. The polypeptide that wherein one or more amino acid are added, lack or replace with different aminoacids also contained in these terms, for example, and protein isoform. Being applicable to the example of the variant of the FGF-23 of disclosure is herein FGF-23 variant (R179Q).
When using in this article, " pharmaceutical composition " will represent to contain the composition that can be applied the compound with treatment in individuality or prevent disease or illness (for example, the fused polypeptide of this paper disclosure).
" individuality " or " experimenter " will refer to mammal while use in this article, include but not limited to people or inhuman mammal, for example ox, horse, canid, sheep or cats.
When " treatment " used in this article by representing to reduce, contain, weaken, alleviate, development or the process of prevention or stable disease. In the context of this paper disclosure, herein the polypeptide of disclosure use can be used for that treatment comprises that muscle reduces that disease, atrophoderma, flesh are subdued, the relevant patient's condition of age of the life expectancy of macular degeneration that encephalatrophy, atherosclerotic, artery sclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, immunologic incompetence, hypertension, dementia, Huntington's disease, Alzheimer's disease, cataract, age are relevant, prostate cancer, apoplexy, shortening, memory loss, wrinkle, hearing loss that impaired renal function is relevant with the age; And comprise type ii diabetes, metabolic syndrome, hyperglycaemia and fat metabolic disorder.
When " prevention " used in this article, in experimenter, reduce the generation of illness or reduce the risk that obtains illness or its associated symptom being illustrated in. In the context of this paper disclosure, herein the polypeptide of disclosure use can be used for that prevention comprises that muscle reduces that disease, atrophoderma, flesh are subdued, the life expectancy of macular degeneration that encephalatrophy, atherosclerotic, artery sclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, immunologic incompetence, hypertension, dementia, Huntington's disease, Alzheimer's disease, cataract, age are relevant, prostate cancer, apoplexy, shortening, memory loss, wrinkle, the impaired renal function hearing loss age relevant patient's condition relevant with the age; And comprise type ii diabetes, metabolic syndrome, hyperglycaemia and fat metabolic disorder. Prevention can be completely, for example, does not have the relevant patient's condition of age or metabolic disorder completely. Prevention also can be part, and the possibility that the patient's condition that in experimenter, the age is relevant or metabolic disorder occur still less may be occurred than not accepting the experimenter of disclosure herein.
When being used in this article, " disease " will represent any patient's condition or the illness of normal function of infringement or interference cell, tissue or organ.
When using in this article, " age related conditions " will represent its incidence of disease in crowd or any disease or the illness relevant to age process of the order of severity in individuality. In one embodiment, the relevant patient's condition of age is following disease or illness, more than 100, in the colony of 000 individual selection, it is at least higher 1.5 times than the incidence of disease in the human individual of age between 30-40 year that described disease or illness are greater than the incidence of disease in the human individual of 60 years old at the age. The life expectancy of the relevant patient's condition of the age relevant to this paper disclosure includes but not limited to that muscle reduces that disease, atrophoderma, flesh are subdued, encephalatrophy, atherosclerotic, artery sclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, immunologic incompetence, hypertension, dementia, Huntington's disease, Alzheimer's disease, cataract, age are relevant macular degeneration, prostate cancer, apoplexy, shortening, memory loss, wrinkle, the impaired renal function hearing loss relevant with the age.
When being used in this article, " metabolic disorder " will represent any disease or the illness of the normal function of infringement or interference cell, tissue or organ by affecting the accumulation in cell, tissue, organ or individuality of energy production in cell or toxin. The metabolic disorder relevant to this paper disclosure includes but not limited to type ii diabetes, metabolic syndrome, hyperglycaemia and obesity.
" effective dose " or " effective dose " is to be enough to realize amount useful or clinical effectiveness that want. In the context of this paper disclosure, it is effectively to produce the pharmacology, treatment or the Klotho fused polypeptide of prevention result or the amount of sKlotho that are intended to. Treatment effective dose causes prevention or improves one or more symptoms (patient's condition or metabolic disorder that for example, the age is relevant) of illness or illness. Treatment effective dose is by the order of severity, the insecticide-applying way etc. that depend on experimenter and the subject disease patient's condition, experimenter's weight and age, the disease patient's condition and different, and it can easily be determined by those of ordinary skill in the art.
" Klotho nucleic acid molecules " is the gene of encoded K lotho albumen while use in this article. The example of people Klotho gene is provided in GenBank accession number No.NM_004795 (SEQIDNO:1). At the aa1-982 of SEQIDNO:47 and the aa1-982 of SEQIDNO:49; And there is with these sequences the other nonrestrictive example that Klotho is provided in the sequence of at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more or 100% homogeneity.
" fragment " refers to the part of polypeptide or nucleic acid molecules while use in this article. Preferably, this part contains with reference at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more of the total length of nucleic acid molecules or polypeptide. Fragment can contain 10,20,30,40,50,60,70,80,90 or 100,200,300,400,500,600,700,800,900,1000 or 3000 nucleotides or amino acid at the most.
Term " basic identical " refer to show with reference to amino acid sequence (for example, arbitrary amino acid sequence described herein) or polypeptide or the nucleic acid molecules of nucleotide sequence (for example, arbitrary nucleotide sequence described herein) at least 50% homogeneity. Preferably, this type of sequence has at least 60%, 70%, 75%, 80% or 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homogeneity in amino acid levels or nucleic acid level with for sequence relatively.
Disclosure relates to method, kit and the composition for preventing or treat the relevant patient's condition of age or metabolic disorder herein; And relate to described composition in therapy, as medicament or its purposes for the treatment to pathological disorders. In some embodiments, this paper disclosure provides the fused polypeptide of at least one extracellular subdomain with Klotho albumen. In some embodiments, fused polypeptide also comprises fibroblast growth factor or its active fragment. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. In other embodiments, fusion comprises the FGF (for example FGF19, FGF21, FGF23 or FGF23 variant R179Q) for example, merging with modified Fc (, FcLALA). FcLALA is the Fc fragment with LALA sudden change (L234A, L235A), and its initiation has the ADCC of the efficiency of reduction, and the combination of weak ground and activation people complement. Klotho extracellular domain can come from α or β Klotho isoform. In addition, although the FGF component of Klotho fused polypeptide is mainly described with reference to FGF-19, fibroblast growth factor-21 and FGF-23, consider that any in 23 kinds of known FGF or its active fragment can be used in practice disclosure herein.
The extracellular domain of Klotho albumen can comprise one or two in KL-D1 and the KL-D2 domain of Klotho albumen. In some embodiments, Klotho fused polypeptide has at least two extracellular subdomains of Klotho albumen. For example, at least two extracellular subdomains can be at least two KL-D1 domains that series connection repeats, at least two KL-D2 domains that series connection repeats, or at least one KL-D1 domain and at least one KL-D2 domain.
The extracellular subdomain of Klotho albumen can effectively be connected mutually with mode with multiple orientation with fibroblast growth factor (or its active fragment). For example, the extracellular subdomain of Klotho albumen can effectively be connected to the N-end of fibroblast growth factor, or alternatively, fibroblast growth factor can effectively be connected to the N-end of at least one extracellular subdomain of Klotho albumen.
The fused polypeptide of disclosure can comprise one or two in KLotho extracellular domain (being KL-D1 (SEQIDNO:5) and KL-D2 (SEQIDNO:6)) herein. KL-D1 and KL-D2 correspond respectively to amino acid residue 58-506 and the 517-953 of total length α Klotho polypeptide (SEQIDNO:2), and amino acid residue 77-508 and the 571-967 of total length β Klotho polypeptide (SEQIDNO:4), and be applicable to disclosure herein. Klotho fused polypeptide can have the KL-D1 domain (described domain has the essentially identical amino acid sequence of amino acid sequence with SEQIDNO:5) of α Klotho polypeptide or the KL-D1 domain (described domain has the essentially identical amino acid sequence of amino acid sequence with SEQIDNO:37) of β Klotho polypeptide. Particularly, Klotho fused polypeptide can have the amino acid sequence with SEQIDNO:5 or SEQIDNO:37 with at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homogeneity. Klotho fused polypeptide can have the KL-D2 domain (described domain has the essentially identical amino acid sequence of amino acid sequence with SEQIDNO:6) of α Klotho polypeptide or the KL-D2 domain (described domain has the essentially identical amino acid sequence of amino acid sequence with SEQIDNO:38) of β Klotho polypeptide. Particularly, Klotho fused polypeptide can have the amino acid sequence with SEQIDNO:6 or SEQIDNO:38 respectively with at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homogeneity.
In some embodiments, the Klotho fused polypeptide of disclosure is soluble herein, and can be in conjunction with FGF acceptor.
Herein the Klotho fused polypeptide of disclosure can contain polypeptide connexon, and its modified Fc fragment of polypeptide and fibroblast growth factor and (optional) by least one extracellular subdomain with Klotho albumen links up. Suitable connexon is well known in the art, and contains some Gly and some Ser residues, for example (Gly4Ser)3(SEQIDNO:11)、Gly4Ser polypeptide (SEQIDNO:12), Gly (SEQIDNO:13), GlyGly (SEQIDNO:14), GlySer (SEQIDNO:15), Gly2Ser (SEQIDNO:16), Ala (SEQIDNO:17) and AlaAla (SEQIDNO:18). In some embodiments, connexon by have at least 2 and at the most 30 repetitions, by the amino acid sequence shown in arbitrary in SEQIDNO:12, SEQIDNO:13, SEQIDNO:14, SEQIDNO:15, SEQIDNO:16, SEQIDNO:17 or SEQIDNO:18.
In the time there is polypeptide connexon in the Klotho of this paper disclosure fused polypeptide, the polypeptide with at least one extracellular subdomain of Klotho albumen can be linked to by peptide bond the N-end of connexon polypeptide, and FGF is linked to the C-end of polypeptide connexon by peptide bond. Alternatively, FGF can be linked to by peptide bond the N-end of connexon polypeptide, and the polypeptide with at least one extracellular subdomain of Klotho is linked to the C-end of polypeptide connexon by peptide bond. Also can use chemical connexon to connect two polypeptide.
The Klotho fused polypeptide of disclosure can comprise signal peptide herein. The example of signal peptide using with Klotho fused polypeptide includes but not limited to Klotho signal peptide (SEQIDNO:8) and IgG signal peptide (SEQIDNO:9).
In some embodiments, herein disclosure provides for example, for example, fusion between FGF (, FGF19, FGF21, FGF23 or FGF23 variant R179Q) and modified Fc (, FcLALA). Fusion can also optionally comprise the connexon between FGF and Fc part. Fusion can also optionally comprise signal peptide. In numerous embodiments, the host cell that disclosure contains the nucleic acid of these fused polypeptide of encoding, the carrier that comprises these nucleic acid and contains these nucleic acid herein.
4.1Klotho and fibroblast growth factor polypeptide
The expection herein Klotho fused polypeptide of disclosure shows the BA suitable with occurring in nature FGF, for example, with the combination of FGF acceptor and induce the phosphorylation of FGF acceptor, FRS2 (FGF receptor substrate 2) and ERK1/2 (protein kinases 1/2 of extracellular signal regulation and control), and activation Egr-1 (early growth replys-1) gene. FGF is and the peptide growth factor of the secretion of FGF receptors bind. The amino acid sequence of FGF and nucleotide sequence are that those skilled in the art are easy to obtain. For example, the example of the nucleotide sequence of FGF19, FGF21 and FGF23 can find in GenBank database with accession number NM_005117, NM_019113 and NM_020638 respectively, and be respectively SEQIDNO:30 in this article, 32 and 34. The example of the amino acid sequence of FGF19, FGF21 and FGF23 can find in GenBank database with accession number NP_005108, NP_061986 and NP_065689 respectively, and be respectively SEQIDNO:31 in this article, 35 and 35. In addition, FGF can comprise one or more variations, the expression of described variation auxiliary protein, for example, FGF23 (R179Q) variant (SEQIDNO:36).
Klotho albumen is that the single-pass of 130kDa is crossed I type transmembrane protein, and it has extracellular domain and short cytoplasm domain. The amino acid sequence of Klotho and nucleotide sequence are that those skilled in the art easily obtain. For example, the example of the nucleotide sequence of α-Klotho and β-Klotho can find in GenBank database with accession number NM_004795 and NM_175737 respectively, and is respectively in this article SEQIDNO:7 and 8. The example of the amino acid sequence of α-Klotho and β-Klotho can find in GenBank database with accession number NP_004786 and NP_783864 respectively, and is respectively in this article SEQIDNO:2 and 4.
The Klotho fused polypeptide of disclosure can be combined with fibroblast growth factor acceptor herein, and has the α-Klotho or the β-Klotho extracellular domain that are effectively connected with FGF-19 (SEQIDNO:31), fibroblast growth factor-21 (SEQIDNO:33), FGF-23 (SEQIDNO:35) or its variant (it comprises that FGF-23 variant (R179Q) (SEQIDNO:36)).
Particularly, the Klotho fused polypeptide of disclosure can comprise and FGF-23 (SEQIDNO:35) or (SEQIDNO:36) α-Klotho (SEQIDNO:2) of effective coupling of FGF-23 variant (R179Q) herein. In addition, the Klotho fused polypeptide of disclosure can have and the effectively β-Klotho (SEQIDNO:4) of coupling of FGF-19 (SEQIDNO:31) herein. The Klotho fused polypeptide of disclosure can comprise and the effectively β-Klotho (SEQIDNO:4) of coupling of fibroblast growth factor-21 (SEQIDNO:33) herein.
Disclosure comprises multiple Klotho and the autoploid of FGF gene and the protein of these gene codes herein. While mentioning gene " autoploid " refer to gene at least partly on essentially identical nucleotide sequence, or its complementary strand or part, prerequisite is nucleotide sequence coded following protein, and described protein has essentially identical activity/function with the protein of coded by said gene that is described nucleotide sequence autoploid. The autoploid of gene described herein can for example, be identified by the percentage homogeneity between the sequence (, the nucleotide sequence of the gene of encoded K lotho and FGF or their complementary strand) of the albumen of the amino acid of possible autoploid or nucleotide sequence and gene or their codings. For example can, by visual inspection or by using known in the art or multiple computer program described herein, measure percentage homogeneity. Usually, use sequence analysis software (for example GeneticsComputerGroup, UniversityofWisconsinBiotechnologyCenter, 1710UniversityAvenue, Madison, the sequence analysis software bag of Wis.53705, BLAST, BESTFIT, GAP or PILEUP/PRETTYBOX program) measurement sequence homogeneity. This type of software, by multiple replacement, disappearance and/or other modification are specified to homology degree, mates same or analogous sequence. Usually conserved amino acid is replaced the replacement comprising in following group:
Glycine and alanine;
Valine, isoleucine and leucine;
Aspartic acid, glutamic acid, asparagine and glutamine;
Serine and threonine;
Lysine and arginine; And
Phenylalanine and tyrosine.
Therefore, be that alanine will be that conserved amino acid is replaced by glycine mutation, become glycine to be also alanine mutation; It will be that conserved amino acid is replaced that valine is sported to isoleucine or leucine, replace isoleucine also with valine or leucine, replace leucine also with valine or isoleucine, etc. Disclosure provides and has had at least one conserved amino acid variant that replace, all amino acid sequences disclosed herein herein.
Measuring in the exemplary instrumentation of homogeneity degree, can use blast program, use e-3And e-100Between probability score, the sequence that this instruction is closely related.
In one embodiment, this paper disclosure provides the fused polypeptide of SEQIDNO:19.
In another embodiment, this paper disclosure provides the fused polypeptide of SEQIDNO:20.
In one embodiment, this paper disclosure provides the fused polypeptide of SEQIDNO:40.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:41 herein, or comprises its variant that at least one conserved amino acid is replaced.
In one embodiment, this paper disclosure provides the fused polypeptide of SEQIDNO:46.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:47 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, this paper disclosure provides the fused polypeptide of SEQIDNO:48.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:49 herein, or comprises its variant that at least one conserved amino acid is replaced.
In one embodiment, this paper disclosure provides the fused polypeptide of SEQIDNO:50.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:51 herein, or comprises its variant that at least one conserved amino acid is replaced.
In one embodiment, this paper disclosure provides the fused polypeptide of SEQIDNO:52.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:53 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:54 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:55 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:56 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:57 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:58 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:59 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:60 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:61 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:62 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:63 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:64 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:65 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:66 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:67 herein, or comprises its variant that at least one conserved amino acid is replaced.
In another embodiment, disclosure provides the fused polypeptide of SEQIDNO:68 herein, or comprises its variant that at least one conserved amino acid is replaced.
While use in this article, term " homology " and " homology " be not limited to refer to have common hereditary ancestors' protein in theory, but also comprise and may heredity is uncorrelated having evolved as carrying out similar function and/or having the protein of similar structure. Also contain following proteins with the function homology of multiple proteins described herein, described protein has the activity of the respective egg white matter that is its autoploid. For the protein with function homology, do not need them in its amino acid sequence, to there is significant homogeneity, and contrary, the protein with function homology is to come thus defined by having similar or identical activity. For example, about Klotho molecule, polypeptide should have in conjunction with FGF polypeptide and the functional character that FGF can be combined with FGFR. About FGF molecule, polypeptide should have in conjunction with FGFR and cause FGFR to activate the functional character of (for example phosphorylation). Mensuration for assessment of the combination of FGF and FGF acceptor and/or the activation of FGF signaling pathways is known in the art, and is described in herein and (sees embodiment 2). Also be known in the art for assessment of the mensuration of Klotho activity, and be described in herein the combination of FGF polypeptide (for example, with). But the protein with structural homology is defined as similar three grades of (or level Four) structures must need to encode their amino acid homogeneity or the nucleic acid homogeneity of gene. In some cases, structure autoploid can comprise only at the avtive spot of protein or the protein of binding site holding structure homology.
Except 26S Proteasome Structure and Function homology, disclosure also contains the protein with multiple Klotho as herein described and FGF amino acid sequence with amino acid homogeneity herein. For measuring the percentage homogeneity/homology of two amino acid sequences, just optimum relatively object (is for example compared to sequence, can in the amino acid sequence of a protein, introduce room, for comparing with the optimum of the amino acid sequence of another protein). Then the amino acid residue on more corresponding amino acid position. In the time that the position in a sequence is occupied with the identical amino acid residue of relevant position in another sequence, two molecules are identical in this position so. Percentage homogeneity between two sequences is the function (, % homogeneity=same position #/total slot #, is multiplied by 100) of the number of the shared same position of sequence.
The amino acid sequence of the molecule of disclosure described herein has the amino acid sequence with amino acid sequence described herein with at least about 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or more homogeneity or homology.
The nucleotide sequence of the molecule of disclosure described herein has with nucleotide sequence hybridization described herein or with nucleotide sequence described herein and has the nucleotide sequence of at least about 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or more homogeneity or homology.
Being suitable for the nucleic acid molecules of the fused polypeptide of disclosure herein can have under stringent condition respectively and Klotho or the FGF nucleotide sequence of the complementary sequence hybridization of the nucleic acid molecules of encoded K lotho or FGF. While use in this article, term " hybridize under stringent condition " is intended to the condition for hybridizing and wash described, under described condition, mutually between nucleotide sequence general maintenance of at least about 70%, 80%, 85%, 90% or more homology hybridize mutually. This type of stringent condition is well known by persons skilled in the art, and can be at CurrentProtocolsinMolecularBiology such as Ausubel, WileyInterscience, and NewYork (2001), finds in 6.3.1-6.3.6. Concrete, the nonrestrictive example of stringent hybridization condition be in 6X sodium chloride/sodium citrate (SSC) in about 45 DEG C of hybridization, then in 0.2XSSC, 0.1%SDS in 50-65 DEG C of washing one or many.
The Klotho-FGF fused polypeptide of 4.2 this paper disclosures
In some embodiments of this paper disclosure, Klotho fused polypeptide has following polypeptide chain, and described polypeptide chain has the first peptide sequence of Klotho polypeptide or its active fragment and the second peptide sequence of coding FGF or its active fragment. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
This paper disclosure comprises the fused polypeptide with at least about more than 95% homology of the amino acid sequence shown in SEQIDNO:19-28. The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:19, described fused polypeptide has N-end and is connected to the Klotho extracellular domain of FGF23 (R179Q) variant (SEQIDNO:36). The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:20, described fused polypeptide have N-end be connected to lack signal peptide, N-end is connected to the IgG signal peptide of the Klotho extracellular domain of FGF23 (R179Q) variant. The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:21, described fused polypeptide has N-end and is connected to the KL-D1 extracellular subdomain of FGF23 (R179Q) variant. The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:22, described fused polypeptide has N-end and is connected to the KL-D2 extracellular subdomain of FGF23 (R179Q) variant. The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:23, described fused polypeptide has N-end and is connected to two KL-D1 extracellular subdomains of FGF23 (R179Q) variant. The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:24, described fused polypeptide has N-end and is connected to two KL-D2 extracellular subdomains of FGF23 (R179Q) variant. The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:25, described fused polypeptide has FGF23 (R179Q) variant that N-end is connected to Klotho extracellular domain. The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:26, described fused polypeptide has FGF23 (R179Q) variant that N-end is connected to KL-D1 extracellular subdomain. The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:27, described fused polypeptide has FGF23 (R179Q) variant that N-end is connected to KL-D2 extracellular subdomain. The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:28, described fused polypeptide has N-end and is connected to FGF23 (R179Q) variant of two KL-D1 extracellular subdomains. The following Klotho fused polypeptide of amino acid sequence encode of SEQIDNO:29, described fused polypeptide has N-end and is connected to FGF23 (R179Q) variant of two KL-D2 extracellular subdomains. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
The Klotho fused polypeptide of disclosure can comprise the amino acid sequence with the amino acid sequence shown in SEQIDNO:7 with at least about 95% homogeneity herein. The amino acid sequence encode of SEQIDNO:7 lacks the Klotho extracellular domain of signal peptide. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase.
This paper describes theme fusion and can prepare them by methods known in the art. For example, can be as U.S. Patent No. 6,194, described in 177, build the fused polypeptide of disclosure herein. In U.S. Patent No. 6,579, the purposes of Klotho polypeptide is described in 850. In U.S. Patent No. 7,223, the purposes of FGF nucleic acid molecules is described in 563.
In some embodiments, by the nucleic acid molecules of PCR clones coding Klotho, and it is connected in in-frame mode with the nucleic acid molecules of coding FGF. In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. The nucleic acid of coding fused polypeptide is effectively connected to promoter, to allow expression. Subsequently the nucleic acid molecules transfection of coding fused polypeptide is entered to host cell, for expressing. Can verify by order-checking the sequence of final construct.
When preparation is herein when the fusion of disclosure, the nucleic acid molecules of the extracellular subdomain of encoded K lotho is merged to the nucleic acid of the nucleic acid molecules of the FGF that encodes and the modified Fc fragment of (optional) coding in in-frame mode. The expression of the nucleic acid molecules obtaining causes the extracellular subdomain of Klotho to merge with respect to FGF polypeptide N-end. The fusion that wherein the extracellular subdomain of Klotho merges with respect to FGF peptide C-end is also possible. The method of preparing fusion is well known in the art.
The fused polypeptide of disclosure has at least two covalently bound polypeptide herein, wherein polypeptide from a protein sequence or domain (for example, Klotho), another polypeptide for example, from another protein sequence or domain (, FGF). In some embodiments, fusion also comprises the modified Fc fragment with the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. In another embodiment, herein disclosure comprises and the FGF of modified Fc segment composition. Can be by well known to a person skilled in the art that method links up the Klotho of the fused polypeptide of this paper disclosure and/or FGF and/or (optional) modified Fc fragment. These methods comprise chemical mode and recombination form.
Use the routine techniques in genetic recombination field, can obtain the nucleic acid in coding structure territory, described domain waits to be impregnated in the fused polypeptide of disclosure herein. The base text of the open general approach for this paper disclosure comprises Sambrook and Russell, MolecularCloning, ALaboratoryManual (the 3rd edition .2001); Kriegler, GeneTransferandExpression:ALaboratoryManual (1990); And CurrentProtocolsinMolecularBiology (volume such as Ausubel, 1994-1999). , can use respectively by the coding for alpha-Klotho shown in SEQIDNO:1 and SEQIDNO:3 or the nucleotide sequence of β-Klotho herein in the nucleic acid of the Klotho fused polypeptide of disclosure at coding. In the nucleic acid of encoded K lotho fused polypeptide, can use respectively by coding FGF19, the FGF21 shown in SEQIDNO:30, SEQIDNO:32 and SEQIDNO:34 or the nucleotide sequence of FGF23. The nucleotide sequence of the molecule of disclosure described herein comprises with SEQIDNO:1, SEQIDNO:3, SEQIDNO:30, SEQIDNO:32 or SEQIDNO:34 hybridization or with described sequence and has the nucleotide sequence of at least about 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or more homogeneity or homology.
Any in use several different methods can obtain the nucleotide sequence of the various ingredients of coding fusion [Klotho, and/or FGF peptide and/or (optional) modified Fc fragment]. For example, can by with Probe Hybridization from the nucleotide sequence of cDNA and genome dna library clones coding polypeptide, or use amplification technique to separate described nucleotide sequence with Oligonucleolide primers. More commonly, use DNA or RNA template, with amplification technique amplification with separate Klotho and FGF sequence (for example seeing Dieffenfach&Dveksler, PCRPrimers:ALaboratoryManual (1995)). Alternatively, can synthesize and produce overlapping oligonucleotides, and link up to produce one or more domains. Use antibody as probe, can also separate from expression library the nucleic acid of encoded K lotho or FGF.
According to this paper disclosure, the various ingredients of fusion [the Fc fragment that Klotho and/or FGF peptide and/or (optional) are modified] can directly connect, or via covalently bound sub-connection, described connexon comprises amino acid connexon, for example polyglycine connexon, or the chemical connexon of another type, comprise that carbohydrate connexon, lipid connexon, aliphatic acid connexon, polyethers connexon (for example PEG) etc. (be for example shown in, Hermanson, Bioconjugatetechniques (1996)). The polypeptide that forms fusion/fused polypeptide is usually that C-end to N-end connects, and connects although they can be also C end to C end, N-end to N-ends or N-end to C-end. In interior location in the fused polypeptide of disclosure, can insert one or more polypeptide structures territory herein. The polypeptide of fusion can be any order. Can be by the recombination of polynucleotide of preparation continuous programming code fusion, by will be for example, from the amino acid whose chain of a protein sequence (the extracellular subdomain of Klotho) covalently bound to for example, from the amino acid whose chain of another protein sequence (FGF), production fused polypeptide. Amino acid chains different in fusion can be arrived together by direct montage, or can be arrived together by indirect montage via cytotoxic compounds or amino acid linking group. Amino acid linking group length can be about 200 amino acid or longer, or common 1 to 100 amino acid. In some embodiments, proline residue is mixed to connexon, to prevent the formation of remarkable secondary structure element of connexon. Connexon can be the flexible amino acid subsequence synthetic as a part for recombination fusion protein conventionally. This type of flexibly connects son is well known by persons skilled in the art.
According to this paper disclosure, the amino acid sequence of fusion [the Fc fragment that the extracellular subdomain of Klotho and/or FGF and/or (optional) are modified] can connect via peptide connexon. The example of peptide connexon is well known in the art, and is described in herein. For example, peptide connexon generally includes some Gly and some Ser residues, for example (Gly4Ser)3(SEQIDNO:11)、Gly4Ser polypeptide (SEQIDNO:12), Gly (SEQIDNO:13), GlyGly (SEQIDNO:14), GlySer (SEQIDNO:15), Gly2Ser (SEQIDNO:16), Ala (SEQIDNO:17) and AlaAla (SEQIDNO:18). Particularly, can be used as flexible hinge for the peptide connexon of the fusion of this paper disclosure plays a role.
Can get rid of prior to Klotho being mixed to the fusion of this paper disclosure the burst of Klotho or FGF. Can comprise the Klotho of fusion or the burst of FGF, for example the polypeptide shown in SEQIDNO:19. But this type of sequence also can be omitted, and for example, replace with the burst (IgG burst (SEQIDNO:9)) of different proteins. Conventionally, the pharmaceutical composition of disclosure will contain the mature form of Klotho and FGF herein.
Conventionally,, prior to mixing fused polypeptide, one or both from Klotho or FGF part got rid of introne.
