CA3217589A1 - Improved prostate-specific membrane antigen targeting radiopharmaceuticals and uses thereof - Google Patents
Improved prostate-specific membrane antigen targeting radiopharmaceuticals and uses thereof Download PDFInfo
- Publication number
- CA3217589A1 CA3217589A1 CA3217589A CA3217589A CA3217589A1 CA 3217589 A1 CA3217589 A1 CA 3217589A1 CA 3217589 A CA3217589 A CA 3217589A CA 3217589 A CA3217589 A CA 3217589A CA 3217589 A1 CA3217589 A1 CA 3217589A1
- Authority
- CA
- Canada
- Prior art keywords
- 6alkyl
- cancer
- group
- 6a1ky1
- term
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 title claims abstract description 27
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 title claims abstract description 15
- 239000012217 radiopharmaceutical Substances 0.000 title abstract description 16
- 229940121896 radiopharmaceutical Drugs 0.000 title abstract description 16
- 230000002799 radiopharmaceutical effect Effects 0.000 title abstract description 15
- 230000008685 targeting Effects 0.000 title description 3
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 155
- 238000003384 imaging method Methods 0.000 claims abstract description 40
- 238000011282 treatment Methods 0.000 claims abstract description 33
- 238000003745 diagnosis Methods 0.000 claims abstract description 31
- 239000003795 chemical substances by application Substances 0.000 claims abstract description 25
- 229910052702 rhenium Inorganic materials 0.000 claims abstract description 6
- WUAPFZMCVAUBPE-UHFFFAOYSA-N rhenium atom Chemical compound [Re] WUAPFZMCVAUBPE-UHFFFAOYSA-N 0.000 claims abstract description 6
- -1 nitro, hydroxyl Chemical group 0.000 claims description 419
- 201000011510 cancer Diseases 0.000 claims description 99
- 229910052739 hydrogen Inorganic materials 0.000 claims description 83
- 239000001257 hydrogen Substances 0.000 claims description 83
- 125000003118 aryl group Chemical group 0.000 claims description 77
- 150000004696 coordination complex Chemical class 0.000 claims description 77
- 239000008194 pharmaceutical composition Substances 0.000 claims description 71
- 150000001875 compounds Chemical class 0.000 claims description 67
- 210000004027 cell Anatomy 0.000 claims description 61
- 238000000034 method Methods 0.000 claims description 61
- 125000000623 heterocyclic group Chemical group 0.000 claims description 50
- 239000000203 mixture Substances 0.000 claims description 46
- 239000002243 precursor Substances 0.000 claims description 45
- 206010060862 Prostate cancer Diseases 0.000 claims description 44
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 44
- 125000001072 heteroaryl group Chemical group 0.000 claims description 36
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 claims description 28
- 238000002372 labelling Methods 0.000 claims description 27
- 238000001727 in vivo Methods 0.000 claims description 25
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 21
- 150000003839 salts Chemical class 0.000 claims description 21
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 claims description 20
- 229910021626 Tin(II) chloride Inorganic materials 0.000 claims description 19
- 235000011150 stannous chloride Nutrition 0.000 claims description 19
- 239000003814 drug Substances 0.000 claims description 18
- 210000002307 prostate Anatomy 0.000 claims description 18
- 238000002600 positron emission tomography Methods 0.000 claims description 17
- 239000008363 phosphate buffer Substances 0.000 claims description 16
- 239000011780 sodium chloride Substances 0.000 claims description 16
- WUAPFZMCVAUBPE-NJFSPNSNSA-N 188Re Chemical compound [188Re] WUAPFZMCVAUBPE-NJFSPNSNSA-N 0.000 claims description 15
- 239000000872 buffer Substances 0.000 claims description 15
- TXUICONDJPYNPY-UHFFFAOYSA-N (1,10,13-trimethyl-3-oxo-4,5,6,7,8,9,11,12,14,15,16,17-dodecahydrocyclopenta[a]phenanthren-17-yl) heptanoate Chemical compound C1CC2CC(=O)C=C(C)C2(C)C2C1C1CCC(OC(=O)CCCCCC)C1(C)CC2 TXUICONDJPYNPY-UHFFFAOYSA-N 0.000 claims description 14
- 238000000163 radioactive labelling Methods 0.000 claims description 14
- 239000002904 solvent Substances 0.000 claims description 14
- 239000001119 stannous chloride Substances 0.000 claims description 14
- 238000002603 single-photon emission computed tomography Methods 0.000 claims description 13
- 230000003139 buffering effect Effects 0.000 claims description 12
- 238000011503 in vivo imaging Methods 0.000 claims description 11
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 11
- 230000001225 therapeutic effect Effects 0.000 claims description 11
- 235000010323 ascorbic acid Nutrition 0.000 claims description 10
- 239000011668 ascorbic acid Substances 0.000 claims description 10
- 229960005070 ascorbic acid Drugs 0.000 claims description 10
- 239000003446 ligand Substances 0.000 claims description 10
- 238000004519 manufacturing process Methods 0.000 claims description 10
- 239000002738 chelating agent Substances 0.000 claims description 9
- 238000002591 computed tomography Methods 0.000 claims description 9
- 125000004093 cyano group Chemical group *C#N 0.000 claims description 9
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 claims description 9
- 239000000651 prodrug Substances 0.000 claims description 9
- 229940002612 prodrug Drugs 0.000 claims description 9
- WUAPFZMCVAUBPE-IGMARMGPSA-N rhenium-186 Chemical compound [186Re] WUAPFZMCVAUBPE-IGMARMGPSA-N 0.000 claims description 9
- 206010006187 Breast cancer Diseases 0.000 claims description 8
- 208000026310 Breast neoplasm Diseases 0.000 claims description 8
- 238000001514 detection method Methods 0.000 claims description 8
- 208000002154 non-small cell lung carcinoma Diseases 0.000 claims description 8
- 210000004881 tumor cell Anatomy 0.000 claims description 8
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 claims description 8
- 206010005003 Bladder cancer Diseases 0.000 claims description 7
- 206010009944 Colon cancer Diseases 0.000 claims description 7
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 claims description 7
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 7
- 229910052799 carbon Inorganic materials 0.000 claims description 7
- 208000029742 colonic neoplasm Diseases 0.000 claims description 7
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 claims description 7
- AXZWODMDQAVCJE-UHFFFAOYSA-L tin(II) chloride (anhydrous) Chemical compound [Cl-].[Cl-].[Sn+2] AXZWODMDQAVCJE-UHFFFAOYSA-L 0.000 claims description 7
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 7
- BDAGIHXWWSANSR-UHFFFAOYSA-M Formate Chemical compound [O-]C=O BDAGIHXWWSANSR-UHFFFAOYSA-M 0.000 claims description 6
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 6
- GKLVYJBZJHMRIY-OUBTZVSYSA-N Technetium-99 Chemical compound [99Tc] GKLVYJBZJHMRIY-OUBTZVSYSA-N 0.000 claims description 6
- 239000008351 acetate buffer Substances 0.000 claims description 6
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 claims description 6
- 201000002120 neuroendocrine carcinoma Diseases 0.000 claims description 6
- 239000003352 sequestering agent Substances 0.000 claims description 6
- 239000012279 sodium borohydride Substances 0.000 claims description 6
- 229910000033 sodium borohydride Inorganic materials 0.000 claims description 6
- JVBXVOWTABLYPX-UHFFFAOYSA-L sodium dithionite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])=O JVBXVOWTABLYPX-UHFFFAOYSA-L 0.000 claims description 6
- 238000003325 tomography Methods 0.000 claims description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 claims description 5
- 239000007995 HEPES buffer Substances 0.000 claims description 5
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 claims description 5
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 claims description 5
- 239000003638 chemical reducing agent Substances 0.000 claims description 5
- 201000002246 embryonal cancer Diseases 0.000 claims description 5
- 208000015347 renal cell adenocarcinoma Diseases 0.000 claims description 5
- 238000003860 storage Methods 0.000 claims description 5
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 claims description 4
- ZOKXTWBITQBERF-AKLPVKDBSA-N Molybdenum Mo-99 Chemical compound [99Mo] ZOKXTWBITQBERF-AKLPVKDBSA-N 0.000 claims description 4
- 239000003963 antioxidant agent Substances 0.000 claims description 4
- 238000006243 chemical reaction Methods 0.000 claims description 4
- 239000012535 impurity Substances 0.000 claims description 4
- 229950009740 molybdenum mo-99 Drugs 0.000 claims description 4
- 230000002265 prevention Effects 0.000 claims description 4
- 239000012064 sodium phosphate buffer Substances 0.000 claims description 4
- 239000012453 solvate Substances 0.000 claims description 4
- 125000004434 sulfur atom Chemical group 0.000 claims description 4
- 229940095064 tartrate Drugs 0.000 claims description 4
- 229910052782 aluminium Inorganic materials 0.000 claims description 3
- 239000012752 auxiliary agent Substances 0.000 claims description 3
- 239000003153 chemical reaction reagent Substances 0.000 claims description 3
- 238000010668 complexation reaction Methods 0.000 claims description 3
- 238000004108 freeze drying Methods 0.000 claims description 3
- 208000020816 lung neoplasm Diseases 0.000 claims description 3
- 239000011159 matrix material Substances 0.000 claims description 3
- 230000000737 periodic effect Effects 0.000 claims description 3
- 150000003003 phosphines Chemical class 0.000 claims description 3
- 230000009467 reduction Effects 0.000 claims description 3
- 238000010405 reoxidation reaction Methods 0.000 claims description 3
- 239000003381 stabilizer Substances 0.000 claims description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 2
- 125000001475 halogen functional group Chemical group 0.000 claims description 2
- 201000005202 lung cancer Diseases 0.000 claims description 2
- 238000002156 mixing Methods 0.000 claims description 2
- PPASLZSBLFJQEF-RKJRWTFHSA-M sodium ascorbate Substances [Na+].OC[C@@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RKJRWTFHSA-M 0.000 claims description 2
- 235000010378 sodium ascorbate Nutrition 0.000 claims description 2
- 229960005055 sodium ascorbate Drugs 0.000 claims description 2
- PPASLZSBLFJQEF-RXSVEWSESA-M sodium-L-ascorbate Chemical compound [Na+].OC[C@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RXSVEWSESA-M 0.000 claims description 2
- WFKWXMTUELFFGS-RNFDNDRNSA-N tungsten-188 Chemical compound [188W] WFKWXMTUELFFGS-RNFDNDRNSA-N 0.000 claims description 2
- 150000002431 hydrogen Chemical class 0.000 claims 11
- 229910006069 SO3H Inorganic materials 0.000 claims 8
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 claims 2
- BKAYIFDRRZZKNF-VIFPVBQESA-N N-acetylcarnosine Chemical compound CC(=O)NCCC(=O)N[C@H](C(O)=O)CC1=CN=CN1 BKAYIFDRRZZKNF-VIFPVBQESA-N 0.000 claims 1
- 125000000218 acetic acid group Chemical group C(C)(=O)* 0.000 claims 1
- 229910052751 metal Inorganic materials 0.000 abstract description 17
- 239000002184 metal Substances 0.000 abstract description 17
- 230000036210 malignancy Effects 0.000 abstract description 16
- 229910052713 technetium Inorganic materials 0.000 abstract description 3
- GKLVYJBZJHMRIY-UHFFFAOYSA-N technetium atom Chemical compound [Tc] GKLVYJBZJHMRIY-UHFFFAOYSA-N 0.000 abstract description 3
- 230000002285 radioactive effect Effects 0.000 abstract description 2
- 150000002739 metals Chemical class 0.000 abstract 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 81
- 125000004435 hydrogen atom Chemical class [H]* 0.000 description 74
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 31
- 238000004128 high performance liquid chromatography Methods 0.000 description 31
- 229940024606 amino acid Drugs 0.000 description 30
- 235000001014 amino acid Nutrition 0.000 description 30
- 150000001413 amino acids Chemical class 0.000 description 30
- 210000001519 tissue Anatomy 0.000 description 30
- 201000010099 disease Diseases 0.000 description 26
- CWERGRDVMFNCDR-UHFFFAOYSA-N thioglycolic acid Chemical compound OC(=O)CS CWERGRDVMFNCDR-UHFFFAOYSA-N 0.000 description 20
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 18
- 239000000126 substance Substances 0.000 description 18
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 18
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 17
- 230000000694 effects Effects 0.000 description 17
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 15
- 125000004432 carbon atom Chemical group C* 0.000 description 15
- 238000002560 therapeutic procedure Methods 0.000 description 15
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 14
- 238000012544 monitoring process Methods 0.000 description 14
- 239000000243 solution Substances 0.000 description 14
- 238000003786 synthesis reaction Methods 0.000 description 14
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 13
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 13
- 239000000047 product Substances 0.000 description 13
- 239000004472 Lysine Substances 0.000 description 12
- 125000005843 halogen group Chemical group 0.000 description 12
- 229960003646 lysine Drugs 0.000 description 12
- 206010027476 Metastases Diseases 0.000 description 11
- 125000004429 atom Chemical group 0.000 description 11
- 230000003211 malignant effect Effects 0.000 description 11
- 229910001868 water Inorganic materials 0.000 description 11
- 101710183768 Glutamate carboxypeptidase 2 Proteins 0.000 description 10
- 102000007066 Prostate-Specific Antigen Human genes 0.000 description 10
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 10
- 239000008215 water for injection Substances 0.000 description 10
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 9
- 125000000882 C2-C6 alkenyl group Chemical group 0.000 description 9
- 125000000217 alkyl group Chemical group 0.000 description 9
- 239000004202 carbamide Substances 0.000 description 9
- 238000009472 formulation Methods 0.000 description 9
- 125000005842 heteroatom Chemical group 0.000 description 9
- DTQVDTLACAAQTR-UHFFFAOYSA-N trifluoroacetic acid Substances OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 9
- 125000005129 aryl carbonyl group Chemical group 0.000 description 8
- 125000005161 aryl oxy carbonyl group Chemical group 0.000 description 8
- 230000004700 cellular uptake Effects 0.000 description 8
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 8
- 239000002609 medium Substances 0.000 description 8
- 230000009401 metastasis Effects 0.000 description 8
- 239000002953 phosphate buffered saline Substances 0.000 description 8
- 102000004169 proteins and genes Human genes 0.000 description 8
- 108090000623 proteins and genes Proteins 0.000 description 8
- 125000000876 trifluoromethoxy group Chemical group FC(F)(F)O* 0.000 description 8
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 7
- 230000002411 adverse Effects 0.000 description 7
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 7
- 210000000056 organ Anatomy 0.000 description 7
- 235000018102 proteins Nutrition 0.000 description 7
- 239000011347 resin Substances 0.000 description 7
- 229920005989 resin Polymers 0.000 description 7
- 238000001356 surgical procedure Methods 0.000 description 7
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 7
- PECYZEOJVXMISF-UHFFFAOYSA-N 3-aminoalanine Chemical compound [NH3+]CC(N)C([O-])=O PECYZEOJVXMISF-UHFFFAOYSA-N 0.000 description 6
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 6
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 125000005110 aryl thio group Chemical group 0.000 description 6
- 150000001721 carbon Chemical group 0.000 description 6
- 230000008859 change Effects 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 125000002541 furyl group Chemical group 0.000 description 6
- SRJOCJYGOFTFLH-UHFFFAOYSA-N isonipecotic acid Chemical compound OC(=O)C1CCNCC1 SRJOCJYGOFTFLH-UHFFFAOYSA-N 0.000 description 6
- 230000000670 limiting effect Effects 0.000 description 6
- 230000004807 localization Effects 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 238000011084 recovery Methods 0.000 description 6
- 125000001424 substituent group Chemical group 0.000 description 6
- 206010061818 Disease progression Diseases 0.000 description 5
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 5
- 230000005750 disease progression Effects 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 238000009169 immunotherapy Methods 0.000 description 5
- 125000005647 linker group Chemical group 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 4
- 108090000369 Glutamate Carboxypeptidase II Proteins 0.000 description 4
- 229910019142 PO4 Inorganic materials 0.000 description 4
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 4
- 230000001594 aberrant effect Effects 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 238000011467 adoptive cell therapy Methods 0.000 description 4
- 238000013019 agitation Methods 0.000 description 4
- 125000004104 aryloxy group Chemical group 0.000 description 4
- 230000027455 binding Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 125000000753 cycloalkyl group Chemical group 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 4
- ORTFAQDWJHRMNX-UHFFFAOYSA-N hydroxidooxidocarbon(.) Chemical group O[C]=O ORTFAQDWJHRMNX-UHFFFAOYSA-N 0.000 description 4
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 4
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 4
- 235000021317 phosphate Nutrition 0.000 description 4
- 238000011362 radionuclide therapy Methods 0.000 description 4
- 239000011541 reaction mixture Substances 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 229940056501 technetium 99m Drugs 0.000 description 4
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 4
- 125000003507 tetrahydrothiofenyl group Chemical group 0.000 description 4
- 238000011269 treatment regimen Methods 0.000 description 4
- ISEYJGQFXSTPMQ-UHFFFAOYSA-N 2-(phosphonomethyl)pentanedioic acid Chemical compound OC(=O)CCC(C(O)=O)CP(O)(O)=O ISEYJGQFXSTPMQ-UHFFFAOYSA-N 0.000 description 3
- DRNGLYHKYPNTEA-UHFFFAOYSA-N 4-azaniumylcyclohexane-1-carboxylate Chemical compound NC1CCC(C(O)=O)CC1 DRNGLYHKYPNTEA-UHFFFAOYSA-N 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 3
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 108091006629 SLC13A2 Proteins 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 230000002159 abnormal effect Effects 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- 239000008186 active pharmaceutical agent Substances 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 125000004658 aryl carbonyl amino group Chemical group 0.000 description 3
- 125000004391 aryl sulfonyl group Chemical group 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 125000005605 benzo group Chemical group 0.000 description 3
- 238000001574 biopsy Methods 0.000 description 3
- 238000001815 biotherapy Methods 0.000 description 3
- 239000005388 borosilicate glass Substances 0.000 description 3
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 3
- FATUQANACHZLRT-KMRXSBRUSA-L calcium glucoheptonate Chemical compound [Ca+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)C([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)C([O-])=O FATUQANACHZLRT-KMRXSBRUSA-L 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000001816 cooling Methods 0.000 description 3
- 125000004122 cyclic group Chemical group 0.000 description 3
- UAOMVDZJSHZZME-UHFFFAOYSA-N diisopropylamine Chemical compound CC(C)NC(C)C UAOMVDZJSHZZME-UHFFFAOYSA-N 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 3
- 239000011521 glass Substances 0.000 description 3
- 150000004676 glycans Chemical class 0.000 description 3
- 229960002449 glycine Drugs 0.000 description 3
- 229910052736 halogen Inorganic materials 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 125000005553 heteroaryloxy group Chemical group 0.000 description 3
- 125000001183 hydrocarbyl group Chemical group 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 125000003387 indolinyl group Chemical group N1(CCC2=CC=CC=C12)* 0.000 description 3
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- OHSVLFRHMCKCQY-NJFSPNSNSA-N lutetium-177 Chemical compound [177Lu] OHSVLFRHMCKCQY-NJFSPNSNSA-N 0.000 description 3
- 238000002595 magnetic resonance imaging Methods 0.000 description 3
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 3
- 230000001613 neoplastic effect Effects 0.000 description 3
- 229910052757 nitrogen Inorganic materials 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 150000002482 oligosaccharides Polymers 0.000 description 3
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 3
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 3
- 229920001282 polysaccharide Polymers 0.000 description 3
- 239000005017 polysaccharide Substances 0.000 description 3
- 230000003449 preventive effect Effects 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 125000003373 pyrazinyl group Chemical group 0.000 description 3
- 125000004076 pyridyl group Chemical group 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 229940083542 sodium Drugs 0.000 description 3
- 229910052708 sodium Inorganic materials 0.000 description 3
- 239000001488 sodium phosphate Substances 0.000 description 3
- 229910000162 sodium phosphate Inorganic materials 0.000 description 3
- 229960003339 sodium phosphate Drugs 0.000 description 3
- 235000011008 sodium phosphates Nutrition 0.000 description 3
- 238000009168 stem cell therapy Methods 0.000 description 3
- 238000009580 stem-cell therapy Methods 0.000 description 3
- 229910052717 sulfur Inorganic materials 0.000 description 3
- 125000001412 tetrahydropyranyl group Chemical group 0.000 description 3
- 125000000335 thiazolyl group Chemical group 0.000 description 3
- 125000001544 thienyl group Chemical group 0.000 description 3
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- 125000005871 1,3-benzodioxolyl group Chemical group 0.000 description 2
- JPRPJUMQRZTTED-UHFFFAOYSA-N 1,3-dioxolanyl Chemical group [CH]1OCCO1 JPRPJUMQRZTTED-UHFFFAOYSA-N 0.000 description 2
- QWENRTYMTSOGBR-UHFFFAOYSA-N 1H-1,2,3-Triazole Chemical compound C=1C=NNN=1 QWENRTYMTSOGBR-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- OYIFNHCXNCRBQI-UHFFFAOYSA-N 2-aminoadipic acid Chemical compound OC(=O)C(N)CCCC(O)=O OYIFNHCXNCRBQI-UHFFFAOYSA-N 0.000 description 2
- RDFMDVXONNIGBC-UHFFFAOYSA-N 2-aminoheptanoic acid Chemical compound CCCCCC(N)C(O)=O RDFMDVXONNIGBC-UHFFFAOYSA-N 0.000 description 2
- 125000004105 2-pyridyl group Chemical group N1=C([*])C([H])=C([H])C([H])=C1[H] 0.000 description 2
- HHONATOJHSQDPZ-UHFFFAOYSA-N 3H-pyrrolizine Chemical compound C1=CN2CC=CC2=C1 HHONATOJHSQDPZ-UHFFFAOYSA-N 0.000 description 2
- PLIKAWJENQZMHA-UHFFFAOYSA-N 4-aminophenol Chemical compound NC1=CC=C(O)C=C1 PLIKAWJENQZMHA-UHFFFAOYSA-N 0.000 description 2
- AWUVEYWJVZSDKT-UHFFFAOYSA-N 4-phosphanylbenzene-1,2,3-tricarboxylic acid Chemical compound OC(=O)C1=CC=C(P)C(C(O)=O)=C1C(O)=O AWUVEYWJVZSDKT-UHFFFAOYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- JGLMVXWAHNTPRF-CMDGGOBGSA-N CCN1N=C(C)C=C1C(=O)NC1=NC2=CC(=CC(OC)=C2N1C\C=C\CN1C(NC(=O)C2=CC(C)=NN2CC)=NC2=CC(=CC(OCCCN3CCOCC3)=C12)C(N)=O)C(N)=O Chemical compound CCN1N=C(C)C=C1C(=O)NC1=NC2=CC(=CC(OC)=C2N1C\C=C\CN1C(NC(=O)C2=CC(C)=NN2CC)=NC2=CC(=CC(OCCCN3CCOCC3)=C12)C(N)=O)C(N)=O JGLMVXWAHNTPRF-CMDGGOBGSA-N 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- ZCYVEMRRCGMTRW-AHCXROLUSA-N Iodine-123 Chemical compound [123I] ZCYVEMRRCGMTRW-AHCXROLUSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- ZFOMKMMPBOQKMC-KXUCPTDWSA-N L-pyrrolysine Chemical compound C[C@@H]1CC=N[C@H]1C(=O)NCCCC[C@H]([NH3+])C([O-])=O ZFOMKMMPBOQKMC-KXUCPTDWSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- OTCCIMWXFLJLIA-UHFFFAOYSA-N N-acetyl-DL-aspartic acid Natural products CC(=O)NC(C(O)=O)CC(O)=O OTCCIMWXFLJLIA-UHFFFAOYSA-N 0.000 description 2
- OTCCIMWXFLJLIA-BYPYZUCNSA-N N-acetyl-L-aspartic acid Chemical compound CC(=O)N[C@H](C(O)=O)CC(O)=O OTCCIMWXFLJLIA-BYPYZUCNSA-N 0.000 description 2
- KSPIYJQBLVDRRI-UHFFFAOYSA-N N-methylisoleucine Chemical compound CCC(C)C(NC)C(O)=O KSPIYJQBLVDRRI-UHFFFAOYSA-N 0.000 description 2
- 150000001204 N-oxides Chemical class 0.000 description 2
- HFVPBQOSFYXKQZ-DTWKUNHWSA-N N6-[(2R)-3,4-Dihydro-2H-pyrrol-2-ylcarbonyl]-L-lysine Chemical compound [O-]C(=O)[C@@H]([NH3+])CCCCNC(=O)[C@H]1CCC=N1 HFVPBQOSFYXKQZ-DTWKUNHWSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 229960000583 acetic acid Drugs 0.000 description 2
- 235000011054 acetic acid Nutrition 0.000 description 2
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 2
- QWCKQJZIFLGMSD-UHFFFAOYSA-N alpha-aminobutyric acid Chemical compound CCC(N)C(O)=O QWCKQJZIFLGMSD-UHFFFAOYSA-N 0.000 description 2
- 238000011319 anticancer therapy Methods 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 125000002393 azetidinyl group Chemical group 0.000 description 2
