CN102180970B - Large-scale preparation method of HIV (Human Immunodeficiency Virus)-resistant fusion polypeptide CP32M based on solid-liquid mixing strategy - Google Patents
Large-scale preparation method of HIV (Human Immunodeficiency Virus)-resistant fusion polypeptide CP32M based on solid-liquid mixing strategy Download PDFInfo
- Publication number
- CN102180970B CN102180970B CN201110041918.7A CN201110041918A CN102180970B CN 102180970 B CN102180970 B CN 102180970B CN 201110041918 A CN201110041918 A CN 201110041918A CN 102180970 B CN102180970 B CN 102180970B
- Authority
- CN
- China
- Prior art keywords
- fragment
- cp32m
- solid
- fmoc
- fragments
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related
Links
Classifications
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
- Y02P20/00—Technologies relating to chemical industry
- Y02P20/50—Improvements relating to the production of bulk chemicals
- Y02P20/55—Design of synthesis routes, e.g. reducing the use of auxiliary or protecting groups
Abstract
The invention relates to a large-scale preparation method of HIV (Human Immunodeficiency Virus)-resistant fusion polypeptide CP32M based on a solid-liquid mixing strategy, and provides a preparation method of HIV-resistant fusion polypeptide CP32M (Ac-VEWNEMTWMEWEREIENYTKLIYKILEESQEQ-NH2) (the synthetic route is shown in the specification). The preparation method comprises the following steps: dividing a target peptide into three fragments, namely a(Ac-1-9-OH), b(Fmoc-10-21-OH) and c(H-22-32-NH2); synthesizing the three peptide fragments by a polypeptide solid-phase coupling method; carrying out liquid-phase condensation on the fragments b and c, and then removing Fmoc groups to obtain intermediate peptide fragments; carrying out liquid-phase condensation on the intermediate peptide fragments and the segment a to obtain a side-chain-protected target peptide; removing side chain protecting groups to obtain a crude target product; and carrying out DEAE weak anion-exchange chromatography and large-scale C18 reversed-phase HPLC (High Performance Liquid Chromatography) two-step purification on the crude product to obtain the purified product.
Description
Technical field：
The present invention relates to the preparation method of AntiHIV1 RT activity fused polypeptide CP32M, more particularly to the synthesis of solid-liquid phase mixed strategy
The preparation method of CP32M.
Background technology：
According to the World Health Organization and UNAIDS (http://www.unaids.org) estimation, full generation
Existing more than 6,000 ten thousand people in boundary are carried HIV, and AIDS is died from more than 25,000,000 people, and developing its medicine has important meaning
Justice.
Current AZT, nevaripine is mainly RTI, protease inhibitors, but drug resistance and side effect
It is its outstanding problem.Viral fusion inhibitor and integrase inhibitor enter clinical in recent years, reduce toxicity.List within 2003
The inhibitor Fuzeon for being uniquely based on HIV surfaces fusion protein gp41 target spots to RTI and protease inhibitors
Resistance and non-resistance patient are respectively provided with good therapeutic effect, and low (the Tom Matthews et al.Nature of side effect
Reviews, 2004,3：215-25.).But Fuzeon to there is consumption bigger than normal, drug resistance produce it is fast wait it is not enough (Yuxian He,
Jianwei Chen, Qiuyun Dai.PNAS, 2008,105 (42)：16332-7.).