The fused polypeptide of disclosure can comprise one or more polymer that connect with one or more reactivity amino acid side chain covalency herein. For example (and unrestricted), this base polymer comprises polyethylene glycol (PEG), it can link to one or more free cysteine sulfhydryl residue, thereby in the time that protein is exposed to oxidisability condition, hinders formation and the gathering of disulfide bond. In addition, estimate that the PEGization of the fused polypeptide of disclosure provides improved character herein, the half life, stability and the protease resistant that for example increase. Alternatively, can for example, by polymer covalency being added into free amine group (lysine ε or N-terminal amino group), modify the fused polypeptide of disclosure herein. Do not relate to be in those of receptors bind, Heparin-binding or correct protein folding for the special concrete cysteine of covalent modification and lysine. Those skilled in the art will be apparent, can use biochemistry for measuring fused polypeptide and/or the method for BA, to determine, whether the modification of special amino acid residue be affected to protein active as required. Also consider the suitable modification that other is similar and be known in the art.
Herein disclosure also relates to and the expression of the fused polypeptide of at least about 95% or more homology of the amino acid sequence shown in SEQIDNO:19-28.
Disclosure contains following fused polypeptide herein, and described fused polypeptide comprises: (a) comprise the polypeptide of at least one extracellular subdomain of Klotho albumen, or its functional activity variant or derivative; (b) polypeptide that comprises fibroblast growth factor, or its functional activity variant or derivative; And (c) there is the modified Fc fragment of the compatibility to Fc-γ-acceptor of minimizing and/or the serum half life of increase. " its functional activity variant or derivative " represents to comprise amino acid sequence longer, shorter than corresponding wild type peptide or that change but remains with variant or the derivative of BA simultaneously. Therefore, " functional activity variant or the derivative " of the extracellular subdomain of Klotho albumen or fibroblast growth factor comprise than the extracellular subdomain of the Klotho albumen of wild type or fibroblast growth factor still less, the more or amino acid sequence that changes, but still retain at least one BA of wild type peptide sequence. The functional activity variant of polypeptide disclosed herein or derivative also can comprise the same acid sequence of polypeptide disclosed herein, but for example, different in posttranslational modification (PEGization, methylate and/or glycosylation), or there is the extra part or the element that add on it. In numerous embodiments, the variant of FGF23 or derivative comprise or do not comprise R179Q.
In one embodiment, functional activity variant or derivative polypeptides comprise the amino acid sequence for example, with sequence disclosed herein (, at least one extracellular subdomain or fibroblast growth factor of Klotho albumen) with at least about 60% homogeneity. Preferably, polypeptide and sequence disclosed herein at least have 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or more homogeneity.
While use in this article, use according to Karlin and Altschul, PNASUSA90:5873-5877,1993) algorithm improvement, Karlin and Altschul (PNASUSA87:2264-2268,1990) is measured the percentage homogeneity of two amino acid sequences (or two nucleotide sequences). This type of algorithm is merged in NBLAST and the XBLAST program of (J.Mol.Biol.215:403-410,1990) such as Altschul. Use NBLAST program, with mark=100, BLAST nucleotide search is carried out in word length=12. Use XBLAST program, with mark=50, BLAST protein search is carried out in word length=3. If (NucleicAcidsRes.25:3389-3402,1997) the described GappedBLAST of utilization such as Altschul are to obtain for the relatively comparison of having vacant position of object. In the time utilizing BLAST and GappedBLAST program, use the default parameters of each program (for example XBLAST and NBLAST), obtain the nucleotide sequence with nucleic acid molecules homology of the present invention.
The similitude of homogeneity or identical expression amino acid sequence (or nucleotide sequence) and there is the implication of this area accreditation. The sequence with homogeneity is shared same or analogous amino acid (or nucleic acid). Therefore, the candidate sequence of sharing 85% amino acid sequence identity with canonical sequence needs: after with canonical sequence comparison candidate sequence, in candidate sequence, 85% amino acid is identical with the corresponding amino acid in canonical sequence, and/or forms conserved amino acid change.
The functional activity variant of polypeptide disclosed herein has retained and original polypeptide or the essentially identical functional activity of fragment. Naturally occurring functional activity variant, for example allelic variant and species variant, and the functional activity variant of non-natural existence, be included in the present invention, and can be by for example induced-mutation technique or by directly synthetic production.
Functional activity variant or derivative have approximately from polypeptide disclosed herein or at least for example 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,25,30,35,40,45,50,55,60 or more amino acid residue different. In the time that this relatively needs to compare, with regard to maximum homology aligned sequences. The site of variation (variation) can be present in polypeptide Anywhere, as long as active substantially similar to polypeptide disclosed herein.
At Bowie etc., Science, in 247:1306-1310 (1990), provide about the guidance of variant and derivative how to prepare the amino acid substitution with phenotype silence, it has been instructed has two kinds of main policies for studying amino acid sequence to the tolerance changing.
The first strategy has utilized by the tolerance of the amino acid substitution of the natural selection between evolutionary stage. By comparing the amino acid sequence in different plant species, can identify amino acid position conservative between species. For example see Fig. 5. These conservative amino acid may be important for protein function. On the contrary, the amino acid position that replacement wherein has been tolerated by natural selection shows for the not crucial position of albumen merit mass-energy. Therefore, the position of tolerance amino acid substitution can be modified and still kept the specific binding activity of polypeptide.
The genetic engineering of the second strategy use, introduces amino acid change with the particular location of the gene clone, to identify the region for protein function key. For example, can use direct mutagenesis or alanine scanning mutagenesis (the each residue at molecule is introduced single alanine mutation) (Cunningham etc., Science, 244:1081-1085 (1989)).
Method from sudden change to the amino acid of protein that introduce is well known to a person skilled in the art. See for example Ausubel (volume), CurrentProtocolsinMolecularBiology, JohnWiley and Sons, Inc. (1994); T.Maniatis, E.F.Fritsch and J.Sambrook, MolecularCloning:ALaboratoryManual, ColdSpringHarborlaboratory, ColdSpringHarbor, N.Y. (1989). Can also use commercially available kit, for example " QuikChange.TM. direct mutagenesis kit " (Stratagene) introduces sudden change. Those skilled in the art can, by replacing the amino acid that does not affect polypeptide function, realize the functional activity variant of generation polypeptide or the derivative of polypeptide.
Variant or derivative can have, and for example, have still retained the one or more conservative replacement of at least one BA. Conservative replacement is such replacement, and wherein, amino acid is replaced by another amino acid with similar quality, makes the technical staff in chemistry of peptides field by substantially constant to secondary structure and the hydrophilic nmature of expection polypeptide. Conventionally, following amino acid whose group has represented conservative change: (1) ala, pro, gly, glu, asp, gln, asn, ser, thr; (2) cys, ser, tyr, thr; (3) val, ile, leu, met, ala, phe; (4) lys, arg, his; (5) phe, tyr, trp, his.
The example of special variant and derivative includes but not limited to, functional activity variant and the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen, for example, following polypeptide, its extracellular domain that comprises Klotho (for example, SEQIDNO:5 or 6) at least about 100, 150, 200, 250, 300, 350, 375, 400 or 425 continuous amino acids, and have no more than about 1 with wild-type sequence (as disclosed in SEQIDNO:5 or 6), 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60 or more amino acid residue difference, retained at least one BA of wild type peptide simultaneously. for example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, at least about 400 continuous amino acids that described polypeptide comprises SEQIDNO:5 or 6, and no more than about 100 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, at least about 400 continuous amino acids that described polypeptide comprises SEQIDNO:5 or 6, and no more than about 50 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, at least about 425 continuous amino acids that described polypeptide comprises SEQIDNO:5 or 6, and no more than about 25 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, at least about 425 continuous amino acids that described polypeptide comprises SEQIDNO:5 or 6, and no more than about 10 amino acid residue differences. in another example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, described polypeptide comprises at least about 100 of SEQIDNO:7, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 925, 950 or 982 continuous amino acids, and with wild-type sequence no more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 70, 75, 80, 85, 90, 95, 100, 110, 120, 140, 150, 160, 170, 180, 190 or 200 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, at least about 500 continuous amino acids that described polypeptide comprises SEQIDNO:7, and no more than about 100 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, at least about 600 continuous amino acids that described polypeptide comprises SEQIDNO:7, and no more than about 100 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, at least about 700 continuous amino acids that described polypeptide comprises SEQIDNO:7, and no more than about 100 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, at least about 800 continuous amino acids that described polypeptide comprises SEQIDNO:7, and no more than about 100 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, at least about 900 continuous amino acids that described polypeptide comprises SEQIDNO:7, and no more than about 100 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide of at least one the extracellular subdomain that comprises Klotho albumen comprise following polypeptide, at least about 900 continuous amino acids that described polypeptide comprises SEQIDNO:7, and no more than about 50 amino acid residue differences.
The example of special variant and derivative includes but not limited to, functional activity variant and the derivative of the polypeptide that comprises fibroblast growth factor, for example, following polypeptide, it comprises fibroblast growth factor (for example FGF19 (SEQIDNO:31), FGF21 (SEQIDNO:33) or FGF23 (SEQIDNO:35)) at least about 100, 125, 150, 150, 175, 200, 225 or 250 continuous amino acids, and with wild-type sequence (as SEQIDNO:31, disclosed in 33 or 35) no more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60 or more amino acid residue difference, retained at least one BA of wild type peptide simultaneously. in numerous embodiments, variant or derivative can comprise or not comprise R179Q variation. for example, functional activity variant or the derivative of the polypeptide that comprises fibroblast growth factor comprise following polypeptide, and described polypeptide comprises SEQIDNO:31, at least about 150 continuous amino acids of 33 or 35, and no more than about 25 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide that comprises fibroblast growth factor comprise following polypeptide, and described polypeptide comprises SEQIDNO:31, at least about 175 continuous amino acids of 33 or 35, and no more than about 25 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide that comprises fibroblast growth factor comprise following polypeptide, and described polypeptide comprises SEQIDNO:31, at least about 200 continuous amino acids of 33 or 35, and no more than about 25 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide that comprises fibroblast growth factor comprise following polypeptide, at least about 225 continuous amino acids that described polypeptide comprises SEQIDNO:35, and no more than about 50 amino acid residue differences. for example, functional activity variant or the derivative of the polypeptide that comprises fibroblast growth factor comprise following polypeptide, at least about 225 continuous amino acids that described polypeptide comprises SEQIDNO:35, and no more than about 25 amino acid residue differences.
4.3 expression of the fused polypeptide of disclosure herein
For expressing the fusion of disclosure herein, by technology well known in the art, the DNA molecular obtaining can be inserted to suitable expression vector by arbitrary method described herein or methods known in the art. For example, can use the Restriction Enzyme of synthetic DNA connexon or connect double-stranded cDNA clone is entered to suitable carrier by flat end by homopolymeric tailing or by relating to. Conventionally use DNA ligase to connect DNA molecular, and by avoid undesired connection by alkaline phosphatase treatment.
Therefore, disclosure comprises the carrier (for example recombinant plasmid and bacteriophage) that comprises nucleic acid molecules as herein described (for example, the recombinant nucleic acid molecules of gene or encoding gene) herein. Term " recombinant vector " (for example comprises following carrier, plasmid, bacteriophage, phasmid, virus, glutinous grain, the glutinous grain of F, or other purified nucleic acid carrier), described carrier is changed, modification or through engineering approaches, thus make it contain come from than recombinant vector natural or natural nucleic acid molecules comprises that those are more, still less or different nucleotide sequences. For example, recombinant vector can comprise the nucleotide sequence of the encoded K lotho-FGF23 fusion being effectively connected with regulating and controlling sequence, described regulating and controlling sequence is promoter sequence, terminator sequence and/or artificial ribosome bind site (RBS) for example, as herein defined. The recombinant vector that allows to be included in the expression of gene wherein or nucleic acid is called as " expression vector ".
For eucaryon host, depend on host's character, can use different transcribing and translational control sequence. They can come from viral source, such as adenovirus, bovine papilloma virus, anthropoid cape virus etc., wherein, adjustment signal and the special gene-correlation connection with high expression level. Example includes but not limited to, the TK promoter of herpesviral, SV40 early promoter, yeast ga14 gene promoter etc. Can select to allow the transcription initiation adjustment signal of inhibition or activation, make it possible to regulatory gene and express.
In some molecules of disclosure as herein described, one or more DNA moleculars with the nucleotide sequence of one or more polypeptide chain of coding fused polypeptide are effectively connected with one or more regulating and controlling sequence, and described regulating and controlling sequence can be integrated into host cell by the DNA molecular of wanting. For example, allow to select one or more marks of the host cell that contains expression vector by introducing, can select the cell of stable conversion of DNA molecular being introduced into. Can select marker gene to be directly connected with nucleotide sequence to be expressed, or introduce identical cell by cotransfection. The optimum of protein described herein synthesizes also may need extra element. It is apparent will using which additional element to those of ordinary skill in the art.
Select the importance factor of special plasmid or viral vectors to include but not limited to: easily identification selects with other recipient cell that never contains carrier the recipient cell that contains carrier; The copy number of the carrier of wanting in special host; And whether want to make carrier " to shuttle back and forth " between the host cell of different plant species.
Once carrier is built as the DNA sequence dna comprising for expressing, can be by one or more in multiple appropriate method known in the art, be introduced into suitable host cell, described method includes but not limited to, for example, conversion, transfection, joint, protoplast fusion, electroporation, calcium phosphate precipitation, directly microinjection etc.
That host cell can be protokaryon or eucaryon. The example of eukaryotic host cell comprises, for example, and mammalian cell, for example people, monkey, mouse and Chinese hamster ovary (CHO) cell. This type of cell is assisted the posttranslational modification of protein, comprises, for example, correctly folding or glycosylation. In addition, also can use the yeast cell to express fused polypeptide of disclosure herein. The same with most of mammalian cells, yeast cells also can make to carry out posttranslational modification to protein, for example comprises glycosylation. Have multiple recombinant DNA strategy, its use can be used in strong promoter sequence and the high copy number plasmid of in yeast, producing protein. Yeast is transcribed with translating mechanism can identify the guiding subsequence on clone's mammalian genes product, makes thus to secrete the peptide (, propetide) with guiding subsequence. It is by use dihyrofolate reductase (DHFR) amplification in DHFR deficiency Chinese hamster ovary celI that high yield is produced the special method of the fused polypeptide of disclosure herein, this is by using as U.S. Patent No. 4, the methotrexate (MTX) level increasing continuously described in 889,803 is carried out. The polypeptide obtaining can be glycosylation form.
After introducing one or more carriers, the host cell of conventionally growing in selective medium, the growth that described culture medium just contains the cell of carrier is selected. Can, by arbitrary known in the art or method purification of recombinant proteins described herein, for example, relate to any conventional method of extraction, precipitation, chromatography and electrophoresis. Other purification process that can be used for protein purification are the affinity chromatographys that use in conjunction with the monoclonal antibody of target protein. Conventionally, by the coarse prepared product that contains recombinant protein by being fixed with the post of suitable monoclonal antibody on it. Protein is attached on post via specific antibody conventionally, and impurity passes through post. After washing post, for example, by changing pH or ionic strength, elute protein from gel.
4.4 mensuration for assessment of fused protein activity
Mensuration described herein (seeing embodiment 2) and mensuration known in the art can be used in and detects Klotho or the FGF activity of the fused polypeptide of disclosure herein. Suitable determination of activity comprises receptors bind mensuration, cell proliferating determining and cell signal transmission mensuration. For example, can be used for determining that combination that whether fused polypeptide has Klotho or a FGF activity is measured comprises: measure the combination of fused polypeptide and FGF acceptor. FGF receptors bind is measured and is included but not limited to: competitive and noncompetitive is measured. For example, for example, by the cell of expressing FGF acceptor and the FGF (radioactive label) through mark being contacted and increased the concentration of the Klotho-FGF fused polypeptide of un-marked, can detect FGF receptors bind. Two kinds of parts that competition is combined with same receptor are added in the reactant mixture that contains cell. Washed cell measurement are through the FGF of mark subsequently. While there is the fused polypeptide of un-marked, the minimizing of the amount of the FGF through mark to its acceptor shows the combination of Klotho-FGF fused polypeptide and acceptor. Alternatively, can mark Klotho-FGF fused polypeptide, and detect the direct combination of fused polypeptide and cell.
Whether cellular response is measured Klotho or FGF activity can also to pass through to measure fused polypeptide. For example, in some embodiments, relate to the cell of expressing FGF acceptor is contacted with fused polypeptide for detection of the mensuration of the BA of Klotho-FGF fused polypeptide, measure cell response, such as, for example, cell proliferation or Egr-1 activation, myotube diameter in C2C12 cell, and relatively exist and the cell response while there is not fused polypeptide. Than there not being fused polypeptide complex, in the time there is fused polypeptide complex, the increase of cell response shows that fused polypeptide has BA. In addition, also can measure the increase of transmitting event (for example phosphorylation of FGFR, FRS2, ERK1/2, p70S6K etc.) as the downstream signal that carrys out autoreceptor of the mark of BA.
4.5 pharmaceutical compositions and methods for the treatment of
Disclosure also relates to pharmaceutical composition herein, and it contains one or more fused polypeptide and pharmaceutically acceptable diluent or supporting agents of disclosure herein. Pharmaceutical composition can also comprise the heparin of medicine effective dose. This type of pharmaceutical composition can be included in kit or container. This type of kit or container can be packed together with the description of half life or external shelf-life in the body of prolongation that relates to fused polypeptide. Optionally, this type of kit or container can also be attended by the book of informing of the form that specify by the government organs of manufacture, use or the sale of management medicine or biological product, described in inform that book has reflected the manufacture that people is used, use or sale that government organs permit. Such composition for example can be used for, by treating in patient's (preferably mammal is most preferably people), prevent or improve in the method for disease or disease symptoms (patient's condition that the age is relevant or metabolic disorder) to patient's drug administration composition.
Generally speaking, the treatment effective dose of the pharmaceutical composition of disclosure is from about 0.0001mg/kg to 0.001mg/kg herein; 0.001mg/kg is 10mg/kg body weight extremely approximately, or from about 0.02mg/kg to about 5mg/kg body weight. Conventionally, the treatment effective dose of fused polypeptide is for example from about 0.001mg to about 0.01mg, approximately extremely approximately 100mg of 0.01mg, or from about 100mg to about 1000mg. Preferably, the treatment effective dose of fused polypeptide is from about 0.001mg/kg to about 2mg/kg.
Those of ordinary skill in the art can determine according to route of administration and the dosage of wanting the optimal drug formulation of fused polypeptide. (see for example Remington ' sPharmaceuticalSciences, the 18th edition (1990), MackPublishingCo., Easton, Pa., its whole disclosures are all incorporated to herein by reference).
Herein the fused polypeptide of disclosure can be used as the pharmaceutical composition that can be solid, liquid or gas (aerosol) form and uses. Typical drug delivery route can include but not limited to: in per os, part, parenteral, hypogloeeis, rectum, vagina, intracutaneous or nose. Parenteral dispenser comprises in hypodermic injection, intravenous, intramuscular, peritonaeum, in pleura, breastbone inner injection or infusion techniques. Preferably, parenteral administration composition. More preferably, intravenous is used composition. Can prepare the pharmaceutical composition of disclosure herein and make in the time using composition to experimenter, allowing the polypeptide of disclosure is herein bioavailable. Composition can be taked the form of one or more dosage units, and wherein for example, tablet can be single dosage unit, and the container of the polypeptide of this paper disclosure of aerosol form can hold multiple dosage units.
Material for the preparation of pharmaceutical composition can be nontoxic with the amount of its use. Those of ordinary skill in the art will obviously know, in pharmaceutical composition, the optimal dosage of active component will depend on multiple factors. Correlative factor includes but not limited to, the type of experimenter's type (for example people), experimenter's holistic health, the age related conditions that experimenter need to treat or metabolic disorder, composition are as the purposes of the part of multi-medicament scheme, special form, the mode of dispenser and the composition of use of the polypeptide of disclosure herein.
Pharmaceutically acceptable supporting agent or carrier (vehicle) can be particulate, and making composition is for example the form of tablet or powder. Supporting agent can be liquid, and composition is for example oral slurries or injectable liquids. In addition, supporting agent can be gaseous state, so that aerosol composition useful in for example sucking dispenser to be provided.
Term " supporting agent " refers to use diluent, adjuvant or the excipient of the polypeptide of disclosure herein with it. This type of pharmaceutical carriers can be liquid, and for example water and oil comprise oil, animal, plant or synthetic source, for example peanut oil, soya-bean oil, mineral oil, sesame wet goods those. Supporting agent can be salting liquid, Arabic gum, gelatin, gelatinized corn starch, mica, keratin, colloidal silica, urea etc. In addition, can also use adjuvant, stabilizing agent, thickener, lubricant and colouring agent. In one embodiment, while being administered to experimenter, polypeptide and pharmaceutically suitable carrier of disclosure are aseptic herein. In the time that the polypeptide intravenous of this paper disclosure is used, water is special carrier. Salting liquid and aqueous glucose and glycerite also can be with being liquid carrier, especially for injectable solution. Suitable pharmaceutical carriers also comprises excipient, such as starch, glucose, lactose, sucrose, gelatin, Fructus Hordei Germinatus, rice, flour, chalk, silica gel, odium stearate, glyceryl monostearate, mica, sodium chloride, dry skimmed milk, glycerine, propylene, ethylene glycol, water, ethanol etc. If necessary, composition of the present invention can also contain a small amount of wetting agent or emulsifying agent or pH buffer.
Composition can be intended to for oral administration, if so, preferably solid or liquid form of composition, wherein semisolid, semiliquid, suspension and gel form are also included within the form of thinking solid or liquid herein.
As the solid composite for oral administration, composition can be configured to the forms such as powder, particle, compressed tablets, pill, capsule, gum, wafer. This type of solid composite generally contains one or more inert diluents. In addition, can there are one or more in following substances: adhesive, for example ethyl cellulose, carboxymethyl cellulose, microcrystalline cellulose or gelatin; Excipient, for example starch, lactose or dextrin, disintegrant, such as alginic acid, sodium alginate, Primogel, cornstarch etc.; Lubricant, for example dolomol or Sterotex; Glidant, for example cataloid; Sweetener, for example sucrose or asccharin, flavor enhancement, for example peppermint, gaultherolin or orange taste flavor enhancement, and colouring agent.
For example, in the time that pharmaceutical composition is the form (gelatine capsule) of capsule, it can also contain liquid carrier except the material that contains the above-mentioned type, for example polyethylene glycol, cyclodextrin or fat oil.
Pharmaceutical composition can be the form of liquid, for example elixir, slurries, solution, emulsion or suspension. Liquid is useful for oral administration or by injected delivery. In the time being intended to for oral administration, composition can contain one or more in sweetener, anticorrisive agent, dyestuff/colouring agent and flavor potentiator. At the composition for using by injection, can also comprise one or more in surfactant, anticorrisive agent, wetting agent, dispersant, suspending agent, buffer, stabilizing agent and isotonic agent.
Herein the fluid composition (no matter they are solution, suspension or other similar type) of disclosure can also comprise one or more in following: sterile diluent, for example water for injection, saline solution, preferably, physiological saline, Ringer ' s solution, isotonic sodium chloride, fixing oil, for example can be as synthetic monoglyceride or two glyceride of solvent or suspension matrix, polyethylene glycol, glycerine, cyclodextrin, propane diols or other solvent; Antibacterial agent, for example phenmethylol or p-hydroxybenzoate; Antioxidant, for example ascorbic acid or sodium hydrogensulfite; Chelating agent, for example ethylenediamine tetra-acetic acid; Buffer, for example acetate, citrate or phosphate, and for example, for the reagent of adjustment of tonicity, sodium chloride or glucose. Parenteral composition can be loaded in ampoule, accessible syringe or the multi-agent buret that glass, plastics or other material make. Physiological saline is special concrete adjuvant. Injectable composition is preferably aseptic.
The compound (for example fused polypeptide) of this paper disclosure that pharmaceutical composition contains effective dose, makes to obtain suitable dosage. Pharmaceutical composition can contain according to the compound of the known effective dose of at present their each illnesss being write out a prescription.
By in prevention, treatment and/or the management relevant patient's condition of age or metabolic disorder effectively, for the route of administration of the polypeptide of this paper disclosure of preventative and/or therapeutic scheme, the route of administration of current prescription that can be based on for other therapeutic agent known in the art. The polypeptide of disclosure can be used by any approach easily herein, for example, by infusion or bolus infusion, by for example, absorption via epithelium or mucous membrane skin inner layer (oral mucosa, rectum or intestinal mucosa etc.). Dispenser can be whole body or local. Multiple delivery system is known, for example microparticle, microcapsules, capsule etc., and they can be used for using the polypeptide of disclosure herein. Can use the polypeptide that exceedes a kind of this paper disclosure to experimenter. Application process can include but not limited to, oral administration and parenteral administration; Parenteral administration includes but not limited to, in intracutaneous, intramuscular, peritonaeum, in intravenous, subcutaneous, nose, in outer, the hypogloeeis of dura mater, nose, in brain, in ventricle, in sheath, in vagina, transdermal, rectum, by sucking or local to ear, nose, eye or skin.
The polypeptide of disclosure can parenteral administration herein. Particularly, the polypeptide of disclosure can be used by intravenous herein.
Can also utilize pulmonary administration, for example, by using inhalator or sprayer, and prepare by aerosol agent, or via pouring in carbon fluorine or synthetic lung surfactant. The polypeptide of disclosure can also for example, be formulated as suppository with conventional adhesive and supporting agent (triglycerides) herein.
The polypeptide of disclosure can be sent in controlled release system herein. For example, can use pump (to see Sefton, CRCCrit.Ref.Biomed.Eng.1987,14,201; Buchwald etc., Surgery1980,88:507; Saudek etc., N.Engl.J.Med.1989,321:574). Can also use polymeric material, (see MedicalApplicationsofControlledRelease, Langer and Wise (volume), CRCPres., BocaRaton, FL, 1974 for the controlled release of the polypeptide of this paper disclosure; ControlledDrugBioavailability, DrugProductDesignandPerformance, Smolen and Ball (volume), Wiley, NewYork, 1984; Ranger and Peppas, J.Macromol.Sci.Rev.Macromol.Chem.1983,23,61; Also see Levy etc., Science1985,228,190; During etc., Ann.Neurol., 1989,25,351; Howard etc., J.Neurosurg., 1989,71,105). Particularly, for example controlled release system can be placed on, near the target (brain) of polypeptide of this paper disclosure, thereby only need a part for whole-body dose (to see for example Goodson, inMedicalApplicationsofControlledRelease, above-mentioned, the 2nd volume, 1984, the 115 pages-138 pages). Can use other controlled release system of discussing in the summary (Science1990,249,1527-1533) of Langer.
For example be disclosed U.S. Patent No. 5,679,377 for realizing the controlled release of polypeptide or the polymeric material of sustained release of disclosure herein; U.S. Patent No. 5,916,597; U.S. Patent No. 5,912,015; U.S. Patent No. 5,989,463; U.S. Patent No. 5,128,326; The open No.WO99/15154 of PCT; In the open No.WO99/20253 of PCT. The example of the polymer using in sustained release forms includes but not limited to gather (2-ethoxy methyl acrylate), poly-(methyl methacrylate), poly-(acrylic acid), ethylene-vinyl acetate copolymer, poly-(methacrylic acid), PGA (PLG), poly-acid anhydrides, poly-(N-vinylpyrrolidone), poly-(vinyl alcohol), polyacrylamide, PEG, polylactide (PLA), PLGA (PLGA) and poe. Preferably, for the polymer of sustained release forms be inertia, containing impurity, the storage-stable, aseptic and biodegradable that can leach.
Conventionally, the treatment effective dose of the pharmaceutical composition of disclosure is from about 0.0001mg/kg to 0.001mg/kg herein; 0.001mg/kg is 10mg/kg body weight extremely approximately, or from about 0.02mg/kg to about 5mg/kg body weight.
In other embodiments, preventative and/or therapeutic scheme relates to polypeptide from this paper disclosure of the effective dose of potion or multi-agent to patient that use, and wherein the dosage of effective dose reaches the extremely blood plasma level of at least 400 μ g/mL of polypeptide at least 0.01 μ g/mL of disclosure herein.
