CN102603882A - Antifungal peptide as well as preparation method and application thereof - Google Patents
Antifungal peptide as well as preparation method and application thereof Download PDFInfo
- Publication number
- CN102603882A CN102603882A CN2011100249928A CN201110024992A CN102603882A CN 102603882 A CN102603882 A CN 102603882A CN 2011100249928 A CN2011100249928 A CN 2011100249928A CN 201110024992 A CN201110024992 A CN 201110024992A CN 102603882 A CN102603882 A CN 102603882A
- Authority
- CN
- China
- Prior art keywords
- peptide
- fungus
- preparation
- antifungal
- polypeptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Images
Landscapes
- Peptides Or Proteins (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The invention provides an antifungal peptide as well as a preparation method and application thereof. The antifungal peptide is the peptide with amino acid sequences shown in SEQ ID NO.2, or a biological activity function fragment, variant or derivative of the peptide. The antifungal peptide has the advantages of relatively wide antifungal spectrum and low cytotoxicity. The antifungal peptide is prepared by a biological or chemical method, can be used for overcoming the defects of low specific activity or the like during the natural polypeptide scale production and application, can be applied in the aquaculture industry, especially in controlling the water fungus and can be used for effectively protecting each stage of the fish growth.
Description
Technical field
The present invention relates to a kind of anti-fungus peptide, Preparation Method And The Use, belong to biological chemistry and biomedical sector with anti-mycotic activity.
Background technology
Antibacterial peptide is one type of amphiphilic small molecules basic polypeptide that extensively is present in the whole organic sphere; Extensively be present in the organism; Comprise bacterium, fungi, plant, insect, fish, birds, crustacean, Amphibians and Mammals etc.; Existing above 750 kinds more than, wherein the overwhelming majority is a cationic antibacterial peptide, and a small amount of negatively charged ion antibacterial peptide is also arranged.Because antibacterial peptide shows broad-spectrum anti-microbial activity, and have neutralizing effect to bacterial poison, its mechanism of action is unique, be difficult for producing resistance, and some antibacterial peptide only works to prokaryotic organism and mutant cell again, and is harmless to eukaryote.Thereby produced under the obvious chemical sproof situation in many pathogenic bacterium, the discovery of antibacterial peptide and further investigation for the brand-new antibacterials of exploitation provide maybe.
Antibacterial peptide is the key factor of body congenital immunity.Therefore the mechanism of action of antibacterial peptide is different with traditional microbiotic, and its target site mainly is the pathogen cells film, be difficult for producing resistance, and antibacterial peptide does not almost have toxic side effect to eukaryotic cell, only acts on prokaryotic cell prokaryocyte and the eukaryotic cell that pathology takes place.Antibacterial peptide not only acts on gram-positive microorganism and Gram-negative bacteria, and acts on fungi, protozoon, some virus and tumour cell, simultaneously, can also quicken immunity and wound healing process.Because pathogenic bacteria progressively develops immunity to drugs to microbiotic, antibacterial peptide has been opened up wide prospect for the new antibacterium of exploitation, antimycotic, antiviral and antitumor drug.
Antibacterial peptide is that prokaryotic organism, eukaryote even the mankind can produce by the huge gene family of a coded polypeptide.At present, scientist has obtained the natural antibacterial peptide with synthetic of hundreds of kind, but though these antibacterial peptides in size, become to be grouped into, all have a very big-difference on electric charge and the secondary structure.In addition, antibacterial peptide has five kinds of structure types: linear structure, spirane structure often; Be rich in cysteine residues; Form the polypeptide of β-laminated structure; The polypeptide of proline rich; The polypeptide that contains rare or modified amino acid.These characteristics are very important for the target structure of identification mikrobe.
About antimycotic albumen and polypeptide, though obtained remarkable progress in recent years.Fungal cell membrane has been proved the desired target as alexin appearance polypeptide and plant alexin.But the fungal cell exists some inner polypeptide and outside polypeptide, is fully possible and induce fungal cell's death through the cascade of adjusting intercellular signal after the antibacterial peptide polypeptide effect outside with it.
Summary of the invention
The present invention is based on the analysis to the chemical structure of sharp bladder spiral shell natural polypeptides, a kind of novel anti-fungus peptide is prepared in chemically modified and synthetic its resulting structure, in the hope of as traditional antibiotic surrogate, strengthens many-sided advantage of antibacterial peptide.