CP32M is the new anti-gp41 fused polypeptides (Ac- of applicant's design
VEWNEMTWMEWEREIENYTKLIYKILEESQEQ-NH2) (Yuxian He.Jianwei Chen, Qiuyun Dai.PNAS,
2008,105 (42)：16332-7.).The peptide has following prominent features：(1) action activity is more much higher than Fuzeon；(2) to T-
20th, the resistance to strain of C34 viruses is highly effective；(3) there is special efficacy to O-shaped HIV-1BCF02 (IC50 is 11.6nm)；(4) drug resistance is low；(5)
The amino acid sequence of CP32M and Fuzeon, C34 and the homology only 28%, 47%, 63% for helping plain peptide Fuserox of the country, and
Containing only 32 amino acid, synthesis is relatively easy, cost reduction.CP32M and related peptide have obtained national inventing patent
(ZL200610087074.9)
Current Peptide systhesis are mainly connected to resin one by one using Stepwise synthesis, i.e. protected amino acid, then by peptide
Cutting, the deprotection of resin and obtain target peptide.Conventional polypeptide synthesis method mainly has Fmoc to protect and Boc Preservation tactics.
Overwhelming majority Peptide systhesis use piperidines using Fmoc Preservation tactics, i.e. deprotection at present, and resin cleavage uses trifluoroacetic acid
(TFA) mixed system, the method is more superior than Boc method, because often step removing Boc is both needed to use TFA in Boc methods, peptide resin cutting is used
Stimulate the hydrogen fluoride of strong severe toxicity.
The scale synthesis of peptide long mainly has two methods, i.e., single Stepwise synthesis, it is adaptable to which peptide chain is less than 30 ammonia
The polypeptide of base acid.And longer polypeptide need to be using using solid-liquid phase mixed strategy (Brian L.Bray.Large-scale
Manufacture of peptide therapeutics by chemical synthesis.Nature, 2003,2：587-
93.), multiple fragments of peptides of method elder generation anamorphic zone side chain protected, fragment carries out liquid phase condensations and obtains target peptide again, and this method can be big
The combined coefficient of peptide long is improved greatly, reduces the consumption of protected amino acid.The key that solid-liquid phase mixed strategy scale synthesizes peptide long is
The selection of fragment, will prevent occurring racemization and coupling efficiency low problem during fragment condensation.The length of fragments of peptides is generally several
It is unsuitable long to more than ten amino acid.Condensation fragment should try one's best and meet claimed below：1. non-photolytic activity or racemization wind are selected as far as possible
Danger minimum amino acid；2. full guard fragments of peptides is in organic solvent such as DMF (DMF), NMP (N- methylpyrroles
Alkanone) in have good dissolubility；3. Fragment purity (Wang De heart Solid-phase organic synthesis high：Principle and application guide Beijing：
Chemical Industry Press, 2004：114-115.).The selection of optimal fragment should also determine each according to particular sequence by testing
The combined coefficient and liquid phase condensations efficiency of section determine.
The purification process of polypeptide typically has ion-exchange chromatography, RPLC.Ion-exchange chromatography has resolution
Rate is high, resolution capacity is big, be easy to the features such as amplifying, and the charge differences according to polypeptide impurities are separated.RP-HPLC color
Spectrum is separated according to the hydrophobic difference of polypeptide.
The content of the invention：
Contain 32 solid liquid phase scale systems of the AntiHIV1 RT activity fused polypeptide CP32M of amino acid it is an object of the invention to provide a kind of
Preparation Method.
In fragment divides selection, the synthetic effect and condensation efficiency of two fragment methods and three fragment methods, allusion quotation have mainly been investigated
The fragment of type is divided and sequence is shown in Table 1.Target peptide is divided into two fragments of peptides α and β by mode 1, but fragment purity and receipts
Rate is very low.When target peptide is divided into three fragments (1), (2), (3) by mode 2, (2), (3) two fragment synthetic effects compared with
It is good, and fragment (1) purity is poor, HPLC analyses have multiple miscellaneous peaks to occur.To reduce fragment (1) synthesis difficulty, by division points
Selection obtains the 3rd kind of dividing mode closer to peptide chain N-terminal.First, second in a small amount of synthesis, the third three fragments synthetic effect compared with
It is good, but fragment second is highly difficult with the third liquid phase condensations, and the synthesis purity of fragment third is not high.By further optimization, find to press
Mode 4 is divided, and preferably, yield reaches 80%, and liquid phase condensations obtain target for each fragment a, b, c combined coefficienies (accompanying drawing 2,3,4) high
Thick PEPC P32M and yield is (accompanying drawing 5) higher.