- 125000004069 aziridinyl group Chemical group 0.000 description 2
- 125000003785 benzimidazolyl group Chemical group N1=C(NC2=C1C=CC=C2)* 0.000 description 2
- 125000000499 benzofuranyl group Chemical group O1C(=CC2=C1C=CC=C2)* 0.000 description 2
- 125000004196 benzothienyl group Chemical group S1C(=CC2=C1C=CC=C2)* 0.000 description 2
- 239000000090 biomarker Substances 0.000 description 2
- 230000036983 biotransformation Effects 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 230000009137 competitive binding Effects 0.000 description 2
- 239000012141 concentrate Substances 0.000 description 2
- 230000002596 correlated effect Effects 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000010511 deprotection reaction Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 239000000032 diagnostic agent Substances 0.000 description 2
- 229940039227 diagnostic agent Drugs 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 125000000597 dioxinyl group Chemical group 0.000 description 2
- 238000004090 dissolution Methods 0.000 description 2
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- AJIPIJNNOJSSQC-NYLIRDPKSA-N estetrol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H]([C@H](O)[C@@H]4O)O)[C@@H]4[C@@H]3CCC2=C1 AJIPIJNNOJSSQC-NYLIRDPKSA-N 0.000 description 2
- 229950009589 estetrol Drugs 0.000 description 2
- 239000012467 final product Substances 0.000 description 2
- 125000000524 functional group Chemical group 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 150000002367 halogens Chemical group 0.000 description 2
- 125000005844 heterocyclyloxy group Chemical group 0.000 description 2
- 238000001794 hormone therapy Methods 0.000 description 2
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 125000002883 imidazolyl group Chemical group 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 125000003406 indolizinyl group Chemical group C=1(C=CN2C=CC=CC12)* 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 229940047122 interleukins Drugs 0.000 description 2
- 125000001977 isobenzofuranyl group Chemical group C=1(OC=C2C=CC=CC12)* 0.000 description 2
- 125000004594 isoindolinyl group Chemical group C1(NCC2=CC=CC=C12)* 0.000 description 2
- 125000002183 isoquinolinyl group Chemical group C1(=NC=CC2=CC=CC=C12)* 0.000 description 2
- 125000004628 isothiazolidinyl group Chemical group S1N(CCC1)* 0.000 description 2
- 125000003965 isoxazolidinyl group Chemical group 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- 239000012139 lysis buffer Substances 0.000 description 2
- 239000011572 manganese Substances 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 239000002207 metabolite Substances 0.000 description 2
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 210000004882 non-tumor cell Anatomy 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 125000000160 oxazolidinyl group Chemical group 0.000 description 2
- 125000003566 oxetanyl group Chemical group 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 125000001147 pentyl group Chemical group C(CCCC)* 0.000 description 2
- 229940124531 pharmaceutical excipient Drugs 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 230000001766 physiological effect Effects 0.000 description 2
- 125000004193 piperazinyl group Chemical group 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 125000006239 protecting group Chemical group 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 125000000561 purinyl group Chemical group N1=C(N=C2N=CNC2=C1)* 0.000 description 2
- 125000003226 pyrazolyl group Chemical group 0.000 description 2
- 125000002098 pyridazinyl group Chemical group 0.000 description 2
- 125000000714 pyrimidinyl group Chemical group 0.000 description 2
- 125000000168 pyrrolyl group Chemical group 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 125000002294 quinazolinyl group Chemical group N1=C(N=CC2=CC=CC=C12)* 0.000 description 2
- 125000002943 quinolinyl group Chemical group N1=C(C=CC2=CC=CC=C12)* 0.000 description 2
- 125000001567 quinoxalinyl group Chemical group N1=C(C=NC2=CC=CC=C12)* 0.000 description 2
- 239000000700 radioactive tracer Substances 0.000 description 2
- 238000001959 radiotherapy Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 210000003079 salivary gland Anatomy 0.000 description 2
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical compound C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 2
- 229960001153 serine Drugs 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 238000003419 tautomerization reaction Methods 0.000 description 2
- GZCRRIHWUXGPOV-CBESVEIWSA-N terbium-149 Chemical compound [149Tb] GZCRRIHWUXGPOV-CBESVEIWSA-N 0.000 description 2
- GZCRRIHWUXGPOV-AHCXROLUSA-N terbium-155 Chemical compound [155Tb] GZCRRIHWUXGPOV-AHCXROLUSA-N 0.000 description 2
- 125000003718 tetrahydrofuranyl group Chemical group 0.000 description 2
- 125000000147 tetrahydroquinolinyl group Chemical group N1(CCCC2=CC=CC=C12)* 0.000 description 2
- 125000004305 thiazinyl group Chemical group S1NC(=CC=C1)* 0.000 description 2
- 125000000437 thiazol-2-yl group Chemical group [H]C1=C([H])N=C(*)S1 0.000 description 2
- 125000001984 thiazolidinyl group Chemical group 0.000 description 2
- GKTQKQTXHNUFSP-UHFFFAOYSA-N thieno[3,4-c]pyrrole-4,6-dione Chemical compound S1C=C2C(=O)NC(=O)C2=C1 GKTQKQTXHNUFSP-UHFFFAOYSA-N 0.000 description 2
- 125000002053 thietanyl group Chemical group 0.000 description 2
- 125000001730 thiiranyl group Chemical group 0.000 description 2
- 125000004571 thiomorpholin-4-yl group Chemical group N1(CCSCC1)* 0.000 description 2
- 229960002898 threonine Drugs 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 2
- 125000004306 triazinyl group Chemical group 0.000 description 2
- RIOQSEWOXXDEQQ-UHFFFAOYSA-N triphenylphosphine Chemical compound C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 RIOQSEWOXXDEQQ-UHFFFAOYSA-N 0.000 description 2
- 102000003390 tumor necrosis factor Human genes 0.000 description 2
- 230000000007 visual effect Effects 0.000 description 2
- 239000003643 water by type Substances 0.000 description 2
- 229910052725 zinc Inorganic materials 0.000 description 2
- 239000011701 zinc Substances 0.000 description 2
- BJBUEDPLEOHJGE-UHFFFAOYSA-N (2R,3S)-3-Hydroxy-2-pyrolidinecarboxylic acid Natural products OC1CCNC1C(O)=O BJBUEDPLEOHJGE-UHFFFAOYSA-N 0.000 description 1
- FDKWRPBBCBCIGA-REOHCLBHSA-N (2r)-2-azaniumyl-3-$l^{1}-selanylpropanoate Chemical compound [Se]C[C@H](N)C(O)=O FDKWRPBBCBCIGA-REOHCLBHSA-N 0.000 description 1
- NWZSZGALRFJKBT-KNIFDHDWSA-N (2s)-2,6-diaminohexanoic acid;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.NCCCC[C@H](N)C(O)=O NWZSZGALRFJKBT-KNIFDHDWSA-N 0.000 description 1
- VEVRNHHLCPGNDU-MUGJNUQGSA-N (2s)-2-amino-5-[1-[(5s)-5-amino-5-carboxypentyl]-3,5-bis[(3s)-3-amino-3-carboxypropyl]pyridin-1-ium-4-yl]pentanoate Chemical compound OC(=O)[C@@H](N)CCCC[N+]1=CC(CC[C@H](N)C(O)=O)=C(CCC[C@H](N)C([O-])=O)C(CC[C@H](N)C(O)=O)=C1 VEVRNHHLCPGNDU-MUGJNUQGSA-N 0.000 description 1
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 description 1
- 125000004916 (C1-C6) alkylcarbonyl group Chemical group 0.000 description 1
- 125000003161 (C1-C6) alkylene group Chemical group 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- 125000001724 1,2,3-oxadiazol-4-yl group Chemical group [H]C1=C(*)N=NO1 0.000 description 1
- 125000004503 1,2,3-oxadiazol-5-yl group Chemical group O1N=NC=C1* 0.000 description 1
- 125000004512 1,2,3-thiadiazol-4-yl group Chemical group S1N=NC(=C1)* 0.000 description 1
- 125000001607 1,2,3-triazol-1-yl group Chemical group [*]N1N=NC([H])=C1[H] 0.000 description 1
- 125000001359 1,2,3-triazol-4-yl group Chemical group [H]N1N=NC([*])=C1[H] 0.000 description 1
- 125000001506 1,2,3-triazol-5-yl group Chemical group [H]N1N=NC([H])=C1[*] 0.000 description 1
- 125000001766 1,2,4-oxadiazol-3-yl group Chemical group [H]C1=NC(*)=NO1 0.000 description 1
- 125000004505 1,2,4-oxadiazol-5-yl group Chemical group O1N=CN=C1* 0.000 description 1
- 125000004515 1,2,4-thiadiazol-3-yl group Chemical group S1N=C(N=C1)* 0.000 description 1
- 125000004516 1,2,4-thiadiazol-5-yl group Chemical group S1N=CN=C1* 0.000 description 1
- 125000003626 1,2,4-triazol-1-yl group Chemical group [*]N1N=C([H])N=C1[H] 0.000 description 1
- 125000001401 1,2,4-triazol-4-yl group Chemical group N=1N=C([H])N([*])C=1[H] 0.000 description 1
- 125000001414 1,2,4-triazol-5-yl group Chemical group [H]N1N=C([H])N=C1[*] 0.000 description 1
- MMWRGWQTAMNAFC-UHFFFAOYSA-N 1,2-dihydropyridine Chemical compound C1NC=CC=C1 MMWRGWQTAMNAFC-UHFFFAOYSA-N 0.000 description 1
- 125000004509 1,3,4-oxadiazol-2-yl group Chemical group O1C(=NN=C1)* 0.000 description 1
- 125000004521 1,3,4-thiadiazol-2-yl group Chemical group S1C(=NN=C1)* 0.000 description 1
- 125000004317 1,3,5-triazin-2-yl group Chemical group [H]C1=NC(*)=NC([H])=N1 0.000 description 1
- 125000004227 1,3-benzoxazol-2-yl group Chemical group [H]C1=C([H])C([H])=C2N=C(*)OC2=C1[H] 0.000 description 1
- 125000000355 1,3-benzoxazolyl group Chemical group O1C(=NC2=C1C=CC=C2)* 0.000 description 1
- YNGDWRXWKFWCJY-UHFFFAOYSA-N 1,4-Dihydropyridine Chemical compound C1C=CNC=C1 YNGDWRXWKFWCJY-UHFFFAOYSA-N 0.000 description 1
- HNSDLXPSAYFUHK-UHFFFAOYSA-N 1,4-bis(2-ethylhexyl) sulfosuccinate Chemical compound CCCCC(CC)COC(=O)CC(S(O)(=O)=O)C(=O)OCC(CC)CCCC HNSDLXPSAYFUHK-UHFFFAOYSA-N 0.000 description 1
- JHTPBGFVWWSHDL-UHFFFAOYSA-N 1,4-dichloro-2-isothiocyanatobenzene Chemical compound ClC1=CC=C(Cl)C(N=C=S)=C1 JHTPBGFVWWSHDL-UHFFFAOYSA-N 0.000 description 1
- 125000005940 1,4-dioxanyl group Chemical group 0.000 description 1
- HKDFRDIIELOLTJ-UHFFFAOYSA-N 1,4-dithianyl Chemical group [CH]1CSCCS1 HKDFRDIIELOLTJ-UHFFFAOYSA-N 0.000 description 1
- 125000000183 1,4-thiazinyl group Chemical group S1C(C=NC=C1)* 0.000 description 1
- 125000004173 1-benzimidazolyl group Chemical group [H]C1=NC2=C([H])C([H])=C([H])C([H])=C2N1* 0.000 description 1
- 125000006083 1-bromoethyl group Chemical group 0.000 description 1
- 125000004214 1-pyrrolidinyl group Chemical group [H]C1([H])N(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000001462 1-pyrrolyl group Chemical group [*]N1C([H])=C([H])C([H])=C1[H] 0.000 description 1
- PNDPGZBMCMUPRI-HVTJNCQCSA-N 10043-66-0 Chemical compound [131I][131I] PNDPGZBMCMUPRI-HVTJNCQCSA-N 0.000 description 1
- 125000004259 1H-pyrrolizin-1-yl group Chemical group [H]C1=C([H])N2C([H])=C([H])C([H])(*)C2=C1[H] 0.000 description 1
- ODMMNALOCMNQJZ-UHFFFAOYSA-N 1H-pyrrolizine Chemical compound C1=CC=C2CC=CN21 ODMMNALOCMNQJZ-UHFFFAOYSA-N 0.000 description 1
- 125000002152 1H-pyrrolizinyl group Chemical group C1(C=CN2C=CC=C12)* 0.000 description 1
- OGNSCSPNOLGXSM-UHFFFAOYSA-N 2,4-diaminobutyric acid Chemical compound NCCC(N)C(O)=O OGNSCSPNOLGXSM-UHFFFAOYSA-N 0.000 description 1
- YGTUPRIZNBMOFV-UHFFFAOYSA-N 2-(4-hydroxybenzoyl)benzoic acid Chemical compound OC(=O)C1=CC=CC=C1C(=O)C1=CC=C(O)C=C1 YGTUPRIZNBMOFV-UHFFFAOYSA-N 0.000 description 1
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 125000004174 2-benzimidazolyl group Chemical group [H]N1C(*)=NC2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- 125000004974 2-butenyl group Chemical group C(C=CC)* 0.000 description 1
- 125000006040 2-hexenyl group Chemical group 0.000 description 1
- 125000004638 2-oxopiperazinyl group Chemical group O=C1N(CCNC1)* 0.000 description 1
- 125000004637 2-oxopiperidinyl group Chemical group O=C1N(CCCC1)* 0.000 description 1
- 125000006087 2-oxopyrrolodinyl group Chemical group 0.000 description 1
- 125000006024 2-pentenyl group Chemical group 0.000 description 1
- 125000000094 2-phenylethyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 description 1
- RSEBUVRVKCANEP-UHFFFAOYSA-N 2-pyrroline Chemical compound C1CC=CN1 RSEBUVRVKCANEP-UHFFFAOYSA-N 0.000 description 1
- 125000004326 2H-pyran-2-yl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])(*)O1 0.000 description 1
- 125000001698 2H-pyranyl group Chemical group O1C(C=CC=C1)* 0.000 description 1
- XABCFXXGZPWJQP-UHFFFAOYSA-N 3-aminoadipic acid Chemical compound OC(=O)CC(N)CCC(O)=O XABCFXXGZPWJQP-UHFFFAOYSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- 125000004975 3-butenyl group Chemical group C(CC=C)* 0.000 description 1
- 125000003349 3-pyridyl group Chemical group N1=C([H])C([*])=C([H])C([H])=C1[H] 0.000 description 1
- 125000004575 3-pyrrolidinyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000001397 3-pyrrolyl group Chemical group [H]N1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- 125000001541 3-thienyl group Chemical group S1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- 125000000339 4-pyridyl group Chemical group N1=C([H])C([H])=C([*])C([H])=C1[H] 0.000 description 1
- KDDQRKBRJSGMQE-UHFFFAOYSA-N 4-thiazolyl Chemical group [C]1=CSC=N1 KDDQRKBRJSGMQE-UHFFFAOYSA-N 0.000 description 1
- ZCAGUOCUDGWENZ-UHFFFAOYSA-N 4-thiomorpholin-4-ylsulfinylthiomorpholine Chemical compound C1CSCCN1S(=O)N1CCSCC1 ZCAGUOCUDGWENZ-UHFFFAOYSA-N 0.000 description 1
- WCNFFKHKJLERFM-UHFFFAOYSA-N 4-thiomorpholin-4-ylsulfonylthiomorpholine Chemical compound C1CSCCN1S(=O)(=O)N1CCSCC1 WCNFFKHKJLERFM-UHFFFAOYSA-N 0.000 description 1
- 125000004315 4H-pyran-2-yl group Chemical group [H]C1=C([H])C([H])([H])C([H])=C(*)O1 0.000 description 1
- 125000001826 4H-pyranyl group Chemical group O1C(=CCC=C1)* 0.000 description 1
- 125000002471 4H-quinolizinyl group Chemical group C=1(C=CCN2C=CC=CC12)* 0.000 description 1
- 125000004539 5-benzimidazolyl group Chemical group N1=CNC2=C1C=CC(=C2)* 0.000 description 1
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 1
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 1
- 229940127124 90Y-ibritumomab tiuxetan Drugs 0.000 description 1
- OPVPGKGADVGKTG-BQBZGAKWSA-N Ac-Asp-Glu Chemical compound CC(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCC(O)=O OPVPGKGADVGKTG-BQBZGAKWSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- 238000011357 CAR T-cell therapy Methods 0.000 description 1
- 101100063435 Caenorhabditis elegans din-1 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- UDIPTWFVPPPURJ-UHFFFAOYSA-M Cyclamate Chemical compound [Na+].[O-]S(=O)(=O)NC1CCCCC1 UDIPTWFVPPPURJ-UHFFFAOYSA-M 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FDKWRPBBCBCIGA-UWTATZPHSA-N D-Selenocysteine Natural products [Se]C[C@@H](N)C(O)=O FDKWRPBBCBCIGA-UWTATZPHSA-N 0.000 description 1
- DSLZVSRJTYRBFB-LLEIAEIESA-N D-glucaric acid Chemical compound OC(=O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O DSLZVSRJTYRBFB-LLEIAEIESA-N 0.000 description 1
- AEMOLEFTQBMNLQ-AQKNRBDQSA-N D-glucopyranuronic acid Chemical compound OC1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-AQKNRBDQSA-N 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 239000004129 EU approved improving agent Substances 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 1
- 108700012941 GNRH1 Proteins 0.000 description 1
- 206010071602 Genetic polymorphism Diseases 0.000 description 1
- 102000003958 Glutamate Carboxypeptidase II Human genes 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 239000007821 HATU Substances 0.000 description 1
- 241000282414 Homo sapiens Species 0.000 description 1
- 101001058904 Homo sapiens Gamma-tubulin complex component 2 Proteins 0.000 description 1
- 101001014636 Homo sapiens Golgin subfamily A member 4 Proteins 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- LCWXJXMHJVIJFK-UHFFFAOYSA-N Hydroxylysine Natural products NCC(O)CC(N)CC(O)=O LCWXJXMHJVIJFK-UHFFFAOYSA-N 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 229930194542 Keto Natural products 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical compound CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 1
- JUQLUIFNNFIIKC-YFKPBYRVSA-N L-2-aminopimelic acid Chemical compound OC(=O)[C@@H](N)CCCCC(O)=O JUQLUIFNNFIIKC-YFKPBYRVSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- AGPKZVBTJJNPAG-UHNVWZDZSA-N L-allo-Isoleucine Chemical compound CC[C@@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-UHNVWZDZSA-N 0.000 description 1
- FFFHZYDWPBMWHY-VKHMYHEASA-N L-homocysteine Chemical compound OC(=O)[C@@H](N)CCS FFFHZYDWPBMWHY-VKHMYHEASA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical compound OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Natural products CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102000009151 Luteinizing Hormone Human genes 0.000 description 1
- 108010073521 Luteinizing Hormone Proteins 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 1
- PWHULOQIROXLJO-UHFFFAOYSA-N Manganese Chemical compound [Mn] PWHULOQIROXLJO-UHFFFAOYSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- OLNLSTNFRUFTLM-UHFFFAOYSA-N N-ethylasparagine Chemical compound CCNC(C(O)=O)CC(N)=O OLNLSTNFRUFTLM-UHFFFAOYSA-N 0.000 description 1
- YPIGGYHFMKJNKV-UHFFFAOYSA-N N-ethylglycine Chemical compound CC[NH2+]CC([O-])=O YPIGGYHFMKJNKV-UHFFFAOYSA-N 0.000 description 1
- 108010065338 N-ethylglycine Proteins 0.000 description 1
- AKCRVYNORCOYQT-YFKPBYRVSA-N N-methyl-L-valine Chemical compound CN[C@@H](C(C)C)C(O)=O AKCRVYNORCOYQT-YFKPBYRVSA-N 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- 125000000815 N-oxide group Chemical group 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- 101100030361 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) pph-3 gene Proteins 0.000 description 1
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical compound OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- CWRVKFFCRWGWCS-UHFFFAOYSA-N Pentrazole Chemical compound C1CCCCC2=NN=NN21 CWRVKFFCRWGWCS-UHFFFAOYSA-N 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 239000012979 RPMI medium Substances 0.000 description 1
- 206010057190 Respiratory tract infections Diseases 0.000 description 1
- 108010077895 Sarcosine Proteins 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 208000032023 Signs and Symptoms Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 208000002847 Surgical Wound Diseases 0.000 description 1
- 229920002253 Tannate Polymers 0.000 description 1
- 241000011102 Thera Species 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- VWQVUPCCIRVNHF-OIOBTWANSA-N Yttrium-86 Chemical compound [86Y] VWQVUPCCIRVNHF-OIOBTWANSA-N 0.000 description 1
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 1
- PTFCDOFLOPIGGS-UHFFFAOYSA-N Zinc dication Chemical compound [Zn+2] PTFCDOFLOPIGGS-UHFFFAOYSA-N 0.000 description 1
- LFEYMWCCUAOUKZ-FVGYRXGTSA-N [(2s)-1,5-bis[(2-methylpropan-2-yl)oxy]-1,5-dioxopentan-2-yl]azanium;chloride Chemical compound Cl.CC(C)(C)OC(=O)CC[C@H](N)C(=O)OC(C)(C)C LFEYMWCCUAOUKZ-FVGYRXGTSA-N 0.000 description 1
- FNQZOQAQDYFBOC-UHFFFAOYSA-N [Re+5].ClC1=C(C(=C(C=C1)P(OP(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1)Cl)Cl Chemical compound [Re+5].ClC1=C(C(=C(C=C1)P(OP(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1)Cl)Cl FNQZOQAQDYFBOC-UHFFFAOYSA-N 0.000 description 1
- 231100000987 absorbed dose Toxicity 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- WNLRTRBMVRJNCN-UHFFFAOYSA-L adipate(2-) Chemical compound [O-]C(=O)CCCCC([O-])=O WNLRTRBMVRJNCN-UHFFFAOYSA-L 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- 229930013930 alkaloid Natural products 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 125000003545 alkoxy group Chemical group 0.000 description 1
- 125000004453 alkoxycarbonyl group Chemical group 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 125000002947 alkylene group Chemical group 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- 239000004411 aluminium Substances 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- PNEYBMLMFCGWSK-UHFFFAOYSA-N aluminium oxide Inorganic materials [O-2].[O-2].[O-2].[Al+3].[Al+3] PNEYBMLMFCGWSK-UHFFFAOYSA-N 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229960002684 aminocaproic acid Drugs 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 125000002178 anthracenyl group Chemical group C1(=CC=CC2=CC3=CC=CC=C3C=C12)* 0.000 description 1
- 230000002280 anti-androgenic effect Effects 0.000 description 1
- 229940124650 anti-cancer therapies Drugs 0.000 description 1
- 230000003092 anti-cytokine Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 239000000051 antiandrogen Substances 0.000 description 1
- 229940030495 antiandrogen sex hormone and modulator of the genital system Drugs 0.000 description 1
- 238000011394 anticancer treatment Methods 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- 229940046844 aromatase inhibitors Drugs 0.000 description 1
- 125000003710 aryl alkyl group Chemical group 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 229960003852 atezolizumab Drugs 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 125000004320 azepan-2-yl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C1([H])* 0.000 description 1
- 125000003725 azepanyl group Chemical group 0.000 description 1
- 125000004567 azetidin-3-yl group Chemical group N1CC(C1)* 0.000 description 1
- 125000004267 aziridin-2-yl group Chemical group [H]N1C([H])([H])C1([H])* 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- 125000004244 benzofuran-2-yl group Chemical group [H]C1=C(*)OC2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- 125000004532 benzofuran-3-yl group Chemical group O1C=C(C2=C1C=CC=C2)* 0.000 description 1
- 125000004533 benzofuran-5-yl group Chemical group O1C=CC2=C1C=CC(=C2)* 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 125000004534 benzothien-2-yl group Chemical group S1C(=CC2=C1C=CC=C2)* 0.000 description 1
- 125000004197 benzothien-3-yl group Chemical group [H]C1=C(*)C2=C([H])C([H])=C([H])C([H])=C2S1 0.000 description 1
- 125000004535 benzothien-5-yl group Chemical group S1C=CC2=C1C=CC(=C2)* 0.000 description 1
- 125000004238 benzotriazol-4-yl group Chemical group [H]N1N=NC2=C(*)C([H])=C([H])C([H])=C12 0.000 description 1
- QRUDEWIWKLJBPS-UHFFFAOYSA-N benzotriazole Chemical compound C1=CC=C2N[N][N]C2=C1 QRUDEWIWKLJBPS-UHFFFAOYSA-N 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 125000002619 bicyclic group Chemical group 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 239000003124 biologic agent Substances 0.000 description 1
- 229960003008 blinatumomab Drugs 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 229910021475 bohrium Inorganic materials 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 229960000455 brentuximab vedotin Drugs 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000004067 bulking agent Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- MIOPJNTWMNEORI-UHFFFAOYSA-N camphorsulfonic acid Chemical compound C1CC2(CS(O)(=O)=O)C(=O)CC1C2(C)C MIOPJNTWMNEORI-UHFFFAOYSA-N 0.000 description 1
- 239000011203 carbon fibre reinforced carbon Substances 0.000 description 1
- 150000001735 carboxylic acids Chemical class 0.000 description 1
- 229960000419 catumaxomab Drugs 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 125000004218 chloromethyl group Chemical group [H]C([H])(Cl)* 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- 125000004241 chroman-2-yl group Chemical group [H]C1=C([H])C([H])=C2C(OC([H])(*)C([H])([H])C2([H])[H])=C1[H] 0.000 description 1
- 125000003016 chromanyl group Chemical group O1C(CCC2=CC=CC=C12)* 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 125000004242 cinnolin-3-yl group Chemical group [H]C1=C([H])C([H])=C2C([H])=C(*)N=NC2=C1[H] 0.000 description 1
- 125000000259 cinnolinyl group Chemical group N1=NC(=CC2=CC=CC=C12)* 0.000 description 1
- BJBUEDPLEOHJGE-IUYQGCFVSA-N cis-3-hydroxy-D-proline zwitterion Chemical compound O[C@H]1CCN[C@H]1C(O)=O BJBUEDPLEOHJGE-IUYQGCFVSA-N 0.000 description 1
- 150000001860 citric acid derivatives Chemical class 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 208000030499 combat disease Diseases 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 230000000875 corresponding effect Effects 0.000 description 1
- 239000012043 crude product Substances 0.000 description 1
- 238000009109 curative therapy Methods 0.000 description 1
- 229940109275 cyclamate Drugs 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 102000003675 cytokine receptors Human genes 0.000 description 1
- 108010057085 cytokine receptors Proteins 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 229960002204 daratumumab Drugs 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 229960002923 denileukin diftitox Drugs 0.000 description 1
- 108010017271 denileukin diftitox Proteins 0.000 description 1
- 229960001251 denosumab Drugs 0.000 description 1
- 230000002074 deregulated effect Effects 0.000 description 1
- 238000002059 diagnostic imaging Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 125000004663 dialkyl amino group Chemical group 0.000 description 1
- 229940061607 dibasic sodium phosphate Drugs 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000000378 dietary effect Effects 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 1
- 125000001664 diethylamino group Chemical group [H]C([H])([H])C([H])([H])N(*)C([H])([H])C([H])([H])[H] 0.000 description 1