Therefore, the objective of the invention is to, a kind of novel anti-fungus peptide is provided.
Another object of the present invention is, the Preparation method and use of above-mentioned anti-fungus peptide is provided.
The objective of the invention is to realize through following technical scheme.On the one hand, the present invention provides a kind of anti-fungus peptide, and said anti-fungus peptide is peptide, its bioactive functions fragment, variant or the verivate with aminoacid sequence shown in the SEQ.ID.NO.2.
Preferably, effective antimycotic concentration of said anti-fungus peptide is for being not less than 1.3 μ M; Preferably said concentration is 1.3-33 μ M.
Preferably, said fungi is selected from Fusarium oxysporum, neurospora crassa and water mo(u)ld.
On the other hand, the present invention also provides the preparation method of said anti-fungus peptide, and said anti-fungus peptide can be through the preparation of biological or chemical method.
The present invention also provides the purposes of above-mentioned anti-fungus peptide in the preparation antifungal medicament.Preferably, said fungi is selected from Fusarium oxysporum, neurospora crassa and water mo(u)ld.
In addition, the present invention also provides a kind of antifungal preparation, and it comprises the above-mentioned anti-fungus peptide of effective anti-fungal amount.Preferably, the concentration of said anti-fungus peptide is for being not less than 1.3 μ M; Preferably said concentration is 1.3-33 μ M.
In a preferred embodiment, the design of anti-fungus peptide provided by the invention and compound method may further comprise the steps:
The wild sharp bladder spiral shell of 1) catching from the field is in laboratory rearing, and temperature remains on 15 ℃, and salinity remains on 35 ‰.
2) every sharp bladder spiral shell is gathered the blood of 0.5ml, and adds isopyknic anti-freezing damping fluid mixing.
3) processing of blood sample.
4) extract and purifying protein according to the SPE and HPLC (performance liquid chromatography) method of routine.
5) be further purified albumen with reversed-phase HPLC.
6) above-mentioned purified proteins is carried out vacuum lyophilization, obtain sharp bladder spiral shell hemocyte antibacterial peptide.
7) measure the molecular weight of antibacterial peptide with the SDS-PAGE method, with the composition of Edman PCR sequencing PCR analysis of amino acid.
8) use micrococci, staphylococcus epidermidis, intestinal bacteria, Aeromonas hydrophila, Vibrio parahemolyticus and vibrio cholerae carry out antibacterial activity and measure.
9) use Fusarium oxysporum, neurospora crassa and water mold carry out the mensuration of anti-mycotic activity.
10) adopt CHSE-214 raji cell assay Raji antibacterial peptide cytotoxicity.
11) design of novel antimicrobial peptide Apn: for the hydrophobicity (bringing up to 38%) that improves antibacterial peptide and cation surface activating from 25% (from+1 bring up to+5), begin to delete 10 hydrophilic amino acid: T-1, Y-2, Y-10 from the N-end; N-13, S-15, Y-16; Q-19, N-23, Q-31 and Y-44.Delete 5 electronegative amino acid: E-6, E-7, E-9, D-18 and D-37 simultaneously.With the amphiphilic polypeptide called after Apn that forms, it is a polypeptide that is different from AP, and hydrophobicity brings up to 38% from 25%, cation surface activating from+1 bring up to+5.
12) synthetic and purified polypeptide Ap and Apn with the chemical synthesis of standard.
13) adopt the spectrography of circular dichroism (CD) that polypeptide A p and Apn are analyzed, adopt the ClustalW biosoftware to carry out homology analysis, the analytical standard homology is higher than 30%.
14) with information biology software PSIPRED and SOPMA polypeptide A p and Apn are carried out secondary structure prediction.