The selection of the fragment dividing mode of table 1
Synthetic route according to fragment strategy 4 is shown in accompanying drawing 1.In fragment synthesis, amino acid and the resin of Fmoc protections
Rate of charge is 2.5: 1, and amino acid is progressively coupled on acid sensitive resin, and band side chain is obtained through gentle cracking after purpose fragment synthesis
The polypeptide fragment of protection, each Fragment purity chromatogram purification that is not required to high can be used for solid liquid phase condensation.The synthesis of CP32M and purifying step
It is rapid as follows：Fragment a (showing in table 1) with 2-Cl-Resin as initial resin, using the linear, solid-phase synthesis side of Fmoc Preservation tactics
Method synthesizes and is gently cracked through 1%TFA and obtained, its N-terminal acetylation modification, yield 60% (purity analysis is shown in accompanying drawing 2)；Fragment b
Synthesized using same method, while N-terminal retains Fmoc protection groups, yield is up to 75% (purity analysis is shown in accompanying drawing 3)；Fragment c with
Sieber resins are initiation material, and yield is up to 85% (purity analysis is shown in accompanying drawing 4).Side chain protected fragment b and fragment c is with HOBt/
(1- hydroxy benzo triazoles/2- (1H- BTAs)-N, N, N ', N '-tetramethylurea hexafluorophosphate/bis- are different for HBTU/DIEA
Propyl group ethylenediamine) for condensing agent is condensed, removing Fmoc groups with 20% piperidines obtains intermediate peptide fragment H-10-32-
NH2, then carry out being condensed to yield full guard target peptide with fragment a, with TFA/EDT (1,2- 3-mercaptoethanol)/H2(three is different for O/TIS
Propyl silane) mixed liquor removing Side chain protective group obtain CP32M crude products.
Crude product selection ion-exchange chromatography carries out first step purifying, and filler is DEAE weak anion exchangers, using flowing
Phase 10mmol/L Na2B4O7Buffer solution (pH=7.8) (A) and 10mmol/L Na2B4O7Buffer solution adds 1mol/L NaCl (pH=
7.8) (B) gradient elution, collects target peak.Then again with it is reverse HPLC-purified (scale post (C18 Kromasil, 50mm ×
400mm)), the acetonihile gradient elution containing 0.1%TFA, receives target peptide CP32M, is freezed after concentration and obtains sterling.
Brief description of the drawings：
The CP32M synthetic route charts of accompanying drawing 1
The fragment a HPLC analysis charts of accompanying drawing 2
The fragment b HPLC analysis charts of accompanying drawing 3
The fragment c HPLC analysis charts of accompanying drawing 4
The CP32M crude product HPLC analysis charts of accompanying drawing 5
The crude product anion-exchange chromatography of accompanying drawing 6 HPLC analysis charts after purification
The sample RPLC of accompanying drawing 7 HPLC analysis charts after purification
Specific embodiment：
Embodiment 1：The synthesis of Fmoc-Leu-CTC Resin
2-Cl-CTC-Resin 14g and Fmoc-Leu-OH 11.9g (33.3mmol) are dissolved in 40ml NMP (N- methyl pyrroles
Pyrrolidone), DIEA (6.6ml, 40mmol) is added, it is coupled 2 hours, to drain, resin uses 60ml DMF (N, N- dimethyl methyls successively
Acid amides), MeOH (absolute methanol), DCM, DMF, DMF washing.Unreacted resin MeOH (63ml, 1.54mol) and DIEA
(7ml, 42.34mmol) is closed 1 hour, is drained, and is washed respectively with 60ml DCM, DMF, DCM, DCM.