- 125000001028 difluoromethyl group Chemical group [H]C(F)(F)* 0.000 description 1
- 125000004852 dihydrofuranyl group Chemical group O1C(CC=C1)* 0.000 description 1
- 125000005057 dihydrothienyl group Chemical group S1C(CC=C1)* 0.000 description 1
- 229940043279 diisopropylamine Drugs 0.000 description 1
- 125000002147 dimethylamino group Chemical group [H]C([H])([H])N(*)C([H])([H])[H] 0.000 description 1
- YPTUAQWMBNZZRN-UHFFFAOYSA-N dimethylaminoboron Chemical compound [B]N(C)C YPTUAQWMBNZZRN-UHFFFAOYSA-N 0.000 description 1
- 229960004497 dinutuximab Drugs 0.000 description 1
- 229950010286 diolamine Drugs 0.000 description 1
- 125000000532 dioxanyl group Chemical group 0.000 description 1
- 125000005879 dioxolanyl group Chemical group 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 125000005883 dithianyl group Chemical group 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 229920001971 elastomer Polymers 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 229960004137 elotuzumab Drugs 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 1
- 125000000031 ethylamino group Chemical group [H]C([H])([H])C([H])([H])N([H])[*] 0.000 description 1
- IFQUWYZCAGRUJN-UHFFFAOYSA-N ethylenediaminediacetic acid Chemical compound OC(=O)CNCCNCC(O)=O IFQUWYZCAGRUJN-UHFFFAOYSA-N 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 125000001153 fluoro group Chemical group F* 0.000 description 1
- 125000004216 fluoromethyl group Chemical group [H]C([H])(F)* 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 229960003692 gamma aminobutyric acid Drugs 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 229940097042 glucuronate Drugs 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 125000001188 haloalkyl group Chemical group 0.000 description 1
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003707 hexyloxy group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])O* 0.000 description 1
- 229950000177 hibenzate Drugs 0.000 description 1
- 238000000589 high-performance liquid chromatography-mass spectrometry Methods 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 150000004677 hydrates Chemical class 0.000 description 1
- IKDUDTNKRLTJSI-UHFFFAOYSA-N hydrazine monohydrate Substances O.NN IKDUDTNKRLTJSI-UHFFFAOYSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- QJHBJHUKURJDLG-UHFFFAOYSA-N hydroxy-L-lysine Natural products NCCCCC(NO)C(O)=O QJHBJHUKURJDLG-UHFFFAOYSA-N 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 229960002308 idarucizumab Drugs 0.000 description 1
- 239000012216 imaging agent Substances 0.000 description 1
- 125000003037 imidazol-2-yl group Chemical group [H]N1C([*])=NC([H])=C1[H] 0.000 description 1
- 125000000336 imidazol-5-yl group Chemical group [H]N1C([H])=NC([H])=C1[*] 0.000 description 1
- 125000002632 imidazolidinyl group Chemical group 0.000 description 1
- 125000004283 imidazolin-2-yl group Chemical group [H]N1C(*)=NC([H])([H])C1([H])[H] 0.000 description 1
- 125000002636 imidazolinyl group Chemical group 0.000 description 1
- 125000001841 imino group Chemical group [H]N=* 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 125000003453 indazolyl group Chemical group N1N=C(C2=C1C=CC=C2)* 0.000 description 1
- 125000004246 indolin-2-yl group Chemical group [H]N1C(*)=C([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- 125000004538 indolizin-3-yl group Chemical group C=1C=C(N2C=CC=CC12)* 0.000 description 1
- 125000001041 indolyl group Chemical group 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 1
- 239000012948 isocyanate Substances 0.000 description 1
- 150000002513 isocyanates Chemical class 0.000 description 1
- RGXCTRIQQODGIZ-UHFFFAOYSA-O isodesmosine Chemical compound OC(=O)C(N)CCCC[N+]1=CC(CCC(N)C(O)=O)=CC(CCC(N)C(O)=O)=C1CCCC(N)C(O)=O RGXCTRIQQODGIZ-UHFFFAOYSA-O 0.000 description 1
- 125000000904 isoindolyl group Chemical group C=1(NC=C2C=CC=CC12)* 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 125000004551 isoquinolin-3-yl group Chemical group C1=NC(=CC2=CC=CC=C12)* 0.000 description 1
- 125000004552 isoquinolin-4-yl group Chemical group C1=NC=C(C2=CC=CC=C12)* 0.000 description 1
- 125000001793 isothiazol-3-yl group Chemical group [H]C1=C([H])C(*)=NS1 0.000 description 1
- 125000004500 isothiazol-4-yl group Chemical group S1N=CC(=C1)* 0.000 description 1
- 125000004501 isothiazol-5-yl group Chemical group S1N=CC=C1* 0.000 description 1
- 125000004284 isoxazol-3-yl group Chemical group [H]C1=C([H])C(*)=NO1 0.000 description 1
- 125000004498 isoxazol-4-yl group Chemical group O1N=CC(=C1)* 0.000 description 1
- 125000004499 isoxazol-5-yl group Chemical group O1N=CC=C1* 0.000 description 1
- 125000004285 isoxazolidin-3-yl group Chemical group [H]N1OC([H])([H])C([H])([H])C1([H])* 0.000 description 1
- 125000003971 isoxazolinyl group Chemical group 0.000 description 1
- 125000000842 isoxazolyl group Chemical group 0.000 description 1
- 125000000468 ketone group Chemical group 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 229940040129 luteinizing hormone Drugs 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 229940091250 magnesium supplement Drugs 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- 229910052748 manganese Inorganic materials 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 229960003194 meglumine Drugs 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- JZMJDSHXVKJFKW-UHFFFAOYSA-M methyl sulfate(1-) Chemical compound COS([O-])(=O)=O JZMJDSHXVKJFKW-UHFFFAOYSA-M 0.000 description 1
- 125000000250 methylamino group Chemical group [H]N(*)C([H])([H])[H] 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 229940045641 monobasic sodium phosphate Drugs 0.000 description 1
- 125000002950 monocyclic group Chemical group 0.000 description 1
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 1
- 235000019799 monosodium phosphate Nutrition 0.000 description 1
- 125000004312 morpholin-2-yl group Chemical group [H]N1C([H])([H])C([H])([H])OC([H])(*)C1([H])[H] 0.000 description 1
- 125000002757 morpholinyl group Chemical group 0.000 description 1
- 230000008722 morphological abnormality Effects 0.000 description 1
- 210000000214 mouth Anatomy 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 125000005487 naphthalate group Chemical group 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 229960000513 necitumumab Drugs 0.000 description 1
- 210000005170 neoplastic cell Anatomy 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 235000001968 nicotinic acid Nutrition 0.000 description 1
- 239000011664 nicotinic acid Substances 0.000 description 1
- 229910017604 nitric acid Inorganic materials 0.000 description 1
- 150000002829 nitrogen Chemical class 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- 229960003301 nivolumab Drugs 0.000 description 1
- 238000002414 normal-phase solid-phase extraction Methods 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 229960003347 obinutuzumab Drugs 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- 229960002450 ofatumumab Drugs 0.000 description 1
- 229950004864 olamine Drugs 0.000 description 1
- 229950008516 olaratumab Drugs 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 201000005443 oral cavity cancer Diseases 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- PXQPEWDEAKTCGB-UHFFFAOYSA-N orotic acid Chemical compound OC(=O)C1=CC(=O)NC(=O)N1 PXQPEWDEAKTCGB-UHFFFAOYSA-N 0.000 description 1
- 125000001715 oxadiazolyl group Chemical group 0.000 description 1
- 125000004287 oxazol-2-yl group Chemical group [H]C1=C([H])N=C(*)O1 0.000 description 1
- 125000004304 oxazol-5-yl group Chemical group O1C=NC=C1* 0.000 description 1
- 125000004288 oxazolidin-2-yl group Chemical group [H]N1C([H])([H])C([H])([H])OC1([H])* 0.000 description 1
- 125000005968 oxazolinyl group Chemical group 0.000 description 1
- 125000002971 oxazolyl group Chemical group 0.000 description 1
- 125000006299 oxetan-3-yl group Chemical group [H]C1([H])OC([H])([H])C1([H])* 0.000 description 1
- 125000003544 oxime group Chemical group 0.000 description 1
- 125000000466 oxiranyl group Chemical group 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229960001972 panitumumab Drugs 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229960002621 pembrolizumab Drugs 0.000 description 1
- 235000019371 penicillin G benzathine Nutrition 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 229940127557 pharmaceutical product Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 125000003386 piperidinyl group Chemical group 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 238000012805 post-processing Methods 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 229960003975 potassium Drugs 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 229940021993 prophylactic vaccine Drugs 0.000 description 1
- 208000023958 prostate neoplasm Diseases 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 125000004258 purin-2-yl group Chemical group [H]N1C2=NC(*)=NC([H])=C2N([H])C1([H])[H] 0.000 description 1
- 125000004542 purin-6-yl group Chemical group N1=CN=C2N=CNC2=C1* 0.000 description 1
- 125000004544 purin-8-yl group Chemical group N1=CN=C2N=C(NC2=C1)* 0.000 description 1
- 125000004944 pyrazin-3-yl group Chemical group [H]C1=C([H])N=C(*)C([H])=N1 0.000 description 1
- 125000004353 pyrazol-1-yl group Chemical group [H]C1=NN(*)C([H])=C1[H] 0.000 description 1
- 125000004289 pyrazol-3-yl group Chemical group [H]N1N=C(*)C([H])=C1[H] 0.000 description 1
- 125000004497 pyrazol-5-yl group Chemical group N1N=CC=C1* 0.000 description 1
- 125000003072 pyrazolidinyl group Chemical group 0.000 description 1
- 125000002755 pyrazolinyl group Chemical group 0.000 description 1
- 125000004940 pyridazin-4-yl group Chemical group N1=NC=C(C=C1)* 0.000 description 1
- 125000000719 pyrrolidinyl group Chemical group 0.000 description 1
- 125000004260 quinazolin-2-yl group Chemical group [H]C1=NC(*)=NC2=C1C([H])=C([H])C([H])=C2[H] 0.000 description 1
- 125000004546 quinazolin-4-yl group Chemical group N1=CN=C(C2=CC=CC=C12)* 0.000 description 1
- 125000004547 quinazolin-6-yl group Chemical group N1=CN=CC2=CC(=CC=C12)* 0.000 description 1
- 125000004159 quinolin-2-yl group Chemical group [H]C1=C([H])C([H])=C2C([H])=C([H])C(*)=NC2=C1[H] 0.000 description 1
- 125000004548 quinolin-3-yl group Chemical group N1=CC(=CC2=CC=CC=C12)* 0.000 description 1
- 125000004549 quinolin-4-yl group Chemical group N1=CC=C(C2=CC=CC=C12)* 0.000 description 1
- 125000004550 quinolin-6-yl group Chemical group N1=CC=CC2=CC(=CC=C12)* 0.000 description 1
- 125000004262 quinoxalin-2-yl group Chemical group [H]C1=NC2=C([H])C([H])=C([H])C([H])=C2N=C1* 0.000 description 1
- 125000004553 quinoxalin-5-yl group Chemical group N1=CC=NC2=C(C=CC=C12)* 0.000 description 1
- 238000002601 radiography Methods 0.000 description 1
- 238000002673 radiosurgery Methods 0.000 description 1
- 229960002633 ramucirumab Drugs 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 201000010174 renal carcinoma Diseases 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- QEVHRUUCFGRFIF-MDEJGZGSSA-N reserpine Chemical compound O([C@H]1[C@@H]([C@H]([C@H]2C[C@@H]3C4=C(C5=CC=C(OC)C=C5N4)CCN3C[C@H]2C1)C(=O)OC)OC)C(=O)C1=CC(OC)=C(OC)C(OC)=C1 QEVHRUUCFGRFIF-MDEJGZGSSA-N 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 125000006413 ring segment Chemical group 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- ZKZBPNGNEQAJSX-UHFFFAOYSA-N selenocysteine Natural products [SeH]CC(N)C(O)=O ZKZBPNGNEQAJSX-UHFFFAOYSA-N 0.000 description 1
- 229940055619 selenocysteine Drugs 0.000 description 1
- 235000016491 selenocysteine Nutrition 0.000 description 1
- 210000001625 seminal vesicle Anatomy 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- DFEYYRMXOJXZRJ-UHFFFAOYSA-N sevoflurane Chemical compound FCOC(C(F)(F)F)C(F)(F)F DFEYYRMXOJXZRJ-UHFFFAOYSA-N 0.000 description 1
- 229960002078 sevoflurane Drugs 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229960004249 sodium acetate Drugs 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- HRZFUMHJMZEROT-UHFFFAOYSA-L sodium disulfite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 1
- 229940001584 sodium metabisulfite Drugs 0.000 description 1
- 235000010262 sodium metabisulphite Nutrition 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 230000000707 stereoselective effect Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 125000003107 substituted aryl group Chemical group 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 150000003892 tartrate salts Chemical class 0.000 description 1
- 229960003102 tasonermin Drugs 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- GZCRRIHWUXGPOV-NJFSPNSNSA-N terbium-161 Chemical compound [161Tb] GZCRRIHWUXGPOV-NJFSPNSNSA-N 0.000 description 1
- 150000003505 terpenes Chemical class 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 125000003039 tetrahydroisoquinolinyl group Chemical group C1(NCCC2=CC=CC=C12)* 0.000 description 1
- 125000004187 tetrahydropyran-2-yl group Chemical group [H]C1([H])OC([H])(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000004853 tetrahydropyridinyl group Chemical group N1(CCCC=C1)* 0.000 description 1
- 125000004264 tetrahydroquinolin-2-yl group Chemical group [H]N1C2=C([H])C([H])=C([H])C([H])=C2C([H])([H])C([H])([H])C1([H])* 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 229940022511 therapeutic cancer vaccine Drugs 0.000 description 1
- 125000001113 thiadiazolyl group Chemical group 0.000 description 1
- 125000005307 thiatriazolyl group Chemical group S1N=NN=C1* 0.000 description 1
- 125000004300 thiazolidin-2-yl group Chemical group [H]N1C([H])([H])C([H])([H])SC1([H])* 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 125000006300 thietan-3-yl group Chemical group [H]C1([H])SC([H])([H])C1([H])* 0.000 description 1
- 125000004271 thiiran-2-yl group Chemical group [H]C1([H])SC1([H])* 0.000 description 1
- 125000004569 thiomorpholin-2-yl group Chemical group N1CC(SCC1)* 0.000 description 1
- 125000004568 thiomorpholinyl group Chemical group 0.000 description 1
- YSMODUONRAFBET-WHFBIAKZSA-N threo-5-hydroxy-L-lysine Chemical compound NC[C@@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-WHFBIAKZSA-N 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 229960005267 tositumomab Drugs 0.000 description 1
- 229910052723 transition metal Inorganic materials 0.000 description 1
- 150000003624 transition metals Chemical class 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 229960001612 trastuzumab emtansine Drugs 0.000 description 1
- 125000004784 trichloromethoxy group Chemical group ClC(O*)(Cl)Cl 0.000 description 1
- 125000003866 trichloromethyl group Chemical group ClC(Cl)(Cl)* 0.000 description 1
- UCPYLLCMEDAXFR-UHFFFAOYSA-N triphosgene Chemical compound ClC(Cl)(Cl)OC(=O)OC(Cl)(Cl)Cl UCPYLLCMEDAXFR-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- WFKWXMTUELFFGS-UHFFFAOYSA-N tungsten Chemical compound [W] WFKWXMTUELFFGS-UHFFFAOYSA-N 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- 239000010937 tungsten Substances 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000012285 ultrasound imaging Methods 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 210000005167 vascular cell Anatomy 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 201000010653 vesiculitis Diseases 0.000 description 1
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 230000036642 wellbeing Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 125000001834 xanthenyl group Chemical group C1=CC=CC=2OC3=CC=CC=C3C(C12)* 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07B—GENERAL METHODS OF ORGANIC CHEMISTRY; APPARATUS THEREFOR
- C07B59/00—Introduction of isotopes of elements into organic compounds ; Labelled organic compounds per se
- C07B59/004—Acyclic, carbocyclic or heterocyclic compounds containing elements other than carbon, hydrogen, halogen, oxygen, nitrogen, sulfur, selenium or tellurium
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/088—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins conjugates with carriers being peptides, polyamino acids or proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/0402—Organic compounds carboxylic acid carriers, fatty acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/0497—Organic compounds conjugates with a carrier being an organic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07B—GENERAL METHODS OF ORGANIC CHEMISTRY; APPARATUS THEREFOR
- C07B59/00—Introduction of isotopes of elements into organic compounds ; Labelled organic compounds per se
- C07B59/008—Peptides; Proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C275/00—Derivatives of urea, i.e. compounds containing any of the groups, the nitrogen atoms not being part of nitro or nitroso groups
- C07C275/04—Derivatives of urea, i.e. compounds containing any of the groups, the nitrogen atoms not being part of nitro or nitroso groups having nitrogen atoms of urea groups bound to acyclic carbon atoms
- C07C275/06—Derivatives of urea, i.e. compounds containing any of the groups, the nitrogen atoms not being part of nitro or nitroso groups having nitrogen atoms of urea groups bound to acyclic carbon atoms of an acyclic and saturated carbon skeleton
- C07C275/16—Derivatives of urea, i.e. compounds containing any of the groups, the nitrogen atoms not being part of nitro or nitroso groups having nitrogen atoms of urea groups bound to acyclic carbon atoms of an acyclic and saturated carbon skeleton being further substituted by carboxyl groups
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07F—ACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
- C07F13/00—Compounds containing elements of Groups 7 or 17 of the Periodic Table
- C07F13/005—Compounds without a metal-carbon linkage
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2123/00—Preparations for testing in vivo
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Physics & Mathematics (AREA)
- Optics & Photonics (AREA)
- Epidemiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
The present invention relates to diagnosis and treatment of malignancies characterised by prostate-specific membrane antigen (PSMA) expression. The invention particularly relates to improved radiopharmaceuticals which selectively bind to PSMA and are suitable for planar imaging of PSMA expression in subjects to diagnose and/or monitor malignancies wherein PSMA is (over)expressed. Additionally, the invention relates to improved radiopharmaceuticals which selectively bind to PSMA and are suitable to act as radionuclide treatment agents. The radiopharmaceuticals rely on a pharmacophore capable of interacting with PSMA and N-terminal mercaptoacetyltripeptides capable of coordinating radioactive metals such as technetium and rhenium.
Description
IMPROVED PROSTATE-SPECIFIC MEMBRANE ANTIGEN TARGETING
RADIOPHARMACEUTICALS AND USES THEREOF
FIELD OF THE INVENTION
The present invention relates to the field of radiopharmaceuticals. In particular, the radiopharmaceuticals are capable of selective binding to prostate-specific membrane antigens (PSMA) and can be used in both diagnosis and treatment of cancer types that are accompanied by (over)expression of PSMA. The PSMA radiopharmaceuticals described herein are characterised by a number of advantages over PSMA radiopharmaceuticals known in the art.
BACKGROUND OF THE INVENTION
In 2018, over 1 million of new prostate cancer cases were registered worldwide, rendering the disease the second most frequent malignancy in adult men worldwide (Rawla, World J
Oncol, 2019). Both the incidence and mortality rate of prostate cancer correlate with increasing age, and the average age of diagnosis is about 66 years. Albeit significant regional differences can be discerned, the global mortality rate of prostate cancer relates to about 3.8% of all deaths caused by cancer in men (Jcmal ct al., CA
Cancer J Clin, 2018). Given the often asymptomatic first stages of prostate cancer progression, the regional incidence rates are tightly correlated to both the adoption of screening campaigns, an increase in average life expectancy, but also westernisation of the lifestyle which impacts obesity, physical inactivity, and dietary factors (Baade et al., Mol Nutr Food Res, 2009).
Hence, it is expected that incidence rates will continue to rise up to 2040 (Ferlay et al., Cancer Today, IARC Cancerbase, 2018).
Continuous advancements in the fields of medicine and health sciences are unearthing new diagnostic markers and therapeutic targets to combat diseases. A marker of particular interest in the context of prostate cancer is the enzyme glutamate carboxy-peptidase II, commonly referred to in the art as prostate-specific membrane antigen (PSMA). PSMA is consistently expressed in all types of prostate tissue and highly overexpressed in prostate cancer tissue and it has been demonstrated that PSMA
expression levels are directly correlated to androgen independence, metastasis, and disease progression (Santoni et al., J Biol Regul Homcost Agents, 2014). In view hereof, diagnosis and monitoring of prostate cancer by positron emission tomography (PET) or by single-photon emission tomography (SPECT) of PSMA is increasingly used in clinical settings (Fanti et al., Eur J
Nucl Med Mol Imaging, 2021). Alternatively, the highly selective expression profile of PSMA
translates to PSMA being especially suited as target for a radionuclide therapy of prostate cancer and other malignancies that are accompanied by PSMA (over)expression. In addition to the highly specific (high) expression levels that can be measured for PSMA in (malignant) prostate tissue, PSMA is rapidly internalised by cells upon ligand binding, which leads to a further concentration of the radionuclide molecule inside cells, thus increasing tumour absorbed dose. Consequently, a number of radiopharmaceuticals have been developed that comprise a selective PSMA ligand conjugated to a radiometal which aim to achieve optimal PSMA imaging and/or PSMA radionuclide therapy. So far, in the field of diagnosis the PSMA
targeting PET tracers gained most attraction, while in the field of therapy recent research focussed on Lu-177 and Ac-225 based radiophannaceuticals. However, worldwide nuclear medical infrastructure is far more developed in the field of SPECT. Thus, a theragnostic tandem applying Tc-99m and Re-188 labeled PSMA tracers would be highly desirable ¨ especially since both radionuclides are available from common generator systems which are authorized for medical use in most countries. For pure diagnostic application (SPECT) a number of 99mTc-radiotracers like iPSMA have been developed.
However, particularly in the case of iPSMA, the HYNIC chelator renders "Re-labelling at least difficult and is, thus, not a viable basis for a potential "kit application".
Further, improving the body clearance of the radiopharmaceutical would be equally desirable.
In view hereof, any approach that may facilitate diagnosis and/or improve treatment of prostate cancer is a valuable asset for identifying afflicted men and/or lowering the mortality rate of men diagnosed with prostate cancer.
SUMMARY OF THE INVENTION
Through extensive research and experimentation, the inventors have identified novel PSMA
radiopharmaceuticals or radiothcranostics (radiothcrapeutics or radiodiagnostics) with improved properties vis-à-vis known PSMA radiopharmaccuticals. The radiopharmaceuticals described herein, including but not limited to Technetium-99m (99"'Tc) labeled imaging agents and Rhenium-188 (1 Re) labeled therapeutics/thera(g)nostics, are characterized by structural modifications in the linker region and/or the chelator and have improved pharmacokinetic properties while maintaining a stable "Re/99"1Tc-coordination to the molecule. The pharmacophore presents three carboxylic groups able to interact with the respective side chains of PSMA and an oxygen as part of zinc complexation in the active center. Besides these obligatory interactions, the inventors were able to optimize the lipophilic interactions in the linker region compared to the lead structure 99mTc-EDDA-HYNIC-iPSMA (TLX-598/199mTcifc-TLX-598 ¨ cf. WO 2017/222362). Moreover, the inventors replaced the HYN1C
chelator by N-terminal mercaptoacetyltripeptides, which are (also) capable of coordinating Technetium-99m and Rhenium-188 (in form of the so called "oxo-core"
Tc(V)0/Re(V)0, coordinated towards the three amide bonds and the dcprotonatcd sulfur; reference). In contrast, this type of coordination does not need application of a stabilizing co-ligand (e.g., EDDA) and, thus, represents a simplification of the underlying chemistry. Additionally, the modified radiopharmaceuticals described herein display a good cellular uptake and renal clearance rates. The exemplified 99mTc and 'Re radiopharmaceuticals hence present improved radiopharmaceutical molecules for respectively planar imaging and radionuclide therapy of PSMA positive tumors.