Preventative and/or curative scheme can relate to the polypeptide that uses this paper disclosure of the effective dose of multidose to patient, and wherein said multidose keeps the blood plasma level of polypeptide at least 0.01 μ g/mL to the 400 μ g/mL of disclosure herein. Can use preventative and/or therapeutic scheme at least 1 day, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months or 9 months.
Preventative and/or therapeutic scheme can relate to combined administration polypeptide and one or more extra therapeutic agents of disclosure herein. Can obtain from any bibliography of this area for the RD of one or more therapeutic agents of preventing, treat and/or managing the relevant patient's condition of age or metabolic disorder at present, include but not limited to the volumes such as Hardman, Goodman&Gilman ' sThePharmacologicalBasisOfBasisOfTherapeutics, the 10th edition., McGraw-Hill, NewYork, 2001; Physician ' sDeskReference (the 60th edition, 2006), its by reference entirety be incorporated to herein.
Disclosure comprises sanatory method herein, and wherein, the agonist activity of Klotho albumen and FGF is wanted. Herein disclosure also comprises purposes in therapy of disclosed protein, fusion, nucleic acid molecules or pharmaceutical composition or as the purposes of medicament that is used for the treatment of pathological disorders, wherein, the agonist activity of Klotho albumen and FGF is wanted. Purposes or the example of these class methods of disclosure include but not limited to the patient's condition or the metabolic disorder that the age is relevant herein.
Disclosure is included in the method for the treatment of or preventing the relevant patient's condition of age in individuality herein; And purposes in therapy of protein disclosed herein, fusion, nucleic acid molecules or pharmaceutical composition or as the purposes of the medicament in individuality treatment or relevant disease of prevention age. The individuality of needs treatment is used to pharmaceutical composition pharmacology effective dose, that contain Klotho fused polypeptide with treatment or the prevention relevant patient's condition of age, and described fused polypeptide has at least one extracellular subdomain and fibroblast growth factor and (optional) modified Fc fragment of Klotho albumen. In some embodiments, the heparin of Klotho fused polypeptide and pharmacology effective dose is used jointly. The life expectancy of the relevant patient's condition of age comprises that muscle reduces that disease, atrophoderma, flesh are subdued, encephalatrophy, atherosclerotic, artery sclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, immunologic incompetence, hypertension, dementia, Huntington's disease, Alzheimer's disease, cataract, age are relevant macular degeneration, prostate cancer, apoplexy, shortening, memory loss, wrinkle, the impaired renal function hearing loss relevant with the age. In some embodiments, at least one extracellular domain that Klotho fused polypeptide contains α Klotho albumen. In special embodiment, the individuality of the treatment that need to subdue for flesh is used at least one extracellular domain of containing α Klotho albumen and the Klotho fusion of fibroblast growth factor 23.
Disclosure also relates to the method for the treatment of or preventing metabolic disorder in individuality herein; And purposes or the conduct in therapy of disclosed protein, fusion, nucleic acid molecules or pharmaceutical composition is used for the purposes at the medicament of individuality treatment or prevention metabolic disorder. The individuality of needs treatment is used to pharmaceutical composition pharmacology effective dose, that contain Klotho fused polypeptide with treatment metabolic disorder, described fused polypeptide has at least one extracellular subdomain and fibroblast growth factor of Klotho albumen, and (optional) modified, the Fc fragment of serum half life that there is minimizing and combination FcRn and/or increase and/or stability. In some embodiments, the heparin of Klotho fused polypeptide and pharmacology effective dose is used jointly. Described method can be used in the treatment or prevention to type ii diabetes, metabolic syndrome, hyperglycaemia and obesity. In special embodiment, need to use at least one extracellular domain of containing β-KLotho albumen and the Klotho fusion of FGF2 1 to the individuality of the treatment of metabolic disorder to using.
Disclosure also provides the method for the treatment of or preventing hyperphosphatemia or calcinosis in individuality herein; And purposes or the conduct in therapy of disclosed protein, fusion, nucleic acid molecules or pharmaceutical composition is used for the purposes at the medicament of individuality treatment or prevention hyperphosphatemia or calcinosis. The individuality of needs treatment is used to pharmaceutical composition pharmacology effective dose, that contain Klotho fused polypeptide with treatment hyperphosphatemia or calcinosis, and described fused polypeptide has at least one extracellular subdomain, fibroblast growth factor and (optional) modified Fc fragment of Klotho albumen. In some embodiments, the heparin of Klotho fused polypeptide and pharmacology effective dose is used jointly. In special embodiment, to using to the individuality of the treatment of hyperphosphatemia or calcinosis the Klotho fusion of the modified Fc fragment of at least one extracellular domain of containing α Klotho albumen and fibroblast growth factor 23 and (optional).
Herein disclosure also relates to the method for in individuality treatment or preventing chronic ephrosis or chronic renal failure; And purposes or the conduct in therapy of disclosed protein, fusion, nucleic acid molecules or pharmaceutical composition is used for the purposes at the medicament of individuality treatment or preventing chronic ephrosis or chronic renal failure. The individuality of needs treatment is used to pharmaceutical composition pharmacology effective dose, that contain Klotho fused polypeptide with treatment chronic kidney disease or chronic renal failure, and described fused polypeptide has at least one extracellular subdomain, fibroblast growth factor and (optional) modified Fc fragment of Klotho albumen. In some embodiments, the heparin of Klotho fused polypeptide and pharmacology effective dose is used jointly. In some embodiments, to using to the individuality of the treatment of chronic kidney disease or chronic renal failure the Klotho fusion of at least one extracellular domain that contains α Klotho albumen.
Herein disclosure is also included in the method for the treatment of in individuality or pre-anti-cancer; And purposes or the conduct in therapy of disclosed protein, fusion, nucleic acid molecules or pharmaceutical composition is used for the purposes at the medicament of individuality treatment or pre-anti-cancer. The individuality of needs treatment is used to pharmaceutical composition pharmacology effective dose, that contain Klotho fused polypeptide with treatment cancer, and described polypeptide has at least one extracellular subdomain, fibroblast growth factor and (optional) modified Fc fragment of Klotho albumen. Described method can be used for treatment or prevention breast cancer. In some embodiments, the heparin of Klotho fused polypeptide and pharmacology effective dose is used jointly. In some embodiments, to using to the individuality of the treatment of cancer the Klotho fusion of at least one extracellular domain that contains α Klotho albumen.
In the method by using the medicine composite for curing illness that contains Klotho fused polypeptide; Or when use the pharmaceutical composition that contains Klotho fused polypeptide in therapy time, Klotho fused polypeptide and (optional) modified Fc fragment have at least one extracellular subdomain and fibroblast growth factor of Klotho albumen. In special embodiment, at least one extracellular domain that Klotho fusion contains β Klotho albumen and FGF2 1.
In another embodiment, fusion comprises FGF (for example FGF19, FGF21, FGF23 or FGF23 variant) and has the combination to FcRn of minimizing and/or the modified Fc fragment of the serum stability of increase. The fusion of the type can be used in various diseases as described above, or is used for the treatment of or prevents the relevant disease of arbitrary FGF known in the art. Can be to there being the individuality needing to use fusion.
Can use fused polypeptide composition according to arbitrary application process well known by persons skilled in the art and as herein described. Special concrete application process comprises subcutaneous or intravenous. Other effective mode of administration has also been described herein.
4.6 methods of treatments and for assessment of the mensuration of effect
Provide method or purposes that fused polypeptide described herein is administered to individual this paper disclosure to can be used in treatment various disease conditions, comprised illness or metabolic disorder that the age is relevant. In situation about being not limited to any particular theory, fused polypeptide can be used for treatment wherein Klotho or the handicapped illness of FGF. The example of illness comprises the illness that metabolic disorder is relevant with the age. For example, the mouse that FGF23 or Klotho knock out all shows multiple similar phenotype, comprise that low body movement, GD, flesh are subdued, atrophoderma, atherosclerotic, short-lived etc. (see Razzaque and Lanske, J.ofEndrocrinology, 194:1-10 (2007), it is incorporated to herein by reference).
Especially, the fused polypeptide of disclosure, in the old and feeble relevant illness for the treatment of, comprises that flesh is useful especially in subduing herein. Not with theoretical combination in the situation that, the ability that Klotho and FGF23 control mineral matter (for example phosphate and calcium) and vitamin D homeostasis may be that these albumen regulate old and feeble and amyotrophic mode.
On the other hand, the fused polypeptide of disclosure can be used for treating metabolic disorder herein. For example, demonstrate β-Klotho and FGF19 and controlled cholic acid homeostasis by regulation and control cholesterol 7-α-hydroxylases (CYP7A1). The limiting examples of bile homeostasis illness is cholestasia. Demonstrate β-Klotho and FGF21 and in adipocyte, induced steatolysis, and therefore reduced fat and preserve and increase glucose uptake. The limiting examples of steatolysis/fat storage illness is metabolic disease and angiocardiopathy fat and that be associated.
Can stimulate phosphate in urine discharge and reduce thus this discovery of phosphate level in serum based on FGF23 at least partly, Klotho-FGF23 fused polypeptide of the present invention can be used in treatment or prevention hyperphosphatemia or calcinosis in individuality. For example, show, cause the homozygous missense mutation in the Klotho of Klotho defect in patient can cause serious tumoral calcinosis and arteriosteogenesis (Ichikawa etc., J.Clin.Invest.117:2684-2691 (2007), it is incorporated to herein by reference). Individuality is used to pharmaceutical composition pharmacology effective dose, that contain Klotho fused polypeptide with treatment or prevention hyperphosphatemia or calcinosis, and described fused polypeptide has at least one extracellular subdomain, fibroblast growth factor and (optional) modified Fc fragment of Klotho albumen. The Klotho fused polypeptide of the modified Fc fragment of at least one extracellular domain of especially, containing α Klotho albumen, fibroblast growth factor and (optional) is useful for treatment hyperphosphatemia or calcinosis.
The Klotho fused polypeptide of disclosure can also be used in individuality treatment or preventing chronic ephrosis or chronic renal failure herein. For example, demonstrate, than unaffected kidney, in patient's the kidney with chronic renal failure, Klotho expresses and is lowered (Koh etc., Biochem.Biophys.Res.Comm.280:1015-1020 (2001), it is incorporated to herein by reference). Individuality is used to pharmaceutical composition pharmacology effective dose, that contain Klotho fused polypeptide with treatment or preventing chronic ephrosis or chronic renal failure, and described fused polypeptide has at least one extracellular subdomain, fibroblast growth factor and (optional) modified Fc fragment of Klotho albumen. The Klotho fused polypeptide of at least one extracellular domain that especially, contains α Klotho albumen is useful for treatment chronic kidney disease or chronic renal failure.
The Klotho fused polypeptide of disclosure can also be used at individuality treatment or pre-anti-cancer herein. For example, show, than ordinary breast cancer tissue, in breast cancer tissue Klotho express be lowered (Wolf etc., Oncogene (2008) delivers in advance online, its be incorporated to by reference this paper). Individuality is used to pharmaceutical composition pharmacology effective dose, that contain Klotho fused polypeptide with treatment or pre-anti-cancer or breast cancer, and described fused polypeptide has at least one extracellular subdomain, fibroblast growth factor and (optional) modified Fc fragment of Klotho albumen. The Klotho fused polypeptide of at least one extracellular domain that especially, contains α Klotho albumen is useful for treatment cancer or breast cancer.
The method of the effective dose for the Klotho fused polypeptide evaluating effect and/or measure disclosure herein to age associated conditions or metabolic disorder comprises, based on the mensuration of organism, for example, use mammal (for example mouse, rat, Primate or some other non-humans) or other animal (for example Xenopus laevis, zebra fish or invertebrate, for example fly or nematode). Can be using disposable Klotho fused polypeptide or be administered to biology as scheme (rule or non-rule). Then biological parameter is evaluated, for example, the parameter that the age is associated. Target Klotho fused polypeptide causes parameter with respect to for example, change with reference to (contrasting biological parameter). Also can evaluate other parameter (for example,, about toxicity, clearance rate and pharmacokinetics).
Can use the there is special illness Evaluation Klotho fused polypeptide of disclosure herein of (for example illness as herein described, illness, metabolic disorder that for example age is relevant). These illnesss can also provide sensitization system, wherein can observe test polypeptide to physiological effect. The example of illness comprises: denervate, disuse atrophy; Metabolic disorder (illness of for example obesity and/or diabetic animal, for example db/db mouse and ob/ob mouse); Brain, hepatic ischemia; Cis-platinum/taxol/vincristine model; Various Tissues (heterograft) graft; Transgenosis bone model; Pain syndrome (comprising inflammatory and neuropathic conditions); Paraquat, genetoxic and oxidative stress model; And tumour I model.
For measuring relevant illness of age, animal model can be when a calorie animal that is subject to the phenotype with change in limited time. For example, F344 rat provides the useful mensuration system for evaluating Klotho fused polypeptide. When calorie is subject in limited time, F344 rat has 0 to 10% ephrosis incidence. But when being fed by freely (adlibitum) while raising, they have 60 to 100% ephrosis incidence.
For evaluating the Klotho fused polypeptide of disclosure herein, be administered to animal (for example, F344 rat or other suitable animal), and for example assessed over time the parameter of animal. Can freely or normally feed raise (for example,, not under the limited condition of calorie, although can evaluate some parameters under this type of condition) to animal. Usually, the cohort of this type of animal is for measuring. Conventionally, if test polypeptide with towards be subject to calorie restriction similar animal phenotype aspect effect parameter, can indicate test polypeptide advantageously to change the life-span regulation and control in animal. This class testing polypeptide can cause calorie at least some life-span regulating and controlling effects (subgroup of for example this type of effect) of restriction and needn't deprive biological calorie and take in.
Parameter to be tested can be parameter that the age is associated or disease association connection, for example, and the symptom of the disease being associated with animal model. For example, can use test polypeptide to SH rat, and Monitoring of blood pressure. Being indicated as favourable test polypeptide can cause than the not similar improvement of the symptom with reference to animal with polypeptide processing. Can comprise to illness or old and feeble other relevant parameter: antioxidant level (for example antioxidase level or activity), stress resistance (for example paraquat resistance), core temperature, glucose level, insulin level, thyrotropic hormone level, prolactin level and luteinising hormone level.
For measuring the polypeptide of this paper disclosure for the validity for the treatment of age associated conditions, the animal that can use the Klotho with minimizing to express, for example, has the mouse of mutant Klotho; See Kuroo, wait Nature, 390; 45 (1997) and the open No.2003/0119910 of the U.S., be both incorporated to herein with its entirety by reference. For example, mutant mouse is used test polypeptide and monitors relevant parameter of age. Being indicated as favourable test polypeptide can cause improving than the similar symptom with reference to animal without polypeptide processing. Can be by measuring body weight, check fertility acquisition, measure the assessment parameters relevant with metabolic disorder or aging such as blood sugar level, observation life-span, observation skin, observation motor function (for example walking). Can also be by measuring the assessment such as size of the calcification tubercle forming on thymic weight, observation thoracic cavity inner surface. In addition, the quantitative assay of the mRNA to Klotho gene or Klotho albumen is also useful for assessment.
Also have some other body inner models and biologicall test to comprise to evaluate animal metabolism parameter, described parameter for example with insulin illness, the parameter that type ii diabetes is relevant. The example of metabolizing parameters comprises: concentration of glucose, insulin concentration and insulin sensitivity.
Another system example for example, taking tumour as feature, in animal model. Tumour can be spontaneous or derivative. For example, tumour can develop from the cell with multiple Gene effect, and for example, they can be p53+ or p53-. Can also use the biology of autoimmune disorder, for example the NZB mouse to SLE susceptible. For evaluating the feature of bone disease, for example can use through ovariectomized animal as model, for example, for osteoporosis. Similarly, for joint disease, model can for example, based on adjuvant-induced arthritis protein, streptococcus cell wall substance or the collagen immunization mouse of available chondroproteoglycan, high mobility group (with); For the disease of kidney, can use kd/kd mouse. Animal model about cognitive (particularly learning and memory) is also obtainable. The animal model of diabetes and complication thereof is also obtainable, for example Streptozotocin model. Can use canid model, for example, for evaluating apoplexy and ischemic.
In the time that whether assessment test polypeptide can change life-span regulation and control, can monitor or evaluate parameter or the biomarker of multiple age association. The example of the parameter of age association comprises: (i) cell or the biological life-span; (ii) there is gene transcripts or existence or the abundance of gene outcome in cell or biology of biological age dependent expression pattern; (iii) cell or biological to the resistance of coercing; (iv) (example of parameter comprises the insulin level of circulation, blood sugar level for cell or one or more biological metabolizing parameters; Fat content; Core temperature etc.); (v) cell existing in biology or the multiplication capacity of cell mass; And (vi) cell or biological appearance or behavior.
Term " average life span " refers to the mean age of biological cohort death. In some cases, use the identical biological cohort of heredity under controlled environmental condition to assess " average life span ". The death causing due to calamity is not counted in. The in the situation that of cannot measuring average life span under controlled environment condition (for example, for people), can use reliable statistics information (for example, from actuarial table) for enough large colony as average life span.
For example, can disclose the difference of biological physiology state to the sign of molecular difference between two kinds of these type of biologies (, a kind of reference is biological, and a kind of biology with the processing of Klotho fused polypeptide). It is usually the identical exact age with reference to biological and treated biology. Term " exact age " represents for example, to start from previously selected event (becoming pregnant, the embryo of regulation or the fetal state, or more preferably, birth) time of experience while use in this article. Can use multiple standards to determine whether biology is " identical " exact age with regard to comparative analysis. Usually, the levels of precision of requirement is the function of the average life span of wild-type biology. For example, for laboratory wild type strain N2 under some controlled conditions existence to for the nematode Caenorhabditis elegans of average about 16 days, the biology mutually of the same age identical number of days of can having survived. For mouse, biology mutually of the same age can survive identical all numbers or month number; For Primate or people, identical year number (or in 2,3 or 5 years); Etc.. Conventionally the biology in identical full age 15,10,5,3,2 or 1% the time quantum of wild-type biology average life span of these species of can having survived. Preferably, biology is adult organism, for example, and the biological average wild-type biology time quantum at the ripe age to breeding of at least having survived.
Before biology shows obvious old and feeble physical trait, can carry out biological screening mensuration. For example, biology can be only 10,30,40,50,60 or 70% adult organism of the same species wild-type biology average life span of having survived. Report the associated change of age of metabolism, immunocompetence and chromosome structure. Can be in test subject (for example, for the mensuration based on biological), or to patient, evaluate arbitrary these change (for example before treating with therapeutic agent described herein, during or afterwards).
Can also in experimenter's biology of Screening test (or processed experimenter), evaluate and calorie mark that restriction is associated. Although these marks may not be to be associated at the age, they may be the instructions of the physiological status of change in the time that KLotho approach is conditioned. Mark can be mRNA or the protein that its abundance changes to some extent in the limited animal of calorie. WO01/12851 and U.S. Patent No. 6,406,853 have been described mark example. Come from the cell of animal described herein or can be used in the mensuration based on cell with the similar cell model of animal model described herein.
For evaluation test polypeptide, the model of amyotrophic effect is comprised: the rat medial gastrocnemius flesh mass loss that 1) denervate causes, for example, by cutting off large midleg right sciatic nerves; 2) the rat medial gastrocnemius flesh mass loss fixedly causing, for example, by being fixed as right ankle-joint 90 degree bendings; 3) hind leg hangs the rat medial gastrocnemius flesh mass loss causing; (seeing for example U.S.2003-0129686); 4) process with cachexia cell factor, il-1 (IL-1) skeletal muscle atrophy (R.N.Cooney, S.R.Kimball, T.C.Vary, Shock7,1-16 (1997)) causing; With 5) skeletal muscle atrophy (A.L.Goldberg, J.Biol.Chem.244,3223-9 (1969)) that causes with glucocorticoid, dexamethasone processing.
The animal model example of AMD comprises: simulate the mouse model Bora of the induced with laser of exudative (wetting) macular degeneration etc., Proc.Natl.Acad.Sci.USA., 100:2679-84 (2003); Expression causes the transgenic mice (Rakoczy etc. of the mutant form of the cathepsin D of the feature being associated with " map shape atrophy (geographicatrophy) " form of AMD, Am.J.Pathol., 161:1515-24 (2002)); And in retinal pigment epithelium, cross VEGF expression and cause the transgenic mice of CNV. Schwesinger etc., Am.J.Pathol.158:1161-72 (2001).
Parkinsonian animal model example comprises: by using dopaminergic nerve toxin 1-methyl-4 phenyl 1,2,36-tetrahydropyridine (MPTP) is processed the Parkinsonian Primate causing and (is seen the open No.20030055231 of such as United States Patent (USP) and Wichmann etc., Ann.N.Y.Acad.Sci., 991:199-213 (2003)); The rat (for example Lab.Anim.Sci., 49:363-71 (1999)) of 6-HAD-injury; And transgenosis invertebrate model (such as Lakso etc., J.Neurochem.86:165-72 (2003) and Link, Mech.AgeingDev., 122:1639-49 (2001)).
The molecular model example of type ii diabetes comprises: the transgenic mice (U.S. Patent No. 6,127,598) of the defective Nkx-2.2 of tool or Nkx-6.1; Fat fa/fa (ZDF) rat of Zucker diabetes. (U.S. Patent No. 6,569,832) and spontaneously develop obesity and normal progress is dominant diabetes B (overttype2diabetes) subsequently rhesus macaque (Hotta etc., Diabetes, 50:1126-33 (2001)); And thering is the transgenic mice of dominant negative IGF-1 acceptor (KR-IGF-IR), it has the insulin resistance of diabetes B sample.
Neuropathic animal and cell model example comprise: mouse (U.S. Patent No. 5,420,112) or the sense organ motor neuropathy of vincristine induction in rabbit (Ogawa etc., Neurotoxicology, 21:501-11 (2000)); For studying Streptozotocin (the STZ)-diabetes rat (Schmidt etc., Am.J.Pathol., 163:21-8 (2003)) of AN; With carrying out property motor neuropathy (pmn) mouse (Martin etc., Genomics, 75:9-16 (2001)).
The animal model example of hyperphosphatemia or tumoral calcinosis comprises Klotho knock-out mice and FGF23 knock-out mice (Yoshida etc., Endocrinology143:683-689 (2002)).
The animal model example of chronic kidney disease or chronic renal failure comprises COL4A3+/-mouse (Beirowski etc., J.Am.Soc.Nephrol.17:1986-1994 (2006)).
The animal model example of cancer comprises that as known in the art (Giovanella etc., Adv.CancerRes.44:69-120 (1985)) transplants or implant cancer cell or tissue in nude mice. For example, the animal model of breast cancer comprises the nude mice (such as Yue etc., the CancerRes.54:5092-5095 (1994) that transplant or implant breast cancer cell or tissue; Glinsky etc., CancerRes.56:5319-5324 (1996); VisonneauAm.J.Path.152:1299-1311 (1998)).
Can be to experimenter, the experimenter who for example grows up experimenter, particularly healthy adult experimenter or have a relevant disease of age uses composition. In the latter case, described method can comprise evaluates experimenter, for example, to characterize symptom or the Other diseases mark of age-related disease, and identify thus that experimenter has nerve degenerative diseases (for example, relevant disease of Alzheimer's disease or age) or to this type of disease-susceptible humans.
Skeletal muscle atrophy
Provide method from this paper disclosure of Klotho fused polypeptide to individuality or the purposes of using to can be used in treatment skeletal muscle atrophy. Amyotrophia comprises that a large amount of neuromusculars, metabolism, immunity and nervous disorders and disease and hunger, auxotrophy, metabolism are coerced, diabetes, aging, muscular dystrophy or myopathy. Amyotrophia occurs in aging course. Amyotrophia also comes from use or the appraxia of the reduction of flesh. Symptom comprises the decline of skeletal muscle tissue quality. In human male, myoplasm amount declined 1/3rd between 50 to 80 years old. More amyotrophic characterization of molecules comprise the rise of ubiquitin ligase and the loss of fribrillin (Furuno etc., J.Biol.Chem., 265:8550-8557,1990). For example, can follow the tracks of the decomposition of these protein by measuring the production of 3-methyl-histidine, the specificity component that described 3-methyl-histidine is actin, and in some flesh, be specificity component (Goodman, Biochem.J.241:121-12,1987 and Lowell of myosin, Deng, Metabolism, 35:1121-112,1986; Stein and Schluter, Am.J.Physiol.Endocrinol.Metab.272:E688-E696,1997). The release of creatine kinase (primary cellular defect mark) (Jackson, etc., Neurology, 41:101104,1991) can be also tell-tale.
Non-Insulin Dependent Diabetes Mellitus
Provide method from this paper disclosure of Klotho fused polypeptide to individuality or the purposes of using to can be used in treatment Non-Insulin Dependent Diabetes Mellitus. Non-Insulin Dependent Diabetes Mellitus is also referred to as " adult's morbidity type " diabetes and diabetes B. Diabetes B also comprises " non-endomorphy type 2 types " and " endomorphy type 2 types ". The insulin secretion of Pancreatico-β-pancreas islet-cell that type ii diabetes can reduce by following sign (1), make the insulin of producing be less than the necessary amounts that keeps blood sugar level balance, and/or (2) " insulin resistance ", wherein health cannot normal response insulin (U.S. Patent No. 5,266,561 and U.S. Patent No. 6,518,069). For example, usually, the insulin level that glucose stimulates cannot rise to 4.0nmol/L above (U.S. Patent No. 5,266,561). The symptom example of type ii diabetes comprises: hyperglycaemia when fasting (U.S. Patent No. 5,266,561); Tired; Polydipsia; Frequent micturition; The dimness of vision; And the infection rate increasing. The molecule instruction of type ii diabetes comprises the islet amyloid sample proteinosis in pancreas.
Neuropathy
Neuropathy can comprise the maincenter and/or the peripheral nerve dysfunction that are caused by systemic disease, the hereditary patient's condition or toxic agent, and it affects motion, sense organ, sensorimotor and autonomic nerve (seeing for example U.S. Patent application No.20030013771). Symptom can depend on the reason of nervous lesion and the special type of affected nerve and difference. For example, the symptom of motor neuropathy comprises clumsiness while carrying out health task, or exhausted after flesh weakness, a small amount of physical sport, stand or difficulty in walking and neuromuscular reflex weaken or do not have (U.S. Patent application No.20030013771). The symptom of AN comprises constipation, and what cardiac arrhythmia and postural hypotension reflected weakens (U.S. Patent application No.20030013771). The neuropathic symptom of sense organ comprises pain and numbness; The tingling sensation of hand, leg or foot; And extremely responsive to contact, and the symptom of retinopathy comprises the dimness of vision, Loss Of Vision, stain and flash of light suddenly.
Alzheimer's disease
Provide the method for this paper disclosure from Klotho fused polypeptide to individuality or the purposes of using to can be used in treatment Alzheimer's disease (AD). Alzheimer's disease is complicated nerve degenerative diseases, and it causes neuronic irreversible loss. An example of the nerve degenerative diseases that is also the relevant patient's condition of age is only provided. The clinical marker of Alzheimer's disease comprises memory, judgement, impaired to the carrying out property of the orientation around health and language. The neurogenic mark of AD comprises regiospecificity neurone loss, amyloid plaques and neurofibrillary tangles. Amyloid plaques is the extracellular patch that contains 4 amyloid (also referred to as Ap or Ap42), and described 4 amyloid is the cleaved products (also referred to as APP) of 8 amyloid precusor protein matter. Neurofibrillary tangles is aggregation in insoluble cell, it is made up of the filament of the MAP of Hyperphosphorylationof abnormally, the amyloid plaques of tightening and neurofibrillary tangles can cause the secondary event (Clark and Karlawish, Ann.Intern.Med.138 (5): 400-410 (2003)) causing by the neurone loss of apoptosis. For example, in the neuron of cultivating, the dependent apoptosis of p-amyloid induction caspase-2-JNeurosci.20 (4): 1386-1392 such as () Troy. In body, plaque deposition can be brought out contiguous neuronic apoptosis in a similar manner.
There is multiple standards, comprise genetic, biochemical, physiological and cognitive standard, can be used in the AD evaluating in experimenter. The symptom of AD and diagnosis are that medical practitioner is known. Some examples of AD symptom and mark are shown in below. Information about these instructions and known other instruction being associated with AD can be used as " AD relevant parameter ". AD relevant parameter can comprise qualitative or quantitative information. The example of quantitative information is the numerical value of one or more tolerance, for example, and the concentration of protein or x-ray tomography figure. Qualitative information can comprise assessment, for example doctor's suggestion or binary ("Yes"/"No") etc. The parameter that AD is relevant comprises that instruction experimenter is not diagnosed as AD or does not have the information of the specific instruction of AD, for example, and the recognition tests result of atypia AD or with the irrelevant heredity APOE polymorphism of AD.