In sum; The invention provides a kind of hemocyte antibacterial peptide primary structure and anti-fungus peptide of designing based on sharp bladder spiral shell with anti-mycotic activity; The method of design of this anti-fungus peptide comprises following step: at first separation and purifying obtain a natural polypeptides from the hemocyte of sharp bladder spiral shell; Visible from its primary structure, this polypeptide contains 47 amino-acid residues, with its called after AP; Secondly, through the synthetic polypeptide that to obtain a molecular weight be 5100.78Da; This polypeptide contains 25% hydrophobic amino acid, and has 1 clean positive charge, and this polypeptide and known active antibacterial peptide have portion homologous property; Based on this sequence information; The design and made up a novel polypeptide and a called after Apn with 30 amino-acid residues, it has 5 clean positive charges, molecular weight is 3028Da; Have 38% hydrophobic molecule, it has stronger hydrophobicity and cation surface activating; The secondary structure of Apn is to adopt the circular dichroism method to measure, so the N-end has a hydrophobicity epi-position, and the C-end has a wetting ability epi-position, has formed an amphipathic molecule.Through experiment showed, that the Apn polypeptide has more activity than AP polypeptide, and be CDCC still when reaching 100 μ M to the CHSE-214 cell.Thus it is clear that, also can obtain to have more the active antibacterial peptide to the chemically modified of natural polypeptides and the chemosynthesis of resulting structure, the defectives such as low specific activity when also having overcome natural polypeptides large-scale production and application simultaneously.
Anti-fungus peptide provided by the invention has anti-fungus spectra comparatively widely; And pair cell toxicity is low; Can adopt the preparation of biological or chemical method, the defectives such as low specific activity when having overcome natural polypeptides large-scale production and application can be applicable to culture fishery; Be particularly useful for controlling water mo(u)ld, can protect each stage of fish growth effectively.
Description of drawings
Below, specify embodiment of the present invention in conjunction with accompanying drawing, wherein:
Fig. 1 is the polypeptide pedigree chart of cut among the embodiment 1, and wherein, the left side is the standard protein molecular weight among the last protein electrophorese figure of figure, and the right side is the cut with anti-mycotic activity.
Fig. 2 is the homology analysis figure of antibacterial peptide among the embodiment 4.
Fig. 3 be among the embodiment 4 the circular dichroism spectrometry to the analytical results of polypeptide.
The antibacterial peptide secondary structure model of Fig. 4 for obtaining among the embodiment 4, wherein, left side figure is antibacterial peptide Ap, the right side is antibacterial peptide Apn.
Embodiment
The concrete embodiment of following reference explains the present invention.It will be appreciated by those skilled in the art that these embodiment only are used to explain the present invention, the scope that it does not limit the present invention in any way.
Embodiment 1The extraction of AP polypeptide and purifying
Catch the sharp bladder spiral shell of self-sow from the field, remain on 15 ℃ in temperature, salinity remains on laboratory rearing under 35 ‰ conditions.
Every sharp bladder spiral shell is gathered the blood of 0.5ml, and (buffer formulation is following: Citric Acid trisodium 2H to add Alsever ' the s solution anti-freezing damping fluid of isopyknic improvement
2O 8.0g, Citric Acid 0.5g, dextrose anhydrous 20.8g, sodium-chlor 22.3g, EDTA3.36g, zero(ppm) water 1000ml, dissolving is filtered, packing, autoclave sterilization, 4 ℃ of refrigerators are preserved subsequent use) mixing, and in 800g, 4 ℃ of following centrifugal 15min; Hemocyte precipitates multigelation 3 times, adds the Tris damping fluid (pH8.7 contains 50mM NaCl) of the 50mM of 5 times of volumes then, uses glass homogenizer homogenate then; In 10000g, 4 ℃ of following centrifugal 20min; The deposition that will contain organoid is resuspended with the 2M acetic acid of 3 times of volumes, and cooling bath, repeats 3 times; In 10000g, 4 ℃ of following centrifugal 20min, so that remove cell debris, 4 ℃ of preservations of supernatant are subsequent use.
SPE and HPLC (performance liquid chromatography) method according to routine are extracted and purifying protein.Operation is as follows: contain proteic supernatant with above-mentioned, be added on the Sep-Pak Plus C-18 pillar, use 5%, 40% and 80% acetonitrile acidifying water elution respectively.Collect elutriant and also detect anti-microbial activity, have only 40% acetonitrile acidifying elutriant to have activity.
Then 40% acetonitrile acidifying elutriant is collected, and be added in the reversed-phase HPLC and be further purified.The specification of chromatographic column is: Sephasil C-18,250 * 4.1mm.And then, collect elutriant with the acidifying acetonitrile solution wash-out of 0-60% linear gradient, freeze-drying is also dissolved with the 0.2ml ultrapure water, detects anti-microbial activity then.
Polypeptide pedigree with cut of anti-mycotic activity is distributed in the scope less than 6.5kDa, and is as shown in Figure 1.