The invention therefore provides thc following aspects:
Aspect 1.
A first aspect of the present invention provides a labeling precursor in the form of a compound of formula (I) or a stereoisomer, or tautomer thereof, II
0 A2¨A3¨A4 HN
\
)O N
HN
0 _____________________________ /C) OH OH
wherein, RI is selected from the group consisting of hydrogen, -C(0)R", c(0)2R12, C(0)NRI2R13, SRI , CI
6alkyl, arylCi_6alkyl, heteroary1C1_6alkyl, heterocycly1C1_6alkyl, aryl, heteroaryl, heterocyclyl; wherein said Ci_6a1ky1, ary1C1_6a1kyl, heteroarylCi_6a1kyl, heterocycly1C1_6a1kyl, aryl, heteroaryl, or heterocyclyl can be unsubstituted or substituted with one or more Z';
N
*
L1 is or ; wherein * represents vvhere L1 is bound to the carbonyl group; and ** represents where Li is bound to Al;
N
* **
* **
IS Ai is or ; wherein * represents where Ai is bound Li;
and ** represents where Al is bound to A2; and wherein, n is an integer selected from 1, 2, 3,4 or 5;
IC is selected from the group consisting of hydroxyC1_6alkyl, C1_6alkylNHR3 C1_6alkylC(0)0H, C1_ 6a1kylNHC(NH)NH2, hydrogen, C1_6alkyl, C2_6a1kenyl, aminoCi_6alkyl, mercaptoC1_6alkyl, Cl_ 6 alkylthioCi_6alkylene, arylCi_6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alkyl(CO2H)2, -S 03H, C1-6alkylheteroaryl, Ci_6a1kylSeH, C 1-6alkylS(0)CH3, CI -6a1ky1 S (CH3)2', C1 -6a1ky1NHC (0)heterocycle and C 1_6alkylC(0)NH2;
R3 is H or -C(0)(CH2)SH;
N
*(.)( **
A2 is selected from: 111 or ; wherein *
represents where A2 is bound A'; and ** represents where A2 is bound to A3; or wherein A2 is absent; and wherein, m is an integer selected from 1, 2, 3, 4 or 5;
R4 is selected from the group consisting of hydroxyCI _6alkyl, C1_6alky1NHR5, CI _6alkylC(0)0H, C1_ 6alkylNHC(NH)NH2, hydrogen, Ch6alkyl, C2_6a1kenyl, aminoCh6a1ky1, mercaptoC16alkyl, C1_ 6alkylthi o C i_6alkylene , arylCi_6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alky1(CO2H)2, -S 03H, C1_ 6alkylheteroaryl, Ci_6a1kylSeH, C 1-6alkylS(0)CH3, Ci_6a1ky1 S (CH3)2+, C1_6a1ky1NHC (0)heterocycle and Ci_6a1ky1C(0)NH2;
125 is H or -C(0)(CH2)SH;
N
**
A3 is selected from: or ; wherein *
represents where A3 is bound A2; and ** represents where A3 is bound to A4; or wherein A3 is absent; and wherein, o is an integer selected from 1, 2, 3, 4 or 5;
R6 is selected from the group consisting of hydroxyCl_6alkyl, Ci_6a1ky1NHR7, C1_6a1ky1C(0)0H, C1_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6a1kyl, C2_6a1kenyl, aminoCi_6alkyl, mercaptoCi_6alkyl, C1_ 6alkylthi o Ci_olkylene , arylCi_6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alky1(CO2H)2, -S 03H, C1_ 6alkylheteroaryl, Ci_6a1kylSeH, C 1-6alkylS(0)CH3, CI -6alkylS(CH3)2', CI -6alkylNHC(0)heterocycle and Ci_6a1kylC(0)NH2, R7 is H or -C(0)(CH2)SH, N
A4 is selected from: or ; wherein * represents where A4 is bound A3; and ** represents where A4 is bound to the carbonyl group; or wherein A4 is absent;
and wherein, t is an integer selected from 1, 2, 3, 4 or 5;
IV is selected from the group consisting of hydroxyCl_6alkyl, C1_6alkyiNHR9, Ci_6alkylC(0)0H, Ci 6alkviNHC(NH)NH2, hydrogen, Ci_6a1ky1, C2_6a1kenyl, aminoCi_6alkyl, mercaptoC1_6alkyl, Ci 6 alkylthi o C i_6alkylene, arylCi_6alky1, -CH(OH)CH3, -C(0)OH, C i_6alkyl(C
02H)2, -S 03H, C 1-6alkylheteroaryl, Ci_6alkylSeH, C1-6alkylS(0)CH3, C1-6alkylS(CH3)2', C1-6alky1NHC(0)heterocycle and Ci_6alkylC(0)NH2;
R9 is H or -C(0)(CH2)SH;
Rio is selected from thc group consisting of ci_6alkyl, heterocycle, aryl, and hetcroaryl;
or R49 is a group of formula (i);
RADIOPHARMACEUTICALS AND USES THEREOF
FIELD OF THE INVENTION
The present invention relates to the field of radiopharmaceuticals. In particular, the radiopharmaceuticals are capable of selective binding to prostate-specific membrane antigens (PSMA) and can be used in both diagnosis and treatment of cancer types that are accompanied by (over)expression of PSMA. The PSMA radiopharmaceuticals described herein are characterised by a number of advantages over PSMA radiopharmaceuticals known in the art.
BACKGROUND OF THE INVENTION
In 2018, over 1 million of new prostate cancer cases were registered worldwide, rendering the disease the second most frequent malignancy in adult men worldwide (Rawla, World J
Oncol, 2019). Both the incidence and mortality rate of prostate cancer correlate with increasing age, and the average age of diagnosis is about 66 years. Albeit significant regional differences can be discerned, the global mortality rate of prostate cancer relates to about 3.8% of all deaths caused by cancer in men (Jcmal ct al., CA
Cancer J Clin, 2018). Given the often asymptomatic first stages of prostate cancer progression, the regional incidence rates are tightly correlated to both the adoption of screening campaigns, an increase in average life expectancy, but also westernisation of the lifestyle which impacts obesity, physical inactivity, and dietary factors (Baade et al., Mol Nutr Food Res, 2009).
Hence, it is expected that incidence rates will continue to rise up to 2040 (Ferlay et al., Cancer Today, IARC Cancerbase, 2018).
Continuous advancements in the fields of medicine and health sciences are unearthing new diagnostic markers and therapeutic targets to combat diseases. A marker of particular interest in the context of prostate cancer is the enzyme glutamate carboxy-peptidase II, commonly referred to in the art as prostate-specific membrane antigen (PSMA). PSMA is consistently expressed in all types of prostate tissue and highly overexpressed in prostate cancer tissue and it has been demonstrated that PSMA
expression levels are directly correlated to androgen independence, metastasis, and disease progression (Santoni et al., J Biol Regul Homcost Agents, 2014). In view hereof, diagnosis and monitoring of prostate cancer by positron emission tomography (PET) or by single-photon emission tomography (SPECT) of PSMA is increasingly used in clinical settings (Fanti et al., Eur J
Nucl Med Mol Imaging, 2021). Alternatively, the highly selective expression profile of PSMA
translates to PSMA being especially suited as target for a radionuclide therapy of prostate cancer and other malignancies that are accompanied by PSMA (over)expression. In addition to the highly specific (high) expression levels that can be measured for PSMA in (malignant) prostate tissue, PSMA is rapidly internalised by cells upon ligand binding, which leads to a further concentration of the radionuclide molecule inside cells, thus increasing tumour absorbed dose. Consequently, a number of radiopharmaceuticals have been developed that comprise a selective PSMA ligand conjugated to a radiometal which aim to achieve optimal PSMA imaging and/or PSMA radionuclide therapy. So far, in the field of diagnosis the PSMA
targeting PET tracers gained most attraction, while in the field of therapy recent research focussed on Lu-177 and Ac-225 based radiophannaceuticals. However, worldwide nuclear medical infrastructure is far more developed in the field of SPECT. Thus, a theragnostic tandem applying Tc-99m and Re-188 labeled PSMA tracers would be highly desirable ¨ especially since both radionuclides are available from common generator systems which are authorized for medical use in most countries. For pure diagnostic application (SPECT) a number of 99mTc-radiotracers like iPSMA have been developed.
However, particularly in the case of iPSMA, the HYNIC chelator renders "Re-labelling at least difficult and is, thus, not a viable basis for a potential "kit application".
Further, improving the body clearance of the radiopharmaceutical would be equally desirable.
In view hereof, any approach that may facilitate diagnosis and/or improve treatment of prostate cancer is a valuable asset for identifying afflicted men and/or lowering the mortality rate of men diagnosed with prostate cancer.
SUMMARY OF THE INVENTION
Through extensive research and experimentation, the inventors have identified novel PSMA
radiopharmaceuticals or radiothcranostics (radiothcrapeutics or radiodiagnostics) with improved properties vis-à-vis known PSMA radiopharmaccuticals. The radiopharmaceuticals described herein, including but not limited to Technetium-99m (99"'Tc) labeled imaging agents and Rhenium-188 (1 Re) labeled therapeutics/thera(g)nostics, are characterized by structural modifications in the linker region and/or the chelator and have improved pharmacokinetic properties while maintaining a stable "Re/99"1Tc-coordination to the molecule. The pharmacophore presents three carboxylic groups able to interact with the respective side chains of PSMA and an oxygen as part of zinc complexation in the active center. Besides these obligatory interactions, the inventors were able to optimize the lipophilic interactions in the linker region compared to the lead structure 99mTc-EDDA-HYNIC-iPSMA (TLX-598/199mTcifc-TLX-598 ¨ cf. WO 2017/222362). Moreover, the inventors replaced the HYN1C
chelator by N-terminal mercaptoacetyltripeptides, which are (also) capable of coordinating Technetium-99m and Rhenium-188 (in form of the so called "oxo-core"
Tc(V)0/Re(V)0, coordinated towards the three amide bonds and the dcprotonatcd sulfur; reference). In contrast, this type of coordination does not need application of a stabilizing co-ligand (e.g., EDDA) and, thus, represents a simplification of the underlying chemistry. Additionally, the modified radiopharmaceuticals described herein display a good cellular uptake and renal clearance rates. The exemplified 99mTc and 'Re radiopharmaceuticals hence present improved radiopharmaceutical molecules for respectively planar imaging and radionuclide therapy of PSMA positive tumors.
The invention therefore provides thc following aspects:
Aspect 1.
A first aspect of the present invention provides a labeling precursor in the form of a compound of formula (I) or a stereoisomer, or tautomer thereof, II
0 A2¨A3¨A4 HN
\
)O N
HN
0 _____________________________ /C) OH OH
wherein, RI is selected from the group consisting of hydrogen, -C(0)R", c(0)2R12, C(0)NRI2R13, SRI , CI
6alkyl, arylCi_6alkyl, heteroary1C1_6alkyl, heterocycly1C1_6alkyl, aryl, heteroaryl, heterocyclyl; wherein said Ci_6a1ky1, ary1C1_6a1kyl, heteroarylCi_6a1kyl, heterocycly1C1_6a1kyl, aryl, heteroaryl, or heterocyclyl can be unsubstituted or substituted with one or more Z';
N
*
L1 is or ; wherein * represents vvhere L1 is bound to the carbonyl group; and ** represents where Li is bound to Al;
N
* **
* **
IS Ai is or ; wherein * represents where Ai is bound Li;
and ** represents where Al is bound to A2; and wherein, n is an integer selected from 1, 2, 3,4 or 5;
IC is selected from the group consisting of hydroxyC1_6alkyl, C1_6alkylNHR3 C1_6alkylC(0)0H, C1_ 6a1kylNHC(NH)NH2, hydrogen, C1_6alkyl, C2_6a1kenyl, aminoCi_6alkyl, mercaptoC1_6alkyl, Cl_ 6 alkylthioCi_6alkylene, arylCi_6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alkyl(CO2H)2, -S 03H, C1-6alkylheteroaryl, Ci_6a1kylSeH, C 1-6alkylS(0)CH3, CI -6a1ky1 S (CH3)2', C1 -6a1ky1NHC (0)heterocycle and C 1_6alkylC(0)NH2;
R3 is H or -C(0)(CH2)SH;
N
*(.)( **
A2 is selected from: 111 or ; wherein *
represents where A2 is bound A'; and ** represents where A2 is bound to A3; or wherein A2 is absent; and wherein, m is an integer selected from 1, 2, 3, 4 or 5;
R4 is selected from the group consisting of hydroxyCI _6alkyl, C1_6alky1NHR5, CI _6alkylC(0)0H, C1_ 6alkylNHC(NH)NH2, hydrogen, Ch6alkyl, C2_6a1kenyl, aminoCh6a1ky1, mercaptoC16alkyl, C1_ 6alkylthi o C i_6alkylene , arylCi_6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alky1(CO2H)2, -S 03H, C1_ 6alkylheteroaryl, Ci_6a1kylSeH, C 1-6alkylS(0)CH3, Ci_6a1ky1 S (CH3)2+, C1_6a1ky1NHC (0)heterocycle and Ci_6a1ky1C(0)NH2;
125 is H or -C(0)(CH2)SH;
N
**
A3 is selected from: or ; wherein *
represents where A3 is bound A2; and ** represents where A3 is bound to A4; or wherein A3 is absent; and wherein, o is an integer selected from 1, 2, 3, 4 or 5;
R6 is selected from the group consisting of hydroxyCl_6alkyl, Ci_6a1ky1NHR7, C1_6a1ky1C(0)0H, C1_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6a1kyl, C2_6a1kenyl, aminoCi_6alkyl, mercaptoCi_6alkyl, C1_ 6alkylthi o Ci_olkylene , arylCi_6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alky1(CO2H)2, -S 03H, C1_ 6alkylheteroaryl, Ci_6a1kylSeH, C 1-6alkylS(0)CH3, CI -6alkylS(CH3)2', CI -6alkylNHC(0)heterocycle and Ci_6a1kylC(0)NH2, R7 is H or -C(0)(CH2)SH, N
A4 is selected from: or ; wherein * represents where A4 is bound A3; and ** represents where A4 is bound to the carbonyl group; or wherein A4 is absent;
and wherein, t is an integer selected from 1, 2, 3, 4 or 5;
IV is selected from the group consisting of hydroxyCl_6alkyl, C1_6alkyiNHR9, Ci_6alkylC(0)0H, Ci 6alkviNHC(NH)NH2, hydrogen, Ci_6a1ky1, C2_6a1kenyl, aminoCi_6alkyl, mercaptoC1_6alkyl, Ci 6 alkylthi o C i_6alkylene, arylCi_6alky1, -CH(OH)CH3, -C(0)OH, C i_6alkyl(C
02H)2, -S 03H, C 1-6alkylheteroaryl, Ci_6alkylSeH, C1-6alkylS(0)CH3, C1-6alkylS(CH3)2', C1-6alky1NHC(0)heterocycle and Ci_6alkylC(0)NH2;
R9 is H or -C(0)(CH2)SH;
Rio is selected from thc group consisting of ci_6alkyl, heterocycle, aryl, and hetcroaryl;
or R49 is a group of formula (i);
2 3 A A4 <
H N
) _________________________ 0 N
H N
0 _____________________ OH OH
(i) wherein the wavy line ( ) indicates the point of attachment to the S atom and A', A2, A3, and A4 are as defined for structure (I);
each RP is independently selected from the group consisting of C1_6a1ky1, haloCh6alkyl, aryl, haloCi-6alkyl, ary-1C1_6a1kyl, heterocyclyl, heteroaryl;
each R42 is independently selected from the group consisting of hydrogen, C1_6a1kyl, aryl, haloCi_6a1ky1, CH2CC13, CH2OCH3, arylCi_6a1ky1, heterocyclyl, heteroaryl;
each 12_13 is independently selected from the group consisting of hydrogen, C1_6a1ky1, aryl, haloC1_6a1ky1, ary1C1_6a1ky1, heterocyclyl, heteroaryl;
each Z1 is independently selected from the group consisting of -C(0)R",i, nitro, hydroxyl, Ci_ 6a1ky1, aryl, heteroaryl, -SR", _NR12C(0)R13, _C(0)2R12, cyano, -S(0)2R1 , halo, haloCi_6a1kyl, haloCi_ 6a1kyloxy, heterocyclyl, amino, -NR11R12, _C(0)NR12R13, _s(0)Rio, _S(0)2N
R12R13; wherein said CI_ 6alkyl, aryl, can be unsubstituted or substituted with one or more C1_4a1ky1, methoxy, nitro, -C(0)aryl, halo, tri fluorom ethyl, trifluoromethoxy.
Aspect 2.
In a second aspect the present invention provides a labeling precursor in the form of a compound of formula (I) or a stereoisomer, or tautomer thereof, wherein, 121- is selected from the group consisting of hydrogen, -C(0)R11, -C(0)2R12, -C(0)NR12R13, CI_ 6alkyl, ary1C1_6a1ky1, heteroary1C1_6a1ky1, heterocycly1C1_6alkyl, aryl, heteroaryl, heterocyclyl;
preferably is hydrogen, -C(0)R", _C (0)2R12, _C(0)NR12R13, -SR1 , C1_6alkyl, ary1C1_6alkyl, heteroary1C1_6alkyl; preferably R1 is hydrogen, -C(0)R", _c(o)2R12, _C(0)NR12R13, _SRN, C1_6alkyl, aryl Ci_6alkyl ;
wherein said Ci_6alkyl, arylCi_6alkyl, heteroarylCi_6alkyl, heterocycly1C1_6alkyl, aryl, heteroaryl, or heterocyclyl can be unsubstituted or substituted with one or more 7';
preferably said groups are unsubstitutcd or substituted with one, two or three Zl;
N
*
Ll is or ; wherein * represents where 1_,1 is bound to the carbonyl group; and ** represents where 1_,1 is bound to Al;
* **
Al i is or ; wheren * represents where Al is bound Ll;
and ** represents where A1 is bound to A2; and wherein, n is an integer selected from 1, 2, 3, 4 or 5; preferably n is selected from 1, 2, or 3;
R2 is selected from the group consisting of hydroxyC1_6alkyl, C1_6alkylNHR1, C1_6alkylC(0)0H, Cl_ 6a1kylNHC(NH)NH2, hydrogen, C1_6alkyl, C2_6alkenyl, aminoC1_6alkyl, mercaptoC1_6alkyl, Ci_ 6a1kylthi o C1_6alkylene , ary1C1_6a1ky1, -CH(OH)CH3, -C(0)OH, C1_6alkyl(CO2H)2, -S 03H, C1_ 6alkylheteroaryl, C1_6alkylSeH, C1_6alkylS(0)CH3, C1_6alkylS(CH3)2 , C1_6alkylNHC(0)heterocycle and C1_6alkylC(0)NH2; preferably R2 is hydroxyCh6alkyl, C1_6alkylNHR3, C1_6alkyle(0)0H, CI_ 6alkylNHC(NH)NH2, hydrogen, Ci_6alky1, C2_6alkenyl, aminoCi_6alkyl, mercaptoCi_6alkyl, C1_ 6alkylthioC i_6alkylene , -CH(OH)CH3, -C(0)0H, C1_6alkyl(CO2H)2, - S 03H, Ci_6alky1SeH, C1_ 6alkylS(0)CH3, Ci_6alky1S(CH3)2', and C1_6alky1C(0)NH2; preferably R2 is hydroxyCl_6alkyl, CI_ 6alkylNHR3, Ci_6alky1C(0)0H, Ci_6alky1NHC(NH)NH2, hydrogen, C1_6alky1, aminoCi_6alky1, mercaptoC1_6alky1, Ci_6alkylthioCi_6alkylene, -CH(OH)CH3, -C(0)0H, Ci_6a1kyl(CO2H)2, -S03H, Ci_ 6alkylS(0)CH3, Ci_6alkylS(CH3)2 , and Ci_6alkylC(0)NH2; preferably R2 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, C1_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, -S03H, Ci_6a1kylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R3 is H or -C(0)(CH2)SH;
.**
A2 is selected from: or R4 ; wherein * represents where A2 is bound Al; and ** represents where A2 is bound to A3; or wherein A2 is absent; and wherein, m is an integer selected from 1, 2, 3, 4 or 5;
R4 is selected from the group consisting of hydroxyCi_6a1kyl, Ci_6alkylNHR5, C1_6alkylC(0)0H, C1_ 6alkylNHC(NH)NH2, hydrogen, Ci_6a1ky1, C2_6alkenyl, aminoCi_6a1ky1, mercaptoCi_6alkyl, Ci_ 6alkylthi o Ci_6alkylene , ary1C _6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alkyl(CO2H)2, -S 03H, Ci_ 6alkylheteroaryl, Ci_6alkylSeH, Ci_6alkylS(0)CH3, CI _6alkylS(CH3)2', CI
_6alkylNHC(0)heterocycle and Ci_6alkylC(0)NH2; preferably R4 is hydroxyCl_6a1ky1, Ci -6alkylNHR5, Ci_6alkylC(0)0H, CI_ 6alkylNHC(NH)NH2, hydrogen, Ci_6a1ky1, C2_6alkenyl, aminoCi_6a1ky1, mercaptoCL6alkyl, C1_ 6alkylthioCi_6a1ky1ene, -CH(OH)CH3, -C(0)0H, Ci_6a1ky1(CO2H)2, -S03H, Ci_6alky1SeH, C1_ 6alkylS(0)CH3, Ci_6alky1S(CH3)2', and C1_6alky1C(0)NH2; preferably R4 is hydroxyCl_6alkyl, CI_ 6alkylNHR5, Ci_6alky1C(0)0H, Ci_6alky1NHC(NH)NH2, hydrogen, C1_6alky1, aminoCi_6a1ky1, mercaptoCi_6alkyl, Ci_6alkylthioCi_6a1ky1ene, -CH(OH)CH3, -C(0)0H, Ci_6alkyl(CO2H)2, -S03H, C1-6alkylS(0)CH3, Ci_6alkylS(CH3)2 , and Ci_6alkylC(0)NH2; preferably R4 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, C1_6alkyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, -S03H, Ci_6a1kylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R5 is H or -C(0)(CH2)SH;
A3 is selected from: or : wherein * represents where A3 is bound A2; and ** represents where A3 is bound to A4; or wherein A3 is absent; and wherein, o is an integer selected from 1, 2, 3, 4 or 5;
R6 is selected from the group consisting of hydroxyCI _6alkyl, Ci_nalky1NHR7, CI _6alkylC(0)0H, C1_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6alky1, C2_6a1kenyl, aminoCi_6a1ky1, mercaptoCi_6a1ky1, Ci_ 6a1ky1thi o Ci_6alkylene, ary1C _6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alky1(CO2H)2, -S 03H, C1-6alkylheteroaryl, Ci_6a1kylSeH, C 1-6a1ky1S(0)CH3, CI -6alkylS(CH3)2', CI -6alkylNHC(0)heterocycle and C1_6a1kylC(0)NH2; preferably R6 is hydroxyCi_6alkyl, Ci_6a1ky1NHR7, Ci_ealky1C(0)0H, C1_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6alky1, C2_6alkenyl, aminoCi_6a1ky1, mercaptoCi_6a1ky1, Ci_ 6a1ky1thioCi_6a1kylene, -CH(OH)CH3, -C(0)0H, Ci_6a1ky1(CO2H)2, -S03H, Ci_6a1ky1SeH, CI_ 6alkylS(0)CH3, Ci_6a1ky1S(CH3)2', and C1_6a1ky1C(0)NH2; preferably R6 is hydroxyCl_6alky1, CI_ 6alkvIN HR7, C1_6a1ky1C (0)0H, C1_6alky1N HC (N H)N H2, hydrogen, C1_6a1kyl, amino Ci_6alkyl, mercaptoCi_6alkyl, Ci_6a1ky1thioCi_6a1kylene, -CH(OH)CH3, -C(0)0H, Ci_6a1ky1(CO2H)2, -S03H, C1-6alkylS(0)CH3, Ci_6a1ky1S(CH3)2 , arid Ci_6alkylC(0)NH2; preferably R6 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, ary1C1_6alkyl, -CH(OH)CH3, -C(0)0H, -S03H, C1_6a1ky1heteroary1, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R7 is H or -C(0)(CH2)SH;
N **
A4 is selected from: or ; wherein * represents where A' is bound A3; and ** represents where A4 is bound to the carbonyl group; or wherein A4 is absent;
and wherein, t is an integer selected from 1, 2, 3, 4 or 5;
R8 is selected from the group consisting of hydroxyCl_6alky1, Ci_6a1ky1NHR9, C1_6alky1C(0)0H, C1_ 6alky1NHC(NH)NH2, hydrogen, C1_6alky1, C2_6alkenyl, aminoCi_6alkyl, mercaptoCi_6alkyl, Ci_ 6alkylthioCi_oalkylene, ary1C -CH(OH)CH3, -C(0)OH, Ci_6alky1(CO2H)2, -S 03H, C1-6alkylheteroaryl, Ci_6alkylSeH, C 1-6alkylS(0)CH3, Ci -6alkylS(CH3)2', Ci -6alkylNHC(0)heterocycle and Ci_6a1kylC(0)NH2; preferably R8 is hydroxyCi_nalkyl, Ci_6a1ky1NHR9, Ci_6alky1C(0)0H, Ci_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6alky1, C2_6alkenyl, aminoCi_6a1ky1, mercaptoCi_6a1ky1, Ci_ 6a1kylthioCi_6a1ky1ene, -CH(OH)CH3, -C(0)0H, C1_6alkyl(CO2H)2, Ci_6alky1SeH, Ci_ 6a1kylS(0)CH3, Ci_6alky1S(CH3)2', and Ci_6alky1C(0)NH2; preferably R' is hydroxyCi_6alkyl, Ci_ 6 alkylNHR9, Ci_6alkylC (0)0H, Ci_6alky1NHC(NH)NH2, hydrogen, C1_6alkyl, amino Ci_6alkyl, mercaptoCi_6alky1, Ci_6a1kylthioCi_6alkylene, -CH(OH)CH3, -C(0)0H, Ci_6a1kyl(CO2H)2, -S03H, C1-6a1kylS(0)CH3, Ci_6alkylS(CH3)2 , and Ci_6alky1C(0)NH2; preferably le is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6alkyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylC1_6alkyl, -CH(OH)CH3, -C(0)0H, -S03H, Ci_6a1ky1heteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R9 is H or -C(0)(CH2)SH;
R" is selected from the group consisting of Ci 6a1ky1, heterocycle, aryl, and heteroaryl;
or RI is a group of formula (i);
OH
-A
H N
__________________________ 0 _______ N
H
0 ____________________ OH OH
(1) wherein the wavy line ( ) indicates the point of attachment to the S atom and 12, Al-, A2, A3, and A4 are as defined for structure (I); preferably R" is C1_6alkyl, or a group of formula (i);
each Ri is independently selected from the group consisting of Ci_6alky1, haloCi_6alkyl, aryl, ary1C1-6alkyl, heterocyclyl, heteroaryl; preferably each RH is Ci_6alkyl, haloCi_6a1ky1, aryl, and arylCi_6a1ky1;
each 1142 is independently selected from the group consisting of hydrogen, Ci_oalkyl, aryl, haloCi_6alky1, CH2CC13, CH2OCH3, ary1Ci_6a1kyl, heterocyclyl, heteroaryl; preferably each R42 is hydrogen, Ci_6a1ky1, aryl; CH2CC13, CH2OCH3;
each R43 is independently selected from the group consisting of hydrogen, Ci_6alkyl, aryl, haloCi_6a1ky1, arylCi_6alkyl, heterocyclyl, heteroaryl; preferably each R42 is hydrogen, Ci_6alkyl, haloCi_6alkyl, aryl, and arylCi_6alkyl;
each Z1 is independently selected from the group consisting of -0R11, -C(0)R11, nitro, hydroxyl, CI_ 6a1ky1, aryl, heteroaryl, -SR", _NR12c(0)¨rc 137C(0 _ )2R12, cyano, -S(0)2R1', halo, haloCi_6a1ky1, haloCi-6alkyloxy. heterocyclyl, amino, -NR11-."K _ 12, C(0)NR12R13, _s(or _ 10, K
S(0)2N Ri2R13; preferably each Z1 is -OR", -C(0)R11, nitro, hydroxyl, Ci_6alkyl, aryl, heteroaryl, -SR", -NR12C(0)R13, -C(0)2R12, cyano, -S(0)2R1 , haloCi_6alkyl, amino, -C(0)NR12R13, -S(0)R1 , -S(0)2N
R12R13; preferably each Z1 is -OR", -C(0)R11, nitro, hydroxyl, Ci_6alkyl, aryl, heteroaryl, -SR", -NR12C(0)R13, -C(0)2R12, cyano, -S(0)2R1 , haloCi_6a1ky1;
wherein said Ci_6alky1, or aryl, can be unsubstituted or substituted with one or more Ci_4alkyl, methoxy, nitro, -C(0)aryl, halo, trifluoromethyl, trifluoromethoxy; preferably said groups can be unsubstituted or substituted with one, two or three Ci_4a1ky1, methoxy, nitro, -C(0)aryl, halo, trifluoromethyl, trifluoromethoxy; preferably said groups can be unsubstituted or substituted with one or more Chaalkyl, methoxy, nitro, -C(0)aryl, halo;
Aspect 3.