The cognition of carrying out property is impaired is the mark of AD. Thisly impairedly can show as memory, judge, make a decision, to orientation around of health and decline (Nussbaum and Ellis, the NewEngJ.Med.348 (14): 1356351364 (2003)) of language. Other dull-witted form of eliminating can be assisted and be made AD diagnosis. Neuronal death causes carrying out property encephalatrophy in AD patient. Imaging technique (for example Magnetic resonance imaging or computer assisted x-ray tomography art) be can use, injury and/or encephalatrophy that the AD in brain is associated detected.
It is abnormal that AD patient can show the biochemistry that the pathology of disease causes. For example, in AD patient, the tan protein level rising (Andreasen, the ArchNeurol.58:349-350 such as N. (2001)) in celiolymph.
Can reduce the level of amyloid 42 (A, B42) peptide in AD patient's CSF. can increase the level (Ertekein-Taner, N. wait Science290:23032304 (2000)) of Ap42 in AD patient's blood plasma. detect and comprise cell known in the art, immunity and other biological method from the technology that in experimenter's sample, biochemistry is abnormal. instruct about generality, see for example Sambrook&Russell, MolecularCloning:ALaboratoryManual, the 3rd edition, ColdSpringHarborLaboratory, N.Y. (2001), Ausubel etc., CurrentProtocolsinMolecularBiology (GreenePublishingAssociatesandWileyInterscience, N.Y. (1989), (Harrow, and Lane E., D. (1988) Antibodies:ALaboratoryManual, ColdSpringHarborLaboratoryPress, ColdSpringHarbor, NY) technology described and in the version upgrading.
For example, can check the biomolecule relevant to AD with antibody, other immunoglobulin (Ig) and other specific binding ligand, for example protein or other antigen. For example can use one or more specific antibodies to survey sample. Various ways is possible, for example ELISA, mensuration, Western blot hybridization and protein array based on fluorescence. In the art, (2000) .NatureBiotech.18 such as such as DeWildt, 989-994; Lucking etc. (1999) .Anal.Biochem.270,103-111; Ge, H. (2000) .NucleicAcidsRes.28, e3, I-VII; MacBeath, G., and Schreiber, S.L. (2000) .Science289,1760 to 1763; With the method for having described production polypeptide array in WO99/51773A1.
In one is measured, use the non-human animal model (for example mouse model) of AD, for example, for evaluating polypeptide or therapeutic scheme. For example, U.S. Patent No. 6,509,515 have described a kind of this type of animal pattern, and its natural energy is for learning and memory test. Animal in brain tissue with make animal within the short-term after birth (conventionally in birth beginning 1 year, preferably birth starts in 2 to 6 months) develop the level of the neuropathic illness of carrying out property, express amyloid precusor protein (APP) sequence. At embryo stage, preferably, the stage of a cell or fertilized oocyte, be conventionally not later than stage of about 8 cells, APP protein sequence is introduced to the ancestors of animal or animal. Then in the false pregnancy person female as replace-conceive, embryonated egg or embryonic development is pregnant to foot. Amyloid precusor protein gene is introduced to animal embryo to be made to mix chromosome with following state, described state causes the super endogenous expression of amyloid precusor protein, and in the neuropathic disease of the cortex of brain-fringe region carrying out property of development, described region is the region of the brain that for example, significantly affected in carrying out property neuropathy morbid state (AD). In affected transgenic animals, gliosis and clinical manifestation mould are built neuropathic disease. The type aspect of carrying out of sacred disease characterizes by the gliosis of undue growth in the cortex-fringe region of the exploration of minimizing and/or the picked-up/utilization of the deoxy-glucose of motor behavior and minimizing and brain. In addition the change of observing, in some aged animal, observe similar. Some other animal model is also described in US5,387,742; 5,877,399; In 6,358,752 and 6,187,992.
Parkinson's disease
Provide method from this paper disclosure of Klotho fused polypeptide to individuality or the purposes of using to can be used in treatment Parkinson's disease. Parkinson's disease is included in the neurodegeneration of dopaminergic neuron in black substance, and this causes regulating and controlling the nigrostriatum dopamine system retrogression of motor function. This pathology and then cause dyskinesia (for example seeing, and Lotharius etc. Nat.Rev.Neurosci., 3:932-42 (2002)). The example of motor symptoms comprises: motion can not (akinesia), bow-backed posture (stoopedposture), gait difficulty, posture shakiness, stiff live (catalepsy), flesh is stiff and tremble. The example of non-motor symptoms comprises that depression, power shortage, passive, dementia and gastrointestinal function obstacle (be shown in for example Fahn, Ann.N.Y.Acad.Sci., 991:1-14 (2003) and Pfeiffer, LancetNeurol., 2:107-16 (2003)). In the people of 65 to 69 years old, to 1 people, observe Parkinson's disease percent 0.5, and in 80 years old and older people, have percent 1 to 3 (for example to see, Nussbaum etc., N.Engl.J.Med., 348:1356-64 (2003)). Parkinsonian molecular marker comprises the reduction (seeing for example U. S. application No.20020172664) of aromatic series L amino acid decarboxylases (AADC); And in nigrostriatum neuron, the loss of DOPAMINE CONTENT IN RABBIT (is shown in for example Fahn, Ann.N.Y.Acad.Sci., 991:1-14 (2003) and Lotharius etc., Nat.Rev.Neurosci., 3:932-42 (2002)). In some family's cases, relevant (the such as Riess etc. of sudden change in the individual gene of PD and coding alpha-synapse nucleoprotein and Pa Jin albumen (E3 ubiquitin ligase) albumen, J.Neurol.250Suppl1:I310 (2003) and Nussbaum etc., N.Engl.J.Med., 348:1356-64 (2003)). Missense mutation in neuronal specificity C-end ubiquitin hydrolase gene is associated with Parkinson's disease (for example, Nussbaum etc., N.Engl.J.Med., 348:1356-64 (2003)) also.
Huntington's disease
Provide method from this paper disclosure of Klotho fused polypeptide to individuality or the purposes of using to can be used in treatment Huntington's disease. Comprise the mensuration based on biological for the method for evaluating the effect of Klotho fused polypeptide to Huntington's disease and/or measuring its effective dose, for example use mammal (for example mouse, rat, Primate or some other non-humans) or other animal (for example Xenopus laevis, zebra fish or invertebrate, for example fly or nematode). Can obtain the several animal models system of Huntington's disease. See for example Brouillet, FunctionalNeurology15 (4): 239-251 (2000); The Nature399:263-267 such as Ona (1999), the HumMolGenet.6 such as Bates (10): 1633-7 (1997); The J.ofNeurochemistry78:694-703 such as Hansson; And Rubinsztein, D.C., TrendsinGenetics, 1S volume, No.4,202-209 page (about the summary of many animals and the non-human model of HD).
The example of this type of animal model is that transgenic mice strain is R6/2 strain (Cell87:493-506 (1996) such as Mangiarini). R6/2 mouse is genetically modified Huntington's disease mouse, and it crosses the exons 1 (under endogenesis promoter control) of expressing people HD gene. The exons 1 of R6/2 people HD gene has the CAG/ polyglutamine repeat length (average 150 CAG repeat) of expansion. These mouse develop have Ren Hengtingdunshi disease a lot of features progressive, be finally the sacred disease of lethal. In R6/2 mouse, observe the abnormal aggregation that formed by the N end portion of Huntington protein (being encoded by HD exons 1) of part, in cytoplasm and nucleus, all observe 45 Cell90:537-548 (1997) such as () Davies. For example, the human Huntington protein in transgenic animals is by comprising at least 55 CAG repeat and more preferably about 150 CAG repeat gene code. These transgenic animals can develop the phenotype of Huntington's disease sample.
The life-span that these transgenic mices are increased, reduced by the body weight that reduces and be characterized by abnormal gait, tremble when static, the injury gained in sports of hind leg clasping and from being born the hyperactivity hyperkinesia of 8 to 10 weeks characterize (for example R6/2 strain; See the Cell87:493-506 such as Mangiarini (1996)). Phenotype is towards the deterioration of carrying out property of hypokinetic direction. The brain of these transgenic mices also shows that neurochemistry is abnormal and histology is abnormal, for example, the change of neurotransmitter receptor (glutamate, dopaminergic), N-acetyl aspartic acid (mark of the neuron integrality) concentration of minimizing and corpus straitum and the brain size of reduction. Therefore, evaluation can comprise the parameter of assessment and neurotransmitter levels, neurotransmitter receptor level, brain size and corpus straitum Size dependence. In addition the transgenosis part that, in the brain tissue of these animals, existence contains human Huntington protein or the abnormal aggregation (for example, R6/2 transgenic mice strain) of total length. See the Cell87:493-506 (1996) such as such as Mangiarini, the Cell90:537-548 such as Davies (1997), Brouillet, the Proc.Natl.Acad.Sci.USA95:6480-6485 (1998) such as FunctionalNeurology15 (4): 239-251 (2000) and Cha.
For test the test polypeptide described in the application or the effect of known peptide in animal model, for example, by test polypeptide is injected in Animal Circulation, transgenic animals are used to the test polypeptide of variable concentrations. Can in animal, evaluate Huntington's disease sample symptom. Whether the progress of then monitoring Huntington's disease sample symptom (for example, as for mouse model above-mentioned) causes the reduction of symptom or delays with the processing of test polypeptide to determine. In another is measured, monitor the depolymerization of Huntington protein aggregation in these animals. Then can put to death animal, obtain brain section. Then just contain transgenic human Huntington protein, its part or comprise human Huntington protein or the existence of the aggregation of the fusion of its part analysis brain section. This analysis can comprise, for example, brain tissue slice is dyeed with anti-Huntington protein antibody, and (antibody of for example anti-Huntington protein is mouse anti human antibody to add the SA that is conjugated with FITC of antibody of the anti-Huntington protein of identification, SA is that people's antibody is specific), and show protein aggregate by fluorescence microscope.
Can obtain several different methods, evaluate and/or monitor Huntington's disease. Known this sick various clinical symptom and mark. Huntington's disease causes ataxia, spiritual difficulty and cognitive change. Degree, age of onset and the performance of these symptoms can be different. Ataxia can comprise and is called as choreoid quick, random, athetoid motion.
The example that motion is evaluated comprises: ocular pursuit (ocularpursuit), saccade starts (saccadeinitiation), saccade speed (saccadevelocity), dyslalia, processus hyoideus goes out (tongueprotrusion), refer to knock ability (fingertapability), prostrate/to lie on the back, sequentially clench fist-stretch out one's hand-turn over the palm (alofist-hand-palmsequence), arm is stiff, bradykinesia, maximum tension obstacle (trunk, upper and lower extremities), maximum chorea (for example trunk, face, upper and lower extremities), gait, the walking of heel toe (tandemwalking) and retropulsion. treatment example can cause total sports scores 4 (TMS-4) (subscale of UHDRS) in for example change during a year.
Cancer
Provide method from this paper disclosure of Klotho fused polypeptide to individuality or the purposes of using to can be used in treatment cancer. cancer comprise caused by undesired high-caliber Cell Differentiation, undesired low-level apoptosis or the two or cause undesired high-caliber Cell Differentiation, undesired low-level apoptosis or any disease of the two. the example of cancer includes but not limited to: leukaemia (for example acute leukemia, ALL, acute myelocytic leukemia, acute granuloblast leukaemia, acute promyelocytic leukemia, acute myelomonocyte leukaemia, acute monocytic leukemia, Di Guglielmo syndrome, chronic leukemia, chronic myelocytic leukemia, chronic lymphocytic leukemia), polycythemia vera, lymthoma (lymphogranulomatosis, Non-Hodgkin lymphoma), Waldenstrom ' s macroglobulinemia, heavy chain disease and solid tumor, for example sarcoma and cancer (for example fibrosarcoma, myxosarcoma, embryonal-cell lipoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangioendothelial sarcoma, lymphangioendothelial sarcoma, synovialoma, celiothelioma, Ewing sarcoma, leiomyosarcoma, rhabdomyosarcoma, colon cancer, cancer of pancreas, breast cancer, oophoroma, prostate cancer, squamous cell carcinoma, basal-cell carcinoma, gland cancer, syringocarcinoma, carcinoma of sebaceous glands, papillary carcinoma, papillary adenocarcinoma, cystadenocarcinoma, cephaloma, bronchiolar carcinoma, clear-cell carcinoma, liver cancer, cholangiocarcinoma, choriocarcinoma, seminoma, embryonal carcinoma, wilm tumor (Wilm ' stumor), cervical carcinoma, the cancer of the uterus, carcinoma of testis, lung cancer, ED-SCLC, carcinoma of urinary bladder, epithelioma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neurinoma, Oligodendroglioma, neurinoma, meningioma, melanoma, neuroblastoma and retina theca cell knurl). lymphocytosis venereal disease disease is also considered to proliferative diseases.
All patents, patent application and the disclosed bibliography of mentioning be herein overall by reference and as this paper all. Although herein disclosure shows and describes with reference to its embodiment is special, it will be appreciated by those skilled in the art that wherein and can carry out multiple change in form and details, and can not depart from the included this paper scope of the disclosure of claims.
5. embodiment
Expression and the purifying of embodiment 1Klotho fused polypeptide
The expression of Klotho fused polypeptide
Encode and there is the expression vector transient transfection HEK293T cell preparation polypeptide of disclosure herein of the extracellular domain of α Klotho and the Klotho fused polypeptide of FGF23 (R179Q) variant by use. The transient transfection of the expression plasmid separately by Klotho, FGF23 and Klotho-FGF23 (R179Q) fusion, generates the conditioned medium of the polypeptide that contains expression. Use Lipofectamine2000 (Invitrogen, Cat#11668-019), in 6 orifice plates, carry out transfection. After transfection 5 hours, add 1%FBS with 3mlDMEM and replace transfection mixture. Add 3mlDMEM add 1%FBS after 72 hours, collection condition culture medium. Separate the sample from the multiple conditioned medium through the HEK293T of transient transfection cell by SDS-polyacrylamide gel electrophoresis (SDS-PAGE), and analyze by Western blot hybridization (Fig. 3 A), or with Coomassie blue stain (Fig. 3 B).
Several samples is carried out to SDS-polyacrylamide gel electrophoresis (the 1st road: contrast; The 2nd road: FGF23; The 3rd road, sKlotho; 4-6 road, sKlotho-FGF23). Coomassie blue stain has disclosed high, the expression of > 180kDa band (Fig. 3 B, as right arrow instruction), and it does not exist in the sample 1-3 road containing not with the carrier transfection of encoded K lotho fused polypeptide. Be secreted into the quality (Fig. 3 A) of the Klotho fused polypeptide of culture medium by the evaluation of Western blot hybridization. Use anti-FGF23 rat monoclonal IgG2A (R&DSystems, Cat#MAB26291) to detect Klotho fused polypeptide as first antibody to pass through Western blot hybridization. Western blot hybridization has verified that at the extra band of observing in the gel of coomassie dyeing be Klotho fused polypeptide. Western blot hybridization has verified that Klotho fused polypeptide has the molecular weight of Klotho fused polypeptide expection. This analysis has shown the expression of Klotho-FGF23 (R179Q) fusion.
The purifying of Klotho fused polypeptide
From having with coding the conditioned medium of culture of the HEK293T cell of the expression vector transient transfection of the extracellular domain of α Klotho and the Klotho fused polypeptide of FGF23R179Q variant, purifying is the polypeptide of disclosure herein. For formation condition culture medium, expression vector (18mlOptiMEM1 (the GIBCO of transfection coding sKlotho-FGF23-6xHis, Cat#11058) 500 μ gDNA in mix with 18ml2 μ g/ml polymine (PEI), enter at the HEK293 cell of expressing suspension growth in culture medium) (express 10 in culture medium (GIBCO, Cat#12338) at Freestype2936The 464mlHEK293T cell of individual cell/ml). After transfection, allow culture growth (120 hours; 37 DEG C, in 5%CO2In incubator; Under 125rpm, vibrate). In the time hatching end, by centrifugal (1000rpm carries out 5 minutes) results conditioned medium. Then conditioned medium is applied on nickel-agarose column. SKlotho-FGF23-6xHis and post are combined closely and are used 50mM imidazoles to carry out wash-out. Then the purified material obtaining is dialysed in PBS, to remove imidazoles. Separate sample (the 1st road, the purified sKlotho-FGF23-6xHis of purified sKlotho-FGF23-6xHis by SDS-PAGE; The 2nd road, molecular weight marker), and pass through with Coomassie blue stain analysis (Fig. 3 C). Dyed SDS-PAGE gel checking, purified sKlotho-FGF23-6xHis has the molecular weight of expection. Loading in the road of purified material, cannot detect corresponding to the band of the protein of total length sKlotho-FGF23-6xHis not and also show that sKlotho-FGF23-6xHis is purified.
Embodiment 2: the external test of assessment Klotho fused polypeptide activity
Egr-1-luciferase
In Egr-1-luciferase reporter gene is measured, the BA of the α Klotho fused polypeptide that test is expressed. The combination of Klotho fused polypeptide and FGF23 acceptor causes the downstream activation of Egr-1 and the expression by the luciferase reporter gene of Egr-1 promoter regulation. Egr-1-luciferase reporter gene is building of reporting based on (Nature, 2006, the 444 volumes, 770-774) such as Urakawa. With the HEK293T cell of inoculating in the poly-D-Lys plate of Egr-1-luciferase reporter gene and transfection standardization reporter (Renilla luciferase) together transfection 48 holes. Egr-1 luciferase reporter gene transfection five hours afterwards, adds 1%FBS with 3mlDMEM and replaces transfection mixture. Add 3mlDMEM and add 1%FBS 72 hours afterwards, collection condition culture medium. After five hours, with the sample replacement transfection mixture of activity to be measured. In initial experiment, in Egr-1-luciferase reporter gene is measured, there are or not exist 20 μ g/ml heparin (Sigma, Cat#H8537; Be dissolved in DMEM as 2mg/ml storage liquid) situation under, test 50% conditioned medium and (only have culture medium, or contain Klotho, FGF23, Klotho and FGF23, and Klotho-FGF23 (R179Q) fusion) and there is the 50%DMEM (Fig. 4) of 1%FBS. Further experiment is used the purified polypeptide (Fig. 5 A and 5B) of definite amount. After 20 hours in passive lysis buffer (Promega, Cat#E194A) cell lysis, and use Dual-Glo luciferase assay system (Promega, Cat#E2940) measure uciferase activity.
In initial experiment, in not classified conditioned medium, show Klotho fused polypeptide activity. Use Egr-1-luciferase reporter gene (Fig. 4), these multiples changes of test expression to luciferase reporter gene are in addition quantitative. The conditioned medium of the combination of the extracellular domain that contains FGF23 and Klotho albumen has activated Egr-1-luciferase, and the conditioned medium that only contains the conditioned medium of FGF23 or only contain the extracellular domain of Klotho does not activate Egr-1-luciferase. The conditioned medium that contains fusion sKlotho-FGF23 (R179Q) has activated Egr-1-luciferase reporter gene, and this is contrary with the conditioned medium that only contains FGF23 or Klotho. In these experiments, the conditioned medium that contains fusion sKlotho-FGF23 (R179Q) is significantly better than the conditioned medium of the combination that contains FGF23 and Klotho to the activation of Egr-1-luciferase reporter gene. In the time there is heparin, significantly strengthened by the conditioned medium that contains fusion sKlotho-FGF23 (R179Q) and the induction of the conditioned medium of the combination that contains FGF23 and Klotho. Table 1 has been listed the relative expression of multiple FGF-Klotho fused polypeptide in conditioned medium, and in Egr-1-luciferase reporter gene is measured corresponding to the relative activity of the not classified conditioned medium of multiple FGF-Klotho fused polypeptide.
Table 1sKlotho-FGF23 merges expression and the activity of variant
*Lack the result that activity may be low expression.
Use definite amount, use the purification process purifying of describing in embodiment 1 to carry out Egr-1-luciferase reporter gene mensuration from the protein of conditioned medium. With use before the result of not classified conditioned medium of the polypeptide that contains expression consistent, cause luciferase reporter gene activity with the processing of the combination of purified FGF23 and sKlotho, but only process and do not cause activity (Fig. 5 A) with purified FGF23. Also depend on the dosage of purified sKlotho from the luciferase reporter gene activity of the combination of purified FGF23 and sKLotho, and the existence that this effect can be passed through heparin (20 μ g/ml) strengthens. In Egr-1-luciferase reporter gene is measured, can be low to moderate about 1.21nM (1.2 times of changes) and at least under the concentration of the about 19.3nM of as many as (2.4 times of changes), detect the effect (Fig. 5 B) of sKlotho-FGF23-6xHis fused polypeptide to uciferase activity. In the time there is heparin (20 μ g/ml), the activity of sKlotho-FGF23-6xHis fused polypeptide significantly strengthens uciferase activity. In the time there is heparin, the effect (2.0 times change) of sKlotho-FGF23-6xHis fused polypeptide to uciferase activity can under the concentration that is low to moderate about 0.6nM, be detected. Result demonstration, purified sKlotho-FGF23-6xHis has induced EGR-1-luc reporter in dose dependent mode, and has shown the processing of carrying out with sKlotho-FGF23-6xHis.
Embodiment 3 assesses the external test of the effect of Klotho fused polypeptide to myocyte
The biological action of the Klotho fused polypeptide that the test of C2C12 sarcoblast is expressed. Cause the phosphorylation of myotube growth and signal transferrin with IGF-1, FGF2 or sKlotho-FGF23 processing C2C12 sarcoblast. C2C12 sarcoblast is inoculated in to (3 parts of DMEM and 1 part of F12), 10%FBS, 1%Glut in the growth medium in the gather-D-Lys in 6 holes and the plate of fibronectin coating with the density of 40,000 cells/well; 1%P/S; 1% linoleic acid; 0.1%ITS:[insulin (10mg/ml), transferrins (5.5mg/ml) and selenium (5ng/ml)]. After sarcoblast reaches and converges (3 days), culture medium is changed to differential medium, and (DMED, has 2% horse serum; 1%Glut; 1%P/S).
Test for myotube diameter, converge culture medium and be changed to differential medium three days afterwards, in the situation that not there is not or exist dexamethasone (100 μ M), in differential medium, process cell 24 hours with IGF-1 (10nM), FGF2 (20ng/ml) or sKlotho-FGF23 (20nM). In the time that processing finishes, with glutaraldehyde (in PBS 5%) fixed cell, and collect multiple fluoroscopic images. Use PipelinePilot program to measure myotube diameter, to determine undue growth or atrophy.
Test for signal transferrin phosphorylation, converge culture medium and be changed to differential medium three days afterwards, make cell hungry four hours with the DMEM that there is no FBS, then in the situation that not there is not or exist rapamycin (40nM), use IGF-1 (10nM), FGF2 (20ng/ml) or sKlotho-FGF23 (20nM) to process 30 minutes. In the situation that there is protease and inhibitors of phosphatases, cell lysis in RIPA buffer solution. Carry out the analysis of Western blot hybridization and carry out detection membrane by the different antibodies shown in figure, and develop on X-ray film, film is scanned.
The result demonstration of this research, sKlotho-FGF23 causes myotube diameter to increase than contrast, and has induced the C2C12 myotube undue growth (Fig. 5 A) similar to the result of IGF-1 and FGF2. In addition,, based on myotube diameter measurement, process the myotube atrophy that can partly reverse induced by dexamethasone with sKlotho-FGF23, IGF-1 and FGF2. In the time not existing or have dexamethasone, on myotube morphology, do not observe difference between sKlotho-FGF23 and FGF2 (by microtubule thickness measure). The trophism of sKlotho-FGF23, IGF-1 and FGF2 is statistically significant.
With consistent to the effect of C2C12 myotube, in C2C12 myotube, the transmission of sKlotho-FGF23 fusion signal causes p70S6K and ERK but not the phosphorylation (Fig. 5 B) of AKT or FoxO. The effect that sKlotho-FGF23 transmits signal is similar to the effect that FGF2 transmits signal, but the effect of signal being transmitted from IGF-1 is different. The degree of observing the ERK phosphorylation by sKlotho-FGF23 is less than by the degree of the ERK phosphorylation of IGF-1 or FGF2. The phosphorylation of p70S6K by sKlotho-FGF23 is rapamycin sensitiveness. Relating in the experiment of C2C12 cell, carry out activation signals transmission without heparin. These results demonstrations, sKlotho-FGF23 fused polypeptide has activated the signal transmission in C2C12 myotube.
The fused polypeptide that embodiment 4 comprises sKlotho, FGF23 and FcLALA
Use the modified Fc fragment of sKlotho, FGF23 and antibody to build multiple fused polypeptide. These modified Fc molecules have (minimizing) of change and the combination of FcRn, and have thus the serum half life of increase. They also have the bioavailability of modification and transporting to the change of other target in mucomembranous surface and body. In this example, FGF23 and sKlotho merge to FcLALA, and this is in U.S. Patent No. 7,217,798 and the 2007Nature449:101-104 such as Hessell in described. What between the various ingredients of these fused polypeptide, get involved is connexon, described in the 1998Proc.Natl.Acad.Sci.USA95:2475-2480 such as Lode. These fusions are inserted into construct, for example, in pcDNA3.1 (Invitrogen, Carlsbad, CA), and are expressed in HEK293 cell.
A.sKlotho-FGF23-FcLALAv1
Build fusion, it comprises: sKlotho, connexon, FGF23, another connexon and FcLALA. This embodiment is named as sKlotho-FGF23-FcLALAv1, is shown in SEQIDNO:46 and 47 below.
The nucleotide sequence (wherein initial ATG is as 1) of sKlotho-FGF23-FcLALAv1 is shown SEQIDNO:46.
The amino acid sequence of sKlotho-FGF23-FcLALAv1 is shown SEQIDNO:47 hereinafter.
In this sequence, the various ingredients of fusion is as follows:
SKlotho:1-982; Connexon 1:983-1001; FGF23:1002-1228; Connexon 2; 1229-1233; FcLALA:1234-1459.
B.sKlotho-FGF23-FcLALAv2
Build fusion, it comprises: sKlotho, connexon, FGF23, another connexon and FcLALA. This embodiment is named as sKlotho-FGF23-FcLALAv2, is shown in SEQIDNO:48 and 49 below.
The nucleotide sequence (wherein initial ATG is as 1) of sKlotho-FGF23-FcLALAv2 is shown SEQIDNO:48.
The amino acid sequence of sKlotho-FGF23-FcLALAv2 is shown SEQIDNO:49 hereinafter.
In this sequence, the various ingredients of fusion is as follows:
SKlotho:(aa or amino acid) 1-982; Connexon 1:983-1001; FGF23:1002-1228; Connexon 2; 1229-1233; FcLALA:1234-1450.
As described herein or as known in the art, can build other fused polypeptide by combine FGF, Klotho, modified Fc fragment and (optionally) connexon sequence and variant thereof and its derivative with multiple combination.
The fused polypeptide that embodiment 5 comprises FGF23 and FcLALA
As U.S. Patent No. 7,217, described in 798, build multiple fused polypeptide by the modified Fc fragment of FGF23 and antibody. These modified Fc molecules have (minimizing) of change and the combination of FcRn, and have thus the serum half life of increase. They also have through the bioavailability of modification and transporting to the change of other target in mucomembranous surface and body. In this example, FGF23 merges to FcLALA. What between the various ingredients of these fused polypeptide, get involved is connexon, as described in the 1998Proc.Natl.Acad.Sci.USA95:2475-2480 such as Lode. These fusions are inserted into construct, for example, in pcDNA3.1 (Invitrogen, Carlsbad, CA), and are expressed in HEK293 cell.
C.FGF23-FcLALAv1
Build fusion, it comprises: FGF23, connexon and FcLALA. This construct is named as FGF23-FcLALAv1, and is shown hereinafter SEQIDNO:50 and 51.
The nucleotide sequence (wherein initial ATG is as 1) of FGF23-FcLALAv1 is shown SEQIDNO:50 hereinafter.
The amino acid sequence of FGF23 (R179Q)-FcLALAv1 is shown SEQIDNO:51 hereinafter.