Adopt conventional electrophoresis method, supernatant samples is added in the sample cell of SDS-PAGE gel, the 1-45kDa that adopts Sigma company is as the standard protein molecular weight.The voltage that electrophoresis adopts is 80V, and electrophoresis time is 3h.Then albumen is forwarded on the pvdf membrane, with the composition of Edman PCR sequencing PCR analysis of amino acid, the result is following: TYMPVEEGEYIVNISYADQPKKNSPFTAKKQPGPKVDLSGVKAYGPG (SEQ.ID.NO.1).
Embodiment 2The design of novel antimicrobial peptide Apn
For the hydrophobicity (bringing up to 38%) that improves antibacterial peptide and cation surface activating from 25% (from+1 bring up to+5), begin to delete 10 hydrophilic amino acid: T-1, Y-2, Y-10, N-13, S-15, Y-16, Q-19, N-23, Q-31 and Y-44 from the N-end.Delete 5 electronegative amino acid: E-6, E-7, E-9, D-18 and D-37 simultaneously.With the amphiphilic polypeptide called after Apn that forms, it is a polypeptide that is different from AP, and sequence is following: MPVGIVIAPKKSPFTAKKPGPVLSGVKAGPG (SEQ.ID.NO.2).
Embodiment 3The chemosynthesis of antibacterial peptide and purifying
The chemical synthesis of employing standard (Lu Yingjin, Wang He.The solid phase synthesis of antibacterial peptide, the research of separation and purification and structure activity relationship, biotechnology journal, 1997,13 (1): 35-41) synthetic aforementioned polypeptides Ap and Apn.
After synthetic, extract polypeptide with 10% (v/v) acetate bi-distilled water, through the RP-HPLC purified polypeptide, purity is greater than 95% then.Confirm that through mass spectrometry method the molecular weight of purified polypeptide Apn is 3.028kDa.
Embodiment 4The homology of antibacterial peptide and structural performance analysis
Through choose a large amount of albumen at Protein Data Bank, with the ClustalW biosoftware above-mentioned antibacterial peptide is carried out homology analysis and comparison, the result sees table 1 and Fig. 2.
The homology comparative result of table 1 antibacterial peptide
The result shows that Ap and Apn analytical standard homology are higher than 30%.Natural antibacterial peptide Ap and medfly Ceratotoxin C have higher homology, and novel antibacterial peptide Apn then reaches 39% with the homology of medfly Ceratotoxin C.
Adopt the above-mentioned synthetic polypeptide of circular dichroism (CD) analysis of spectral method.Each sample triplicate is averaged as the final result of mensuration, and is as shown in Figure 3.With information biology software PSIPRED and SOPMA (derive from website ExPASy web server,
Http:// expasy.org) Ap and Apn are carried out secondary structure prediction, the result sees Fig. 4.
Embodiment 5The antibacterial activity test
Carry out the antibacterial activity of above-mentioned antibacterial peptide measures with micrococci, staphylococcus epidermidis, intestinal bacteria, Aeromonas hydrophila, Vibrio parahemolyticus and vibrio cholerae.
These bacteriums on the TSB substratum in 37 ℃ of cultivations; When OD to be grown into (620nm) value is 0.2-0.3, get 100 μ l (1: 100) dilution bacterium liquid, add 10 μ l antibacterial peptides; Continue to cultivate 24h, whether the absorbance (620nm) that detects bacterium liquid decides bacterial growth to be suppressed.The concentration range of antibacterial peptide is 33 μ M.The result sees table 2.
The antibacterial activity of table 2 antibacterial peptide is measured
Above-mentioned antibacterium test-results shows that two kinds of antibacterial peptides all do not have tangible antibacterial activity.
Embodiment 6The anti-mycotic activity test
With Fusarium oxysporum, neurospora crassa and water mold above-mentioned antibacterial peptide is carried out the anti-mycotic activity test.
With the fungal spore of 80 μ l, concentration is 1 * 10
4Individual spore/ml, tsiklomitsin (10 μ g/ml), Streptomycin sulphate (10 μ g/ml) and 20 μ l antibacterial peptides are added in the micro plate jointly, and room temperature (22 ℃) is cultivated 30min then, detects absorbance (595nm).And then after continuing incubated at room temperature 72h, measuring absorbance (595nm).Judge the inhibition situation of fungal growth through the difference that compares absorbance.Antibacterial peptide working concentration 1.3 μ M.The result is shown in table 3.