In a third aspect the present invention provides a labeling precursor in the form of a compound of any one of formula (IA), (IB), (IC) or (ID):
=-..........õ--H
N y A
''IrL N 'Ir-S
H R
(IA) .....--.....z.õ,-H N
y H H H
y OyL, N N N R
N S
0 H id.
(IB) o o H
N0 \ 0 0 H
(IC) H N
H N-"LO 0 0 N Li OH yO 0 H
(ID) wherein LI, Al, A4, RI, R4, R6 and R8 have the same meaning as that defined herein.
Aspect 4. According to particular embodiments, the present invention provides a compound of formula (I), wherein, R2 is selected from the group consisting of -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)1\11-12, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, -s 03H, Ci_6alkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R4 is selected from the group consisting of -CH2OH, -CH2NHR5, -CH2C(0)0H, -(CH2)3NHC(NH)1\11-12, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6a1ky1, -CH(OH)CH3, -C(0)0H, -S03H, Ci_6alkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R6 is selected from the group consisting of -CH2OH, -CH2NHR2, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6alkyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alky1, -CH(OH)CH3, -C(0)0H, -S 03H, Croalkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)Nfl2:
R8 is selected from the group consisting of -CH2OH, -CH2NHIe, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6alkyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alky1, -CH(OH)CH3, -C(0)0H, -S 03H, Croalkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)Nfl2:
preferably wherein. R1 is hydrogen, acetyl or -SR", wherein Rth is a group of formula (i).
Aspect 5.
According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, R1 is selected from the group consisting of hydrogen, -C(0)R11, -C(0)2R12, -C(0)N1e2R13, -SR", C1-6 alkyl, ary1C1_6a1kyl, heteroarylCi_6alkyl, heterocyclylCi_6alkyl, aryl, heteroaryl, heterocyclyl;
preferably re is hydrogen, C1_6alkylcarbony1, ary1Ci_6alkylcarbonyl, arylcarbonyl, C1_ 6alkyloxycarbonyl, arylCi_6alkyloxycarbonyl, aryloxycarbonyl, heteroaryloxy, aminocarbonyl, mono-Ci_6alkylaminocarbony1, di-Ci_6alkylaminocarbonyl, mono-arylaminocarbonyl, di-alrylaminocarbonyl, Ci_6alkylthio, arylCi_6a1ky1thio, arylthio, C1_6alkyl, ary1Cr6alkyl, heteroarylCi_6alkyl, heterocycly1C1_ 6a1ky1, aryl, heteroaryl, heterocyclyl; preferably R1 is hydrogen, Ci_6alkylcarbonyl, arylCI_ 6alkylcarbonyl, arylcarbonyl, Ci_6alkyloxycarbonyl, arylC1_6alkyloxycarbonyl, aryloxycarbonyl, mono-Ci_6alkylaminocarbonyl, di-Cr6a1kylaminocarbonyl, Ci_6alkylthio, arylCi_6alkylthio, arylthio, Ci_6alky1, arylCalkyl, heteroarylCi_nalkyl, hetcrocycly1C1-6alkyl, aryl, heteroaryl, heterocycly1; preferably le is hydrogen, C1_6a1kylcarbonyl, ary1C1_6alkylcarbonyl, arylcarbonyl, Ci_6alkyloxycarbonyl, arylCi_ 6alkyloxycarbonyl, aryloxycarbonyl, Ci_6a1kylthio, ary1C1_6alkylthio, arylthio, C1_6alkyl, arylCi_6a1ky1;
preferably le is hydrogen, C1_4a1ky1carbony1, arylCi_4alkylcarbonyl, arylcarbonyl, CI -4 alkyloxycarbonyl, aryl C i_4alkyloxycarbonyl, aryloxycarbonyl, C
i_4alkylthio, aryl C i_4alkylthio, arylthio, C 1_4a1kyl, aryl C i_4alkyl ;
wherein said groups can be unsubstituted or substituted with one or more Z1;
preferably said groups are unsubstituted or substituted with one, two or three Z1.
Aspect 6.
According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, R2 is selected from the group consisting of hydroxyCl_6alkyl, C1_6alkylNHR3, C1_6alkylC(0)0H, CI_ 6alkylNHC(NH)NH2, hydrogen, Cr6alkyl, C2_6alkenyl, a1ninoCi_6alkyl, mercaptoCr6alkyl, C1_ 6 alkylthi o C
-CH(OH)CH3, -C(0)OH, C 1_6alkyl(CO2H)2, -S 03H, Ci_ 6alkylheteroaryl, Ci_6alkylSeH, C 1-6alky1S(0)CH3, CI -6alkylS(CH3)2', CI -6alky1NHC(0)heterocycle and Ch6alky1C(0)NI-12; preferably R2 is hydroxyCl_6alky1, Ci -6alkylNHR3, Ci_6a1kylC(0)0H, C1_ 6a1kylNHC(NH)NH2, hydrogen, Ci_6alkyl, aminoCi -6alkyl, mercaptoC 1-6alkyl, Ci_6alkylthioCi_ 6alkylene, -CH(OH)CH3, -C(0)0H, C1_6alkyl(CO21-1)2, -S03H, C1_6a1ky1SeH, Ci_6alkylS(0)CH3, C1_ 6a1kylS(CH3)2 , and Ci_6alkylC(0)N1-12; preferably R2 is hydroxyCl_4alkyl, C1_4alkylNHR3, C1_ 6alkylC( 0)0H, Ci4a1ky1NHC(NH)NH2, hydrogen, Ci_4alky1, aminoCi_6a1ky1, mercaptoCi_6a1ky1, CI_ 4a1kylthioCi_4alky1ene, -CH(OH)CH3, -C(0)0H, C1_4alky1(CO21-1)2, -S03H, Ci_4alkylSeH, C1_ 4a1kylS(0)CH3, Ci_e4alkylS(CH3)2', and Ci4a1ky1C(0)N112; preferably R2 is hydroxyCl_4a1kyl, C1_ 4a1kylNHR3, Ci_6a1ky1C (0)0H, Ci_4alky1NHC(NH)N1-12, hydrogen, C1_4alky1, amino CI -6alkyl, -CH(OH)CH3, -C(0)0H, Ci_4alkyl(CO2H)2, -S03H, Ci_4alky1S(0)CH3, Ci_e4alkylS(CH3)2', and C1_ 4a1kylC(0)NII2; preferably R2 is -CI12011, -(CII2)3NIIC(NII)NII2, hydrogen, Ci_6a1kyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)OH, -S 03H, Ci -6alkylhete roaryl, -CH2C(0)N1-12, and -(CH2)2C (0)NH2 Aspect 7.
According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, R4 is selected from the group consisting of hydroxyCl_6alkyl, Ci_6alkylNH125, C1_6alkylC(0)0H, C1_ 6a1kylNHC(NH)NH2, hydrogen, C1_6alky1, C2_6a1kenyl, aminoCi_6alkyl, mcrcaptoCi_6alkyl, C1_ 6a1kylthi o Ci_olkylene , arylCi_6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alkyl(CO21-1)2, -S 03H, C1_ 6alkylheteroaryl, Ci_6alkylSeH, C 1-6alky1S(0)CH3, CI -6alkylS(CH3)2t Ci_6alky1NHC(0)heterocycle and Ci_6alkylC(0)NI12; preferably R4 is hydroxyCi_6alky1, Ci -6alkylNHR5, Ci_6alkylC(0)0H, CI_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6a1kyl, aminoCi_6alkyl, mercaptoCi_6alkyl, Ci_6a1ky1thioCi_ 6alkylene, -CH(OH)CH3, -C(0)0H, Ci_6alkyl(CO2H)2, -S03H, C1_6alky1SeH, Ci_6alkylS(0)CH3, CI_ 6a1kylS(CH3)2% and Ci_6a1kylC(0)NF12; preferably R4 is hydroxyCl_4a1kyl, Ci_4a1kylNHR5, CI
-6a1kylC(0)0H, Ci4a1kylNHC(NH)N1-12, hydrogen, Ci_4alkyl, aminoCi_6alky1, mercaptoC1_6a1kyl, C1_ 4a1kylthioCi_4alky1ene, -CH(OH)CH3, -C(0)0H, C1_4alky1(CO21-1)2, -S03H, Ci_4alkylSeH, CI_ 4a1kylS(0)CH3, Ci_e4alkylS(CH3)2', and Ci_4a1ky1C(0)N1-12; preferably le is hydroxyCl_4alkyl, C1_ 4a1kylNHR5, Ci_6a1ky1C(0)0H, Ci_4alky1NHC(NH)Nfl2, hydrogen, C1_4alky1, aminoC1_6alkyl, -CH(OH)CH3, -C(0)0H. C1_4alkyl(CO2H)2, -S03H, Ci_4alky1S(0)CH3, Ci_e4alkylS(CH3)2t and C1-4a1kylC(0)NH2; preferably R4 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ch6a1kyl, -(C1-12)20H, -(CH2)4NI-12, -CH2SH, -(CF12)2SCI-L, ary1Ci_6a1kyl, -CH(OH)CH3, -C(0)0H, -S03H, Ci_6alkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NR2.
Aspect 8.
According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, R6 is selected from the group consisting of hydroxyCl_6a1kyl, Ci_6alkylNHR7, C1_6alkylC(0)0H, C1_ 6alkylNHC(NH)NH2, hydrogen, Ci_6alky1, C2_6a1kenyl, aminoC1_6alkyl, mercaptoC1_6alkyl, C1_ 6a1kylthi o Ci_olkylene , arylCi_6alky1, -CH(OH)CH3, -C(0)OH, Ci_6alkyl(CO2H)2, -S 03H, Ci_ 6alkylheteroaryl, Ci_6alkylSeH, C 1-6alky1S(0)CH3, Ci -6alkylS(CH3)2', Ci -6alkylNHC(0)heterocycle and Ci_6alkylC(0)NH2; preferably R6 is hydroxyCi_6alkyl, Ci -6alkylNHR7, Ci_6alkylC(0)0H, Ci_ 6alkylNHC(NH)NH2, hydrogen, Ci_6alkyl, aminoCi -6alkyl, mercaptoC 1-6alkyl, Ci_6alkylthioCi_ 6a1ky1ene, -CH(OH)CH3, -C(0)0H, Ci_6alkyl(CO2H)2, -S03H, Ci_6alkylSeH, Ci_6alkylS(0)CH3, Ci_ 6alkylS(CH3)2', and Ci_6alkylC(0)NH2; preferably R6 is hydroxyC1_4alkyl, Ci_4alkylNHR7, Ci_ 6a1kyl C ( 0)0H, Ci_4alkylNHC(NH)NH2, hydrogen, Ci_4alkyl, amino CI -6alkyl, mercaptoCi_6a1kyl, CI_ 4a1kylthioC1_4a1ky1ene, -CH(OH)CH3, -C(0)0H, C1_4alky1(CO2H)2, -S03H, Ci_4alkylSeH, Ci_ 4alkylS(0)CII3, Ci_e4alkylS(CII3)2', and Ci_4alky1C(0)NII2; preferably R6 is hydroxyC1_4alkyl, Ci_ 4a1kylNHR7, Ci_6a1ky1C(0)0H, Ci_4alky1NHC(NH)NH2, hydrogen, C1_4alky1, aminoCi_6alkyl, -CH(OH)CH3, -C(0)0H, Ci_4alkyl(CO2H)2, -S03H, Ci_4alky1S(0)CH3, Ci_e4alkylS(CH3)2% and C1-4alkylC(0)NH2; preferably R4 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1kyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, -s 03H, Ci_6alkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2.
Aspect 9. According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, R8 is selected from the group consisting of hydroxyCl_6a1kyl, C1_6alkylNHR9, C1_6alkylC(0)0H, CI_ 6a1kylNHC(NH)NH2, hydrogen, Ci_6alky1, C2_6a1kenyl, aminoCi_6alkyl, mercaptoC1_6alkyl, Ci_ 6alkvlthi 0 Ci_6alkylene , ary1C _6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alkyl(C
0211)2, -S 03H, Ci-6alkylheteroaryl, Ch6alkylSeH, Ci_6alkylS(0)CH3, Ci_6alkylS(CH3)2 , Ci_6alky1NHC(0)heterocycle and Ci_6a1kylC(0)NH2; preferably R8 is hydroxyCl_6alkyl, Ci_6a1kylNHR9, Ci_6a1kylC(0)0H, CI_ 6a1kylNHC(NH)NH2, hydrogen, Ci_6alkyl, aminoCi -6alkyl, mercaptoC1_6alkyl, Ci_6alkylthioCi_ 6alkylene, -CH(OH)CH3, -C(0)0H, Ci_6alkyl(CO2H)2, -S03H, C1_6a1ky1SeH, Ci_6alkylS(0)CH3, CI_ 6a1kylS(CH3)2', and Ci_6alkylC(0)NH2; preferably 128 is hydroxyCi_4alkyl, Ci_4alkylNHR9, C1-6alkylC(0)0H, Ci4a1kylNHC(NH)NH2, hydrogen, Ci_4alkyl, aminoC1_6alky1, mercaptoCi_6a1kyl, 4a1kylthioCi_4alky1ene, -CH(OH)CH3, -C(0)0H, Ci_4alky1(CO2H)2, -S03H, Ci_4alkylSeH, Ci_ 4alkylS(0)CH3, Ci_e4alkylS(CH3)2 , and Ci_4alky1C(0)NH2; preferably R8 is hydroxyCi_4alkyl, Ci_ 4a1kylNHIV, C1_6alky1C(0)0H, C1_4alky1NHC(NH)NH2, hydrogen, C1_4a1ky1, aminoCi alkyl, -CH(OH)CH3, -C(0)0H. Ci_4a1kyl(CO2H)2, -S03H, Ci_4a1ky1S(0)CH3, Ci_e4a1ky1S(CH3)2', and Ci_ 4a1kylC(0)NH2; preferably R8 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1kyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, -S 03H, Ci_oalkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2.
Aspect 10. According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, each Z1 is independently selected from the group consisting of -0R11, -C(0)R11, nitro, hydroxyl, C1_ 6a1ky1, aryl, heteroaryl, -SR", _NR12c(o)R13, _C(0)2R12, cyano, -S(0)2R1 , halo, haloCi_6a1kyl, haloCi-6alkyloxy, heterocyclyl, amino, -NR11R12, _C(0)NRI2R13, _s(0)Rio, _S(0)2NR12R13; preferably Z1 is C1_ 6alkyloxy, ary1Ci_6a1kyloxy, aryloxy, heteroaryloxy, heterocyclyloxy, Ci_6alkylcarbonyl, arylCi_ 6a1ky1carb0ny1, arylcarbonyl, nitro. hydroxyl, C1_6alkyl, aryl, heteroaryl, C1_6a1kylthio, arylCi_6alkylthio, arvlthio, Ci_6a1ky1carbony1amino, arylCi_6alkylcarbonylamino, arylcarbonylamino, hydroxycarbonyl, CI 6alkyloxycarbonyl, arylCi6alkyloxycarbonyl, aryloxycarbonyl, cyano, C16a1ky1su1fony1, arylCI
oalkylsulfonyl, arylsulfonyl, halo, haloCi_6alky1, haloCi_oalkyloxy, heterocyclyl, amino, mono-C1_ 6alkylamino, di-Ci_6alkylamino, mono-arylamino, di-arylamino; preferably Z1 is C1_6alkyloxy, aryloxy, C1_6alkylcarbonyl, arylcarbonyl, nitro, hydroxyl, Ci_6alkyl, aryl, heteroaryl, Ci_6alkylthio, arylthio, CI_ 6alkylcarbonylamino, ary1C1_6alkylcarbonylamino, arylcarbonylamino, hydroxycarbonyl, CI_ 6alkyloxycarbonyl, aryloxycarbonyl, cyano, C1_6alkylsulfonyl arylsulfonyl, halo, haloCi_6alkyl, haloCi_ 6a1kv1oxy, heterocyclyl, amino, mono-Ci_6alkylamino, di-C1_6alkylamino;
preferably Z1 is Ci_4alky1oxy, aryloxy, C1_4a1ky1carb0ny1, arylcarbonyl, nitro, hydroxyl, C1_4a1ky1, aryl, heteroaryl, C1_4a1ky1thio, arvlthio, Ci_4alkylcarbonylamino, arylC1_4alkylcarbonylamino, arylcarbonylamino, hydroxycarbonyl, Ci_6alkyloxycarbonyl, aryloxycarbonyl, cyano, Ci_4alkylsulfonyl arylsulfonyl, haloCi_4alkyl, mono-CI_ 4a1ky1amin0, di-C1_4alkylamino;
wherein said Ci_6alkyl, or aryl, can be unsubstituted or substituted with one or more Ci_4alkyl, methoxy, nitro, -C(0)aryl, halo, trifluoromethyl, trifluoromethoxy; preferably said groups can be unsubstituted or substituted with one, two or three Ci_4alkyl, methoxy, nitro, -C(0)aryl, halo, trifluoromethyl, trifluoromethoxy.
Aspect 11. A solvate, hydrate, salt or prodrug of the compound of any one of aspects 1 to 10.
Aspect 12. Another aspect of the present invention provides a metal complex of a compound as defined herein (also called labeling precursor) such as the ones defined in any one of aspects 1 to 11, and an element of Group VII of the Periodic Table. Preferably, said element is a radionuclide, more preferably the element is "mTc or ''Re or 16Re.
Aspect 13. Yet another aspect of the present invention relates to a pharmaceutical composition comprising one or more pharmaceutically acceptable excipients and a metal complex as defined in the previous aspects.
Aspect 14. According to another aspect, the present invention also encompasses a metal complex as defined hereinabove or a pharmaceutical composition as defined hereinabove, for use as a medicament.
Aspect 15. According to yet another aspect, the present invention also encompasses a metal complex according to aspect 12 or a pharmaceutical composition according to aspect 13, for use in the treatment or prevention of cancer. In a preferred embodiment of said aspect, the radionuclide used for therapeutic use is 188Re or 186Re.
Aspect 16. According to yet another aspect, the present invention also encompasses a metal complex according to aspect 12, or a pharmaceutical composition according to aspect 13, for use as a radiodiagnostic agent for use in in-vivo imaging or detection of tumor or cancer cells or of in-vivo diagnosis of cancer in a subject. Preferred imaging methods are: positron emission tomography (PET), PET computed tomography (PET-CT) or single-photon emission tomography (SPECT).
In a preferred embodiment of said aspect, the radionuclide used for imaging is 99mTc.
Aspect 17. The metal complex or pharmaceutical composition for use according to aspect 15 or 16, wherein said cancer is a PSMA-expressing cancer or tumor.
Aspect 18. The metal complex or pharmaceutical composition for use according to aspect 17, wherein said cancer is selected from the group consisting of: conventional renal cell cancer, transitional cell of the bladder cancer, non-small-cell lung cancer, testicular-embryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer, preferably prostate cancer.
Aspect 19. A method of treating or preventing cancer in a subject comprising administering a therapeutically effective amount of the metal complex according to aspect 12, or a pharmaceutical composition according to aspect 13 to said patient. In a preferred embodiment of said aspect, the radionuclide used for therapeutic use is 188Rc or H6Re.
Aspect 20. A method of in-vivo imaging or detection of tumor or cancer cells or of in-vivo diagnosis of cancer in a subject, comprising administering a suitable amount of the metal complex according to aspect 12, or a pharmaceutical composition according to aspect 13 to said patient and visualizing said metal complex using an in-vivo radio-imaging method.
Preferred imaging methods are:
positron emission tomography (PET), PET computed tomography (PET-CT) or single-photon emission tomography (SPECT). In a preferred embodiment of said aspect, the radionuclide used for imaging is 99mTc.
Aspect 21. The method according to aspect 19 or 20, wherein said cancer is a PSMA-expressing cancer or tumor, more preferably wherein said cancer is selected from the group consisting of:
conventional renal cell cancer, transitional cell of the bladder cancer, non-small-cell lung cancer, testicular-embryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer, preferably prostate cancer.
Aspect 22. The present invention also encompasses a radiolabelling kit comprising:
- the labelling precursor (or compound) as defined hcrcinabovc, - a suitable buffering system, preferably selected from the group consisting of: phosphate buffers, acetate buffers, formate buffers; and HEPES buffers, more preferably phosphate buffers; even more preferably a sodium-phosphate buffer; and - a suitable reducing agent, enabling the reduction of the pertechnetate/perrhenate to a suitable oxidation state for coordination, most likely: Tc(V)0/Re(V)0, such as but not limited to: ascorbic acid, sodium borohydride, sodium dithionite, phosphines such as TCEP, and stannous chloride (Tin(II)chloride), preferably stannous chloride most preferably stannous chloride (tin(11)chloride).
Aspect 23. The radiolabelling kit according to aspect 22, wherein said compound and buffer are present in one or more vials, preferably glass vials, more preferably siliconized vials such as borosilicate glass vials.
Aspect 24. The radiolabelling kit according to aspect 22 or 23, wherein said compound and/or buffer arc present in lyophilised form.
Aspect 25. In some embodiments of the kit of any one of aspects 22 to 24, the reducing agents are selected from the group consisting of: ascorbic acid, sodium borohydride, sodium dithionite, phosphines such as TCEP, and stannous chloride (Tin(II)chloride), preferably stannous chloride.
Aspect 26. The radiolabelling kit according to any one of aspects 22 to 25, wherein said kit also comprises a suitable anti-oxidant agent such as but not limited to: sodium ascorbate/ascorbic acid mixtures, sodium borohydride, sodium dithionite, and stannous chloride.
Aspect 27. The radiolabelling kit according to any one of aspects 22 to 26, wherein said kit also comprises a suitable auxiliary agents or ligands enabling the protection against reoxidation of Tc(V)0/Re(V)0 as competing reaction to coordination, such as but not limited to: tartrate, citrate or glucoheptonate.