In this sequence, the various ingredients of fusion is as follows:
FGF23:(aa) 1-251; Connexon: 252-256; FcLALA:257-482.
D.FGF23-FcLALAv2
Build fusion, it comprises: FGF23-FcLALAv2, it comprises FGF23 and FcLALA.
The nucleotide sequence (wherein initial ATG is as 1) of FGF23-FcLALAv2 is below being shown SEQIDNO:52.
The amino acid sequence of FGF23 (R179Q)-FcLALAv2 is shown SEQIDNO:53 hereinafter.
In this sequence, the various ingredients of fusion is as follows:
FGF23:1-251; Connexon: 252-256; FcLALA:257-473.
As described herein or as known in the art, can be by combine FGF sequence, modified Fc fragment and (optionally) connexon with multiple combination, and variant and its derivative build other fused polypeptide.
E. measured by the activation of the Egr-1-luc reporter of sKlotho-FGF23 (R179Q)-FcLALA fusion; The activation of the Egr-1-luc reporter by FGF23 (R179Q)-FcLALA albumen; And the pharmacokinetics spectrum of FGF23 (R179Q) to FGF23 (R179Q)-FcLaLav2.
Fig. 7 has shown by the activation of the Egr-1-luc reporter of sKlotho-FGF23 (R179Q)-FcLALA fusion. With Egr-1-luc reporter transient transfection HEK293T cell, and with instruction conditioned medium incubated cell in the situation that not there is not or exist 20 μ g/ml heparin. Then after 18 hours, measure uciferase activity. Result demonstration, sklotho-FGF23-FcLALA fusion has been induced reporter gene activity. In the time there is heparin, these inductions significantly strengthen. SKF-Fcv1:sKlotho-FGF23-FcLALAv1; SKF-Fcv2:sKlotho-FGF23-FcLALAv2
Fig. 8 has shown by the activation of the Egr-1-luc reporter of FGF23 (R179Q)-FcLALA albumen. With transient transfection HEK293T cell together with the total length cross-film form of Egr-1-luc reporter and Klotho, and with 30% conditioned medium incubated cell of instruction. Then after 18 hours, measure uciferase activity. Result demonstration, FGF23-FcLALA fusion has been induced reporter gene activity in the mode similar to FGF23.
Fig. 9 has shown the pharmacokinetics spectrum of FGF23 (R179Q) to FGF23 (R179Q)-FcLALAv2. With 2mg/kg, every group of four mouse are carried out to hypodermic injection with FGF23 (R179Q)-6xHis or FGF23 (R179Q)-FcLALAv2. In the time of instruction, collect blood serum sample, and by elisa assay FGF23. FGF23 (R179Q)-FcLALA concentration in serum keeps raising at the time point of 24 hours, and FGF23 (R179Q)-6xHis gets back to foundation level. This result shows, adds FcLALA, and in the body of FGF23 (R179Q), half life significantly improves.
Embodiment 6 is sKlotho-FGF23 fusion effect in the body strengthening in flesh growth after the amyotrophia of induced by dexamethasone
Experimental data demonstration, after the amyotrophia of induced by dexamethasone, the intramuscular injection of sKlotho-FGF23 has significantly strengthened the growth of myoplasm amount. In this experiment, use the peptide corresponding to SEQIDNO:41.
Figure 10 has shown that the absolute weight (A) of gastrocnemius-musculus soleus-sole of the foot flesh (GSP) muscle and weight percent change (B), after showing the amyotrophia of induced by dexamethasone, than intramuscular injection sKlotho (sKLO) or phosphate buffered saline (PBS) (PBS), the intramuscular injection of sKlotho-FGF23 (KLOFGF) has significantly strengthened the regrowth of myoplasm amount.
By eight 15 week age male C57BL/6 mouse be randomized into 8 groups according to body weight, every group of 10 mouse. Four groups obtain and there is no the water (W21d) of DEX, and other four groups reach three weeks with the DEX (D21d) obtaining in drinking water for 2.4mg/kg/ days. After three weeks, stop DEX and process, and put to death immediately a W21d group and a D21d group, process the amyotrophia degree of induction to set up DEX. Allow remaining three groups of W21d or D21d mouse to recover other 14 days (R14d), they obtain respectively 2x50 μ lPBS, sKlotho-FGF23 (KLOFGF during this period; 1.6mg/ml) or sKlotho (sKLO; Intramuscular injection 1.6mg/ml), is every other day injected in right side gastrocnemius-musculus soleus-sole of the foot flesh muscle complex. After last intramuscular injection 24 hours, put to death mouse, measure flesh weight, and be expressed as absolute weight (A) or change than the percentage of W21d+PBS group.
These data have shown amyotrophia sKlotho-FGF23 fusion effect in the body strengthening in flesh growth afterwards of induced by dexamethasone.
Additional mutations in the FGF23 part of embodiment 7 fusions, described sudden change has reduced gathering, has reduced the cutting of undesired protease induction and increased production.
The some sudden changes in the FGF23 part of sKlotho-FGF23 and FGF23-FcLaLa fused polypeptide are studied. These comprise Q156, C206 and C244 (wherein numeral is based on FGF23 amino acid sequence). The example of each sudden change comprises Q156A, C206S and C244S, and sudden change in any these sites can with sudden change (for example R179Q) combination at R179. Example series is provided in the SEQIDNO:54 to 68 of Fig. 2.
Suspect that C206 and C244 relate to dimerization; And Q156 is the site that is accredited as the responsive site of protease by inventor. Be the quality that any other amino acid has strengthened protein by these amino acid mutations, this is that the protein production of being assembled, reducing the cutting of undesired protease induction and increased cell by reduction realizes, and does not disturb FGF23 activity. This is beat all result, because guard in the FGF23 albumen that these three sites are found in people, rhesus macaque, ox, Mouse and rat. This conservative be shown in below between SEQIDNO:69,70,71,72 and 73 relatively in, Q156, C206 and C244 adopt runic underscore font.
hFGF23MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
Rhesus macaque MLGARLRLWVCALCSVCSMSVIRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIH KNGH
Ox MLGARLGLWVCTLSCV-----VQAYPNSSPLLGSSWGGLTHLYTATARNSYHLQIH GDGH
Mouse MLGTCLRLLVGVLCTVCSLGTARAYPDTSPLLGSNWGSLTHLYTATARTSYHLQIH RDGH
Rat MLGACLRLLVGALCTVCSLGTARAYSDTSPLLGSNWGSLTHLYTATARNSYHLQIH RDGH
hFGF23VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
Rhesus macaque VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFNPENCRFR HWTL
Ox VDGSPQQTVYSALMIRSEDAGFVVITGVMSRRYLCMDFTGNIFGSHHFSPESCRFR QRTL
Mouse VDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFR QWTL
Rat VDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFR QWTL
hFGF23ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSFLSRRNEIPLIHFNTPI-PRRHTR
Rhesus macaque ENGYDVYHSPQHHFLVSLGRAKRAFLPGMNPPPYSFLSRRNEIPLIHFNTPR-PRRHTR
Ox ENGYDVYHSPQHRFLVSLGRAKRAFLPGTNPPPYAFLSRRNEIPLPHFAATARPRRHTR
Mouse ENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSFLARRNEVPLLHFYTVR-PRRHTR
Rat ENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSFLARRNEVPLLHFYTAR-PRRHTR
hFGF23SAEDDSERDPLNVLKPRARMTPAPASSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGT
Rhesus macaque SAEDDSERDPLNVLKPRARMTPAPASSQELPSAEDNSPVASDPLGVVRGGRVNTHAGGT
Ox SAHDSG--DPLSVLKPRARATPVPAASQELPSAEDSGPAASDPLGVLRGHRLDVRAGSA
Mouse SAEDPPERDPLNVLKPRPRATPVPVSSRELPSAEEGGPAASDPLGVLRRGRGDARGGAG
Rat SAEDPPERDPLNVLKPRPRATPIPVSSRELPSAEEGGPAASDPLGVLRRGRGDARRGAG
hFGF23GPEGRPFAKFI(SEQIDNO:69)
Rhesus macaque GPEARPFPKFI(SEQIDNO:70)
Ox GAERRPFPGFA(SEQIDNO:71)
Mouse GADRRPFPRFV(SEQIDNO:72)
Rat GTDRRPFPRFV(SEQIDNO:73)
In Figure 11, show that these three kinds of sudden changes do not hinder the fact of FGF23 activity. The figure illustrates by the activation of the Egr-1-luc reporter of FGF23 (R179Q)-FcLALA and Q156A, C206S, C244S and C206S/C244S mutant.
With EGR-1-luc reporter transient transfection HEK293T cell together with the total length cross-film form of Klotho and the FGF23-FcLaLa mutant of instruction. Then after 18 hours, measure uciferase activity. Result demonstration, C206S, C244S, C206S/C244S (three independent clonings) and Q156A (three independent clonings) mutant are in activation EGR-1-Luc reporter gene activity, effective on an equal basis with FGF23-FcLALA fusion.
The data demonstration showing in Figure 12, sudden change C244 and C206 have changed dimerization and the gathering of FGF23. The figure illustrates the protein quality of WT, Q156A, C206S, C244S and the C206S/C244S mutant of FGF23 (R179Q)-FcLaLa. Use FGF23 antibody, analyze the conditioned medium of the HEK293T cell of the FGF23-FcLaLa expression vector transient transfection of the instruction of using by oneself by Western blot hybridization. Result demonstration, C206S/244S sudden change has stoped protein dimerization and Q156A sudden change to have the proteolytic fragments of reduction.
Therefore, surprisingly, although these Q156, C206 and C244 residue are conservative between species, they also can be suddenlyd change, and can not reduce FGF23 activity, and can be assembled and be cut and produce by raising the quality of Enhancin matter by reduction.
Unless otherwise defined, technology used herein and scientific terminology have be familiar with disclosure herein under common the understood identical implication of expert in field.
Unless otherwise directed, do not have at length specifically described all methods, step, technology and operation can and carry out according to known mode itself, this will be technical staff institute clearly. Again for example, can be with reference to manual of standards mentioned in this article and general background technology and other bibliography of wherein mentioning.
Claim of the present invention is nonrestrictive, and is provided in hereinafter.
Although disclose in detail specific embodiment and claim herein, but this only carries out with way of example for illustration purposes, this scope that is not intended to the claim theme of scope to claims or any corresponding following application is limited. Especially, inventor considers to carry out multiple replacement, variation and improvement to this paper disclosure, and does not depart from aim and the scope of this paper disclosure as defined in claim. Believe that to nucleic acid parent material or object clone's selection be that those of ordinary skill in the art can conventional carry out on the basis of knowing embodiment described herein. Other side, advantage and improvement are considered within the scope of the following claims. The scope that rewrites claim in the corresponding application of submitting to from now on may be the restriction due to multiple national patent methods, and is not appreciated that the theme of withdrawing a claim and requiring.
Sequence table (Fig. 2)
People Klotho nucleotide sequence (NM_004795) (SEQIDNO:1)
Coded protein region: 9-3047
1cgcgcagcatgcccgccagcgccccgccgcgccgcccgcggccgccgccgccgtcgctgt
61cgctgctgctggtgctgctgggcctgggcggccgccgcctgcgtgcggagccgggcgacg
121gcgcgcagacctgggcccgtttctcgcggcctcctgcccccgaggccgcgggcctcttcc
181agggcaccttccccgacggcttcctctgggccgtgggcagcgccgcctaccagaccgagg
241gcggctggcagcagcacggcaagggtgcgtccatctgggatacgttcacccaccaccccc
301tggcacccccgggagactcccggaacgccagtctgccgttgggcgccccgtcgccgctgc
361agcccgccaccggggacgtagccagcgacagctacaacaacgtcttccgcgacacggagg
421cgctgcgcgagctcggggtcactcactaccgcttctccatctcgtgggcgcgagtgctcc
481ccaatggcagcgcgggcgtccccaaccgcgaggggctgcgctactaccggcgcctgctgg
541agcggctgcgggagctgggcgtgcagcccgtggtcaccctgtaccactgggacctgcccc
601agcgcctgcaggacgcctacggcggctgggccaaccgcgccctggccgaccacttcaggg
661attacgcggagctctgcttccgccacttcggcggtcaggtcaagtactggatcaccatcg
721acaacccctacgtggtggcctggcacggctacgccaccgggcgcctggcccccggcatcc
781ggggcagcccgcggctcgggtacctggtggcgcacaacctcctcctggctcatgccaaag
841tctggcatctctacaatacttctttccgtcccactcagggaggtcaggtgtccattgccc
901taagctctcactggatcaatcctcgaagaatgaccgaccacagcatcaaagaatgtcaaa
961aatctctggactttgtactaggttggtttgccaaacccgtatttattgatggtgactatc
1021ccgagagcatgaagaataacctttcatctattctgcctgattttactgaatctgagaaaa
1081agttcatcaaaggaactgctgacttttttgctctttgctttggacccaccttgagttttc
1141aacttttggaccctcacatgaagttccgccaattggaatctcccaacctgaggcaactgc
1201tttcctggattgaccttgaatttaaccatcctcaaatatttattgtggaaaatggctggt
1261ttgtctcagggaccaccaagagagatgatgccaaatatatgtattacctcaaaaagttca
1321tcatggaaaccttaaaagccatcaagctggatggggtggatgtcatcgggtataccgcat
1381ggtccctcatggatggtttcgagtggcacagaggttacagcatcaggcgtggactcttct
1441atgttgactttctaagccaggacaagatgttgttgccaaagtcttcagccttgttctacc
1501aaaagctgatagagaaaaatggcttccctcctttacctgaaaatcagcccctagaaggga
1561catttccctgtgactttgcttggggagttgttgacaactacattcaagtagataccactc
1621tgtctcagtttaccgacctgaatgtttacctgtgggatgtccaccacagtaaaaggctta
1681ttaaagtggatggggttgtgaccaagaagaggaaatcctactgtgttgactttgctgcca
1741tccagccccagatcgctttactccaggaaatgcacgttacacattttcgcttctccctgg
1801actgggccctgattctccctctgggtaaccagtcccaggtgaaccacaccatcctgcagt
1861actatcgctgcatggccagcgagcttgtccgtgtcaacatcaccccagtggtggccctgt
1921ggcagcctatggccccgaaccaaggactgccgcgcctcctggccaggcagggcgcctggg
1981agaacccctacactgccctggcctttgcagagtatgcccgactgtgctttcaagagctcg
2041gccatcacgtcaagctttggataacgatgaatgagccgtatacaaggaatatgacataca
2101gtgctggccacaaccttctgaaggcccatgccctggcttggcatgtgtacaatgaaaagt
2161ttaggcatgctcagaatgggaaaatatccatagccttgcaggctgattggatagaacctg
2221cctgccctttctcccaaaaggacaaagaggtggccgagagagttttggaatttgacattg
2281gctggctggctgagcccattttcggctctggagattatccatgggtgatgagggactggc
2341tgaaccaaagaaacaattttcttcttccttatttcactgaagatgaaaaaaagctaatcc
2401agggtacctttgactttttggctttaagccattataccaccatccttgtagactcagaaa
2461aagaagatccaataaaatacaatgattacctagaagtgcaagaaatgaccgacatcacgt
2521ggctcaactcccccagtcaggtggcggtagtgccctgggggttgcgcaaagtgctgaact
2581ggctgaagttcaagtacggagacctccccatgtacataatatccaacggaatcgatgacg
2641ggctgcatgctgaggacgaccagctgagggtgtattatatgcagaattacataaacgaag
2701ctctcaaagcccacatactggatggtatcaatctttgcggatactttgcttattcgttta
2761acgaccgcacagctccgaggtttggcctctatcgttatgctgcagatcagtttgagccca
2821aggcatccatgaaacattacaggaaaattattgacagcaatggtttcccgggcccagaaa
2881ctctggaaagattttgtccagaagaattcaccgtgtgtactgagtgcagtttttttcaca
2941cccgaaagtctttactggctttcatagcttttctattttttgcttctattatttctctct
3001cccttatattttactactcgaagaaaggcagaagaagttacaaatagttctgaacatttt
3061tctattcattcattttgaaataattatgcagacacatcagctgttaaccatttgcacctc
3121taagtgttgtgaaactgtaaatttcatacatttgacttctagaaaacatttttgtggctt
3181atgacagaggttttgaaatgggcataggtgatcgtaaaatattgaataatgcgaatagtg
3241cctgaatttgttctctttttgggtgattaaaaaactgacaggcactataatttctgtaac
3301acactaacaaaagcatgaaaaataggaaccacaccaatgcaacatttgtgcagaaatttg
3361aatgacaagattaggaatattttcttctgcacccacttctaaatttaatgtttttctgga
3421agtagtaattgcaagagttcgaatagaaagttatgtaccaagtaaccatttctcagctgc
3481cataataatgcctagtggcttcccctctgtcaaatctagtttcctatggaaaagaagatg
3541gcagatacaggagagacgacagagggtcctaggctggaatgttcctttcgaaagcaatgc
3601ttctatcaaatactagtattaatttatgtatctggttaatgacatacttggagagcaaat
3661tatggaaatgtgtattttatatgatttttgaggtcctgtctaaaccctgtgtccctgagg
3721gatctgtctcactggcatcttgttgagggccttgcacataggaaacttttgataagtatc
3781tgcggaaaaacaaacatgaatcctgtgatattgggctcttcaggaagcataaagcaattg
3841tgaaatacagtataccgcagtggctctaggtggaggaaaggaggaaaaagtgcttattat
3901gtgcaacattatgattaatctgattatacaccatttttgagcagatcttggaatgaatga
3961catgacctttccctagagaataaggatgaaataatcactcattctatgaacagtgacact
4021actttctattctttagctgtactgtaatttctttgagttgatagttttacaaattcttaa
4081taggttcaaaagcaatctggtctgaataacactggatttgtttctgtgatctctgaggtc
4141tattttatgtttttgctgctacttctgtggaagtagctttgaactagttttactttgaac
4201tttcacgctgaaacatgctagtgatatctagaaagggctaattaggtctcatcctttaat
4261gccccttaaataagtcttgctgattttcagacagggaagtctctctattacactggagct
4321gttttatagataagtcaatattgtatcaggcaagataaaccaatgtcataacaggcattg
4381ccaacctcactgacacagggtcatagtgtataataatatactgtactatataatatatca
4441tctttagaggtatgattttttcatgaaagataagcttttggtaatattcattttaaagtg
4501gacttattaaaattggatgctagagaatcaagtttattttatgtatatatttttctgatt
4561ataagagtaatatatgttcattgtaaaaatttttaaaacacagaaactatatgcaaagaa
4621aaaataaaaattatctataatctcagaacccagaaatagccactattaacatttcctacg
4681tattttattttacatagatcatattgtatatagttagtatctttattaatttttattatg
4741aaactttcctttgtcattattagtcttcaaaagcatgatttttaatagttgttgagtatt
4801ccaccacaggaatgtatcacaacttaaccgttcccgtttgttagactagtttcttattaa
4861tgttgatgaatgttgtttaaaaataattttgttgctacatttactttaatttccttgact
4921gtaaagagaagtaattttgctccttgataaagtattatattaataataaatctgcctgca
4981actttttgccttctttcataatc
Klotho amino acid sequence (NP_004786) (SEQIDNO:2)
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQGT
61FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPA
121TGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERL
181RELGVQPVVTLYHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNP
241YVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEKKFI
361KGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHPQIFIVENGWFVS
421GTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVD
481FLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQ
541FTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENP
661YTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRH
721AQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWLNQ
781RNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLN
841SPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPETLE
961RFCPEEFTVCTECSFFHTRKSLLAFIAFLFFASIISLSLIFYYSKKGRRSYK
β-Klotho nucleotide sequence (NM_175737) (SEQIDNO:3)
Coded protein region: 98-3232
1atcctcagtctcGcagttcaagctaatcattgacagagctttacaatcacaagcttttac
61tgaagctttgataagacagtccagcagttggtggcaaatgaagccaggctgtgcggcagg
121atctccagggaatgaatggattttcttcagcactgatgaaataaccacacgctataggaa
181tacaatgtccaacgggggattgcaaagatctgtcatcctgtcagcacttattctgctacg
241agctgttactggattctctggagatggaagagctatatggtctaaaaatcctaattttac
301tccggtaaatgaaagtcagctgtttctctatgacactttccctaaaaactttttctgggg
361tattgggactggagcattgcaagtggaagggagttggaagaaggatggaaaaggaccttc
421tatatgggatcatttcatccacacacaccttaaaaatgtcagcagcacgaatggttccag
481tgacagttatatttttctggaaaaagacttatcagccctggattttataggagtttcttt
541ttatcaattttcaatttcctggccaaggcttttccccgatggaatagtaacagttgccaa
601cgcaaaaggtctgcagtactacagtactcttctggacgctctagtgcttagaaacattga
661acctatagttactttataccactgggatttgcctttggcactacaagaaaaatatggggg
721gtggaaaaatgataccataatagatatcttcaatgactatgccacatactgtttccagat
781gtttggggaccgtgtcaaatattggattacaattcacaacccatatctagtggcttggca
841tgggtatgggacaggtatgcatgcccctggagagaagggaaatttagcagctgtctacac
901tgtgggacacaacttgatcaaggctcactcgaaagtttggcataactacaacacacattt
961ccgcccacatcagaagggttggttatcgatcacgttgggatctcattggatcgagccaaa
1021ccggtcggaaaacacgatggatatattcaaatgtcaacaatccatggtttctgtgcttgg
1081atggtttgccaaccctatccatggggatggcgactatccagaggggatgagaaagaagtt
1141gttctccgttctacccattttctctgaagcagagaagcatgagatgagaggcacagctga
1201tttctttgccttttcttttggacccaacaacttcaagcccctaaacaccatggctaaaat
1261gggacaaaatgtttcacttaatttaagagaagcgctgaactggattaaactggaatacaa
1321caaccctcgaatcttgattgctgagaatggctggttcacagacagtcgtgtgaaaacaga
1381agacaccacggccatctacatgatgaagaatttcctcagccaggtgcttcaagcaataag
1441gttagatgaaatacgagtgtttggttatactgcctggtctctcctggatggctttgaatg
1501gcaggatgcttacaccatccgccgaggattattttatgtggattttaacagtaaacagaa
1561agagcggaaacctaagtcttcagcacactactacaaacagatcatacgagaaaatggttt
1621ttctttaaaagagtccacgccagatgtgcagggccagtttccctgtgacttctcctgggg
1681tgtcactgaatctgttcttaagcccgagtctgtggcttcgtccccacagttcagcgatcc
1741tcatctgtacgtgtggaacgccactggcaacagactgttgcaccgagtggaaggggtgag
1801gctgaaaacacgacccgctcaatgcacagattttgtaaacatcaaaaaacaacttgagat
1861gttggcaagaatgaaagtcacccactaccggtttgctctggattgggcctcggtccttcc
1921cactggcaacctgtccgcggtgaaccgacaggccctgaggtactacaggtgcgtggtcag
1981tgaggggctgaagcttggcatctccgcgatggtcaccctgtattatccgacccacgccca
2041cctaggcctccccgagcctctgttgcatgccgacgggtggctgaacccatcgacggccga
2101ggccttccaggcctacgctgggctgtgcttccaggagctgggggacctggtgaagctctg
2161gatcaccatcaacgagcctaaccggctaagtgacatctacaaccgctctggcaacgacac
2221ctacggggcggcgcacaacctgctggtggcccacgccctggcctggcgcctctacgaccg
2281gcagttcaggccctcacagcgcggggccgtgtcgctgtcgctgcacgcggactgggcgga
2341acccgccaacccctatgctgactcgcactggagggcggccgagcgcttcctgcagttcga
2401gatcgcctggttcgccgagccgctcttcaagaccggggactaccccgcggccatgaggga
2461atacattgcctccaagcaccgacgggggctttccagctcggccctgccgcgcctcaccga
2521ggccgaaaggaggctgctcaagggcacggtcgacttctgcgcgctcaaccacttcaccac
2581taggttcgtgatgcacgagcagctggccggcagccgctacgactcggacagggacatcca
2641gtttctgcaggacatcacccgcctgagctcccccacgcgcctggctgtgattccctgggg
2701ggtgcgcaagctgctgcggtgggtccggaggaactacggcgacatggacatttacatcac
2761cgccagtggcatcgacgaccaggctctggaggatgaccggctccggaagtactacctagg
2821gaagtaccttcaggaggtgctgaaagcatacctgattgataaagtcagaatcaaaggcta
2881ttatgcattcaaactggctgaagagaaatctaaacccagatttggattcttcacatctga
2941ttttaaagctaaatcctcaatacaattttacaacaaagtgatcagcagcaggggcttccc
3001ttttgagaacagtagttctagatgcagtcagacccaagaaaatacagagtgcactgtctg
3061cttattccttgtgcagaagaaaccactgatattcctgggttgttgcttcttctccaccct
3121ggttctactcttatcaattgccatttttcaaaggcagaagagaagaaagttttggaaagc
3181aaaaaacttacaacacataccattaaagaaaggcaagagagttgttagctaaactgatct
3241gtctgcatgatagacagtttaaaaattcatcccagttcc
Beta-amino acids sequence (NP_783864) (SEQIDNO:4)
1mkpgcaagspgnewiffstdeittryrntmsngglqrsvilsalillravtgfsgdgrai
61wsknpnftpvnesqlflydtfpknffwgigtgalqvegswkkdgkgpsiwdhfihthlkn
121vsstngssdsyiflekdlsaldfigvsfyqfsiswprlfpdgivtvanakglqyystlld
181alvlrniepivtlyhwdlplalqekyggwkndtiidifndyatycfqmfgdrvkywitih
241npylvawhgygtgmhapgekgnlaavytvghnlikahskvwhnynthfrphqkgwlsitl
301gshwiepnrsentmdifkcqqsmvsvlgwfanpihgdgdypegmrkklfsvlpifseaek
361hemrgtadffafsfgpnnfkplntmakmgqnvslnlrealnwikleynnpriliaengwf
421tdsrvktedttaiymmknflsqvlqairldeirvfgytawslldgfewqdaytirrglfy
481vdfnskqkerkpkssahyykqiirengfslkestpdvqgqfpcdfswgvtesvlkpesva
541sspqfsdphlyvwnatgnrllhrvegvrlktrpaqctdfvnikkqlemlarmkvthyrfa
601ldwasvlptgnlsavnrqalryyrcvvseglklgisamvtlyypthahlglpepllhadg
661wlnpstaeafqayaglcfqelgdlvklwitinepnrlsdiynrsgndtygaahnllvaha
721lawrlydrqfrpsqrgavslslhadwaepanpyadshwraaerflqfeiawfaeplfktg
781dypaamreyiaskhrrglsssalprlteaerrllkgtvdfcalnhfttrfvmheqlagsr
841ydsdrdiqflqditrlssptrlavipwgvrkllrwvrrnygdmdiyitasgiddqaledd
901rlrkyylgkylqevlkaylidkvrikgyyafklaeekskprfgfftsdfkakssiqfynk
961vissrgfpfensssrcsqtqentectvclflvqkkpliflgccffstlvlllsiaifqrq
1021krrkfwkaknlqhiplkkgkrvvs
People Klotho domain 1 (KL-D1) amino acid sequence (SEQIDNO:5)
58qgt
61fpdgflwavgsaayqteggwqqhgkgasiwdtfthhplappgdsrnaslplgapsplqpa
121tgdvasdsynnvfrdtealrelgvthyrfsiswarvlpngsagvpnreglryyrrllerl
181relgvqpvvtlyhwdlpqrlqdayggwanraladhfrdyaelcfrhfggqvkywitidnp
241yvvawhgyatgrlapgirgsprlgylvahnlllahakvwhlyntsfrptqggqvsialss
301hwinprrmtdhsikecqksldfvlgwfakpvfidgdypesmknnlssilpdftesekkfi
361kgtadffalcfgptlsfqlldphmkfrqlespnlrqllswidlefnhpqifivengwfvs
421gttkrddakymyylkkfimetlkaikldgvdvigytawslmdgfewhrgysirrglfyvd
481flsqdkmllpkssalfyqkliekngf
People Klotho domain 2 (KL-D2) amino acid sequence (SEQIDNO:6)
517gtfpcdfawgvvdnyiqvdttlsq
541ftdlnvylwdvhhskrlikvdgvvtkkrksycvdfaaiqpqiallqemhvthfrfsldwa
601lilplgnqsqvnhtilqyyrcmaselvrvnitpvvalwqpmapnqglprllarqgawenp
661ytalafaeyarlcfqelghhvklwitmnepytrnmtysaghnllkahalawhvynekfrh
721aqngkisialqadwiepacpfsqkdkevaervlefdigwlaepifgsgdypwvmrdwlnq
781rnnfllpyftedekkliqgtfdflalshyttilvdsekedpikyndylevqemtditwln
841spsqvavvpwglrkvlnwlkfkygdlpmyiisngiddglhaeddqlrvyymqnyinealk
901ahildginlcgyfaysfndrtaprfglyryaadqfepkasmkhyrkiidsngf
Klotho extracellular domain (there is no signal peptide) amino acid sequence (SEQIDNO:7)
28epgdgaqtwarfsrppapeaaglfqgt
61fpdgflwavgsaayqteggwqqhgkgasiwdtfthhplappgdsrnaslplgapsplqpa
121tgdvasdsynnvfrdtealrelgvthyrfsiswarvlpngsagvpnreglryyrrllerl
181relgvqpvvtlyhwdlpqrlqdayggwanraladhfrdyaelcfrhfggqvkywitidnp
241yvvawhgyatgrlapgirgsprlgylvahnlllahakvwhlyntsfrptqggqvsialss
301hwinprrmtdhsikecqksldfvlgwfakpvfidgdypesmknnlssilpdftesekkfi
361kgtadffalcfgptlsfqlldphmkfrqlespnlrqllswidlefnhpqifivengwfvs
421gttkrddakymyylkkfimetlkaikldgvdvigytawslmdgfewhrgysirrglfyvd
481flsqdkmllpkssalfyqkliekngfpplpenqplegtfpcdfawgvvdnyiqvdttlsq
541ftdlnvylwdvhhskrlikvdgvvtkkrksycvdfaaiqpqiallqemhvthfrfsldwa
601lilplgnqsqvnhtilqyyrcmaselvrvnitpvvalwqpmapnqglprllarqgawenp
661ytalafaeyarlcfqelghhvklwitmnepytrnmtysaghnllkahalawhvynekfrh
721aqngkisialqadwiepacpfsqkdkevaervlefdigwlaepifgsgdypwvmrdwlnq
781rnnfllpyftedekkliqgtfdflalshyttilvdsekedpikyndylevqemtditwln
841spsqvavvpwglrkvlnwlkfkygdlpmyiisngiddglhaeddqlrvyymqnyinealk
901ahildginlcgyfaysfndrtaprfglyryaadqfepkasmkhyrkiidsngfpgpetle
961rfcpeeftvctecsffhtrksl
Klotho signal peptide amino acid sequence (SEQIDNO:8)
1mpasapprrprppppslslllvllglggrrlra
IgG signal peptide amino acid sequence (SEQIDNO:9)
1msvltqvlallllwltgtrcrrlra