Embodiment 2：The synthesis of Fmoc-Met-CTC Resin
2-Cl-CTC-Resin 16.75g and Fmoc-Met-OH 15.1g (40mmol) are dissolved in 40ml NMP, add DIEA
(8ml, 48mmol), is coupled 2 hours, drains, and resin is washed with 60ml DMF, MeOH, DCM, DMF, DMF successively.It is unreacted
Resin is closed 1 hour with MeOH (81ml, 1.98mol) and DIEA (9ml, 54.43mmol), is drained, successively with 60ml DCM,
DMF, DCM, DCM are washed.
Embodiment 3：The synthesis in solid state of polypeptide fragment a (Ac-1-9-OH)
Fmoc-Met-CTC Resin (21.1g, 15mmol) 20% piperidines/nmp solution (100ml) difference deprotections 5
Minute and 30 minutes, then washed with DMF, DCM, MeOH, DCM (3 times), NMP (3 times) successively.After draining, activation is added
Fmoc-Trp (Boc)-OH (37.5mmol, 23.78g)/HOBt (39.375mmol, 1.05eq)/lDIEA (78.75mmo,
2.1eq)/HBTU (40.125mmol, 1.07eq) nmp solution, shakes 3 hours, and ninhydrin detection is negative, dry adsorbent, then
Washed with DMF, MeOH, DCM, DMF, DMF (100ml).Be sequentially connected as stated above remaining amino acid Fmoc-Thr (tBu)-
OH、Fmoc-Met-OH、Fmoc-Glu(OtBu)-OH、Fmoc-Asn(Trt)-OH、Fmoc-Trp(Boc)-OH、Fmoc-Glu
(OtBu)-OH、Fmoc-Val-OH.After last amino acid Val connections are finished, Fmoc groups (method is the same) is removed, then
N-terminal (reaction 2 hours) is modified with acetic anhydride (7ml, 75mmol) and DIEA (25ml, 150mmol) mixed liquor, peptide resin is drained,
Washed with 100ml DMF, MeOH, DCM, DMF, DCM (2 times) successively.
Peptide resin is washed 4 times (200ml) with the DCM solution of 1%TFA, each 3min, then is washed with DCM 3 times (100ml),
Cleaning solution is collected, revolving removes remnants DCM with absolute ethyl alcohol, adds 500ml cold water to separate out precipitation, stands 2 hours, and suction filtration dries in the air
Do to obtain 15g fragments a (Ac-1-9-OH).Take on a small quantity, use TFA/DTT/H2O/TIS (1ml/50mg/50 μ l/20 μ l) sloughs side chain
Protection group, HPLC analyses (accompanying drawing 2).
Embodiment 4：The synthesis in solid state of polypeptide fragment b (Fmoc-10-21-OH)
Fmoc-Leu-CTC Resin (18.14g, 15mmol) 20% piperidines/nmp solution (100ml) difference deprotections 5
Minute and 30 minutes, then washed with DMF, DCM, MeOH, DCM (3 times), NMP (3 times) successively.After draining, activation is added
Fmoc-Lys (Boc)-OH (17.6g, 37.5mmol)/HOBt (39.375mmol, 1.05eq)/DIEA (78.75mmol,
2.1eq)/HBTU (40.125mmol, 1.07eq) nmp solution, concussion reaction 3 hours, ninhydrin detection is negative, and drains tree
Fat, then washed (100ml) with DMF, MeOH, DCM, DMF, DMF.Remaining amino acid Fmoc-Thr is sequentially connected as stated above
(tBu)-OH、Fmoc-Tyr(tBu)-OH、Fmoc-Asn(Trt)-OH、Fmoc-Glu(OtBu)-OH、Fmoc-Ile-OH
Fmoc-Glu(OtBu)-OH、Fmoc-Arg(Pbf)-OH、Fmoc-Glu(OtBu)-OH、Fmoc-Trp(Boc)-OH、Fmoc-
Glu(OtBu)-OH。
Peptide resin is washed 4 times (200ml) with the DCM solution of 1%TFA, each 3min, then is washed with DCM 3 times (100ml),
Cleaning solution is collected, revolving removes remnants DCM with absolute ethyl alcohol, adds 500ml cold water to separate out precipitation, stands 2 hours, and suction filtration dries in the air
Do to obtain 32g fragments b (Fmoc-10-21-OH).Take on a small quantity, use TFA/DTT/H2O/TIS (1ml/50mg/50 μ l/20 μ l) is sloughed
Side chain protective group, HPLC analyses (accompanying drawing 3).