The anti-mycotic activity of table 3 antibacterial peptide is measured
N representes there is not activity.
Above-mentioned antibacterium test-results shows that two kinds of antibacterial peptides all have anti-mycotic activity, and Apn has anti-fungus spectra comparatively widely.
Embodiment 7Cell toxicity test
Adopt the cytotoxicity of the above-mentioned antibacterial peptide of CHSE-214 raji cell assay Raji.
At the bottom of the CHSE-214 monolayer grows into the confluent culture plate hole 70% the time, wash 3 times with PBS, add antibacterial peptide (concentration range is 1-100 μ M) the effect 3h of different concns then, each concentration is provided with 3 holes.Wash 3 times with PBS then, again with containing 0.1% tryptic EDTA effect 30-60s, peptic cell.Expect that with platform blue dyeing process detects cytoactive then.The result is as shown in table 4, and the cellular control unit survival rate is greater than 90%.
The CTA result of table 4 antibacterial peptide
Above-mentioned test-results shows, in concentration during less than 10 μ M, and Ap and Apn no significant difference, and in concentration during greater than 33 μ M, the toxicity of Apn is significantly less than Ap.
Claims (10)
1. an anti-fungus peptide is characterized in that, said anti-fungus peptide is peptide, its bioactive functions fragment, variant or the verivate with aminoacid sequence shown in the SEQ.ID.NO.2.
2. anti-fungus peptide according to claim 1 is characterized in that, effective antimycotic concentration of said anti-fungus peptide is for being not less than 1.3 μ M.
3. anti-fungus peptide according to claim 1 and 2 is characterized in that, effective antimycotic concentration of said anti-fungus peptide is 1.3-33 μ M.
4. according to each described anti-fungus peptide among the claim 1-3, it is characterized in that said fungi is selected from Fusarium oxysporum, neurospora crassa and water mo(u)ld.
5. the preparation method of each said anti-fungus peptide in the claim 1 to 4 is characterized in that, said anti-fungus peptide is through the preparation of biological or chemical method.
In the claim 1 to 4 each said anti-fungus peptide in the purposes of preparation in the antifungal medicament.
7. the described purposes of claim 6 is characterized in that, said fungi is selected from Fusarium oxysporum, neurospora crassa and water mo(u)ld.
8. antifungal preparation, it comprises each said anti-fungus peptide in the claim 1 to 4 of effective anti-fungal amount.
9. antifungal preparation according to claim 8 is characterized in that, the concentration of said anti-fungus peptide is for being not less than 1.3 μ M.
10. antifungal preparation according to claim 9 is characterized in that, the concentration of said anti-fungus peptide is 1.3-33 μ M.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN 201110024992 CN102603882B (en) | 2011-01-24 | 2011-01-24 | Antifungal peptide as well as preparation method and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN 201110024992 CN102603882B (en) | 2011-01-24 | 2011-01-24 | Antifungal peptide as well as preparation method and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN102603882A true CN102603882A (en) | 2012-07-25 |
| CN102603882B CN102603882B (en) | 2013-07-17 |
Family
ID=46521703
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN 201110024992 Active CN102603882B (en) | 2011-01-24 | 2011-01-24 | Antifungal peptide as well as preparation method and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN102603882B (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104059129A (en) * | 2014-06-04 | 2014-09-24 | 北京源生元科技发展有限公司 | Antifungal peptide and application thereof to inhibition of generation of aflatoxin |
| CN108660120A (en) * | 2017-03-27 | 2018-10-16 | 中国科学院微生物研究所 | Anti-fungus peptide and application thereof |
| CN110724175A (en) * | 2019-10-14 | 2020-01-24 | 浙江海洋大学 | Preparation method for extracting antibacterial peptide from Mytilus edulis processing leftovers by utilizing ultrasonic homogenization |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1314362A (en) * | 2000-03-16 | 2001-09-26 | 中国科学院上海生物化学研究所 | Anti-fungus peptide and its preparing method and use |
-
2011
- 2011-01-24 CN CN 201110024992 patent/CN102603882B/en active Active
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1314362A (en) * | 2000-03-16 | 2001-09-26 | 中国科学院上海生物化学研究所 | Anti-fungus peptide and its preparing method and use |