(Gly4Ser)3Polypeptide connexon nucleotide sequence (SEQIDNO:10)
1ggaggtggaggttcaggaggtggaggttcaggaggtggaggttca
(Gly4Ser)3Polypeptide connexon amino acid sequence (SEQIDNO:11)
1GGGGSGGGGSGGGGS
(Gly4Ser) polypeptide connexon amino acid sequence (SEQIDNO:12)
1GGGGS
(Gly) polypeptide connexon amino acid sequence (SEQIDNO:13)
1G
(GlyGly) polypeptide connexon amino acid sequence (SEQIDNO:14)
1GG
(GlySer) polypeptide connexon amino acid sequence (SEQIDNO:15)
1GS
(Gly2Ser) polypeptide connexon amino acid sequence (SEQIDNO:16)
1GGS
(Ala) polypeptide connexon amino acid sequence (SEQIDNO:17)
1A
(AlaAla) polypeptide connexon amino acid sequence (SEQIDNO:18)
1AA
Klotho signal peptide-Klotho extracellular domain-FGF23 (R179Q)
Amino acid sequence (SEQIDNO:19)
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSL
1001KYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSAL
1051MIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENG
1101YDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPI
1151PRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDP
1201LGVVRGGRVNTHAGGTGPEGCRPFAKFI*
IgG signal peptide-Klotho extracellular domain-FGF23 (R179Q)
Amino acid sequence (SEQIDNO:20)
1MSVLTQVLALLLLWLTGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQ
51GTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNAS
101LPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLP
151NGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDAYGGWA
201NRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGIR
251GSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSSHWINPRRM
301TDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEKK
351FIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHP
401QIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAW
451SLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPP
501LPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWDVHHSKRLI
551KVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQ
601SQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWE
651NPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHA
701LAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIG
751WLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSH
801YTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNW
851LKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALKAHILDGIN
901LCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPET
951LERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSLKYPNASPL
1001LGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAG
1051FVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQ
1101YHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSA
1151EDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGR
1201VNTHAGGTGPEGCRPFAKFI*
KL-D1-FGF23 (R179Q) amino acid sequence (SEQIDNO:21)
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGSGGGGSGGGGSGGGGSLKYPNASPLLGSSWGGL
551IHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVM
601SRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLG
651RAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDP
701LNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGT
751GPEGCRPFAKFI*
KL-D2-FGF23 (R179Q) amino acid sequence (SEQIDNO:22)
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLPLPENQPLEGTFPCDFAWG
51VVDNYIQVDTTLSQFTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFA
101AIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNHTILQYYRCMASEL
151VRVNITPVVALWQPMAPNQGLPRLLARQGAWENPYTALAFAEYARLCFQE
201LGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRHAQNGKI
251SIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRD
301WLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYND
351YLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGID
401DGLHAEDDQLRVYYMQNYINEALKAHILDGINLCGYFAYSFNDRTAPRFG
451LYRYAADQFEPKASMKHYRKIIDSNGFPGPETLERFCPEEFTVCTECSFF
501HTRKSLGSGGGGSGGGGSGGGGSLKYPNASPLLGSSWGGLIHLYTATARN
551SYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFR
601GNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGM
651NPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARM
701TPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAK
751FI*
(KL-D1)2-FGF23 (R179Q) amino acid sequence (SEQIDNO:23)
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGSGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIW
551DTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALR
601ELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVT
651LYHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNP
701YVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQ
751GGQVSIALSSHWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPES
801MKNNLSSILPDFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLE
851SPNLRQLLSWIDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIME
901TLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLP
951KSSALFYQKLIEKNGFPEFGSGGGGSGGGGSGGGGSLKYPNASPLLGSSW
1001GGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVIT
1051GVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLV
1101SLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSE
1151RDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHA
1201GGTGPEGCRPFAKFI*
(KL-D2)2-FGF23 (R179Q) amino acid sequence (SEQIDNO:24)
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLPLPENQPLEGTFPCDFAWG
51VVDNYIQVDTTLSQFTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFA
101AIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNHTILQYYRCMASEL
151VRVNITPVVALWQPMAPNQGLPRLLARQGAWENPYTALAFAEYARLCFQE
201LGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAwHVYNEKFRHAQNGKI
251SIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRD
301WLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYND
351YLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGID
401DGLHAEDDQLRVYYMQNYINEALKAHILDGINLCGYFAYSFNDRTAPRFG
451LYRYAADQFEPKASMKHYRKIIDSNGFPGPETLERFCPEEFTVCTECSFF
501HTRKSLGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWDVHHSKRLIKV
551DGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQ
601VNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENP
651YTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALA
701WHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWL
751AEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYT
801TILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLK
851FKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALKAHILDGINLC
901GYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFGSGGGGS
951GGGGSGGGGSLKYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVD
1001GAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPEN
1051CRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRN
1101EIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPS
1151AEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI*
FGF23 (R179Q)-Klotho extracellular domain amino acid sequence (SEQIDNO:25)
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IGSGGGGSGGGGSGGGGSLKEPGDGAQTWARFSRPPAPEAAGLFQGTFPD
301GFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGA
351PSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAG
401VPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDAYGGWANRALA
451DHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGIRGSPRL
501GYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSSHWINPRRMTDHSI
551KECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEKKFIKGT
601ADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHPQIFIV
651ENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDG
701FEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQ
751PLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWDVHHSKRLIKVDGV
801VTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNH
851TILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENPYTA
901LAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHV
951YNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEP
1001IFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTIL
1051VDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKY
1101GDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALKAHILDGINLCGYF
1151AYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPETLERFC
1201PEEFTVCTECSFFHTRKSL*
FGF23 (R179Q)-KL-D1 amino acid sequence (SEQIDNO:26)
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRN
301ASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARV
351LPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDAYGG
401WANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPG
451IRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSSHWINPR
501RMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESE
551KKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFN
601HPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYT
651AWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGF
652*
FGF23 (R179Q)-KL-D2 amino acid sequence (SEQIDNO:27)
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWDVHHSKRLIKVDGVVT
301KKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNHTI
351LQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENPYTALA
401FAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYN
451EKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIF
501GSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVD
551SEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGD
601LPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALKAHILDGINLCGYFAY
651SFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGF*
FGF23(R179Q)-(KL-D1)2Amino acid sequence (SEQIDNO:28)
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRN
301ASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARV
351LPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDAYGG
401WANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPG
451IRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSSHWINPR
501RMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESE
551KKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFN
601HPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYT
651AWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGF
701QGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNA
751SLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVL
801PNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDAYGGW
851ANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGI
901RGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSSHWINPRR
951MTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEK
1001KFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNH
1051PQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTA
1101WSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGF*
FGF23 (R179Q)-(KL-D2) 2 amino acid sequence (SEQIDNO:29)
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWDVHHSKRLIKVDGVVT
301KKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNHTI
351LQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENPYTALA
401FAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYN
451EKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIF
501GSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVD
551SEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGD
601LPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALKAHILDGINLCGYFAY
651SFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFGTFPCDFAWGVV
701DNYIQVDTTLSQFTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAI
751QPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNHTILQYYRCMASELVR
801VNITPVVALWQPMAPNQGLPRLLARQGAWENPYTALAFAEYARLCFQELG
851HHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRHAQNGKISI
901ALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWL
951NQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYL
1001EVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDG
1051LHAEDDQLRVYYMQNYINEALKAHILDGINLCGYFAYSFNDRTAPRFGLY
1101RYAADQFEPKASMKHYRKIIDSNGF*
FGF19 nucleotide sequence (NM_005117) (SEQIDNO:30)
Coded protein region (464-1114)
1gctcccagccaagaacctcggggccgctgcgcggtggggaggagttccccgaaacccggc
61cgctaagcgaggcctcctcctcccgcagatccgaacggcctgggcggggtcaccccggct
121gggacaagaagccgccgcctgcctgcccgggcccggggagggggctggggctggggccgg
181aggcggggtgtgagtgggtgtgtgcggggggcggaggcttgatgcaatcccgataagaaa
241tgctcgggtgtcttgggcacctacccgtggggcccgtaaggcgctactatataaggctgc
301cggcccggagccgccgcgccgtcagagcaggagcgctgcgtccaggatctagggccacga
361ccatcccaacccggcactcacagccccgcagcgcatcccggtcgccgcccagcctcccgc
421acccccatcgccggagctgcgccgagagccccagggaggtgccatgcggagcgggtgtgt
481ggtggtccacgtatggatcctggccggcctctggctggccgtggccgggcgccccctcgc
541cttctcggacgcggggccccacgtgcactacggctggggcgaccccatccgcctgcggca
601cctgtacacctccggcccccacgggctctccagctgcttcctgcgcatccgtgccgacgg
661cgtcgtggactgcgcgcggggccagagcgcgcacagtttgctggagatcaaggcagtcgc
721tctgcggaccgtggccatcaagggcgtgcacagcgtgcggtacctctgcatgggcgccga
781cggcaagatgcaggggctgcttcagtactcggaggaagactgtgctttcgaggaggagat
841ccgcccagatggctacaatgtgtaccgatccgagaagcaccgcctcccggtctccctgag
901cagtgccaaacagcggcagctgtacaagaacagaggctttcttccactctctcatttcct
961gcccatgctgcccatggtcccagaggagcctgaggacctcaggggccacttggaatctga
1021catgttctcttcgcccctggagaccgacagcatggacccatttgggcttgtcaccggact
1081ggaggccgtgaggagtcccagctttgagaagtaactgagaccatgcccgggcctcttcac
1141tgctgccaggggctgtggtacctgcagcgtgggggacgtgcttctacaagaacagtcctg
1201agtccacgttctgtttagctttaggaagaaacatctagaagttgtacatattcagagttt
1261tccattggcagtgccagtttctagccaatagacttgtctgatcataacattgtaagcctg
1321tagcttgcccagctgctgcctgggcccccattctgctccctcgaggttgctggacaagct
1381gctgcactgtctcagttctgcttgaatacctccatcgatggggaactcacttcctttgga
1441aaaattcttatgtcaagctgaaattctctaattttttctcatcacttccccaggagcagc
1501cagaagacaggcagtagttttaatttcaggaacaggtgatccactctgtaaaacagcagg
1561taaatttcactcaaccccatgtgggaattgatctatatctctacttccagggaccatttg
1621cccttcccaaatccctccaggccagaactgactggagcaggcatggcccaccaggcttca
1681ggagtaggggaagcctggagccccactccagccctgggacaacttgagaattccccctga
1741ggccagttctgtcatggatgctgtcctgagaataacttgctgtcccggtgtcacctgctt
1801ccatctcccagcccaccagccctctgcccacctcacatgcctccccatggattggggcct
1861cccaggccccccaccttatgtcaacctgcacttcttgttcaaaaatcaggaaaagaaaag
1921atttgaagaccccaagtcttgtcaataacttgctgtgtggaagcagcgggggaagaccta
1981gaaccctttccccagcacttggttttccaacatgatatttatgagtaatttattttgata
2041tgtacatctcttattttcttacattatttatgcccccaaattatatttatgtatgtaagt
2101gaggtttgttttgtatattaaaatggagtttgtttgtaaaaaaaaaaaaaaaaaaaa
FGF19 amino acid sequence (NP_005108) (SEQIDNO:31)
1MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
61RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
121AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
181GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
FGF21 nucleotide sequence (NM_019113) (SEQIDNO:32)
Coded protein region 151-780
1CTGTCAGCTGAGGATCCAGCCGAAAGAGGAGCCAGGCACTCAGGCCACCTGAGTCTACTC
61ACCTGGACAACTGGAATCTGGCACCAATTCTAAACCACTCAGCTTCTCCGAGCTCACACC
121CCGGAGATCACCTGAGGACCCGAGCCATTGATGGACTCGGACGAGACCGGGTTCGAGCAC
181TCAGGACTGTGGGTTTCTGTGCTGGCTGGTCTTCTGCTGGGAGCCTGCCAGGCACACCCC
241ATCCCTGACTCCAGTCCTCTCCTGCAATTCGGGGGCCAAGTCCGGCAGCGGTACCTCTAC
301ACAGATGATGCCCAGCAGACAGAAGCCCACCTGGAGATCAGGGAGGATGGGACGGTGGGG
361GGCGCTGCTGACCAGAGCCCCGAAAGTCTCCTGCAGCTGAAAGCCTTGAAGCCGGGAGTT
421ATTCAAATCTTGGGAGTCAAGACATCCAGGTTCCTGTGCCAGCGGCCAGATGGGGCCCTG
481TATGGATCGCTCCACTTTGACCCTGAGGCCTGCAGCTTCCGGGAGCTGCTTCTTGAGGAC
541GGATACAATGTTTACCAGTCCGAAGCCCACGGCCTCCCGCTGCACCTGCCAGGGAACAAG
601TCCCCACACCGGGACCCTGCACCCCGAGGACCAGCTCGCTTCCTGCCACTACCAGGCCTG
661CCCCCCGCACTCCCGGAGCCACCCGGAATCCTGGCCCCCCAGCCCCCCGATGTGGGCTCC
721TCGGACCCTCTGAGCATGGTGGGACCTTCCCAGGGCCGAAGCCCCAGCTACGCTTCCTGA
781AGCCAGAGGCTGTTTACTATGACATCTCCTCTTTATTTATTAGGTTATTTATCTTATTTA
841TTTTTTTATTTTTCTTACTTGAGATAATAAAGAGTTCCAGAGGAGAAAAAAAAAAAAAAA
901AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
FGF21 amino acid sequence (NP_061986) (SEQIDNO:33)
1MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH
61LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
121CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGI
181LAPQPPDVGSSDPLSMVGPSQGRSPSYAS
FGF23 nucleotide sequence (NM_020638) (SEQIDNO:34)
Coded protein region 147-902
1cggcaaaaaggagggaatccagtctaggatcctcacaccagctacttgcaagggagaagg
61aaaaggccagtaaggcctgggccaggagagtcccgacaggagtgtcaggtttcaatctca
121gcaccagccactcagagcagggcacgatgttgggggcccgcctcaggctctgggtctgtg
181ccttgtgcagcgtctgcagcatgagcgtcctcagagcctatcccaatgcctccccactgc
241tcggctccagctggggtggcctgatccacctgtacacagccacagccaggaacagctacc
301acctgcagatccacaagaatggccatgtggatggcgcaccccatcagaccatctacagtg
361ccctgatgatcagatcagaggatgctggctttgtggtgattacaggtgtgatgagcagaa
421gatacctctgcatggatttcagaggcaacatttttggatcacactatttcgacccggaga
481actgcaggttccaacaccagacgctggaaaacgggtacgacgtctaccactctcctcagt
541atcacttcctggtcagtctgggccgggcgaagagagccttcctgccaggcatgaacccac
601ccccgtactcccagttcctgtcccggaggaacgagatccccctaattcacttcaacaccc
661ccataccacggcggcacacccggagcgccgaggacgactcggagcgggaccccctgaacg
721tgctgaagccccgggcccggatgaccccggccccggcctcctgttcacaggagctcccga
781gcgccgaggacaacagcccgatggccagtgacccattaggggtggtcaggggcggtcgag
841tgaacacgcacgctgggggaacgggcccggaaggctgccgccccttcgccaagttcatct
901agggtcgctggaagggcaccctctttaacccatccctcagcaaacgcagctcttcccaag
961gaccaggtcccttgacgttccgaggatgggaaaggtgacaggggcatgtatggaatttgc
1021tgcttctctggggtcccttccacaggaggtcctgtgagaaccaacctttgaggcccaagt
1081catggggtttcaccgccttcctcactccatatagaacacctttcccaataggaaacccca
1141acaggtaaactagaaatttccccttcatgaaggtagagagaaggggtctctcccaacata
1201tttctcttccttgtgcctctcctctttatcacttttaagcataaaaaaaaaaaaaaaaaa
1261aaaaaaaaaaaaaagcagtgggttcctgagctcaagactttgaaggtgtagggaagagga
1321aatcggagatcccagaagcttctccactgccctatgcatttatgttagatgccccgatcc
1381cactggcatttgagtgtgcaaaccttgacattaacagctgaatggggcaagttgatgaaa
1441acactactttcaagccttcgttcttccttgagcatctctggggaagagctgtcaaaagac
1501tggtggtaggctggtgaaaacttgacagctagacttgatgcttgctgaaatgaggcagga
1561atcataatagaaaactcagcctccctacagggtgagcaccttctgtctcgctgtctccct
1621ctgtgcagccacagccagagggcccagaatggccccactctgttcccaagcagttcatga
1681tacagcctcaccttttggccccatctctggtttttgaaaatttggtctaaggaataaata
1741gcttttacactggctcacgaaaatctgccctgctagaatttgcttttcaaaatggaaata
1801aattccaactctcctaagaggcatttaattaaggctctacttccaggttgagtaggaatc
1861cattctgaacaaactacaaaaatgtgactgggaagggggctttgagagactgggactgct
1921ctgggttaggttttctgtggactgaaaaatcgtgtccttttctctaaatgaagtggcatc
1981aaggactcagggggaaagaaatcaggggacatgttatagaagttatgaaaagacaaccac
2041atggtcaggctcttgtctgtggtctctagggctctgcagcagcagtggctcttcgattag
2101ttaaaactctcctaggctgacacatctgggtctcaatccccttggaaattcttggtgcat
2161taaatgaagccttaccccattactgcggttcttcctgtaagggggctccattttcctccc
2221tctctttaaatgaccacctaaaggacagtatattaacaagcaaagtcgattcaacaacag
2281cttcttcccagtcacttttttttttctcactgccatcacatactaaccttatactttgat
2341ctattctttttggttatgagagaaatgttgggcaactgtttttacctgatggttttaagc
2401tgaacttgaaggactggttcctattctgaaacagtaaaactatgtataatagtatatagc
2461catgcatggcaaatattttaatatttctgttttcatttcctgttggaaatattatcctgc
2521ataatagctattggaggctcctcagtgaaagatcccaaaaggattttggtggaaaactag
2581ttgtaatctcacaaactcaacactaccatcaggggttttctttatggcaaagccaaaata
2641gctcctacaatttcttatatccctcgtcatgtggcagtatttatttatttatttggaagt
2701ttgcctatccttctatatttatagatatttataaaaatgtaacccctttttcctttcttc
2761tgtttaaaataaaaataaaatttatctcagcttctgttagcttatcctctttgtagtact
2821acttaaaagcatgtcggaatataagaataaaaaggattatgggaggggaacattagggaa
2881atccagagaaggcaaaattgaaaaaaagattttagaattttaaaattttcaaagatttct
2941tccattcataaggagactcaatgattttaattgatctagacagaattatttaagttttat
3001caatattggatttctggt
FGF23 amino acid sequence (NP_065689) (SEQIDNO:35)
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
61VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
121ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
181AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
241PEGCRPFAKFI
FGF23 (R179Q) amino acid sequence (SEQIDNO:36)
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
61VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
121ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQS
181AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
241PEGCRPFAKFI
People β-K1otho domain 1 (b-KL-D1) amino acid sequence (SEQIDNO:37)
77ydtfpknffwgigtgalqvegswkkdgkgpsiwdhfihthlkn
121vsstngssdsyiflekdlsaldfigvsfyqfsiswprlfpdgivtvanskglqyystlld
181alvlrniepivtlyhwdlplalqekyggwkndtiidifndyatycfqmfgdrvkywitih
241npylvawhgygtgmhapgekgnlaavytvghnlikahskvwhnynthfrphqkgwlsitl
301gshwiepnrsentmdifkcqqsmvsvlgwfanpihgdgdypegmrkklfsvlpifseaek
361hemrgtadffafsfgpnnfkplntmakmgqnvslnlrealnwikleynnpriliaengwf
421tdsrvktedttaiymmknflsqvlqairldeirvfgytawslldgfewqdaytirrglfy
481vdfnskqkerkpkssahyykqiirengf
People β-Klotho domain 2 (b-KL-D2) amino acid sequence (SEQIDNO:38)
571trpaqctdfvnikkqlemlarmkvthyrfa
601ldwasvlptgnlsavnrqalryyrcvvseglklgisamvtlyypthahlglpepllhadg
661wlnpstaeafqayaglcfqelgdlvklwitinepnrlsdiynrsgndtygaahnllvaha
721lawrlydrqfrpsqrgavslslhadwaepanpyadshwraaerflqfeiawfaeplfktg
781dypaamreyiaskhrrglsssalprlteaerrllkgtvdfcalnhfttrfvmheqlagsr
841ydsdrdiqflqditrlssptrlavipwgvrkllrwvrrnygdmdiyitasgiddqaledd
901rlrkyylgkylqevlkaylidkvrikgyyafklaeekskprfgfftsdfkakssiqfynk
961vissrgf
β-Klotho extracellular domain (there is no signal peptide) amino acid sequence
(SEQIDNO:39)
52gfsgdgrai
61wsknpnftpvnesqlflydtfpknffwgigtgalqvegswkkdgkgpsiwdhfihthlkn
121vsstngssdsyiflekdlsaldfigvsfyqfsiswprlfpdgivtvanakglqyystlld
181alvlrniepivtlyhwdlplalqekyggwkndtiidifndyatycfqmfgdrvkywitih
241npylvawhgygtgmhapgekgnlaavytvghnlikahskvwhnynthfrphqkgwlsitl
301gshwiepnrsentmdifkcqqsmvsvlgwfanpihgdgdypegmrkklfsvlpifseaek
361hemrgtadffafsfgpnnfkplntmakmgqnvslnlrealnwikleynnpriliaengwf
421tdsrvktedttaiymmknflsqvlqairldeirvfgytawslldgfewqdaytirrglfy
481vdfnskqkerkpkssahyykqiirengfslkestpdvqgqfpcdfswgvtesvlkpesva
541sspqfsdphlyvwnatgnrllhrvegvrlktrpaqctdfvnikkqlemlarmkvthyrfa
601ldwasvlptgnlsavnrqalryyrcvvseglklgisamvtlyypthahlglpepllhadg
661wlnpstaeafqayaglcfqelgdlvklwitinepnrlsdiynrsgndtygaahnllvaha
721lawrlydrqfrpsqrgavslslhadwaepanpyadshwraaerflqfeiawfaeplfktg
781dypaamreyiaskhrrglsssalprlteaerrllkgtvdfcalnhfttrfvmheqlagsr
841ydsdrdiqflqditrlssptrlavipwgvrkllrwvrrnygdmdiyitasgiddqaledd
901rlrkyylgkylqevlkaylidkvrikgyyafklaeekskprfgfftsdfkakssiqfynk
961vissrgfpfensssrcsqtqentectvclflvqkkpl
There is no the sKlotho-FGF23 amino acid sequence (there is no signal peptide) of signal peptide
(SEQIDNO:40)
EPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSL
1001KYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSAL
1051MIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENG
1101YDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPI
1151PRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDP
1201LGVVRGGRVNTHAGGTGPEGCRPFAKFI*
There is no sKlotho-FGF23 (R179Q) (the there is no signal peptide) amino acid sequence of signal peptide
(SEOIDNO:41)
EPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSL
1001KYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSAL
1051MIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENG
1101YDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPI
1151PRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDP
1201LGVVRGGRVNTHAGGTGPEGCRPFAKFI*
There is no the FGF23 (SEQIDNO:42) of signal peptide
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
61VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
121ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
181AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
241PEGCRPFAKFI
There is no the FGF23 (R179Q) of signal peptide (SEQIDNO:43)
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
61VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
121ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQS
181AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
241PEGCRPFAKFI
There is the sKlotho (SEQIDNO:44) of Klotho signal peptide
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSL
There is the sKlotho (SEQIDNO:45) of IgG signal peptide
1MSVLTQVLALLLLWLTGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQ
51GTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNAS
101LPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLP
151NGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDAYGGWA
201NRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGIR
251GSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSSHWINPRRM
301TDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEKK
351FIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHP
401QIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAW
451SLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPP
501LPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWDVHHSKRLI
551KVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQ
601SQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWE
651NPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHA
701LAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIG
751WLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSH
801YTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNW
851LKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALKAHILDGIN
901LCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPET
951LERFCPEEFTVCTECSFFHTRKSL*
sKlotho-FGF23-FcLALAv1(SEQIDNO:46)
1ATGCCCGCCAGCGCCCCGCCGCGCCGCCCGCGGCCGCCGCCGCCGTCGCTGTCGCTGCTG
61CTGGTGCTGCTGGGCCTGGGCGGCCGCCGCCTGCGTGCGGAGCCGGGCGACGGCGCGCAG
121ACCTGGGCCCGTTTCTCGCGGCCTCCTGCCCCCGAGGCCGCGGGCCTCTTCCAGGGCACC
181TTCCCCGACGGCTTCCTCTGGGCCGTGGGCAGCGCCGCCTACCAGACCGAGGGCGGCTGG
241CAGCAGCACGGCAAGGGTGCGTCCATCTGGGATACGTTCACCCACCACCCCCTGGCACCC
301CCGGGAGACTCCCGGAACGCCAGTCTGCCGTTGGGCGCCCCGTCGCCGCTGCAGCCCGCC
361ACCGGGGACGTAGCCAGCGACAGCTACAACAACGTCTTCCGCGACACGGAGGCGCTGCGC
421GAGCTCGGGGTCACTCACTACCGCTTCTCCATCTCGTGGGCGCGAGTGCTCCCCAATGGC
481AGCGCGGGCGTCCCCAACCGCGAGGGGCTGCGCTACTACCGGCGCCTGCTGGAGCGGCTG
541CGGGAGCTGGGCGTGCAGCCCGTGGTCACCCTGTACCACTGGGACCTGCCCCAGCGCCTG
601CAGGACGCCTACGGCGGCTGGGCCAACCGCGCCCTGGCCGACCACTTCAGGGATTACGCG
661GAGCTCTGCTTCCGCCACTTCGGCGGTCAGGTCAAGTACTGGATCACCATCGACAACCCC
721TACGTGGTGGCCTGGCACGGCTACGCCACCGGGCGCCTGGCCCCCGGCATCCGGGGCAGC
781CCGCGGCTCGGGTACCTGGTGGCGCACAACCTCCTCCTGGCTCATGCCAAAGTCTGGCAT
841CTCTACAATACTTCTTTCCGTCCCACTCAGGGAGGTCAGGTGTCCATTGCCCTAAGCTCT
901CACTGGATCAATCCTCGAAGAATGACCGACCACAGCATCAAAGAATGTCAAAAATCTCTG
961GACTTTGTACTAGGTTGGTTTGCCAAACCCGTATTTATTGATGGTGACTATCCCGAGAGC
1021ATGAAGAATAACCTTTCATCTATTCTGCCTGATTTTACTGAATCTGAGAAAAAGTTCATC
1081AAAGGAACTGCTGACTTTTTTGCTCTTTGCTTTGGACCCACCTTGAGTTTTCAACTTTTG
1141GACCCTCACATGAAGTTCCGCCAATTGGAATCTCCCAACCTGAGGCAACTGCTTTCCTGG
1201ATTGACCTTGAATTTAACCATCCTCAAATATTTATTGTGGAAAATGGCTGGTTTGTCTCA
1261GGGACCACCAAGAGAGATGATGCCAAATATATGTATTACCTCAAAAAGTTCATCATGGAA
1321ACCTTAAAAGCCATCAAGCTGGATGGGGTGGATGTCATCGGGTATACCGCATGGTCCCTC
1381ATGGATGGTTTCGAGTGGCACAGAGGTTACAGCATCAGGCGTGGACTCTTCTATGTTGAC
1441TTTCTAAGCCAGGACAAGATGTTGTTGCCAAAGTCTTCAGCCTTGTTCTACCAAAAGCTG
1501ATAGAGAAAAATGGCTTCCCTCCTTTACCTGAAAATCAGCCCCTAGAAGGGACATTTCCC
1561TGTGACTTTGCTTGGGGAGTTGTTGACAACTACATTCAAGTAGATACCACTCTGTCTCAG
1621TTTACCGACCTGAATGTTTACCTGTGGGATGTCCACCACAGTAAAAGGCTTATTAAAGTG
1681GATGGGGTTGTGACCAAGAAGAGGAAATCCTACTGTGTTGACTTTGCTGCCATCCAGCCC
1741CAGATCGCTTTACTCCAGGAAATGCACGTTACACATTTTCGCTTCTCCCTGGACTGGGCC
1801CTGATTCTCCCTCTGGGTAACCAGTCCCAGGTGAACCACACCATCCTGCAGTACTATCGC
1861TGCATGGCCAGCGAGCTTGTCCGTGTCAACATCACCCCAGTGGTGGCCCTGTGGCAGCCT
1921ATGGCCCCGAACCAAGGACTGCCGCGCCTCCTGGCCAGGCAGGGCGCCTGGGAGAACCCC
1981TACACTGCCCTGGCCTTTGCAGAGTATGCCCGACTGTGCTTTCAAGAGCTCGGCCATCAC
2041GTCAAGCTTTGGATAACGATGAATGAGCCGTATACAAGGAATATGACATACAGTGCTGGC
2101CACAACCTTCTGAAGGCCCATGCCCTGGCTTGGCATGTGTACAATGAAAAGTTTAGGCAT
2161GCTCAGAATGGGAAAATATCCATAGCCTTGCAGGCTGATTGGATAGAACCTGCCTGCCCT
2221TTCTCCCAAAAGGACAAAGAGGTGGCCGAGAGAGTTTTGGAATTTGACATTGGCTGGCTG
2281GCTGAGCCCATTTTCGGCTCTGGAGATTATCCATGGGTGATGAGGGACTGGCTGAACCAA
2341AGAAACAATTTTCTTCTTCCTTATTTCACTGAAGATGAAAAAAAGCTAATCCAGGGTACC
2401TTTGACTTTTTGGCTTTAAGCCATTATACCACCATCCTTGTAGACTCAGAAAAAGAAGAT
2461CCAATAAAATACAATGATTACCTAGAAGTGCAAGAAATGACCGACATCACGTGGCTCAAC
2521TCCCCCAGTCAGGTGGCGGTAGTGCCCTGGGGGTTGCGCAAAGTGCTGAACTGGCTGAAG
2581TTCAAGTACGGAGACCTCCCCATGTACATAATATCCAACGGAATCGATGACGGGCTGCAT
2641GCTGAGGACGACCAGCTGAGGGTGTATTATATGCAGAATTACATAAACGAAGCTCTCAAA
2701GCCCACATACTGGATGGTATCAATCTTTGCGGATACTTTGCTTATTCGTTTAACGACCGC
2761ACAGCTCCGAGGTTTGGCCTCTATCGTTATGCTGCAGATCAGTTTGAGCCCAAGGCATCC
2821ATGAAACATTACAGGAAAATTATTGACAGCAATGGTTTCCCGGGCCCAGAAACTCTGGAA
2881AGATTTTGTCCAGAAGAATTCACCGTGTGTACTGAGTGCAGTTTTTTTCACACCCGAAAG
2941TCTTTAGGATCCGGAGGTGGAGGTTCAGGAGGTGGAGGTTCAGGAGGTGGAGGTTCACTT
3001AAGTATCCCAATGCCTCCCCACTGCTCGGCTCCAGCTGGGGTGGCCTGATCCACCTGTAC
3061ACAGCCACAGCCAGGAACAGCTACCACCTGCAGATCCACAAGAATGGCCATGTGGATGGC
3121GCACCCCATCAGACCATCTACAGTGCCCTGATGATCAGATCAGAGGATGCTGGCTTTGTG
3181GTGATTACAGGTGTGATGAGCAGAAGATACCTCTGCATGGATTTCAGAGGCAACATTTTT
3241GGATCACACTATTTCGACCCGGAGAACTGCAGGTTCCAACACCAGACGCTGGAAAACGGG
3301TACGACGTCTACCACTCTCCTCAGTATCACTTCCTGGTCAGTCTGGGCCGGGCGAAGAGA
3361GCCTTCCTGCCAGGCATGAACCCACCCCCGTACTCCCAGTTCCTGTCCCGGAGGAACGAG
3421ATCCCCCTAATTCACTTCAACACCCCCATACCACGGCGGCACACCCAGAGCGCCGAGGAC
3481GACTCGGAGCGGGACCCCCTGAACGTGCTGAAGCCCCGGGCCCGGATGACCCCGGCCCCG
3541GCCTCCTGTTCACAGGAGCTCCCGAGCGCCGAGGACAACAGCCCGATGGCCAGTGACCCA
3601TTAGGGGTGGTCAGGGGCGGTCGAGTGAACACGCACGCTGGGGGAACGGGCCCGGAAGGC
3661TGCCGCCCCTTCGCCAAGTTCATCGGAGGTGGAGGTTCAAAAACCCACACGTGTCCTCCT
3721TGTCCTGCCCCAGAAGCAGCAGGTGGTCCATCAGTTTTTCTTTTCCCTCCCAAACCCAAG
3781GATACGCTGATGATCTCTCGCACGCCTGAGGTGACATGCGTCGTAGTAGACGTGAGCCAC
3841GAAGATCCCGAGGTGAAGTTCAATTGGTATGTGGACGGAGTAGAAGTGCATAACGCGAAA
3901ACTAAGCCGCGCGAGGAACAATATAACAGTACTTACAGGGTGGTATCCGTGCTCACAGTC
3961CTGCACCAGGACTGGCTGAACGGTAAGGAATACAAGTGCAAAGTAAGCAACAAGGCACTT
4021CCCGCGCCTATTGAGAAAACAATCTCCAAGGCGAAGGGACAACCAAGAGAACCTCAGGTT
4081TACACTCTCCCGCCTTCCAGGGAAGAGATGACCAAAAATCAAGTTTCCCTGACTTGCCTC
4141GTCAAAGGATTCTACCCTTCCGACATTGCTGTTGAATGGGAAAGCAATGGACAACCAGAG
4201AACAACTACAAGACAACACCCCCGGTGCTGGATAGTGACGGATCTTTCTTTCTCTACTCA
4261AAGCTGACCGTGGATAAGTCCAGGTGGCAGCAGGGAAACGTGTTTTCCTGCTCTGTCATG
4321CATGAAGCGCTGCATAATCACTATACCCAGAAGTCTCTGAGCTTGAGCCCAGGCAAGTAA
sKlotho-FGF23-FcLALAv1(SEQIDNO:47)
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSL
1001KYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSAL
1051MIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENG
1101YDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPI
1151PRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDP
1201LGVVRGGRVNTHAGGTGPEGCRPFAKFIGGGGSKTHTCPPCPAPEAAGGP
1251SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK
1301TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK
1351AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE
1401NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ
1451KSLSLSPGK*
sKlotho-FGF23-FcLALAv2(SEQIDNO:48)
1ATGCCCGCCAGCGCCCCGCCGCGCCGCCCGCGGCCGCCGCCGCCGTCGCTGTCGCTGCTG
61CTGGTGCTGCTGGGCCTGGGCGGCCGCCGCCTGCGTGCGGAGCCGGGCGACGGCGCGCAG
121ACCTGGGCCCGTTTCTCGCGGCCTCCTGCCCCCGAGGCCGCGGGCCTCTTCCAGGGCACC
181TTCCCCGACGGCTTCCTCTGGGCCGTGGGCAGCGCCGCCTACCAGACCGAGGGCGGCTGG
241CAGCAGCACGGCAAGGGTGCGTCCATCTGGGATACGTTCACCCACCACCCCCTGGCACCC
301CCGGGAGACTCCCGGAACGCCAGTCTGCCGTTGGGCGCCCCGTCGCCGCTGCAGCCCGCC
361ACCGGGGACGTAGCCAGCGACAGCTACAACAACGTCTTCCGCGACACGGAGGCGCTGCGC
421GAGCTCGGGGTCACTCACTACCGCTTCTCCATCTCGTGGGCGCGAGTGCTCCCCAATGGC
481AGCGCGGGCGTCCCCAACCGCGAGGGGCTGCGCTACTACCGGCGCCTGCTGGAGCGGCTG
541CGGGAGCTGGGCGTGCAGCCCGTGGTCACCCTGTACCACTGGGACCTGCCCCAGCGCCTG
601CAGGACGCCTACGGCGGCTGGGCCAACCGCGCCCTGGCCGACCACTTCAGGGATTACGCG
661GAGCTCTGCTTCCGCCACTTCGGCGGTCAGGTCAAGTACTGGATCACCATCGACAACCCC
721TACGTGGTGGCCTGGCACGGCTACGCCACCGGGCGCCTGGCCCCCGGCATCCGGGGCAGC
781CCGCGGCTCGGGTACCTGGTGGCGCACAACCTCCTCCTGGCTCATGCCAAAGTCTGGCAT
841CTCTACAATACTTCTTTCCGTCCCACTCAGGGAGGTCAGGTGTCCATTGCCCTAAGCTCT
901CACTGGATCAATCCTCGAAGAATGACCGACCACAGCATCAAAGAATGTCAAAAATCTCTG
961GACTTTGTACTAGGTTGGTTTGCCAAACCCGTATTTATTGATGGTGACTATCCCGAGAGC
1021ATGAAGAATAACCTTTCATCTATTCTGCCTGATTTTACTGAATCTGAGAAAAAGTTCATC
1081AAAGGAACTGCTGACTTTTTTGCTCTTTGCTTTGGACCCACCTTGAGTTTTCAACTTTTG
1141GACCCTCACATGAAGTTCCGCCAATTGGAATCTCCCAACCTGAGGCAACTGCTTTCCTGG
1201ATTGACCTTGAATTTAACCATCCTCAAATATTTATTGTGGAAAATGGCTGGTTTGTCTCA
1261GGGACCACCAAGAGAGATGATGCCAAATATATGTATTACCTCAAAAAGTTCATCATGGAA
1321ACCTTAAAAGCCATCAAGCTGGATGGGGTGGATGTCATCGGGTATACCGCATGGTCCCTC
1381ATGGATGGTTTCGAGTGGCACAGAGGTTACAGCATCAGGCGTGGACTCTTCTATGTTGAC
1441TTTCTAAGCCAGGACAAGATGTTGTTGCCAAAGTCTTCAGCCTTGTTCTACCAAAAGCTG
1501ATAGAGAAAAATGGCTTCCCTCCTTTACCTGAAAATCAGCCCCTAGAAGGGACATTTCCC
1561TGTGACTTTGCTTGGGGAGTTGTTGACAACTACATTCAAGTAGATACCACTCTGTCTCAG
1621TTTACCGACCTGAATGTTTACCTGTGGGATGTCCACCACAGTAAAAGGCTTATTAAAGTG
1681GATGGGGTTGTGACCAAGAAGAGGAAATCCTACTGTGTTGACTTTGCTGCCATCCAGCCC
1741CAGATCGCTTTACTCCAGGAAATGCACGTTACACATTTTCGCTTCTCCCTGGACTGGGCC
1801CTGATTCTCCCTCTGGGTAACCAGTCCCAGGTGAACCACACCATCCTGCAGTACTATCGC
1861TGCATGGCCAGCGAGCTTGTCCGTGTCAACATCACCCCAGTGGTGGCCCTGTGGCAGCCT
1921ATGGCCCCGAACCAAGGACTGCCGCGCCTCCTGGCCAGGCAGGGCGCCTGGGAGAACCCC
1981TACACTGCCCTGGCCTTTGCAGAGTATGCCCGACTGTGCTTTCAAGAGCTCGGCCATCAC
2041GTCAAGCTTTGGATAACGATGAATGAGCCGTATACAAGGAATATGACATACAGTGCTGGC
2101CACAACCTTCTGAAGGCCCATGCCCTGGCTTGGCATGTGTACAATGAAAAGTTTAGGCAT
2161GCTCAGAATGGGAAAATATCCATAGCCTTGCAGGCTGATTGGATAGAACCTGCCTGCCCT
2221TTCTCCCAAAAGGACAAAGAGGTGGCCGAGAGAGTTTTGGAATTTGACATTGGCTGGCTG
2281GCTGAGCCCATTTTCGGCTCTGGAGATTATCCATGGGTGATGAGGGACTGGCTGAACCAA
2341AGAAACAATTTTCTTCTTCCTTATTTCACTGAAGATGAAAAAAAGCTAATCCAGGGTACC
2401TTTGACTTTTTGGCTTTAAGCCATTATACCACCATCCTTGTAGACTCAGAAAAAGAAGAT
2461CCAATAAAATACAATGATTACCTAGAAGTGCAAGAAATGACCGACATCACGTGGCTCAAC
2521TCCCCCAGTCAGGTGGCGGTAGTGCCCTGGGGGTTGCGCAAAGTGCTGAACTGGCTGAAG
2581TTCAAGTACGGAGACCTCCCCATGTACATAATATCCAACGGAATCGATGACGGGCTGCAT
2641GCTGAGGACGACCAGCTGAGGGTGTATTATATGCAGAATTACATAAACGAAGCTCTCAAA
2701GCCCACATACTGGATGGTATCAATCTTTGCGGATACTTTGCTTATTCGTTTAACGACCGC
2761ACAGCTCCGAGGTTTGGCCTCTATCGTTATGCTGCAGATCAGTTTGAGCCCAAGGCATCC
2821ATGAAACATTACAGGAAAATTATTGACAGCAATGGTTTCCCGGGCCCAGAAACTCTGGAA
2881AGATTTTGTCCAGAAGAATTCACCGTGTGTACTGAGTGCAGTTTTTTTCACACCCGAAAG
2941TCTTTAGGATCCGGAGGTGGAGGTTCAGGAGGTGGAGGTTCAGGAGGTGGAGGTTCACTT
3001AAGTATCCCAATGCCTCCCCACTGCTCGGCTCCAGCTGGGGTGGCCTGATCCACCTGTAC
3061ACAGCCACAGCCAGGAACAGCTACCACCTGCAGATCCACAAGAATGGCCATGTGGATGGC
3121GCACCCCATCAGACCATCTACAGTGCCCTGATGATCAGATCAGAGGATGCTGGCTTTGTG
3181GTGATTACAGGTGTGATGAGCAGAAGATACCTCTGCATGGATTTCAGAGGCAACATTTTT
3241GGATCACACTATTTCGACCCGGAGAACTGCAGGTTCCAACACCAGACGCTGGAAAACGGG
3301TACGACGTCTACCACTCTCCTCAGTATCACTTCCTGGTCAGTCTGGGCCGGGCGAAGAGA
3361GCCTTCCTGCCAGGCATGAACCCACCCCCGTACTCCCAGTTCCTGTCCCGGAGGAACGAG
3421ATCCCCCTAATTCACTTCAACACCCCCATACCACGGCGGCACACCCAGAGCGCCGAGGAC
3481GACTCGGAGCGGGACCCCCTGAACGTGCTGAAGCCCCGGGCCCGGATGACCCCGGCCCCG
3541GCCTCCTGTTCACAGGAGCTCCCGAGCGCCGAGGACAACAGCCCGATGGCCAGTGACCCA
3601TTAGGGGTGGTCAGGGGCGGTCGAGTGAACACGCACGCTGGGGGAACGGGCCCGGAAGGC
3661TGCCGCCCCTTCGCCAAGTTCATCGGAGGTGGAGGTTCAGCCCCAGAAGCAGCAGGTGGT
3721CCATCAGTTTTTCTTTTCCCTCCCAAACCCAAGGATACGCTGATGATCTCTCGCACGCCT
3781GAGGTGACATGCGTCGTAGTAGACGTGAGCCACGAAGATCCCGAGGTGAAGTTCAATTGG
3841TATGTGGACGGAGTAGAAGTGCATAACGCGAAAACTAAGCCGCGCGAGGAACAATATAAC
3901AGTACTTACAGGGTGGTATCCGTGCTCACAGTCCTGCACCAGGACTGGCTGAACGGTAAG
3961GAATACAAGTGCAAAGTAAGCAACAAGGCACTTCCCGCGCCTATTGAGAAAACAATCTCC
4021AAGGCGAAGGGACAACCAAGAGAACCTCAGGTTTACACTCTCCCGCCTTCCAGGGAAGAG
4081ATGACCAAAAATCAAGTTTCCCTGACTTGCCTCGTCAAAGGATTCTACCCTTCCGACATT
4141GCTGTTGAATGGGAAAGCAATGGACAACCAGAGAACAACTACAAGACAACACCCCCGGTG
4201CTGGATAGTGACGGATCTTTCTTTCTCTACTCAAAGCTGACCGTGGATAAGTCCAGGTGG
4261CAGCAGGGAAACGTGTTTTCCTGCTCTGTCATGCATGAAGCGCTGCATAATCACTATACC
4321CAGAAGTCTCTGAGCTTGAGCCCAGGCAAGTAA
sKlotho-FGF23-FcLALAv2(SEQIDNO:49)
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSL
1001KYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSAL
1051MIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENG
1101YDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPI
1151PRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDP
1201LGVVRGGRVNTHAGGTGPEGCRPFAKFIGGGGSAPEAAGGPSVFLFPPKP
1251KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
1301STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ
1351VYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV
1401LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
1451*
FGF23-FcLALAv1(SEQIDNO:50)
1ATGTTGGGGGCCCGCCTCAGGCTCTGGGTCTGTGCCTTGTGCAGCGTCTGCAGCATGAGC
61GTCCTCAGAGCCTATCCCAATGCCTCCCCACTGCTCGGCTCCAGCTGGGGTGGCCTGATC
121CACCTGTACACAGCCACAGCCAGGAACAGCTACCACCTGCAGATCCACAAGAATGGCCAT
181GTGGATGGCGCACCCCATCAGACCATCTACAGTGCCCTGATGATCAGATCAGAGGATGCT
241GGCTTTGTGGTGATTACAGGTGTGATGAGCAGAAGATACCTCTGCATGGATTTCAGAGGC
301AACATTTTTGGATCACACTATTTCGACCCGGAGAACTGCAGGTTCCAACACCAGACGCTG
361GAAAACGGGTACGACGTCTACCACTCTCCTCAGTATCACTTCCTGGTCAGTCTGGGCCGG
421GCGAAGAGAGCCTTCCTGCCAGGCATGAACCCACCCCCGTACTCCCAGTTCCTGTCCCGG
481AGGAACGAGATCCCCCTAATTCACTTCAACACCCCCATACCACGGCGGCACACCCAGAGC
541GCCGAGGACGACTCGGAGCGGGACCCCCTGAACGTGCTGAAGCCCCGGGCCCGGATGACC
601CCGGCCCCGGCCTCCTGTTCACAGGAGCTCCCGAGCGCCGAGGACAACAGCCCGATGGCC
661AGTGACCCATTAGGGGTGGTCAGGGGCGGTCGAGTGAACACGCACGCTGGGGGAACGGGC
721CCGGAAGGCTGCCGCCCCTTCGCCAAGTTCATCGGAGGTGGAGGTTCAAAAACCCACACG
781TGTCCTCCTTGTCCTGCCCCAGAAGCAGCAGGTGGTCCATCAGTTTTTCTTTTCCCTCCC
841AAACCCAAGGATACGCTGATGATCTCTCGCACGCCTGAGGTGACATGCGTCGTAGTAGAC
901GTGAGCCACGAAGATCCCGAGGTGAAGTTCAATTGGTATGTGGACGGAGTAGAAGTGCAT
961AACGCGAAAACTAAGCCGCGCGAGGAACAATATAACAGTACTTACAGGGTGGTATCCGTG
1021CTCACAGTCCTGCACCAGGACTGGCTGAACGGTAAGGAATACAAGTGCAAAGTAAGCAAC
1081AAGGCACTTCCCGCGCCTATTGAGAAAACAATCTCCAAGGCGAAGGGACAACCAAGAGAA
1141CCTCAGGTTTACACTCTCCCGCCTTCCAGGGAAGAGATGACCAAAAATCAAGTTTCCCTG
1201ACTTGCCTCGTCAAAGGATTCTACCCTTCCGACATTGCTGTTGAATGGGAAAGCAATGGA
1261CAACCAGAGAACAACTACAAGACAACACCCCCGGTGCTGGATAGTGACGGATCTTTCTTT
1321CTCTACTCAAAGCTGACCGTGGATAAGTCCAGGTGGCAGCAGGGAAACGTGTTTTCCTGC
1381TCTGTCATGCATGAAGCGCTGCATAATCACTATACCCAGAAGTCTCTGAGCTTGAGCCCA
1441GGCAAGTAA
FGF23(R179Q)-FcLALAv1(SEQIDNO:51)
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IGGGGSKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
301VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
351GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
401TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
451RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
FGF23-FcLALAv2(SEQIDNO:52)
1ATGTTGGGGGCCCGCCTCAGGCTCTGGGTCTGTGCCTTGTGCAGCGTCTGCAGCATGAGC
61GTCCTCAGAGCCTATCCCAATGCCTCCCCACTGCTCGGCTCCAGCTGGGGTGGCCTGATC
121CACCTGTACACAGCCACAGCCAGGAACAGCTACCACCTGCAGATCCACAAGAATGGCCAT
181GTGGATGGCGCACCCCATCAGACCATCTACAGTGCCCTGATGATCAGATCAGAGGATGCT
241GGCTTTGTGGTGATTACAGGTGTGATGAGCAGAAGATACCTCTGCATGGATTTCAGAGGC
301AACATTTTTGGATCACACTATTTCGACCCGGAGAACTGCAGGTTCCAACACCAGACGCTG
361GAAAACGGGTACGACGTCTACCACTCTCCTCAGTATCACTTCCTGGTCAGTCTGGGCCGG
421GCGAAGAGAGCCTTCCTGCCAGGCATGAACCCACCCCCGTACTCCCAGTTCCTGTCCCGG
481AGGAACGAGATCCCCCTAATTCACTTCAACACCCCCATACCACGGCGGCACACCCAGAGC
541GCCGAGGACGACTCGGAGCGGGACCCCCTGAACGTGCTGAAGCCCCGGGCCCGGATGACC
601CCGGCCCCGGCCTCCTGTTCACAGGAGCTCCCGAGCGCCGAGGACAACAGCCCGATGGCC
661AGTGACCCATTAGGGGTGGTCAGGGGCGGTCGAGTGAACACGCACGCTGGGGGAACGGGC
721CCGGAAGGCTGCCGCCCCTTCGCCAAGTTCATCGGAGGTGGAGGTTCAGCCCCAGAAGCA
781GCAGGTGGTCCATCAGTTTTTCTTTTCCCTCCCAAACCCAAGGATACGCTGATGATCTCT
841CGCACGCCTGAGGTGACATGCGTCGTAGTAGACGTGAGCCACGAAGATCCCGAGGTGAAG
901TTCAATTGGTATGTGGACGGAGTAGAAGTGCATAACGCGAAAACTAAGCCGCGCGAGGAA
961CAATATAACAGTACTTACAGGGTGGTATCCGTGCTCACAGTCCTGCACCAGGACTGGCTG
1021AACGGTAAGGAATACAAGTGCAAAGTAAGCAACAAGGCACTTCCCGCGCCTATTGAGAAA
1081ACAATCTCCAAGGCGAAGGGACAACCAAGAGAACCTCAGGTTTACACTCTCCCGCCTTCC
1141AGGGAAGAGATGACCAAAAATCAAGTTTCCCTGACTTGCCTCGTCAAAGGATTCTACCCT
1201TCCGACATTGCTGTTGAATGGGAAAGCAATGGACAACCAGAGAACAACTACAAGACAACA
1261CCCCCGGTGCTGGATAGTGACGGATCTTTCTTTCTCTACTCAAAGCTGACCGTGGATAAG
1321TCCAGGTGGCAGCAGGGAAACGTGTTTTCCTGCTCTGTCATGCATGAAGCGCTGCATAAT
1381CACTATACCCAGAAGTCTCTGAGCTTGAGCCCAGGCAAGTAA
FGF23(R179Q)-FcLALAv2(SEQIDNO:53)
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IGGGGSAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK
301FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
351NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP
401SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
451CSVMHEALHNHYTQKSLSLSPGK*
The amino acid sequence (SEQIDNO:54) of sKlotho-FGF23 (R1156Q, C1183S)
SKlotho:aa[amino acid] 1-982; Connexon 1:aa983-1001; FGF23:aa1002-1228
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSL
1001KYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSAL
1051MIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENG
1101YDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPI
1151PRRHTQSAEDDSERDPLNVLKPRARMTPAPASSQELPSAEDNSPMASDP
1201LGVVRGGRVNTHAGGTGPEGCRPFAKFI*
The amino acid sequence (SEQIDNO:55) of sKlotho-FGF23 (R1156Q, C1221S)
SKlotho:1-982; Connexon 1:983-1001; FGF23:1002-1228;
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSL
1001KYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSAL
1051MIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENG
1101YDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPI
1151PRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDP
1201LGVVRGGRVNTHAGGTGPEGRPFAKFI*
The amino acid sequence (SEQIDNO:56) of sKlotho-FGF23 (R1156Q, Q1133A)
SKlotho:1-982; Connexon 1:983-1001; FGF23:1002-1228
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSL
1001KYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSAL
1051MIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENG
1101YDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSFLSRRNEIPLIHFNTPI
1151PRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDP
1201LGVVRGGRVNTHAGGTGPEGCRPFAKFI*
The amino acid sequence (SEQIDNO:57) of sKlotho-FGF23 (R1156Q, C1183S, C1221S)
SKlotho:1-982; Connexon 1:983-1001; FGF23:1002-1228
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSL
1001KYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSAL
1051MIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENG
1101YDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPI
1151PRRHTQSAEDDSERDPLNVLKPRARMTPAPASSQELPSAEDNSPMASDP
1201LGVVRGGRVNTHAGGTGPEGRPFAKFI*
The amino acid sequence (SEQIDNO:58) of sKlotho-FGF23 (R1156Q, C1183S, C1221S, Q1133A)
SKlotho:1-982; Connexon 1:983-1001; FGF23:1002-1228
1MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPA
51PEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAP
101PGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFS
151ISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
201QDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYAT
251GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
301HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP
351DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSW
401IDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGV
451DVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKL
501IEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWD
551VHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
601LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRL
651LARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG
701HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAE
751RVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGT
801FDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPW
851GLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
901AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDS
951NGFPGPETLERFCPEEFTVCTECSFFHTRKSLGSGGGGSGGGGSGGGGSL
1001KYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSAL
1051MIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENG
1101YDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSFLSRRNEIPLIHFNTPI
1151PRRHTQSAEDDSERDPLNVLKPRARMTPAPASSQELPSAEDNSPMASDP
1201LGVVRGGRVNTHAGGTGPEGRPFAKFI*
FGF23 (R179Q; C206S) amino acid sequence (SEQIDNO:59) of-FcLALAv1
FGF23:1-251; Connexon: 252-256; FcLALA:257-482
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IGGGGSKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
301VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
351GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
401TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
451RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
The amino acid sequence (SEQIDNO:60) of FGF23 (R179Q, C244S)-FcLALAv1
FGF23:1-251; Connexon: 252-256; FcLALA:257-482
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGRPFAKF
251IGGGGSKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
301VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
351GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
401TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
451RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
The amino acid sequence (SEQIDNO:61) of FGF23 (R179Q, Q156A)-FcLALAv1
FGF23:1-251; Connexon: 252-256; FcLALA:257-482
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IGGGGSKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
301VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
351GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
401TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
451RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
The amino acid sequence (SEQIDNO:62) of FGF23 (R179Q, C206S, C244S)-FcLALAv1
FGF23:1-251; Connexon: 252-256; FcLALA:257-482
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGRPFAKF
251IGGGGSKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
301VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
351GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
401TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
451RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
The amino acid sequence (SEQIDNO:63) of FGF23 (R179Q, C206S, C244S, Q156A)-FcLALAv1
FGF23:1-251; Connexon: 252-256; FcLALA:257-482
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGRPFAKF
251IGGGGSKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
301VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
351GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
401TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
451RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
The amino acid sequence (SEQIDNO:64) of FGF23 (R179Q, C206S)-FcLALAv2
FGF23:1-251; Connexon: 252-256; FcLALA:257-473
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IGGGGSAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK
301FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
351NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP
401SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
451CSVMHEALHNHYTQKSLSLSPGK*
The amino acid sequence (SEQIDNO:65) of FGF23 (R179Q, C244S)-FcLALAv2
FGF23:1-251; Connexon: 252-256; FcLALA:257-473
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGRPFAKF
251IGGGGSAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK
301FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
351NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP
401SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
451CSVMHEALHNHYTQKSLSLSPGK*
The amino acid sequence (SEQIDNO:66) of FGF23 (R179Q, Q156A)-FcLALAv2
FGF23:1-251; Connexon: 252-256; FcLALA:257-473
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKF
251IGGGGSAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK
301FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
351NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP
401SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
451CSVMHEALHNHYTQKSLSLSPGK*
The amino acid sequence (SEQIDNO:67) of FGF23 (R179Q, C206S, C244S)-FcLALAv2
FGF23:1-251; Connexon: 252-256; FcLALA:257-473
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGRPFAKF
251IGGGGSAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK
301FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
351NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP
401SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
451CSVMHEALHNHYTQKSLSLSPGK*
The amino acid sequence (SEQIDNO:68) of FGF23 (R179Q, C206S, C244S, Q156A)-FcLALAv2
FGF23:1-251; Connexon: 252-256; FcLALA:257-473
1MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNS
51YHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRG
101NIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMN
151PPPYSFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMT
201PAPASSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGRPFAKF
251IGGGGSAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK
301FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
351NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP
401SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
451CSVMHEALHNHYTQKSLSLSPGK*
Claims (22)
1. fused polypeptide, described fused polypeptide is held to hold to C-from N-and is: (a) people αThe sKlotho of Klotho, (b) human fibroblastic growth factor 23 polypeptide, it hasIn the sudden change of position R179, C206 and C244, the wherein sudden change at position R179 placeFor R179Q; And optionally (c) has the compatibility to Fc-γ-acceptor of minimizingAnd/or the modified Fc fragment of the serum half life increasing; They are by polypeptide connexonConnect, wherein said fused polypeptide can activate Egr-1.