Embodiment 5：Polypeptide fragment c (H-22-32-NH2) synthesis in solid state
21.74g (15mmol, 0.69mmol/g) Sieber Resin are taken off respectively with 20% piperidines/nmp solution (100ml)
Protection 5 minutes and 30 minutes, is then washed with DMF, DCM, MeOH, DCM (3 times), NMP (3 times) successively.After draining, add and live
Change Fmoc-Gln (Trt)-OH (23.02g, 37.5mmol)/HOBt (39.375mmol, 1.05eq)/DIEA (78.75mmol,
2.1eq)/HBTU (40.125mmol, 1.07eq) nmp solution, shakes 3 hours, and ninhydrin detection is negative, dry adsorbent, then
Washed with DMF, MeOH, DCM, DMF, DMF (100ml).Be sequentially connected as stated above remaining amino acid Fmoc-Glu (OtBu)-
OH、Fmoc-Gln(Trt)-OH、Fmoc-Ser(tBu)-OH、Fmoc-Glu(OtBu)-OH、Fmoc-Glu(OtBu)-OH、
Fmoc-Leu-OH、Fmoc-Ile-OH、Fmoc-Lys(Boc)-OH、Fmoc-Tyr(tBu)-OH、Fmoc-Ile-OH.Last
After individual amino acid I connections are finished, remove Fmoc groups (method is the same).
Peptide resin is washed 8 times (200ml) with the DCM solution of 1%TFA, each 3min, then is washed with DCM 3 times (100ml),
Cleaning solution is collected, revolving removes remnants DCM with absolute ethyl alcohol, adds 500ml cold water to separate out precipitation, stands 2 hours, and suction filtration dries in the air
Do to obtain 29g fragment c (H-22-32-NH2).Take on a small quantity, use TFA/DTT/H2O/TIS (1ml/50mg/50 μ l/20 μ l) sloughs side chain
Protection group, HPLC analyses (accompanying drawing 4).
Embodiment 6：Middle fragments of peptides H-10-32-NH2Synthesis
Fmoc-10-21-OH (side chain protected) (5mmol, 13.76g)/H-22-32-NH2(side chain protected) (8mmol,
18.3g) be dissolved in 60ml NMP, add HOBt (6mmol, 1.2eq), DIEA (12mmol, 2.4eq) and HBTU (6mmol,
1.2eq), it is stirred at room temperature 2 hours, the detection reaction of TLC methods is complete, adds 500ml cold water to separate out precipitation in stirring, stand 2 hours, takes out
Filter, solid is added 500ml cold water to separate out precipitation, is stood 2 hours after drying with 20% piperidines of 60ml/NMP deprotection 1h, stirring,
Solid is washed with saturated sodium bicarbonate solution, distilled water, n-hexane respectively after suction filtration.26.5g intermediate peptide pieces are obtained after solid is lyophilized
Section H-10-32-NH2。
Embodiment 7：Synthesis with side chain protected target peptide CP32M
Side chain protected fragment Ac-1-9-OH (4.8mmol, 8.05g) and side chain protected fragment H-10-32-NH2
(4.8mmol, 22.9g) is dissolved in 80ml NMP, add HOBt (5.76mmol, 1.2eq), DIEA (11.52mmol,
2.4eq), (5.76mmol, 1.2eq) HBTU, is stirred at room temperature 2 hours, and the detection reaction of TLC methods is complete, and 600ml cold water is added in stirring
Precipitation is separated out, 2 hours are stood, solid dries to obtain 30g bands side respectively with saturated sodium bicarbonate solution, distillation water washing after suction filtration
The CP32M of chain protection.