Aspect 28. Additionally sequestering agents competing with the chelator for radiometal impurities can be present as well in the kit. Preferably, such sequestering agents are selected from:, mono-, di-, oligo-, or polysaccharides, polynucleate agents, glucoheptonate, tartrate salts and citrate salts.
Aspect 29. In some embodiments, the kit according to any one of aspects 22 to 28 can also include a stabilizer enabling the storage of the kit known in the art, and/or further excipients such as lyophilization agents, matrix reagents or solubilizers known in the art.
Aspect 30. In yet another embodiment, the present invention also provides for a method of radiolabelling a compound or labelling precursor according to any one of aspects 1 to 11, comprising the steps of:
- providing a compound or labelling precursor according to any one of aspects 1 to 11, - providing a suitable buffering system - providing a radionuclide, preferably selected from 99'Tc or "Re and 186Re - providing a suitable reducing agent - mixing all components at a suitable pH and allowing the complexation of the radionuclide and labelling precursor to occur, thereby obtaining a radiolabelled compound.
Aspect 31. The method of aspect 30, wherein said buffering system is selected from the group consisting of: phosphate buffers, acetate buffers, formate buffers, and HEPES
buffers, more preferably phosphate buffers, even more preferably a sodium-phosphate buffer.
Aspect 32. The method of aspects 30 or 31, wherein when the radionuclide used is 99mTc, the precursor and buffer are mixed and a suitable amount of pertechnetate is eluated in saline from a molybdenum-99 (99Mo/99Tc) generator into said mixture. Preferably, the pH of said mixture is set at between 2 and 12 preferably between 7 to 10, and preferably, the temperature of the mixture is kept between 20 and 130 C , preferably from about 20 to 98 C for about 2 to 60 minutes preferably 5 to 15 minutes.
Aspect 32. The method of any one of aspects 30 to 31, wherein when the radionuclide used is "'Re, the precursor and buffer are mixed and a suitable amount of Rhenium is eluted in saline from a tungsten-188wr /188Re) generator into said mixture (with or without postprocessing of the generator eluate). Preferably, the pH is set at between 2 and 9 and the mixture is heated at about 95 to 99 C for about 5 to 60 minutes.
Aspect 33. The method of any one of aspects 30 to 32, wherein when the radionuclide used is 'Re, the precursor and buffer are mixed and a suitable amount of Rhenium-186 is produced from a cyclotron or reactor and added into said mixture. Preferably, the pH is set at between 2 and 12, preferably between 2 and 9 and the temperature of the mixture is kept between 20 and 130 C, preferably from about 20 to 98 C for about 5 to 60 minutes.
Aspect 34. Use of the metal complex according to aspect 12, or a pharmaceutical composition according to aspect 13 for the manufacturing of a medicament for treating or preventing cancer in a subject. In a preferred embodiment of said aspect, the radionuclide used for therapeutic use is 188Re or 186Re.
Aspect 35. Use of the metal complex according to aspect 12, or a pharmaceutical composition according to aspect 13 for the manufacturing of a medicament for in-vivo imaging or detection of tumor or cancer cells or of in-vivo diagnosis of cancer in a subject. Preferred imaging methods are: positron emission tomography (PET), PET computed tomography (PET-CT) or single-photon emission tomography (SPECT). In a preferred embodiment of said aspect, the radionuclide used for imaging is 99mTc.
Aspect 36. The method according to aspect 34 or 35, wherein said cancer is a PSMA-expressing cancer or tumor, more preferably wherein said cancer is selected from the group consisting of:
conventional renal cell cancer, transitional cell of the bladder cancer, non-small-cell lung cancer, testicular-embryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer, preferably prostate cancer.
The above and further aspects and preferred embodiments of the invention are described in the following sections and in the appended claims. The subject matter of the appended claims is hereby specifically incorporated in this specification.
BRIEF DESCRIPTION OF THE FIGURES
The following description of the figures of specific embodiments of the invention is merely exemplary in nature and is not intended to limit the present teachings, their application or uses Figure 1 represents photographs obtained using planar imaging technique. The planar imaging photographs show LNCaP tumor bearing mice that have been injected with exemplary compounds according to the invention. An activity standard (approx. 1 MBq of the respective tracer, indicated with an arrow) was placed next to the mice as a control of the imaging.
DETAILED DESCRIPTION
As used herein, the singular forms "a", "an", and "the" include both singular and plural referents unless the context clearly dictates otherwise.
The terms "comprising", "comprises" and "comprised of' as used herein are synonymous with "including", "includes" or "containing", "contains", and are inclusive or open-ended and do not exclude additional, non-recited members, elements or method steps. The terms also encompass "consisting of' and "consisting essentially of', which enjoy well-established meanings in patent terminology.
The recitation of numerical ranges by endpoints includes all numbers and fractions subsumed within the respective ranges, as well as the recited endpoints. This applies to numerical ranges irrespective of whether they are introduced by the expression "from... to ..." or the expression "between.., and... or another expression.
The terms "about" or "approximately" as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, are meant to encompass variations of and from the specified value, such as variations of +1-10% or less, preferably +/-5% or less, more preferably +1-1% or less, and still more preferably +/-0.1% or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier "about" or "approximately" refers is itself also specifically, and preferably, disclosed.
Whereas the terms "one or more" or "at least one", such as one or more members or at least one member of a group of members, is clear per se, by means of further exemplification, the term encompasses inter alict a reference to any one of said members, or to any two or more of said members, such as, e.g., any >3, >4, >5, >6 or >7 etc. of said members, and up to all said members. In another example, "one or more" or "at least one" may refer to 1, 2, 3, 4, 5, 6, 7 or more.
The discussion of the background to the invention herein is included to explain the context of the invention. This is not to be taken as an admission that any of the material referred to was published, known, or part of the common general knowledge in any country as of the priority date of any of the claims.
Throughout this disclosure, various publications, patents and published patent specifications are referenced by an identifying citation. All documents cited in the present specification are hereby incorporated by reference in their entirety. In particular, the teachings or sections of such documents herein specifically referred to are incorporated by reference.
Unless otherwise defined, all terms used in disclosing the invention, including technical and scientific terms, have the meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. By means of further guidance, term definitions are included to better appreciate the teaching of the invention. When specific terms are defined in connection with a particular aspect of the invention or a particular embodiment of the invention, such connotation or meaning is meant to apply throughout this specification, i.e., also in the context of other aspects or embodiments of the invention, unless otherwise defined. For example, embodiments directed to products are also applicable to corresponding features of methods and uses.
In the following passages, different aspects or embodiments of the invention are defined in more detail.
Each aspect or embodiment so defined may be combined with any other aspect(s) or embodiment(s) unless clearly indicated to the contrary. In particular, any feature indicated as being preferred or advantageous may be combined with any other feature or features indicated as being preferred or advantageous.
Reference throughout this specification to "one embodiment", "an embodiment"
means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment of the present invention. Thus, appearances of the phrases -in one embodiment- or "in an embodiment" in various places throughout this specification are not necessarily all referring to the same embodiment. Furthermore, the particular features, structures or characteristics may be combined in any suitable manner, as would be apparent to a person skilled in the art from this disclosure, in one or more embodiments. Furthermore, while some embodiments described herein include some but not other features included in other embodiments, combinations of features of different embodiments are meant to be within the scope of the invention, and form different embodiments, as would be understood by those in the art. For example, in the appended claims, alternative combinations of claimed embodiments are encompassed, as would be understood by those in the art.
When describing the present invention, the terms used are to be construed in accordance with the following definitions, unless a context dictates otherwise.
Whenever the term -substituted" is used herein, it is meant to indicate that one or more hydrogen atoms on the atom indicated in the expression using "substituted- is replaced with a selection from the indicated group, provided that the indicated atom's normal valence is not exceeded, and that the substitution results in a chemically stable compound, i.e. a compound that is sufficiently robust to survive isolation from a reaction mixture.
Where groups can be substituted, such groups may be substituted with one or more, and preferably one, two or three substituents. Preferred substituents may be selected from but not limited to, for example, the group comprising halo, hydroxyl, alkyl, alkoxy, trifluoromethyl, trifluoromethoxy, cycloalkyl, aryl, arylalkyl, heterocyclyl, heteroaryl, cyano, amino, nitro, carboxyl, and mono-or dialkylamino.
The term -halo" or -halogen" as a group or part of a group is generic for fluoro, chloro, bromo, iodo.
The term "hydroxyl- or "hydroxy- as used herein refers to the group -OH.
The term -cyano" as used herein refers to the group -1\1.
The term -amino" as used herein refers to the -NH2group.
The term "nitro- as used herein refers to the -NO2 group.
The term "carboxy" or "carboxyl" or "hydroxycarbonyl" as used herein refers to the group -0O21-1.
The term "aminocarbonyl" as used herein refers to the group -CONH2.
The term "Ci_6alkyl", as a group or part of a group, refers to a hydrocarbyl group of comprising from 1 to 6 carbon atoms. Ci_6alkyl groups may be linear or branched and may be substituted as indicated herein. Generally, alkyl groups of this invention comprise from 1 to 6 carbon atoms, preferably from 1 to 5 carbon atoms, preferably from 1 to 4 carbon atoms, more preferably from 1 to 3 carbon atoms, still WO 2022/253785 2.) more preferably 1 to 2 carbon atoms. When a subscript is used herein following a carbon atom, the subscript refers to the number of carbon atoms that the named group may contain. For example, "C1_ 6a1ky1" includes methyl, ethyl, n-propyl, i-propyl, butyl and its isomers (e.g. n-butyl, i-butyl and t-butyl);
pentyl and its isomers, hexyl and its isomers. For example, "Ci_salkyl"
includes all linear or branched alkyl groups with between 1 and 5 carbon atoms, and thus includes methyl, ethyl, n-propyl, i-propyl, butyl and its isomers (e.g. n-butyl, i-butyl and t-butyl); pentyl and its isomers. For example, "Ci_4alkyl"
includes all linear or branched alkyl groups with between 1 and 4 carbon atoms, and thus includes methyl, ethyl, n-propyl, i-propyl, butyl and its isomers (e.g. n-butyl, i-butyl and t-butyl). For example "Ci_3a1kyl" includes all linear or branched alkyl groups with between 1 and 3 carbon atoms, and thus includes methyl, ethyl, n-propyl, i-propyl.
When the term "Ci_6alkyl" is used as a suffix following another term, as in "hydroxyC1_6alkyl alkyl,"
this is intended to refer to an Ci_6alkyl group, as defined above, being substituted with one or two (preferably one) substituent(s) selected from the other, specifically-named group, also as defined herein.
The term "hydroxyCi_6alkyl" therefore refers to a -Ra-OH group wherein R. is alkylene as defined herein.
The term "haloCi_6alkyl" as a group or part of a group, refers to a CI _6alkyl group having the meaning as defined above wherein one, two, or three hydrogen atoms are each replaced with a halogen as defined herein. Non-limiting examples of such haloalkyl groups include chloromethyl, 1-bromoethyl, fluoromethyl, difluoromethyl, trifluoromethyl, 1,1,1-trifluoroethyl, trichloromethyl, tribromomethyl, and the like.
The term Arifluoromethyl" as used herein refers to the group ¨CF).
The term "trifluoromethoxy" as used herein refers to the group ¨0CF3.
The term "Ci_6alkyloxy" or "Ci_6alkyloxy-, as a group or part of a group, refers to a group having the formula ¨ORb wherein Rb is Ci_6alkyl as defined herein above. Non-limiting examples of suitable Ci_ 6alkoxy include methoxy, ethoxy, propoxy, isopropoxy, butoxy, isobutoxy, see-butoxy, tert-butoxy, pentyloxy and hexyloxy.
The term "haloCi_6alkyloxy" as a group or part of a group, refers to a C1_6alkyloxy group having the meaning as defined above wherein one, two, or three hydrogen atoms are each replaced with a halogen as defined herein. Non-limiting examples of such haloCi_6alkyl groups include chloromethyloxy, 1-fluoromethyloxy, difluoromethyloxy, trifluoromethyloxy, 1,1,1-trifluoroethyloxy, trichloromethyloxy, tribromomethyloxy, and the like.
The term "C2_6alkeny1- as a group or part of a group, refers to an unsaturated hydrocarbyl group, which may be linear, or branched comprising one or more carbon-carbon double bonds and comprising from 2 to 6 carbon atoms. For example, C2_4alkenyl includes all linear, or branched alkenyl groups having 2 to 4 carbon atoms. Examples of C2_6alkenyl groups are ethenyl, 2-propenyl, 2-butenyl, 3-butenyl, 2-pentenyl and its isomers, 2-hexenyl and its isomers, 2,4-pentadienyl. and the like.
The term "aryl", as a group or part of a group, refers to a polyunsaturated, aromatic hydrocarbyl group having a single ring (i.e. phenyl) or multiple aromatic rings fused together (e.g. naphthyl), or linked covalently, typically comprising 6 to 12 carbon atoms; wherein at least one ring is aromatic, preferably comprising 6 to 10 carbon atoms, wherein at least one ring is aromatic. The aromatic ring may optionally include one to two additional rings (either cycloalkyl, heterocyclyl or heteroaryl) fused thereto.
Examples of suitable aryl include C6_12aryl, preferably C6_Haryl, more preferably C6_8aryl. Non-limiting examples of aryl comprise phenyl, biphenylyl, biphenylenvl, or 1-or 2-naphthanely1; 5- or 6-tetralinyl, 1-, 2-, 3-, 4-, 5-, 6-, 7- or 8-azulenyl, 4-, 5-, 6 or 7-indenyl, 4- or 5-indanyl, 5-, 6-, 7- or 8-tetrahydronaphthyl, 1,2,3,4-tetrahydronaphthyl, 1,4-dihydronaphthyl;
anthracenyl, dibenzosuberyl, and 1-, 2-, 3-, 4- or 5-pyrenyl. A "substituted aryl" refers to an aryl group having one or more substituent(s) (for example 1, 2 or 3 substituent(s), or 1 to 2 substituent(s)), at any available point of attachment.
The term "aryloxy", as a group or part of a group, refers to a group having the formula -ORg wherein Rg is aryl as defined herein above.
The term "arylCi_6alkyl", as a group or part of a group, means a Ci_6alkyl as defined herein, wherein at least one hydrogen atom is replaced by at least one aryl as defined herein.
Non-limiting examples of arylCi_6alkyl group include benzyl, phenethyl, dibenzylmethyl, methylphenylmethyl, 3-(2-naphthyl)-butyl, 9-anthrylmethyl, 9-fluorenymethyl and the like.
The term "arylCi_6alkyloxy", as a group or part of a group, refers to a group having the formula -ORg wherein Rg is arylCi_6alkylas defined herein above.
The terms "heterocyclyl" or "heterocycloakyl" or "heterocyclo", as a group or part of a group, refer to non-aromatic, fully saturated or partially unsaturated cyclic groups (for example, 3 to 7 member monocyclic, 7 to 11 member bicyclic, or comprising a total of 3 to 10 ring atoms) which have at least one heteroatom in at least one carbon atom-containing ring; wherein said ring may be fused to an aryl, cycloalkyl, heteroaryl or heterocyclyl ring. Each ring of the heterocyclyl group containing a heteroatom may have 1, 2, 3 or 4 heteroatoms selected from N, 0 and/or S, where the N and S heteroatoms may optionally be oxidized and the N heteroatoms may optionally be quatemized, and wherein at least one carbon atom of heterocyclyl can be oxidized to form at least one C=0. The heterocyclic group may be attached at any heteroatom or carbon atom of the ring or ring system, where valence allows. The rings of multi-ring heterocycles may be fused, bridged and/or joined through one or more Spiro atoms.
Non limiting exemplary heterocyclic groups include xanthenyl, aziridinyl, oxiranyl, thiiranyl, azetidinyl, oxetanyl, pyrrolidiiiyl, thietanyl, 2-imidazoljnyl, pyrazolidinyl isoxazolinyl, oxazolidinyl, isoxazolidinyl, thiazolidinyl, isothiazolidinyl, piperidinyl, succinimidyl, 3H-indolyl, indolinyl, chromanyl (also known as 3,4-dihydrobenzo[b]pyranyl), isoindolinyl, 2H-pyrrolyl, 1 , 2-pyn-olinyl , 3 -pyn-ol inyl , 4H-quinolizinyl , 2-oxopiperazinyl , piperazinyl , homopiperazinyl, 2-pyrazolinyl, 3-pyrazolinyl, tetrahydro-2H-pyranyl, 2H-pyranyl, 4H-pyranyl, 3,4-dihydro-2H-pyranyl, 3-dioxolanyl, 1,4-dioxanyl, 2,5-dioximidazolidinyl, 2-oxopiperidinyl, 2-oxopyrrolodinyl, indolinyl, tetrahydropyranyl, tetrahydrofuranyl, tetrahydrothiophenyl, tetrahydroquinolinyl, tetrahydroisoquinolin-l-yl, tetrahydroisoquinolin-2-yl, tetrahydroisoquinolin-3-yl, tetrahydroisoquinolin-4-yl, thiomorpholin-4-yl, thiomorpholin-4-ylsulfoxide, thiomorpholin-4-ylsulfone, 1,3-dioxolanyl, 1,4-oxathianyl, 1,4-dithianyl, 1,3,5-trioxanyl, 1H-pyrrolizinyl, tetrahydro-1,1-dioxothiophenyl, N- formylpiperazinyl, and morpholin-4-yl. The term "aziridinyl" as used herein includes aziridin-l-yl and aziridin-2-yl. The term "oxyranyl" as used herein includes oxyrany1-2-yl. The term "thiiranyl" as used herein includes thiiran-2-yl. The term "azetidinyl"
as used herein includes azetidin-l-yl, azetidin-2-y1 and azetidin-3-yl. The term "oxetanyl" as used herein includes oxetan-2-y1 and oxetan-3-yl. The term "thietanyl" as used herein includes thietan-2-y1 and thietan-3-yl. The term "pyrrolidinyl" as used herein includes pyrrolidin- 1-yl, pyrrolidin-2-y1 and pyrrolidin-3-yl. The term "tetrahydrofuranyl" as used herein includes tetrahydrofuran-2-y1 and tetrahydrofuran-3-yl. The term "tetrahydrothiophenyl" as used herein includes tetrahydrothiophen-2-y1 and tetrahydrothiophen-3-yl.
The term "succinimidyl" as used herein includes suceinimid-1-y1 and succininmid-3-yl. The term "di hydropyrrol yl " as used herein includes 2,3 -di hydropyrrol -1-y1 , 2,3 -dihydro-1H-pyrrol -2-yl, 2,3 -dihydro-1H-pyrrol-3-yl, 2,5 -dihydropyrrol-1 -yl, 2,5 -dihydro-1H-pyrrol-3 -yl and 2,5 -dihydropyrrol-5 -yl. The term "2H-pyrroly1" as used herein includes 2H-pyrrol-2-yl, 2H-pyrrol-3-yl, 2H-pyrrol-4-y1 and 2H-pyrrol-5-yl. The term "3H-pyrroly1" as used herein includes 3H-pyrrol-2-yl, 3H-pyrrol-3-yl, 3H-pyrrol-4-y-1 and 3H-pyrrol-5-yl. The term "dihydrofuranyl" as used herein includes 2,3-dihydrofuran-2-yl, 2,3-dihydrofuran-3-yl, 2,3-dihydrofuran-4-yl, 2,3-dihydrofuran-5-yl, 2,5-dihydrofuran-2-yl, 2,5-dihydrofuran-3-yl, 2,5-dihydrofuran-4-y1 and 2,5-dihydrofuran-5-yl. The term "dihydrothiophenyl" as used herein includes 2,3-dihydrothiophen-2-yl, 2,3-dihydrothiophen-3-yl, 2,3-dihydrothiophen-4-yl, 2,3 -dihydrothiophen-5 -yl, 2,5 -dihydrothiophen-2-yl, 2,5 -dihydrothiophen-3 -yl, 2,5 -dihydrothiophen-4-y1 and 2,5-dihydrothiophen-5-yl. The term "imidazolidinyl" as used herein includes imidazolidin- 1 -yl, imidazolidin-2-y1 and imidazolidin-4-yl. The term "pyrazolidinyl" as used herein includes pyrazolidin-l-yl, pyrazolidin-3-y1 and pyrazolidin-4-yl. The term "imidazolinyl" as used herein includes imidazolin- 1 -yl, imidazolin-2-yl, imidazolin-4-y1 and imidazolin-5-yl. The term "pyrazolinyl"
as used herein includes 1-pyrazolin-3-yl, 1-pyrazolin-4-yl, 2-pyrazolin-l-yl, 2-pyrazolin-3-yl, 2-pyrazolin-4-yl, 2 -pyrazolin-5 -yl, 3-pyrazolin-1-yl, 3 -pyrazolin-2-yl, 3 -pyrazolin-3 -yl, 3 -pyrazolin-4 -y1 and 3-pyrazolin-5-yl. The term "dioxolanyl" also known as "1,3-dioxolanyl" as used herein includes dioxolan-2-yl, dioxolan-4-y1 and dioxolan-5-yl. The term "dioxoly1" also known as "1,3-dioxoly1" as used herein includes dioxo1-2-yl, dioxo1-4-y1 and dioxo1-5-yl. The term "oxazolidinyl" as used herein includes oxazolidin-2-yl, oxazolidin-3-yl, oxazolidin-4-y1 and oxazolidin-5-yl. The term "isoxazolidinyl" as used herein includes isoxazolidin-2-yl, isoxazolidin-3-yl, isoxazolidin-4-y1 and isoxazolidin-5-yl. The term "oxazolinyl" as used herein includes 2-oxazoliny1-2-yl, 2-oxazoliny1-4-yl, 2-oxazoliny1-5-yl, 3-oxazoliny1-2-yl, 3-oxazoliny1-4-yl, 3-oxazoliny-1-5-yl, 4-oxazoliny1-2-yl, 4-oxazoliny1-3-yl, 4-oxazoliny1-4-y1 and 4-oxazoliny1-5-yl. The term "isoxazolinyl" as used herein includes 2-isoxazoliny1-3-yl, 2-isoxazoliny1-4-yl, 2-isoxazoliny1-5-yl, 3-isoxazoliny1-3-yl, 3-isoxazoliny1-4-yl. 3-isoxazoliny1-5-yl, 4-isoxazoliny1-2-yl, 4-isoxazoliny1-3-yl, 4-isoxazoliny1-4-y1 and 4-isoxazoliny1-5-yl. The term "thiazolidinyl" as used herein includes thiazolidin-2-yl, thiazolidin-3-yl, thiazolidin-4-y1 and thiazolidin-5-yl. The term "isothiazolidinyl" as used herein includes isothiazolidin-2-yl, isothiazolidin-3-yl, isothiazolidin-4-y1 and isothiazolidin-5-yl. The term -chromanyl" as used herein includes chroman-2-yl, chroman-3-yl, chroman-4-yl, chroman-5-yl, chroman-6-yl, chroman-7-yl and chroman-8-yl. The term "-thiazolinyl" as used herein includes 2-thiazoliny1-2-yl, 2-thiazoliny1-4-yl, 2-thiazoliny1-5-yl, 3-thiazoliny1-2-yl, 3-thiazoliny1-4-yl, 3-thiazoliny1-5-yl, 4-thiazoliny1-2-yl, 4-thiazoliny1-3-yl, 4-thiazoliny1-4-y1 and 4-thiazoliny1-5-yl. The term "isothiazolinyl- as used herein includes 2-isothiazoliny1-3-yl, 2-isothiazoliny1-4-yl, 2-isothiazoliny1-5-yl,
H N
) _________________________ 0 N
H N
0 _____________________ OH OH
(i) wherein the wavy line ( ) indicates the point of attachment to the S atom and A', A2, A3, and A4 are as defined for structure (I);
each RP is independently selected from the group consisting of C1_6a1ky1, haloCh6alkyl, aryl, haloCi-6alkyl, ary-1C1_6a1kyl, heterocyclyl, heteroaryl;
each R42 is independently selected from the group consisting of hydrogen, C1_6a1kyl, aryl, haloCi_6a1ky1, CH2CC13, CH2OCH3, arylCi_6a1ky1, heterocyclyl, heteroaryl;
each 12_13 is independently selected from the group consisting of hydrogen, C1_6a1ky1, aryl, haloC1_6a1ky1, ary1C1_6a1ky1, heterocyclyl, heteroaryl;
each Z1 is independently selected from the group consisting of -C(0)R",i, nitro, hydroxyl, Ci_ 6a1ky1, aryl, heteroaryl, -SR", _NR12C(0)R13, _C(0)2R12, cyano, -S(0)2R1 , halo, haloCi_6a1kyl, haloCi_ 6a1kyloxy, heterocyclyl, amino, -NR11R12, _C(0)NR12R13, _s(0)Rio, _S(0)2N
R12R13; wherein said CI_ 6alkyl, aryl, can be unsubstituted or substituted with one or more C1_4a1ky1, methoxy, nitro, -C(0)aryl, halo, tri fluorom ethyl, trifluoromethoxy.
Aspect 2.