2. the fused polypeptide of claim 1, also comprises signal peptide.
3. the fused polypeptide of claim 2, wherein signal peptide is Klotho signal peptide.
4. the fused polypeptide of claim 2, wherein signal peptide is IgG signal peptide.
5. the fused polypeptide of claim 1-4 any one, wherein polypeptide connexon is by being selected fromSEQIDNO:11、SEQIDNO:12、SEQIDNO:13、SEQIDNO:14, SEQIDNO:15, SEQIDNO:16, SEQIDNO:17 and SEQIDThe amino acid sequence composition of the group that NO:18 forms.
6. the fused polypeptide of claim 1-4 any one, wherein polypeptide connexon is by being selected fromSEQIDNO:12、SEQIDNO:13、SEQIDNO:14、SEQIDNO:15, SEQIDNO:16, SEQIDNO:17 and SEQIDNO:18 formAt least 1 of amino acid sequence of group at the most 30 repeat to form.
7. the fused polypeptide of claim 1-4 any one, wherein polypeptide connexon is by SEQThe amino acid 252-256 composition of IDNO:68.
8. the fused polypeptide of claim 1-4 any one, itself and Desmocyte growth factorSub-receptor-specific combination.
9. the claim 1 being formed by the amino acid sequence of SEQIDNO:57 or 58Fused polypeptide.
10. melting of the claim 1 being formed by the amino acid sequence of SEQIDNO:58Close polypeptide.
11. by SEQIDNO:61,62,63,66,67 or 68 amino acid sequenceThe fused polypeptide of composition.
12. the fused polypeptide being formed by the amino acid sequence of SEQIDNO:68.
13. the fused polypeptide of any one of claim 1-4 is wherein said modifiedFc fragment is FcLALA, the amino acid that its amino acid sequence is SEQIDNO:47The amino acid/11 234-1450 of 1234-1459 or SEQIDNO:49.
The fused polypeptide of 14. any one that comprise claim 1-13 and pharmaceutically suitable carrierPharmaceutical composition.
The nucleic acid of the fused polypeptide of any one of 15. coding claim 1-13.
16. the host cell of the nucleic acid that contains claim 15.
17. the carrier of the nucleic acid that comprises claim 15.
18. the fused polypeptide described in any one of claim 1-10 and 13 is used in preparationPurposes in the pharmaceutical composition for the treatment of in individuality or prevention age related conditions, itsDescribed in age related conditions be selected from that atrophoderma, flesh are subdued, atherosclerotic, movingThe group that the life expectancy of arteries and veins sclerosis, pulmonary emphysema, osteoporosis, shortening forms.
19. the purposes of claim 18, wherein age related conditions is that flesh is subdued.
20. the fused polypeptide described in any one of claim 1-13 for the preparation ofTreatment or prevention hypophosphatemia illness, hyperphosphatemia, dermatomyositis or crown in individualityPurposes in the pharmaceutical composition of arterial disease.
21. the fused polypeptide described in any one of claim 1-10 and 13 is used in preparationIn treating or prevent the purposes in amyotrophic pharmaceutical composition.
22. the medicine of the fused polypeptide described in any one that comprises claim 1-10 and 13Compositions is for the preparation for the treatment of or prevent the purposes in amyotrophic pharmaceutical composition.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201310049110.2A CN103204941B (en) | 2010-01-29 | 2011-01-27 | Use the method and composition of FGF23 fused polypeptide |
CN201610245160.1A CN105968208A (en) | 2010-01-29 | 2011-01-27 | Methods and compositions using FGF23 fusion polypeptides |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/696,693 US8420088B2 (en) | 2008-01-28 | 2010-01-29 | Methods and compositions using FGF23 fusion polypeptides |
US12/696,693 | 2010-01-29 | ||
PCT/EP2011/051112 WO2011092234A1 (en) | 2010-01-29 | 2011-01-27 | Methods and compositions using fgf23 fusion polypeptides |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201610245160.1A Division CN105968208A (en) | 2010-01-29 | 2011-01-27 | Methods and compositions using FGF23 fusion polypeptides |
CN201310049110.2A Division CN103204941B (en) | 2010-01-29 | 2011-01-27 | Use the method and composition of FGF23 fused polypeptide |
Publications (2)
Publication Number | Publication Date |
---|---|
CN102725413A CN102725413A (en) | 2012-10-10 |
CN102725413B true CN102725413B (en) | 2016-05-11 |
Family
ID=43828141
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201310049110.2A Active CN103204941B (en) | 2010-01-29 | 2011-01-27 | Use the method and composition of FGF23 fused polypeptide |
CN201610245160.1A Withdrawn CN105968208A (en) | 2010-01-29 | 2011-01-27 | Methods and compositions using FGF23 fusion polypeptides |
CN201180007622.1A Active CN102725413B (en) | 2010-01-29 | 2011-01-27 | Use the method and composition of FGF23 fused polypeptide |
Family Applications Before (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201310049110.2A Active CN103204941B (en) | 2010-01-29 | 2011-01-27 | Use the method and composition of FGF23 fused polypeptide |
CN201610245160.1A Withdrawn CN105968208A (en) | 2010-01-29 | 2011-01-27 | Methods and compositions using FGF23 fusion polypeptides |
Country Status (16)
Country | Link |
---|---|
US (3) | US8420088B2 (en) |
EP (2) | EP2529016B1 (en) |
JP (2) | JP5964243B2 (en) |
KR (1) | KR20130032296A (en) |
CN (3) | CN103204941B (en) |
AR (1) | AR080043A1 (en) |
AU (1) | AU2011209380B2 (en) |
CA (1) | CA2787285A1 (en) |
EA (1) | EA201201047A1 (en) |
ES (1) | ES2605302T3 (en) |
MX (1) | MX336391B (en) |
PL (1) | PL2529016T3 (en) |
PT (1) | PT2529016T (en) |
TW (2) | TWI569805B (en) |
UY (1) | UY33204A (en) |
WO (1) | WO2011092234A1 (en) |
Families Citing this family (33)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8420088B2 (en) | 2008-01-28 | 2013-04-16 | Novartis Ag | Methods and compositions using FGF23 fusion polypeptides |
TW200936156A (en) | 2008-01-28 | 2009-09-01 | Novartis Ag | Methods and compositions using Klotho-FGF fusion polypeptides |
US8951966B2 (en) | 2011-07-01 | 2015-02-10 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants and fusions of FGF19 polypeptides, and uses and methods thereof for treatment of metabolic disorders and diseases |
US9290557B2 (en) | 2012-11-28 | 2016-03-22 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants and fusions of FGF19 polypeptides |
ES2828505T3 (en) | 2012-11-28 | 2021-05-26 | Ngm Biopharmaceuticals Inc | Compositions and methods for the treatment of metabolic disorders and diseases |
CN102961739A (en) * | 2012-12-12 | 2013-03-13 | 黄曙 | Application of KLOTHO protein |
US9273107B2 (en) | 2012-12-27 | 2016-03-01 | Ngm Biopharmaceuticals, Inc. | Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
IL292303A (en) | 2012-12-27 | 2022-06-01 | Ngm Biopharmaceuticals Inc | Methods for modulating bile acid homeostatsis and treatment of bile acid disorders and disease |
WO2014152993A1 (en) * | 2013-03-14 | 2014-09-25 | The Board Of Regents Of The University Of Oklahoma | Use of klotho nucleic acids or proteins for treatment of diabetes and diabetes-related conditions |
KR101492710B1 (en) * | 2013-04-03 | 2015-02-13 | 중앙대학교 산학협력단 | Makers for the diagnosis to prostate cancer using FGF23 gene and method for predicting and detecting to prostate cancer using the same |
US9618502B2 (en) | 2013-10-24 | 2017-04-11 | Tokyo Metropolitan Geriatric Hospital And Institute Of Gerontology | Muscle stem cell or myoblast, method for screening substances that participate in metabolic conversion using same, and pharmaceutical composition comprising substance obtained from said screening method |
EP3062881B1 (en) | 2013-10-28 | 2019-10-02 | NGM Biopharmaceuticals, Inc. | Cancer models and associated methods |
EP3068435A1 (en) | 2013-11-13 | 2016-09-21 | Novartis AG | Mtor inhibitors for enhancing the immune response |
JP6837840B2 (en) | 2014-01-24 | 2021-03-10 | エヌジーエム バイオファーマシューティカルス,インコーポレーテッド | Binding protein and how to use it |
JP6370577B2 (en) * | 2014-03-26 | 2018-08-08 | 国立大学法人京都工芸繊維大学 | Screening method for anti-aging substances |
US10398758B2 (en) | 2014-05-28 | 2019-09-03 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions |
EP3155005A4 (en) | 2014-06-16 | 2018-07-11 | NGM Biopharmaceuticals, Inc. | Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
US10588980B2 (en) | 2014-06-23 | 2020-03-17 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
US10517929B2 (en) | 2014-10-23 | 2019-12-31 | Ngm Biopharmaceuticals, Inc. | Pharmaceutical compositions comprising FGF19 variants |
WO2016073855A1 (en) | 2014-11-07 | 2016-05-12 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders |
EA201791238A1 (en) * | 2014-12-04 | 2018-02-28 | Новартис Аг | METHODS AND COMPOSITIONS IN WHICH OPTIONS OF KLOTHO POLYPEPTIDES ARE USED |
JP6794363B2 (en) | 2015-02-06 | 2020-12-02 | ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア | Methods and compositions for improving cognition |
US10800843B2 (en) | 2015-07-29 | 2020-10-13 | Ngm Biopharmaceuticals, Inc. | Beta klotho-binding proteins |
JP6728352B2 (en) | 2015-11-09 | 2020-07-22 | エヌジーエム バイオファーマシューティカルス,インコーポレーテッド | How to treat disorders related to bile acids |
EA037848B1 (en) * | 2016-07-14 | 2021-05-27 | Общество С Ограниченной Ответственностью "Биохимический Агент" | Fusion protein, polynucleotide, genetic construct, producer, preparation for regeneration of cartilage (variants) |
CN107759697B (en) * | 2016-08-19 | 2023-03-24 | 安源医药科技(上海)有限公司 | Method for producing fusion protein |
CN106279437B (en) | 2016-08-19 | 2017-10-31 | 安源医药科技(上海)有限公司 | Hyperglycosylated human coagulation factor VIII fusion proteins and preparation method thereof and purposes |
US11123438B2 (en) | 2016-08-19 | 2021-09-21 | Ampsource Biopharma Shanghai Inc. | Linker peptide for constructing fusion protein |
US11370841B2 (en) | 2016-08-26 | 2022-06-28 | Ngm Biopharmaceuticals, Inc. | Methods of treating fibroblast growth factor 19-mediated cancers and tumors |
KR20210153069A (en) * | 2019-04-19 | 2021-12-16 | 제네똥 | Gene therapy for fibroblast growth factor 23-associated hypophosphatemic disease |
WO2021128065A1 (en) * | 2019-12-25 | 2021-07-01 | 广州菲康生物技术有限公司 | Human fgf-23 fluorescence immunochromatographic test paper and human fgf-23 fluorescence immunochromatographic test kit |
US11028132B1 (en) | 2020-04-07 | 2021-06-08 | Yitzhak Rosen | Half-life optimized linker composition |
US11981718B2 (en) | 2020-05-27 | 2024-05-14 | Ampsource Biopharma Shanghai Inc. | Dual-function protein for lipid and blood glucose regulation |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1446227A (en) * | 2000-07-19 | 2003-10-01 | 先端研究与技术学院 | Novel fibroblast growth factor (FRF23) and method for use |
WO2009095372A1 (en) * | 2008-01-28 | 2009-08-06 | Novartis Ag | Methods and compositions using klotho-fgf fusion polypeptides |
WO2009117622A2 (en) * | 2008-03-19 | 2009-09-24 | Ambrx, Inc. | Modified fgf-23 polypeptides and their uses |
Family Cites Families (42)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
IL71691A (en) | 1984-04-27 | 1991-04-15 | Yeda Res & Dev | Production of interferon-ypsilon |
US5128326A (en) | 1984-12-06 | 1992-07-07 | Biomatrix, Inc. | Drug delivery systems based on hyaluronans derivatives thereof and their salts and methods of producing same |
US5266561A (en) | 1988-01-11 | 1993-11-30 | Amylin Pharmaceuticals, Inc. | Treatment of type 2 diabetes mellitus |
AU642932B2 (en) | 1989-11-06 | 1993-11-04 | Alkermes Controlled Therapeutics, Inc. | Protein microspheres and methods of using them |
US5387742A (en) | 1990-06-15 | 1995-02-07 | Scios Nova Inc. | Transgenic mice displaying the amyloid-forming pathology of alzheimer's disease |
US5408038A (en) * | 1991-10-09 | 1995-04-18 | The Scripps Research Institute | Nonnatural apolipoprotein B-100 peptides and apolipoprotein B-100-apolipoprotein A-I fusion peptides |
US5912015A (en) | 1992-03-12 | 1999-06-15 | Alkermes Controlled Therapeutics, Inc. | Modulated release from biocompatible polymers |
US5420112A (en) | 1992-06-12 | 1995-05-30 | Lewis; Michael E. | Prevention and treatment of peripheral neuropathy |
US5541094A (en) * | 1992-09-25 | 1996-07-30 | E. I. Du Pont De Nemours And Company | Glyoxylic acid/aminomethylphosphonic acid mixtures prepared using a microbial transformant |
US5877399A (en) | 1994-01-27 | 1999-03-02 | Johns Hopkins University | Transgenic mice expressing APP-Swedish mutation develop progressive neurologic disease |
US6187992B1 (en) | 1994-12-05 | 2001-02-13 | Merck & Co., Inc. | Transgenic mouse having a disrupted amyloid precursor protein gene |
JP2000507912A (en) | 1995-08-31 | 2000-06-27 | アルカームズ コントロールド セラピューティックス,インコーポレイテッド | Sustained release composition of active agent |
US6194177B1 (en) | 1996-02-20 | 2001-02-27 | Applied Research Systems Ars Holding N.V. | DNA encoding a hybrid heterodimeric protein |
JP3258027B2 (en) | 1996-03-15 | 2002-02-18 | サマーセット・ファーマシューティカルズ・インコーポレイテッド | Prevention and treatment of peripheral neuropathy by administration of selegiline |
US6358752B1 (en) | 1996-09-27 | 2002-03-19 | Cornell Research Foundation, Inc. | Liposome-enhanced test device and method |
KR20000062345A (en) | 1996-12-26 | 2000-10-25 | 히라타 다다시 | Novel peptide, novel DNA, and novel antibody |
US6127598A (en) | 1997-07-25 | 2000-10-03 | The Regents Of The University Of California | NKX-2.2 and NKX-6.1 transgenic mouse models for diabetes, depression, and obesity |
US5989463A (en) | 1997-09-24 | 1999-11-23 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release devices |
SE512663C2 (en) | 1997-10-23 | 2000-04-17 | Biogram Ab | Active substance encapsulation process in a biodegradable polymer |
JP2002510505A (en) | 1998-04-03 | 2002-04-09 | フィロス インク. | Localizable protein arrays |
US7060479B2 (en) * | 1999-12-08 | 2006-06-13 | Serono Genetics Institute, S.A. | Full-length human cDNAs encoding potentially secreted proteins |
US20030055231A1 (en) | 1998-10-28 | 2003-03-20 | Jian Ni | 12 human secreted proteins |
ATE319105T1 (en) | 1999-04-22 | 2006-03-15 | Liposcience Inc | NMR METHOD FOR DETERMINING THE RISK OF DEVELOPING DIABETES TYPE 2 |
ATE384137T1 (en) | 1999-08-12 | 2008-02-15 | Wisconsin Alumni Res Found | IDENTIFICATION OF GENETIC MARKERS OF BIOLOGICAL AGE AND METABOLISM |
US6569832B1 (en) | 1999-11-12 | 2003-05-27 | Novo Nordisk A/S | Inhibition of beta cell degeneration |
US6716626B1 (en) | 1999-11-18 | 2004-04-06 | Chiron Corporation | Human FGF-21 nucleic acids |
US6406853B1 (en) | 1999-12-23 | 2002-06-18 | The Regents Of The University Of California | Interventions to mimic the effects of calorie restriction |
JP2006238894A (en) * | 2000-02-15 | 2006-09-14 | Amgen Inc | Fibroblast growth factor-23 molecules and uses thereof |
US20060160181A1 (en) * | 2000-02-15 | 2006-07-20 | Amgen Inc. | Fibroblast Growth Factor-23 molecules and uses thereof |
EP1261638A2 (en) | 2000-03-08 | 2002-12-04 | Chiron Corporation | Human fgf-23 gene and gene expression products |
AU2002243750A1 (en) | 2001-01-30 | 2002-08-12 | Regeneron Pharmaceuticals, Inc. | Novel nucleic acid and polypeptide molecules |
US7588757B2 (en) | 2001-03-14 | 2009-09-15 | Genzyme Corporation | Methods of treating Parkinson's disease using recombinant adeno-associated virus virions |
CA2443719A1 (en) * | 2001-04-26 | 2002-11-07 | Geneprot, Inc. | Human fibroblast growth factor-related compositions |
EP1327443A1 (en) | 2001-12-21 | 2003-07-16 | Kyowa Hakko Kogyo Co., Ltd. | Therapeutic or preventing agent for the diseases caused by a decrease in the expression level of the klotho protein |
US20050004348A1 (en) * | 2002-12-23 | 2005-01-06 | Miyamoto Ken-Ichi | Novel type II Na/Pi cotransporters and type II Na/Pi cotransporter expression regulatory factors |
EP1673395A1 (en) | 2003-10-15 | 2006-06-28 | PDL BioPharma, Inc. | Alteration of fc-fusion protein serum half-lives by mutagenesis of positions 250, 314 and/or 428 of the heavy chain constant region of ig |
US8420088B2 (en) | 2008-01-28 | 2013-04-16 | Novartis Ag | Methods and compositions using FGF23 fusion polypeptides |
PE20120021A1 (en) | 2008-10-10 | 2012-02-10 | Amgen Inc | MUTANTS FGF21 |
MX2011011815A (en) | 2009-05-05 | 2012-01-27 | Amgen Inc | Fgf21 mutants and uses thereof. |
US8461111B2 (en) | 2009-05-20 | 2013-06-11 | Florida State University Research Foundation | Fibroblast growth factor mutants having improved functional half-life and methods of their use |
US20110195077A1 (en) | 2010-01-29 | 2011-08-11 | Novartis Ag | Methods and compositions using fgf23 fusion ppolypeptides |
US10588980B2 (en) | 2014-06-23 | 2020-03-17 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
-
2010
- 2010-01-29 US US12/696,693 patent/US8420088B2/en not_active Expired - Fee Related
-
2011
- 2011-01-27 CN CN201310049110.2A patent/CN103204941B/en active Active
- 2011-01-27 CN CN201610245160.1A patent/CN105968208A/en not_active Withdrawn
- 2011-01-27 PT PT117058305T patent/PT2529016T/en unknown
- 2011-01-27 KR KR1020127022498A patent/KR20130032296A/en not_active Application Discontinuation
- 2011-01-27 MX MX2012008780A patent/MX336391B/en unknown
- 2011-01-27 EP EP11705830.5A patent/EP2529016B1/en active Active
- 2011-01-27 PL PL11705830T patent/PL2529016T3/en unknown
- 2011-01-27 EA EA201201047A patent/EA201201047A1/en unknown
- 2011-01-27 AU AU2011209380A patent/AU2011209380B2/en not_active Ceased
- 2011-01-27 EP EP16184724.9A patent/EP3124612A1/en not_active Withdrawn
- 2011-01-27 CN CN201180007622.1A patent/CN102725413B/en active Active
- 2011-01-27 UY UY0001033204A patent/UY33204A/en not_active Application Discontinuation
- 2011-01-27 CA CA2787285A patent/CA2787285A1/en not_active Withdrawn
- 2011-01-27 JP JP2012550437A patent/JP5964243B2/en active Active
- 2011-01-27 WO PCT/EP2011/051112 patent/WO2011092234A1/en active Application Filing
- 2011-01-27 ES ES11705830.5T patent/ES2605302T3/en active Active
- 2011-01-27 AR ARP110100273A patent/AR080043A1/en unknown
- 2011-01-28 TW TW103100421A patent/TWI569805B/en not_active IP Right Cessation
- 2011-01-28 TW TW100103508A patent/TWI430805B/en active
-
2013
- 2013-03-12 US US13/796,711 patent/US8932589B2/en not_active Expired - Fee Related
-
2014
- 2014-11-03 US US14/531,620 patent/US9475857B2/en active Active
-
2016
- 2016-04-25 JP JP2016087432A patent/JP2016190847A/en active Pending
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1446227A (en) * | 2000-07-19 | 2003-10-01 | 先端研究与技术学院 | Novel fibroblast growth factor (FRF23) and method for use |
WO2009095372A1 (en) * | 2008-01-28 | 2009-08-06 | Novartis Ag | Methods and compositions using klotho-fgf fusion polypeptides |
WO2009117622A2 (en) * | 2008-03-19 | 2009-09-24 | Ambrx, Inc. | Modified fgf-23 polypeptides and their uses |
Non-Patent Citations (2)
Title |
---|
Klotho converts canonical FGF receptor into a specific receptor for FGF23;URAKAWA et al;《Nature》;20061231;第444卷;第770-774页 * |
WU X et al.C-terminal tail of FGF19 determines its specificity toward Klotho co-receptors.《Journal of biological chemistry》.2008,第283卷(第48期),33304-33309. * |
Also Published As
Publication number | Publication date |
---|---|
CN102725413A (en) | 2012-10-10 |
US9475857B2 (en) | 2016-10-25 |
KR20130032296A (en) | 2013-04-01 |
EP3124612A1 (en) | 2017-02-01 |
CN103204941B (en) | 2016-05-04 |
UY33204A (en) | 2011-08-31 |
JP2016190847A (en) | 2016-11-10 |
MX2012008780A (en) | 2012-12-17 |
TWI430805B (en) | 2014-03-21 |
US8420088B2 (en) | 2013-04-16 |
WO2011092234A1 (en) | 2011-08-04 |
EP2529016B1 (en) | 2016-08-24 |
JP5964243B2 (en) | 2016-08-03 |
EP2529016A1 (en) | 2012-12-05 |
JP2013517781A (en) | 2013-05-20 |
CA2787285A1 (en) | 2011-08-04 |
CN105968208A (en) | 2016-09-28 |
TW201129373A (en) | 2011-09-01 |
MX336391B (en) | 2016-01-18 |
AR080043A1 (en) | 2012-03-07 |
US20130224196A1 (en) | 2013-08-29 |
US20100215657A1 (en) | 2010-08-26 |
PL2529016T3 (en) | 2017-02-28 |
US20160031961A1 (en) | 2016-02-04 |
EA201201047A1 (en) | 2013-02-28 |
AU2011209380A1 (en) | 2012-08-09 |
PT2529016T (en) | 2016-12-12 |
ES2605302T3 (en) | 2017-03-13 |
CN103204941A (en) | 2013-07-17 |
TW201414488A (en) | 2014-04-16 |
TWI569805B (en) | 2017-02-11 |
AU2011209380B2 (en) | 2013-09-12 |
US8932589B2 (en) | 2015-01-13 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN102725413B (en) | Use the method and composition of FGF23 fused polypeptide | |
CN102015760B (en) | Methods and compositions using KLOTHO-FGF fusion polypeptides | |
US9139631B2 (en) | Methods and compositions using FGF23 variant polypeptides with reduced aggregation and cleavage | |
EP3227319B1 (en) | Methods and compositions using klotho variant polypeptides | |
EP3973981A1 (en) | Huwentoxin-iv variants and methods of use | |
US10414808B2 (en) | Huwentoxin-IV variants and methods of use |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C53 | Correction of patent for invention or patent application | ||
CB02 | Change of applicant information |
Address after: Basel Applicant after: Novartis Ag Address before: Basel Applicant before: Novartis AG |
|
COR | Change of bibliographic data |
Free format text: CORRECT: APPLICANT; FROM: NOVARTIS AG TO: NOVARTIS CO., LTD. |
|
C14 | Grant of patent or utility model | ||
GR01 | Patent grant |