Embodiment 8：Full guard target peptide removing Side chain protective group obtains CP32M
CP32M 40g with protection group TFA (200ml)/EDT (20ml)/H2O (20ml)/TIS (8ml) deprotection 3 is small
When, remove the decomposition agents such as TFA under reduced pressure, the cold absolute ethers of 1L are poured into, stir, stand 1 hour.Suction filtration, absolute ether is washed 3 times,
Weigh about 26g after drying, HPLC analyses (accompanying drawing 5).
Embodiment 9：CP32M crude products carry out anion-exchange chromatography purifying
Chromatographic column selects Protein-Pak DEAE 40HR(5cm × 30cm), applied sample amount is 15g (2g/ times).Stream
It is dynamic mutually to use 10mmol/L Na2B4O7Buffer solution (pH=7.8) (A) and 10mmol/L Na2B4O7Buffer solution adds 1mol/LNaCl
(pH=7.8) (B), gradient is 0-4L/0-30%B, 4L-6L/100%B, flow velocity 14ml/min.Detection wavelength 280nm.
Target peak is collected, sample 5 gram of the purity more than 80% is obtained, accompanying drawing 6 is shown in HPLC analyses.
Embodiment 10：Reverse HPLC-purified sample
Reverse HPLC-purified selection scale post (C18 Kromasil10 μm (5cm × 40cm)), with containing 0.1%TFA
Acetonitrile carry out gradient elution, gradient is 1min-5min/20%B-40%B；5min-25min/40%B-70%B；Inspection
Survey wavelength 214nm.Applied sample amount 5g (0.8 gram/times), collects target peptide CP32M, is freezed after concentration, obtains purity and is more than 98%
Accompanying drawing 7 is shown in 3 grams of sterling, HPLC analyses.
Claims (1)
1. a kind of AntiHIV1 RT activity fused polypeptide CP32M " Ac-VEWNEMTWMEWEREIENYTKLIYKILEESQEQ-NH2" solid-liquid mix
Close tactful scale preparation method, it is characterised in that target peptide is divided into by three fragments, i.e. fragment using solid liquid phase mixed strategy
A " Ac-VEWNEMTWM ", fragment b " EWEREIENYTKL ", fragment c " IYKILEESQEQ-NH2”；Fragment a and fragment b is with 2-
Cl- resins are initiation material, and, with Sieber resins as initiation material, three fragments of peptides-resins are according to progressively Solid-phase Polypeptide for fragment c
Coupling method synthesizes, and full guard fragments of peptides is obtained through gentle cracking；B, c fragment remove Fmoc blocking groups after carrying out liquid phase condensations
Intermediate peptide fragment is obtained, then liquid phase condensations is carried out so as to obtain the target peptide of side chain protected with fragment a again, removing side chain is protected
Shield group obtains CP32M crude products.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201110041918.7A CN102180970B (en) | 2011-02-22 | 2011-02-22 | Large-scale preparation method of HIV (Human Immunodeficiency Virus)-resistant fusion polypeptide CP32M based on solid-liquid mixing strategy |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201110041918.7A CN102180970B (en) | 2011-02-22 | 2011-02-22 | Large-scale preparation method of HIV (Human Immunodeficiency Virus)-resistant fusion polypeptide CP32M based on solid-liquid mixing strategy |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN102180970A CN102180970A (en) | 2011-09-14 |
| CN102180970B true CN102180970B (en) | 2017-05-24 |
Family
ID=44567280