Non-Patent Citations (2)
| Title |
|---|
| N FUSETANI: "Antifungal peptides in marine invertebrates", 《INVERTEBRATE SURVIVAL JOURNAL》 * |
| 肖业臣等: "昆虫抗菌肽和抗真菌肽结构与功能的关系及分子设计", 《昆虫学报》 * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104059129A (en) * | 2014-06-04 | 2014-09-24 | 北京源生元科技发展有限公司 | Antifungal peptide and application thereof to inhibition of generation of aflatoxin |
| CN108660120A (en) * | 2017-03-27 | 2018-10-16 | 中国科学院微生物研究所 | Anti-fungus peptide and application thereof |
| CN110724175A (en) * | 2019-10-14 | 2020-01-24 | 浙江海洋大学 | Preparation method for extracting antibacterial peptide from Mytilus edulis processing leftovers by utilizing ultrasonic homogenization |
Also Published As
| Publication number | Publication date |
|---|---|
| CN102603882B (en) | 2013-07-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Tam et al. | Correlations of cationic charges with salt sensitivity and microbial specificity of cystine-stabilized β-strand antimicrobial peptides | |
| CN111533786B (en) | Beta-hairpin antibacterial peptide with tryptophan and arginine cross-chain interaction and preparation method thereof | |
| Conlon et al. | The alyteserins: two families of antimicrobial peptides from the skin secretions of the midwife toad Alytes obstetricans (Alytidae) | |
| CN102924574B (en) | Antibacterial peptide LZ1 and application of antibacterial peptide in preparation of antibacterial medicament | |
| He et al. | Antimicrobial peptide diversity in the skin of the torrent frog, Amolops jingdongensis | |
| Gauri et al. | Purification and structural characterization of a novel antibacterial peptide from Bellamya bengalensis: activity against ampicillin and chloramphenicol resistant Staphylococcus epidermidis | |
| Mohammadi et al. | Identification and characterization of novel antimicrobial peptide from hippocampus comes by In Silico and experimental studies | |
| Zhang et al. | Pleurocidin congeners demonstrate activity against Streptococcus and low toxicity on gingival fibroblasts | |
| Maselli et al. | OctoPartenopin: Identification and preliminary characterization of a novel antimicrobial peptide from the suckers of Octopus vulgaris | |
| Zare-Zardini et al. | Identification and biochemical characterization of a new antibacterial and antifungal peptide derived from the insect Sphodromantis viridis | |
| Sivakamavalli et al. | Purification and characterization of a cysteine-rich 14-kda antibacterial peptide from the granular hemocytes of mangrove crab episesarma tetragonum and its antibiofilm activity | |
| Ishwarya et al. | Haemolytic and antibiofilm properties of haemocyanin purified from the haemolymph of Indian white shrimp Fenneropenaeus indicus | |
| CN110156875B (en) | Antibacterial peptide H5-p5, and preparation method and application thereof | |
| EP4229178A1 (en) | A process for the preparation of an antimicrobial peptide | |
| CN102603882B (en) | Antifungal peptide as well as preparation method and application thereof | |
| Accary et al. | Protein content analysis and antimicrobial activity of the crude venom of Montivipera bornmuelleri; a viper from Lebanon | |
| Cho et al. | The novel cathelicidin of naked mole rats, Hg-CATH, showed potent antimicrobial activity and low cytotoxicity | |
| CN113549137B (en) | Proline-rich antibacterial peptide Pyr-2 targeting gram-negative bacteria and preparation method and application thereof | |
| CN103965340B (en) | Guenther's frog antibacterial peptide and application thereof | |
| CN102603883A (en) | Antibacterial peptide, as well as preparation method and application thereof | |
| Lin et al. | Discovery of a novel antimicrobial peptide, Temporin-pke, from the skin secretion of Pelophylax kl. esculentus, and evaluation of its structure-activity relationships | |
| Liu et al. | Purification and cloning of a novel antimicrobial peptide from salivary glands of the hard tick, Ixodes sinensis | |
| CN100575359C (en) | A kind of Odorranagrahami antimicrobialpeptideand and uses thereof | |
| KR101601364B1 (en) | A method for designing antimicrobial peptides for reducing the hemolysis thereof | |
| Kim et al. | Development of a novel short synthetic antibacterial peptide derived from the swallowtail butterfly Papilio xuthus larvae |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| C14 | Grant of patent or utility model | ||
| GR01 | Patent grant |