In a second aspect the present invention provides a labeling precursor in the form of a compound of formula (I) or a stereoisomer, or tautomer thereof, wherein, 121- is selected from the group consisting of hydrogen, -C(0)R11, -C(0)2R12, -C(0)NR12R13, CI_ 6alkyl, ary1C1_6a1ky1, heteroary1C1_6a1ky1, heterocycly1C1_6alkyl, aryl, heteroaryl, heterocyclyl;
preferably is hydrogen, -C(0)R", _C (0)2R12, _C(0)NR12R13, -SR1 , C1_6alkyl, ary1C1_6alkyl, heteroary1C1_6alkyl; preferably R1 is hydrogen, -C(0)R", _c(o)2R12, _C(0)NR12R13, _SRN, C1_6alkyl, aryl Ci_6alkyl ;
wherein said Ci_6alkyl, arylCi_6alkyl, heteroarylCi_6alkyl, heterocycly1C1_6alkyl, aryl, heteroaryl, or heterocyclyl can be unsubstituted or substituted with one or more 7';
preferably said groups are unsubstitutcd or substituted with one, two or three Zl;
N
*
Ll is or ; wherein * represents where 1_,1 is bound to the carbonyl group; and ** represents where 1_,1 is bound to Al;
* **
Al i is or ; wheren * represents where Al is bound Ll;
and ** represents where A1 is bound to A2; and wherein, n is an integer selected from 1, 2, 3, 4 or 5; preferably n is selected from 1, 2, or 3;
R2 is selected from the group consisting of hydroxyC1_6alkyl, C1_6alkylNHR1, C1_6alkylC(0)0H, Cl_ 6a1kylNHC(NH)NH2, hydrogen, C1_6alkyl, C2_6alkenyl, aminoC1_6alkyl, mercaptoC1_6alkyl, Ci_ 6a1kylthi o C1_6alkylene , ary1C1_6a1ky1, -CH(OH)CH3, -C(0)OH, C1_6alkyl(CO2H)2, -S 03H, C1_ 6alkylheteroaryl, C1_6alkylSeH, C1_6alkylS(0)CH3, C1_6alkylS(CH3)2 , C1_6alkylNHC(0)heterocycle and C1_6alkylC(0)NH2; preferably R2 is hydroxyCh6alkyl, C1_6alkylNHR3, C1_6alkyle(0)0H, CI_ 6alkylNHC(NH)NH2, hydrogen, Ci_6alky1, C2_6alkenyl, aminoCi_6alkyl, mercaptoCi_6alkyl, C1_ 6alkylthioC i_6alkylene , -CH(OH)CH3, -C(0)0H, C1_6alkyl(CO2H)2, - S 03H, Ci_6alky1SeH, C1_ 6alkylS(0)CH3, Ci_6alky1S(CH3)2', and C1_6alky1C(0)NH2; preferably R2 is hydroxyCl_6alkyl, CI_ 6alkylNHR3, Ci_6alky1C(0)0H, Ci_6alky1NHC(NH)NH2, hydrogen, C1_6alky1, aminoCi_6alky1, mercaptoC1_6alky1, Ci_6alkylthioCi_6alkylene, -CH(OH)CH3, -C(0)0H, Ci_6a1kyl(CO2H)2, -S03H, Ci_ 6alkylS(0)CH3, Ci_6alkylS(CH3)2 , and Ci_6alkylC(0)NH2; preferably R2 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, C1_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, -S03H, Ci_6a1kylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R3 is H or -C(0)(CH2)SH;
.**
A2 is selected from: or R4 ; wherein * represents where A2 is bound Al; and ** represents where A2 is bound to A3; or wherein A2 is absent; and wherein, m is an integer selected from 1, 2, 3, 4 or 5;
R4 is selected from the group consisting of hydroxyCi_6a1kyl, Ci_6alkylNHR5, C1_6alkylC(0)0H, C1_ 6alkylNHC(NH)NH2, hydrogen, Ci_6a1ky1, C2_6alkenyl, aminoCi_6a1ky1, mercaptoCi_6alkyl, Ci_ 6alkylthi o Ci_6alkylene , ary1C _6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alkyl(CO2H)2, -S 03H, Ci_ 6alkylheteroaryl, Ci_6alkylSeH, Ci_6alkylS(0)CH3, CI _6alkylS(CH3)2', CI
_6alkylNHC(0)heterocycle and Ci_6alkylC(0)NH2; preferably R4 is hydroxyCl_6a1ky1, Ci -6alkylNHR5, Ci_6alkylC(0)0H, CI_ 6alkylNHC(NH)NH2, hydrogen, Ci_6a1ky1, C2_6alkenyl, aminoCi_6a1ky1, mercaptoCL6alkyl, C1_ 6alkylthioCi_6a1ky1ene, -CH(OH)CH3, -C(0)0H, Ci_6a1ky1(CO2H)2, -S03H, Ci_6alky1SeH, C1_ 6alkylS(0)CH3, Ci_6alky1S(CH3)2', and C1_6alky1C(0)NH2; preferably R4 is hydroxyCl_6alkyl, CI_ 6alkylNHR5, Ci_6alky1C(0)0H, Ci_6alky1NHC(NH)NH2, hydrogen, C1_6alky1, aminoCi_6a1ky1, mercaptoCi_6alkyl, Ci_6alkylthioCi_6a1ky1ene, -CH(OH)CH3, -C(0)0H, Ci_6alkyl(CO2H)2, -S03H, C1-6alkylS(0)CH3, Ci_6alkylS(CH3)2 , and Ci_6alkylC(0)NH2; preferably R4 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, C1_6alkyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, -S03H, Ci_6a1kylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R5 is H or -C(0)(CH2)SH;
A3 is selected from: or : wherein * represents where A3 is bound A2; and ** represents where A3 is bound to A4; or wherein A3 is absent; and wherein, o is an integer selected from 1, 2, 3, 4 or 5;
R6 is selected from the group consisting of hydroxyCI _6alkyl, Ci_nalky1NHR7, CI _6alkylC(0)0H, C1_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6alky1, C2_6a1kenyl, aminoCi_6a1ky1, mercaptoCi_6a1ky1, Ci_ 6a1ky1thi o Ci_6alkylene, ary1C _6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alky1(CO2H)2, -S 03H, C1-6alkylheteroaryl, Ci_6a1kylSeH, C 1-6a1ky1S(0)CH3, CI -6alkylS(CH3)2', CI -6alkylNHC(0)heterocycle and C1_6a1kylC(0)NH2; preferably R6 is hydroxyCi_6alkyl, Ci_6a1ky1NHR7, Ci_ealky1C(0)0H, C1_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6alky1, C2_6alkenyl, aminoCi_6a1ky1, mercaptoCi_6a1ky1, Ci_ 6a1ky1thioCi_6a1kylene, -CH(OH)CH3, -C(0)0H, Ci_6a1ky1(CO2H)2, -S03H, Ci_6a1ky1SeH, CI_ 6alkylS(0)CH3, Ci_6a1ky1S(CH3)2', and C1_6a1ky1C(0)NH2; preferably R6 is hydroxyCl_6alky1, CI_ 6alkvIN HR7, C1_6a1ky1C (0)0H, C1_6alky1N HC (N H)N H2, hydrogen, C1_6a1kyl, amino Ci_6alkyl, mercaptoCi_6alkyl, Ci_6a1ky1thioCi_6a1kylene, -CH(OH)CH3, -C(0)0H, Ci_6a1ky1(CO2H)2, -S03H, C1-6alkylS(0)CH3, Ci_6a1ky1S(CH3)2 , arid Ci_6alkylC(0)NH2; preferably R6 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, ary1C1_6alkyl, -CH(OH)CH3, -C(0)0H, -S03H, C1_6a1ky1heteroary1, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R7 is H or -C(0)(CH2)SH;
N **
A4 is selected from: or ; wherein * represents where A' is bound A3; and ** represents where A4 is bound to the carbonyl group; or wherein A4 is absent;
and wherein, t is an integer selected from 1, 2, 3, 4 or 5;
R8 is selected from the group consisting of hydroxyCl_6alky1, Ci_6a1ky1NHR9, C1_6alky1C(0)0H, C1_ 6alky1NHC(NH)NH2, hydrogen, C1_6alky1, C2_6alkenyl, aminoCi_6alkyl, mercaptoCi_6alkyl, Ci_ 6alkylthioCi_oalkylene, ary1C -CH(OH)CH3, -C(0)OH, Ci_6alky1(CO2H)2, -S 03H, C1-6alkylheteroaryl, Ci_6alkylSeH, C 1-6alkylS(0)CH3, Ci -6alkylS(CH3)2', Ci -6alkylNHC(0)heterocycle and Ci_6a1kylC(0)NH2; preferably R8 is hydroxyCi_nalkyl, Ci_6a1ky1NHR9, Ci_6alky1C(0)0H, Ci_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6alky1, C2_6alkenyl, aminoCi_6a1ky1, mercaptoCi_6a1ky1, Ci_ 6a1kylthioCi_6a1ky1ene, -CH(OH)CH3, -C(0)0H, C1_6alkyl(CO2H)2, Ci_6alky1SeH, Ci_ 6a1kylS(0)CH3, Ci_6alky1S(CH3)2', and Ci_6alky1C(0)NH2; preferably R' is hydroxyCi_6alkyl, Ci_ 6 alkylNHR9, Ci_6alkylC (0)0H, Ci_6alky1NHC(NH)NH2, hydrogen, C1_6alkyl, amino Ci_6alkyl, mercaptoCi_6alky1, Ci_6a1kylthioCi_6alkylene, -CH(OH)CH3, -C(0)0H, Ci_6a1kyl(CO2H)2, -S03H, C1-6a1kylS(0)CH3, Ci_6alkylS(CH3)2 , and Ci_6alky1C(0)NH2; preferably le is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6alkyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylC1_6alkyl, -CH(OH)CH3, -C(0)0H, -S03H, Ci_6a1ky1heteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R9 is H or -C(0)(CH2)SH;
R" is selected from the group consisting of Ci 6a1ky1, heterocycle, aryl, and heteroaryl;
or RI is a group of formula (i);
OH
-A
H N
__________________________ 0 _______ N
H
0 ____________________ OH OH
(1) wherein the wavy line ( ) indicates the point of attachment to the S atom and 12, Al-, A2, A3, and A4 are as defined for structure (I); preferably R" is C1_6alkyl, or a group of formula (i);
each Ri is independently selected from the group consisting of Ci_6alky1, haloCi_6alkyl, aryl, ary1C1-6alkyl, heterocyclyl, heteroaryl; preferably each RH is Ci_6alkyl, haloCi_6a1ky1, aryl, and arylCi_6a1ky1;
each 1142 is independently selected from the group consisting of hydrogen, Ci_oalkyl, aryl, haloCi_6alky1, CH2CC13, CH2OCH3, ary1Ci_6a1kyl, heterocyclyl, heteroaryl; preferably each R42 is hydrogen, Ci_6a1ky1, aryl; CH2CC13, CH2OCH3;
each R43 is independently selected from the group consisting of hydrogen, Ci_6alkyl, aryl, haloCi_6a1ky1, arylCi_6alkyl, heterocyclyl, heteroaryl; preferably each R42 is hydrogen, Ci_6alkyl, haloCi_6alkyl, aryl, and arylCi_6alkyl;
each Z1 is independently selected from the group consisting of -0R11, -C(0)R11, nitro, hydroxyl, CI_ 6a1ky1, aryl, heteroaryl, -SR", _NR12c(0)¨rc 137C(0 _ )2R12, cyano, -S(0)2R1', halo, haloCi_6a1ky1, haloCi-6alkyloxy. heterocyclyl, amino, -NR11-."K _ 12, C(0)NR12R13, _s(or _ 10, K
S(0)2N Ri2R13; preferably each Z1 is -OR", -C(0)R11, nitro, hydroxyl, Ci_6alkyl, aryl, heteroaryl, -SR", -NR12C(0)R13, -C(0)2R12, cyano, -S(0)2R1 , haloCi_6alkyl, amino, -C(0)NR12R13, -S(0)R1 , -S(0)2N
R12R13; preferably each Z1 is -OR", -C(0)R11, nitro, hydroxyl, Ci_6alkyl, aryl, heteroaryl, -SR", -NR12C(0)R13, -C(0)2R12, cyano, -S(0)2R1 , haloCi_6a1ky1;
wherein said Ci_6alky1, or aryl, can be unsubstituted or substituted with one or more Ci_4alkyl, methoxy, nitro, -C(0)aryl, halo, trifluoromethyl, trifluoromethoxy; preferably said groups can be unsubstituted or substituted with one, two or three Ci_4a1ky1, methoxy, nitro, -C(0)aryl, halo, trifluoromethyl, trifluoromethoxy; preferably said groups can be unsubstituted or substituted with one or more Chaalkyl, methoxy, nitro, -C(0)aryl, halo;
Aspect 3.
In a third aspect the present invention provides a labeling precursor in the form of a compound of any one of formula (IA), (IB), (IC) or (ID):
=-..........õ--H
N y A
''IrL N 'Ir-S
H R
(IA) .....--.....z.õ,-H N
y H H H
y OyL, N N N R
N S
0 H id.
(IB) o o H
N0 \ 0 0 H
(IC) H N
H N-"LO 0 0 N Li OH yO 0 H
(ID) wherein LI, Al, A4, RI, R4, R6 and R8 have the same meaning as that defined herein.
Aspect 4. According to particular embodiments, the present invention provides a compound of formula (I), wherein, R2 is selected from the group consisting of -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)1\11-12, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, -s 03H, Ci_6alkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R4 is selected from the group consisting of -CH2OH, -CH2NHR5, -CH2C(0)0H, -(CH2)3NHC(NH)1\11-12, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6a1ky1, -CH(OH)CH3, -C(0)0H, -S03H, Ci_6alkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R6 is selected from the group consisting of -CH2OH, -CH2NHR2, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6alkyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alky1, -CH(OH)CH3, -C(0)0H, -S 03H, Croalkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)Nfl2:
R8 is selected from the group consisting of -CH2OH, -CH2NHIe, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6alkyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alky1, -CH(OH)CH3, -C(0)0H, -S 03H, Croalkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)Nfl2:
preferably wherein. R1 is hydrogen, acetyl or -SR", wherein Rth is a group of formula (i).
Aspect 5.
According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, R1 is selected from the group consisting of hydrogen, -C(0)R11, -C(0)2R12, -C(0)N1e2R13, -SR", C1-6 alkyl, ary1C1_6a1kyl, heteroarylCi_6alkyl, heterocyclylCi_6alkyl, aryl, heteroaryl, heterocyclyl;
preferably re is hydrogen, C1_6alkylcarbony1, ary1Ci_6alkylcarbonyl, arylcarbonyl, C1_ 6alkyloxycarbonyl, arylCi_6alkyloxycarbonyl, aryloxycarbonyl, heteroaryloxy, aminocarbonyl, mono-Ci_6alkylaminocarbony1, di-Ci_6alkylaminocarbonyl, mono-arylaminocarbonyl, di-alrylaminocarbonyl, Ci_6alkylthio, arylCi_6a1ky1thio, arylthio, C1_6alkyl, ary1Cr6alkyl, heteroarylCi_6alkyl, heterocycly1C1_ 6a1ky1, aryl, heteroaryl, heterocyclyl; preferably R1 is hydrogen, Ci_6alkylcarbonyl, arylCI_ 6alkylcarbonyl, arylcarbonyl, Ci_6alkyloxycarbonyl, arylC1_6alkyloxycarbonyl, aryloxycarbonyl, mono-Ci_6alkylaminocarbonyl, di-Cr6a1kylaminocarbonyl, Ci_6alkylthio, arylCi_6alkylthio, arylthio, Ci_6alky1, arylCalkyl, heteroarylCi_nalkyl, hetcrocycly1C1-6alkyl, aryl, heteroaryl, heterocycly1; preferably le is hydrogen, C1_6a1kylcarbonyl, ary1C1_6alkylcarbonyl, arylcarbonyl, Ci_6alkyloxycarbonyl, arylCi_ 6alkyloxycarbonyl, aryloxycarbonyl, Ci_6a1kylthio, ary1C1_6alkylthio, arylthio, C1_6alkyl, arylCi_6a1ky1;
preferably le is hydrogen, C1_4a1ky1carbony1, arylCi_4alkylcarbonyl, arylcarbonyl, CI -4 alkyloxycarbonyl, aryl C i_4alkyloxycarbonyl, aryloxycarbonyl, C
i_4alkylthio, aryl C i_4alkylthio, arylthio, C 1_4a1kyl, aryl C i_4alkyl ;
wherein said groups can be unsubstituted or substituted with one or more Z1;
preferably said groups are unsubstituted or substituted with one, two or three Z1.
Aspect 6.
According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, R2 is selected from the group consisting of hydroxyCl_6alkyl, C1_6alkylNHR3, C1_6alkylC(0)0H, CI_ 6alkylNHC(NH)NH2, hydrogen, Cr6alkyl, C2_6alkenyl, a1ninoCi_6alkyl, mercaptoCr6alkyl, C1_ 6 alkylthi o C
-CH(OH)CH3, -C(0)OH, C 1_6alkyl(CO2H)2, -S 03H, Ci_ 6alkylheteroaryl, Ci_6alkylSeH, C 1-6alky1S(0)CH3, CI -6alkylS(CH3)2', CI -6alky1NHC(0)heterocycle and Ch6alky1C(0)NI-12; preferably R2 is hydroxyCl_6alky1, Ci -6alkylNHR3, Ci_6a1kylC(0)0H, C1_ 6a1kylNHC(NH)NH2, hydrogen, Ci_6alkyl, aminoCi -6alkyl, mercaptoC 1-6alkyl, Ci_6alkylthioCi_ 6alkylene, -CH(OH)CH3, -C(0)0H, C1_6alkyl(CO21-1)2, -S03H, C1_6a1ky1SeH, Ci_6alkylS(0)CH3, C1_ 6a1kylS(CH3)2 , and Ci_6alkylC(0)N1-12; preferably R2 is hydroxyCl_4alkyl, C1_4alkylNHR3, C1_ 6alkylC( 0)0H, Ci4a1ky1NHC(NH)NH2, hydrogen, Ci_4alky1, aminoCi_6a1ky1, mercaptoCi_6a1ky1, CI_ 4a1kylthioCi_4alky1ene, -CH(OH)CH3, -C(0)0H, C1_4alky1(CO21-1)2, -S03H, Ci_4alkylSeH, C1_ 4a1kylS(0)CH3, Ci_e4alkylS(CH3)2', and Ci4a1ky1C(0)N112; preferably R2 is hydroxyCl_4a1kyl, C1_ 4a1kylNHR3, Ci_6a1ky1C (0)0H, Ci_4alky1NHC(NH)N1-12, hydrogen, C1_4alky1, amino CI -6alkyl, -CH(OH)CH3, -C(0)0H, Ci_4alkyl(CO2H)2, -S03H, Ci_4alky1S(0)CH3, Ci_e4alkylS(CH3)2', and C1_ 4a1kylC(0)NII2; preferably R2 is -CI12011, -(CII2)3NIIC(NII)NII2, hydrogen, Ci_6a1kyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)OH, -S 03H, Ci -6alkylhete roaryl, -CH2C(0)N1-12, and -(CH2)2C (0)NH2 Aspect 7.
According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, R4 is selected from the group consisting of hydroxyCl_6alkyl, Ci_6alkylNH125, C1_6alkylC(0)0H, C1_ 6a1kylNHC(NH)NH2, hydrogen, C1_6alky1, C2_6a1kenyl, aminoCi_6alkyl, mcrcaptoCi_6alkyl, C1_ 6a1kylthi o Ci_olkylene , arylCi_6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alkyl(CO21-1)2, -S 03H, C1_ 6alkylheteroaryl, Ci_6alkylSeH, C 1-6alky1S(0)CH3, CI -6alkylS(CH3)2t Ci_6alky1NHC(0)heterocycle and Ci_6alkylC(0)NI12; preferably R4 is hydroxyCi_6alky1, Ci -6alkylNHR5, Ci_6alkylC(0)0H, CI_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6a1kyl, aminoCi_6alkyl, mercaptoCi_6alkyl, Ci_6a1ky1thioCi_ 6alkylene, -CH(OH)CH3, -C(0)0H, Ci_6alkyl(CO2H)2, -S03H, C1_6alky1SeH, Ci_6alkylS(0)CH3, CI_ 6a1kylS(CH3)2% and Ci_6a1kylC(0)NF12; preferably R4 is hydroxyCl_4a1kyl, Ci_4a1kylNHR5, CI
-6a1kylC(0)0H, Ci4a1kylNHC(NH)N1-12, hydrogen, Ci_4alkyl, aminoCi_6alky1, mercaptoC1_6a1kyl, C1_ 4a1kylthioCi_4alky1ene, -CH(OH)CH3, -C(0)0H, C1_4alky1(CO21-1)2, -S03H, Ci_4alkylSeH, CI_ 4a1kylS(0)CH3, Ci_e4alkylS(CH3)2', and Ci_4a1ky1C(0)N1-12; preferably le is hydroxyCl_4alkyl, C1_ 4a1kylNHR5, Ci_6a1ky1C(0)0H, Ci_4alky1NHC(NH)Nfl2, hydrogen, C1_4alky1, aminoC1_6alkyl, -CH(OH)CH3, -C(0)0H. C1_4alkyl(CO2H)2, -S03H, Ci_4alky1S(0)CH3, Ci_e4alkylS(CH3)2t and C1-4a1kylC(0)NH2; preferably R4 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ch6a1kyl, -(C1-12)20H, -(CH2)4NI-12, -CH2SH, -(CF12)2SCI-L, ary1Ci_6a1kyl, -CH(OH)CH3, -C(0)0H, -S03H, Ci_6alkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NR2.
Aspect 8.
According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, R6 is selected from the group consisting of hydroxyCl_6a1kyl, Ci_6alkylNHR7, C1_6alkylC(0)0H, C1_ 6alkylNHC(NH)NH2, hydrogen, Ci_6alky1, C2_6a1kenyl, aminoC1_6alkyl, mercaptoC1_6alkyl, C1_ 6a1kylthi o Ci_olkylene , arylCi_6alky1, -CH(OH)CH3, -C(0)OH, Ci_6alkyl(CO2H)2, -S 03H, Ci_ 6alkylheteroaryl, Ci_6alkylSeH, C 1-6alky1S(0)CH3, Ci -6alkylS(CH3)2', Ci -6alkylNHC(0)heterocycle and Ci_6alkylC(0)NH2; preferably R6 is hydroxyCi_6alkyl, Ci -6alkylNHR7, Ci_6alkylC(0)0H, Ci_ 6alkylNHC(NH)NH2, hydrogen, Ci_6alkyl, aminoCi -6alkyl, mercaptoC 1-6alkyl, Ci_6alkylthioCi_ 6a1ky1ene, -CH(OH)CH3, -C(0)0H, Ci_6alkyl(CO2H)2, -S03H, Ci_6alkylSeH, Ci_6alkylS(0)CH3, Ci_ 6alkylS(CH3)2', and Ci_6alkylC(0)NH2; preferably R6 is hydroxyC1_4alkyl, Ci_4alkylNHR7, Ci_ 6a1kyl C ( 0)0H, Ci_4alkylNHC(NH)NH2, hydrogen, Ci_4alkyl, amino CI -6alkyl, mercaptoCi_6a1kyl, CI_ 4a1kylthioC1_4a1ky1ene, -CH(OH)CH3, -C(0)0H, C1_4alky1(CO2H)2, -S03H, Ci_4alkylSeH, Ci_ 4alkylS(0)CII3, Ci_e4alkylS(CII3)2', and Ci_4alky1C(0)NII2; preferably R6 is hydroxyC1_4alkyl, Ci_ 4a1kylNHR7, Ci_6a1ky1C(0)0H, Ci_4alky1NHC(NH)NH2, hydrogen, C1_4alky1, aminoCi_6alkyl, -CH(OH)CH3, -C(0)0H, Ci_4alkyl(CO2H)2, -S03H, Ci_4alky1S(0)CH3, Ci_e4alkylS(CH3)2% and C1-4alkylC(0)NH2; preferably R4 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1kyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, -s 03H, Ci_6alkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2.
Aspect 9. According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, R8 is selected from the group consisting of hydroxyCl_6a1kyl, C1_6alkylNHR9, C1_6alkylC(0)0H, CI_ 6a1kylNHC(NH)NH2, hydrogen, Ci_6alky1, C2_6a1kenyl, aminoCi_6alkyl, mercaptoC1_6alkyl, Ci_ 6alkvlthi 0 Ci_6alkylene , ary1C _6alkyl, -CH(OH)CH3, -C(0)OH, Ci_6alkyl(C
0211)2, -S 03H, Ci-6alkylheteroaryl, Ch6alkylSeH, Ci_6alkylS(0)CH3, Ci_6alkylS(CH3)2 , Ci_6alky1NHC(0)heterocycle and Ci_6a1kylC(0)NH2; preferably R8 is hydroxyCl_6alkyl, Ci_6a1kylNHR9, Ci_6a1kylC(0)0H, CI_ 6a1kylNHC(NH)NH2, hydrogen, Ci_6alkyl, aminoCi -6alkyl, mercaptoC1_6alkyl, Ci_6alkylthioCi_ 6alkylene, -CH(OH)CH3, -C(0)0H, Ci_6alkyl(CO2H)2, -S03H, C1_6a1ky1SeH, Ci_6alkylS(0)CH3, CI_ 6a1kylS(CH3)2', and Ci_6alkylC(0)NH2; preferably 128 is hydroxyCi_4alkyl, Ci_4alkylNHR9, C1-6alkylC(0)0H, Ci4a1kylNHC(NH)NH2, hydrogen, Ci_4alkyl, aminoC1_6alky1, mercaptoCi_6a1kyl, 4a1kylthioCi_4alky1ene, -CH(OH)CH3, -C(0)0H, Ci_4alky1(CO2H)2, -S03H, Ci_4alkylSeH, Ci_ 4alkylS(0)CH3, Ci_e4alkylS(CH3)2 , and Ci_4alky1C(0)NH2; preferably R8 is hydroxyCi_4alkyl, Ci_ 4a1kylNHIV, C1_6alky1C(0)0H, C1_4alky1NHC(NH)NH2, hydrogen, C1_4a1ky1, aminoCi alkyl, -CH(OH)CH3, -C(0)0H. Ci_4a1kyl(CO2H)2, -S03H, Ci_4a1ky1S(0)CH3, Ci_e4a1ky1S(CH3)2', and Ci_ 4a1kylC(0)NH2; preferably R8 is -CH2OH, -CH2NHR3, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1kyl, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, -S 03H, Ci_oalkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2.