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201110041918.7A Expired - Fee Related CN102180970B (en) | 2011-02-22 | 2011-02-22 | Large-scale preparation method of HIV (Human Immunodeficiency Virus)-resistant fusion polypeptide CP32M based on solid-liquid mixing strategy |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN102180970B (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103880945B (en) * | 2013-12-28 | 2016-09-07 | 郑州大明药物科技有限公司 | The method of preparation high-purity thymalfasin |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1955190A (en) * | 2005-12-14 | 2007-05-02 | 中国人民解放军军事医学科学院生物工程研究所 | Polypeptide of controlling IIIv virus fusion and its use |
| CN101538315A (en) * | 2009-01-13 | 2009-09-23 | 深圳市翰宇药业有限公司 | Method for preparing Leuprorelin by combination of solid phase method and liquid phase method |
| CN101870732A (en) * | 2009-04-22 | 2010-10-27 | 兰州大学 | Method for synthesizing mono pegylation-thymopentin by solid phase and liquid phase combination |
-
2011
- 2011-02-22 CN CN201110041918.7A patent/CN102180970B/en not_active Expired - Fee Related
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1955190A (en) * | 2005-12-14 | 2007-05-02 | 中国人民解放军军事医学科学院生物工程研究所 | Polypeptide of controlling IIIv virus fusion and its use |
| CN101538315A (en) * | 2009-01-13 | 2009-09-23 | 深圳市翰宇药业有限公司 | Method for preparing Leuprorelin by combination of solid phase method and liquid phase method |
| CN101870732A (en) * | 2009-04-22 | 2010-10-27 | 兰州大学 | Method for synthesizing mono pegylation-thymopentin by solid phase and liquid phase combination |
Also Published As
| Publication number | Publication date |
|---|---|
| CN102180970A (en) | 2011-09-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN103497245B (en) | Method for synthesizing thymalfasin | |
| CN104650219B (en) | The method that fragment condensation prepares Liraglutide | |
| CN109311961A (en) | A kind of synthetic method of Suo Malu peptide | |
| CN107383171A (en) | A kind of method by secondary cyclization synthesis in solid state Pu Kana peptides | |
| CN106699871A (en) | Preparation method of liraglutide | |
| CN102875665A (en) | Method for synthesizing liraglutide | |
| CN109641946A (en) | The preparation method of glucagon-like peptide | |
| CN101747426B (en) | Method for synthesizing pramlintide | |
| CN107434820A (en) | A kind of synthetic method of Wella card peptide | |
| CN104910269B (en) | A method of synthesis Teriparatide | |
| CN106854234A (en) | A kind of method that full solid phase prepares carbetocin | |
| CN106928320A (en) | A kind of method of synthesis Etelcalcetide | |
| CN105001298B (en) | A kind of synthesis isolation and purification method of indissoluble polypeptide | |
| CN102924575B (en) | Preparation method of bivalirudin | |
| CN104177490B (en) | Method for preparing salmon calcitonin acetate by fragment condensation | |
| CN107383170A (en) | A kind of simple synthesis of Pu Kana peptides | |
| CN107501408A (en) | A kind of preparation method of Teriparatide | |
| CN106554391B (en) | Method for synthesizing marine biological peptide Xen2174 | |
| CN109734794A (en) | A kind of preparation method of A Bapa peptide | |
| CN104788546A (en) | Preparation method of linear peptides containing 24 amino acid residues | |
| CN107022021A (en) | A kind of solid-phase synthesis of Liraglutide | |
| CN110894225B (en) | Large-scale preparation and purification method and application of mu-conopeptide | |
| CN106854235A (en) | A kind of solid phase fragment method synthesizes carbetocin | |
| CN106854230A (en) | A kind of solid phase fragment method synthesizes carbetocin | |
| CN103992391A (en) | Purifying method for terlipressin |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20170524 Termination date: 20210222 |
|
| CF01 | Termination of patent right due to non-payment of annual fee |