Aspect 10. According to particular embodiments, the present invention provides a labeling precursor in the form of a compound of formula (I), wherein, each Z1 is independently selected from the group consisting of -0R11, -C(0)R11, nitro, hydroxyl, C1_ 6a1ky1, aryl, heteroaryl, -SR", _NR12c(o)R13, _C(0)2R12, cyano, -S(0)2R1 , halo, haloCi_6a1kyl, haloCi-6alkyloxy, heterocyclyl, amino, -NR11R12, _C(0)NRI2R13, _s(0)Rio, _S(0)2NR12R13; preferably Z1 is C1_ 6alkyloxy, ary1Ci_6a1kyloxy, aryloxy, heteroaryloxy, heterocyclyloxy, Ci_6alkylcarbonyl, arylCi_ 6a1ky1carb0ny1, arylcarbonyl, nitro. hydroxyl, C1_6alkyl, aryl, heteroaryl, C1_6a1kylthio, arylCi_6alkylthio, arvlthio, Ci_6a1ky1carbony1amino, arylCi_6alkylcarbonylamino, arylcarbonylamino, hydroxycarbonyl, CI 6alkyloxycarbonyl, arylCi6alkyloxycarbonyl, aryloxycarbonyl, cyano, C16a1ky1su1fony1, arylCI
oalkylsulfonyl, arylsulfonyl, halo, haloCi_6alky1, haloCi_oalkyloxy, heterocyclyl, amino, mono-C1_ 6alkylamino, di-Ci_6alkylamino, mono-arylamino, di-arylamino; preferably Z1 is C1_6alkyloxy, aryloxy, C1_6alkylcarbonyl, arylcarbonyl, nitro, hydroxyl, Ci_6alkyl, aryl, heteroaryl, Ci_6alkylthio, arylthio, CI_ 6alkylcarbonylamino, ary1C1_6alkylcarbonylamino, arylcarbonylamino, hydroxycarbonyl, CI_ 6alkyloxycarbonyl, aryloxycarbonyl, cyano, C1_6alkylsulfonyl arylsulfonyl, halo, haloCi_6alkyl, haloCi_ 6a1kv1oxy, heterocyclyl, amino, mono-Ci_6alkylamino, di-C1_6alkylamino;
preferably Z1 is Ci_4alky1oxy, aryloxy, C1_4a1ky1carb0ny1, arylcarbonyl, nitro, hydroxyl, C1_4a1ky1, aryl, heteroaryl, C1_4a1ky1thio, arvlthio, Ci_4alkylcarbonylamino, arylC1_4alkylcarbonylamino, arylcarbonylamino, hydroxycarbonyl, Ci_6alkyloxycarbonyl, aryloxycarbonyl, cyano, Ci_4alkylsulfonyl arylsulfonyl, haloCi_4alkyl, mono-CI_ 4a1ky1amin0, di-C1_4alkylamino;
wherein said Ci_6alkyl, or aryl, can be unsubstituted or substituted with one or more Ci_4alkyl, methoxy, nitro, -C(0)aryl, halo, trifluoromethyl, trifluoromethoxy; preferably said groups can be unsubstituted or substituted with one, two or three Ci_4alkyl, methoxy, nitro, -C(0)aryl, halo, trifluoromethyl, trifluoromethoxy.
Aspect 11. A solvate, hydrate, salt or prodrug of the compound of any one of aspects 1 to 10.
Aspect 12. Another aspect of the present invention provides a metal complex of a compound as defined herein (also called labeling precursor) such as the ones defined in any one of aspects 1 to 11, and an element of Group VII of the Periodic Table. Preferably, said element is a radionuclide, more preferably the element is "mTc or ''Re or 16Re.
Aspect 13. Yet another aspect of the present invention relates to a pharmaceutical composition comprising one or more pharmaceutically acceptable excipients and a metal complex as defined in the previous aspects.
Aspect 14. According to another aspect, the present invention also encompasses a metal complex as defined hereinabove or a pharmaceutical composition as defined hereinabove, for use as a medicament.
Aspect 15. According to yet another aspect, the present invention also encompasses a metal complex according to aspect 12 or a pharmaceutical composition according to aspect 13, for use in the treatment or prevention of cancer. In a preferred embodiment of said aspect, the radionuclide used for therapeutic use is 188Re or 186Re.
Aspect 16. According to yet another aspect, the present invention also encompasses a metal complex according to aspect 12, or a pharmaceutical composition according to aspect 13, for use as a radiodiagnostic agent for use in in-vivo imaging or detection of tumor or cancer cells or of in-vivo diagnosis of cancer in a subject. Preferred imaging methods are: positron emission tomography (PET), PET computed tomography (PET-CT) or single-photon emission tomography (SPECT).
In a preferred embodiment of said aspect, the radionuclide used for imaging is 99mTc.
Aspect 17. The metal complex or pharmaceutical composition for use according to aspect 15 or 16, wherein said cancer is a PSMA-expressing cancer or tumor.
Aspect 18. The metal complex or pharmaceutical composition for use according to aspect 17, wherein said cancer is selected from the group consisting of: conventional renal cell cancer, transitional cell of the bladder cancer, non-small-cell lung cancer, testicular-embryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer, preferably prostate cancer.
Aspect 19. A method of treating or preventing cancer in a subject comprising administering a therapeutically effective amount of the metal complex according to aspect 12, or a pharmaceutical composition according to aspect 13 to said patient. In a preferred embodiment of said aspect, the radionuclide used for therapeutic use is 188Rc or H6Re.
Aspect 20. A method of in-vivo imaging or detection of tumor or cancer cells or of in-vivo diagnosis of cancer in a subject, comprising administering a suitable amount of the metal complex according to aspect 12, or a pharmaceutical composition according to aspect 13 to said patient and visualizing said metal complex using an in-vivo radio-imaging method.
Preferred imaging methods are:
positron emission tomography (PET), PET computed tomography (PET-CT) or single-photon emission tomography (SPECT). In a preferred embodiment of said aspect, the radionuclide used for imaging is 99mTc.
Aspect 21. The method according to aspect 19 or 20, wherein said cancer is a PSMA-expressing cancer or tumor, more preferably wherein said cancer is selected from the group consisting of:
conventional renal cell cancer, transitional cell of the bladder cancer, non-small-cell lung cancer, testicular-embryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer, preferably prostate cancer.
Aspect 22. The present invention also encompasses a radiolabelling kit comprising:
- the labelling precursor (or compound) as defined hcrcinabovc, - a suitable buffering system, preferably selected from the group consisting of: phosphate buffers, acetate buffers, formate buffers; and HEPES buffers, more preferably phosphate buffers; even more preferably a sodium-phosphate buffer; and - a suitable reducing agent, enabling the reduction of the pertechnetate/perrhenate to a suitable oxidation state for coordination, most likely: Tc(V)0/Re(V)0, such as but not limited to: ascorbic acid, sodium borohydride, sodium dithionite, phosphines such as TCEP, and stannous chloride (Tin(II)chloride), preferably stannous chloride most preferably stannous chloride (tin(11)chloride).
Aspect 23. The radiolabelling kit according to aspect 22, wherein said compound and buffer are present in one or more vials, preferably glass vials, more preferably siliconized vials such as borosilicate glass vials.
Aspect 24. The radiolabelling kit according to aspect 22 or 23, wherein said compound and/or buffer arc present in lyophilised form.
Aspect 25. In some embodiments of the kit of any one of aspects 22 to 24, the reducing agents are selected from the group consisting of: ascorbic acid, sodium borohydride, sodium dithionite, phosphines such as TCEP, and stannous chloride (Tin(II)chloride), preferably stannous chloride.
Aspect 26. The radiolabelling kit according to any one of aspects 22 to 25, wherein said kit also comprises a suitable anti-oxidant agent such as but not limited to: sodium ascorbate/ascorbic acid mixtures, sodium borohydride, sodium dithionite, and stannous chloride.
Aspect 27. The radiolabelling kit according to any one of aspects 22 to 26, wherein said kit also comprises a suitable auxiliary agents or ligands enabling the protection against reoxidation of Tc(V)0/Re(V)0 as competing reaction to coordination, such as but not limited to: tartrate, citrate or glucoheptonate.
Aspect 28. Additionally sequestering agents competing with the chelator for radiometal impurities can be present as well in the kit. Preferably, such sequestering agents are selected from:, mono-, di-, oligo-, or polysaccharides, polynucleate agents, glucoheptonate, tartrate salts and citrate salts.
Aspect 29. In some embodiments, the kit according to any one of aspects 22 to 28 can also include a stabilizer enabling the storage of the kit known in the art, and/or further excipients such as lyophilization agents, matrix reagents or solubilizers known in the art.
Aspect 30. In yet another embodiment, the present invention also provides for a method of radiolabelling a compound or labelling precursor according to any one of aspects 1 to 11, comprising the steps of:
- providing a compound or labelling precursor according to any one of aspects 1 to 11, - providing a suitable buffering system - providing a radionuclide, preferably selected from 99'Tc or "Re and 186Re - providing a suitable reducing agent - mixing all components at a suitable pH and allowing the complexation of the radionuclide and labelling precursor to occur, thereby obtaining a radiolabelled compound.
Aspect 31. The method of aspect 30, wherein said buffering system is selected from the group consisting of: phosphate buffers, acetate buffers, formate buffers, and HEPES
buffers, more preferably phosphate buffers, even more preferably a sodium-phosphate buffer.
Aspect 32. The method of aspects 30 or 31, wherein when the radionuclide used is 99mTc, the precursor and buffer are mixed and a suitable amount of pertechnetate is eluated in saline from a molybdenum-99 (99Mo/99Tc) generator into said mixture. Preferably, the pH of said mixture is set at between 2 and 12 preferably between 7 to 10, and preferably, the temperature of the mixture is kept between 20 and 130 C , preferably from about 20 to 98 C for about 2 to 60 minutes preferably 5 to 15 minutes.
Aspect 32. The method of any one of aspects 30 to 31, wherein when the radionuclide used is "'Re, the precursor and buffer are mixed and a suitable amount of Rhenium is eluted in saline from a tungsten-188wr /188Re) generator into said mixture (with or without postprocessing of the generator eluate). Preferably, the pH is set at between 2 and 9 and the mixture is heated at about 95 to 99 C for about 5 to 60 minutes.
Aspect 33. The method of any one of aspects 30 to 32, wherein when the radionuclide used is 'Re, the precursor and buffer are mixed and a suitable amount of Rhenium-186 is produced from a cyclotron or reactor and added into said mixture. Preferably, the pH is set at between 2 and 12, preferably between 2 and 9 and the temperature of the mixture is kept between 20 and 130 C, preferably from about 20 to 98 C for about 5 to 60 minutes.
Aspect 34. Use of the metal complex according to aspect 12, or a pharmaceutical composition according to aspect 13 for the manufacturing of a medicament for treating or preventing cancer in a subject. In a preferred embodiment of said aspect, the radionuclide used for therapeutic use is 188Re or 186Re.
Aspect 35. Use of the metal complex according to aspect 12, or a pharmaceutical composition according to aspect 13 for the manufacturing of a medicament for in-vivo imaging or detection of tumor or cancer cells or of in-vivo diagnosis of cancer in a subject. Preferred imaging methods are: positron emission tomography (PET), PET computed tomography (PET-CT) or single-photon emission tomography (SPECT). In a preferred embodiment of said aspect, the radionuclide used for imaging is 99mTc.
Aspect 36. The method according to aspect 34 or 35, wherein said cancer is a PSMA-expressing cancer or tumor, more preferably wherein said cancer is selected from the group consisting of:
conventional renal cell cancer, transitional cell of the bladder cancer, non-small-cell lung cancer, testicular-embryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer, preferably prostate cancer.
The above and further aspects and preferred embodiments of the invention are described in the following sections and in the appended claims. The subject matter of the appended claims is hereby specifically incorporated in this specification.
BRIEF DESCRIPTION OF THE FIGURES
The following description of the figures of specific embodiments of the invention is merely exemplary in nature and is not intended to limit the present teachings, their application or uses Figure 1 represents photographs obtained using planar imaging technique. The planar imaging photographs show LNCaP tumor bearing mice that have been injected with exemplary compounds according to the invention. An activity standard (approx. 1 MBq of the respective tracer, indicated with an arrow) was placed next to the mice as a control of the imaging.
DETAILED DESCRIPTION
As used herein, the singular forms "a", "an", and "the" include both singular and plural referents unless the context clearly dictates otherwise.
The terms "comprising", "comprises" and "comprised of' as used herein are synonymous with "including", "includes" or "containing", "contains", and are inclusive or open-ended and do not exclude additional, non-recited members, elements or method steps. The terms also encompass "consisting of' and "consisting essentially of', which enjoy well-established meanings in patent terminology.
The recitation of numerical ranges by endpoints includes all numbers and fractions subsumed within the respective ranges, as well as the recited endpoints. This applies to numerical ranges irrespective of whether they are introduced by the expression "from... to ..." or the expression "between.., and... or another expression.
The terms "about" or "approximately" as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, are meant to encompass variations of and from the specified value, such as variations of +1-10% or less, preferably +/-5% or less, more preferably +1-1% or less, and still more preferably +/-0.1% or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier "about" or "approximately" refers is itself also specifically, and preferably, disclosed.
Whereas the terms "one or more" or "at least one", such as one or more members or at least one member of a group of members, is clear per se, by means of further exemplification, the term encompasses inter alict a reference to any one of said members, or to any two or more of said members, such as, e.g., any >3, >4, >5, >6 or >7 etc. of said members, and up to all said members. In another example, "one or more" or "at least one" may refer to 1, 2, 3, 4, 5, 6, 7 or more.
The discussion of the background to the invention herein is included to explain the context of the invention. This is not to be taken as an admission that any of the material referred to was published, known, or part of the common general knowledge in any country as of the priority date of any of the claims.
Throughout this disclosure, various publications, patents and published patent specifications are referenced by an identifying citation. All documents cited in the present specification are hereby incorporated by reference in their entirety. In particular, the teachings or sections of such documents herein specifically referred to are incorporated by reference.
Unless otherwise defined, all terms used in disclosing the invention, including technical and scientific terms, have the meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. By means of further guidance, term definitions are included to better appreciate the teaching of the invention. When specific terms are defined in connection with a particular aspect of the invention or a particular embodiment of the invention, such connotation or meaning is meant to apply throughout this specification, i.e., also in the context of other aspects or embodiments of the invention, unless otherwise defined. For example, embodiments directed to products are also applicable to corresponding features of methods and uses.
In the following passages, different aspects or embodiments of the invention are defined in more detail.
Each aspect or embodiment so defined may be combined with any other aspect(s) or embodiment(s) unless clearly indicated to the contrary. In particular, any feature indicated as being preferred or advantageous may be combined with any other feature or features indicated as being preferred or advantageous.
Reference throughout this specification to "one embodiment", "an embodiment"
means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment of the present invention. Thus, appearances of the phrases -in one embodiment- or "in an embodiment" in various places throughout this specification are not necessarily all referring to the same embodiment. Furthermore, the particular features, structures or characteristics may be combined in any suitable manner, as would be apparent to a person skilled in the art from this disclosure, in one or more embodiments. Furthermore, while some embodiments described herein include some but not other features included in other embodiments, combinations of features of different embodiments are meant to be within the scope of the invention, and form different embodiments, as would be understood by those in the art. For example, in the appended claims, alternative combinations of claimed embodiments are encompassed, as would be understood by those in the art.
When describing the present invention, the terms used are to be construed in accordance with the following definitions, unless a context dictates otherwise.
Whenever the term -substituted" is used herein, it is meant to indicate that one or more hydrogen atoms on the atom indicated in the expression using "substituted- is replaced with a selection from the indicated group, provided that the indicated atom's normal valence is not exceeded, and that the substitution results in a chemically stable compound, i.e. a compound that is sufficiently robust to survive isolation from a reaction mixture.
Where groups can be substituted, such groups may be substituted with one or more, and preferably one, two or three substituents. Preferred substituents may be selected from but not limited to, for example, the group comprising halo, hydroxyl, alkyl, alkoxy, trifluoromethyl, trifluoromethoxy, cycloalkyl, aryl, arylalkyl, heterocyclyl, heteroaryl, cyano, amino, nitro, carboxyl, and mono-or dialkylamino.
The term -halo" or -halogen" as a group or part of a group is generic for fluoro, chloro, bromo, iodo.
The term "hydroxyl- or "hydroxy- as used herein refers to the group -OH.
The term -cyano" as used herein refers to the group -1\1.
The term -amino" as used herein refers to the -NH2group.
The term "nitro- as used herein refers to the -NO2 group.
The term "carboxy" or "carboxyl" or "hydroxycarbonyl" as used herein refers to the group -0O21-1.
The term "aminocarbonyl" as used herein refers to the group -CONH2.
The term "Ci_6alkyl", as a group or part of a group, refers to a hydrocarbyl group of comprising from 1 to 6 carbon atoms. Ci_6alkyl groups may be linear or branched and may be substituted as indicated herein. Generally, alkyl groups of this invention comprise from 1 to 6 carbon atoms, preferably from 1 to 5 carbon atoms, preferably from 1 to 4 carbon atoms, more preferably from 1 to 3 carbon atoms, still WO 2022/253785 2.) more preferably 1 to 2 carbon atoms. When a subscript is used herein following a carbon atom, the subscript refers to the number of carbon atoms that the named group may contain. For example, "C1_ 6a1ky1" includes methyl, ethyl, n-propyl, i-propyl, butyl and its isomers (e.g. n-butyl, i-butyl and t-butyl);
pentyl and its isomers, hexyl and its isomers. For example, "Ci_salkyl"
includes all linear or branched alkyl groups with between 1 and 5 carbon atoms, and thus includes methyl, ethyl, n-propyl, i-propyl, butyl and its isomers (e.g. n-butyl, i-butyl and t-butyl); pentyl and its isomers. For example, "Ci_4alkyl"
includes all linear or branched alkyl groups with between 1 and 4 carbon atoms, and thus includes methyl, ethyl, n-propyl, i-propyl, butyl and its isomers (e.g. n-butyl, i-butyl and t-butyl). For example "Ci_3a1kyl" includes all linear or branched alkyl groups with between 1 and 3 carbon atoms, and thus includes methyl, ethyl, n-propyl, i-propyl.
When the term "Ci_6alkyl" is used as a suffix following another term, as in "hydroxyC1_6alkyl alkyl,"
this is intended to refer to an Ci_6alkyl group, as defined above, being substituted with one or two (preferably one) substituent(s) selected from the other, specifically-named group, also as defined herein.
The term "hydroxyCi_6alkyl" therefore refers to a -Ra-OH group wherein R. is alkylene as defined herein.
The term "haloCi_6alkyl" as a group or part of a group, refers to a CI _6alkyl group having the meaning as defined above wherein one, two, or three hydrogen atoms are each replaced with a halogen as defined herein. Non-limiting examples of such haloalkyl groups include chloromethyl, 1-bromoethyl, fluoromethyl, difluoromethyl, trifluoromethyl, 1,1,1-trifluoroethyl, trichloromethyl, tribromomethyl, and the like.
The term Arifluoromethyl" as used herein refers to the group ¨CF).
The term "trifluoromethoxy" as used herein refers to the group ¨0CF3.
The term "Ci_6alkyloxy" or "Ci_6alkyloxy-, as a group or part of a group, refers to a group having the formula ¨ORb wherein Rb is Ci_6alkyl as defined herein above. Non-limiting examples of suitable Ci_ 6alkoxy include methoxy, ethoxy, propoxy, isopropoxy, butoxy, isobutoxy, see-butoxy, tert-butoxy, pentyloxy and hexyloxy.
The term "haloCi_6alkyloxy" as a group or part of a group, refers to a C1_6alkyloxy group having the meaning as defined above wherein one, two, or three hydrogen atoms are each replaced with a halogen as defined herein. Non-limiting examples of such haloCi_6alkyl groups include chloromethyloxy, 1-fluoromethyloxy, difluoromethyloxy, trifluoromethyloxy, 1,1,1-trifluoroethyloxy, trichloromethyloxy, tribromomethyloxy, and the like.
The term "C2_6alkeny1- as a group or part of a group, refers to an unsaturated hydrocarbyl group, which may be linear, or branched comprising one or more carbon-carbon double bonds and comprising from 2 to 6 carbon atoms. For example, C2_4alkenyl includes all linear, or branched alkenyl groups having 2 to 4 carbon atoms. Examples of C2_6alkenyl groups are ethenyl, 2-propenyl, 2-butenyl, 3-butenyl, 2-pentenyl and its isomers, 2-hexenyl and its isomers, 2,4-pentadienyl. and the like.
The term "aryl", as a group or part of a group, refers to a polyunsaturated, aromatic hydrocarbyl group having a single ring (i.e. phenyl) or multiple aromatic rings fused together (e.g. naphthyl), or linked covalently, typically comprising 6 to 12 carbon atoms; wherein at least one ring is aromatic, preferably comprising 6 to 10 carbon atoms, wherein at least one ring is aromatic. The aromatic ring may optionally include one to two additional rings (either cycloalkyl, heterocyclyl or heteroaryl) fused thereto.
Examples of suitable aryl include C6_12aryl, preferably C6_Haryl, more preferably C6_8aryl. Non-limiting examples of aryl comprise phenyl, biphenylyl, biphenylenvl, or 1-or 2-naphthanely1; 5- or 6-tetralinyl, 1-, 2-, 3-, 4-, 5-, 6-, 7- or 8-azulenyl, 4-, 5-, 6 or 7-indenyl, 4- or 5-indanyl, 5-, 6-, 7- or 8-tetrahydronaphthyl, 1,2,3,4-tetrahydronaphthyl, 1,4-dihydronaphthyl;
anthracenyl, dibenzosuberyl, and 1-, 2-, 3-, 4- or 5-pyrenyl. A "substituted aryl" refers to an aryl group having one or more substituent(s) (for example 1, 2 or 3 substituent(s), or 1 to 2 substituent(s)), at any available point of attachment.
The term "aryloxy", as a group or part of a group, refers to a group having the formula -ORg wherein Rg is aryl as defined herein above.
The term "arylCi_6alkyl", as a group or part of a group, means a Ci_6alkyl as defined herein, wherein at least one hydrogen atom is replaced by at least one aryl as defined herein.
Non-limiting examples of arylCi_6alkyl group include benzyl, phenethyl, dibenzylmethyl, methylphenylmethyl, 3-(2-naphthyl)-butyl, 9-anthrylmethyl, 9-fluorenymethyl and the like.
The term "arylCi_6alkyloxy", as a group or part of a group, refers to a group having the formula -ORg wherein Rg is arylCi_6alkylas defined herein above.
The terms "heterocyclyl" or "heterocycloakyl" or "heterocyclo", as a group or part of a group, refer to non-aromatic, fully saturated or partially unsaturated cyclic groups (for example, 3 to 7 member monocyclic, 7 to 11 member bicyclic, or comprising a total of 3 to 10 ring atoms) which have at least one heteroatom in at least one carbon atom-containing ring; wherein said ring may be fused to an aryl, cycloalkyl, heteroaryl or heterocyclyl ring. Each ring of the heterocyclyl group containing a heteroatom may have 1, 2, 3 or 4 heteroatoms selected from N, 0 and/or S, where the N and S heteroatoms may optionally be oxidized and the N heteroatoms may optionally be quatemized, and wherein at least one carbon atom of heterocyclyl can be oxidized to form at least one C=0. The heterocyclic group may be attached at any heteroatom or carbon atom of the ring or ring system, where valence allows. The rings of multi-ring heterocycles may be fused, bridged and/or joined through one or more Spiro atoms.
Non limiting exemplary heterocyclic groups include xanthenyl, aziridinyl, oxiranyl, thiiranyl, azetidinyl, oxetanyl, pyrrolidiiiyl, thietanyl, 2-imidazoljnyl, pyrazolidinyl isoxazolinyl, oxazolidinyl, isoxazolidinyl, thiazolidinyl, isothiazolidinyl, piperidinyl, succinimidyl, 3H-indolyl, indolinyl, chromanyl (also known as 3,4-dihydrobenzo[b]pyranyl), isoindolinyl, 2H-pyrrolyl, 1 , 2-pyn-olinyl , 3 -pyn-ol inyl , 4H-quinolizinyl , 2-oxopiperazinyl , piperazinyl , homopiperazinyl, 2-pyrazolinyl, 3-pyrazolinyl, tetrahydro-2H-pyranyl, 2H-pyranyl, 4H-pyranyl, 3,4-dihydro-2H-pyranyl, 3-dioxolanyl, 1,4-dioxanyl, 2,5-dioximidazolidinyl, 2-oxopiperidinyl, 2-oxopyrrolodinyl, indolinyl, tetrahydropyranyl, tetrahydrofuranyl, tetrahydrothiophenyl, tetrahydroquinolinyl, tetrahydroisoquinolin-l-yl, tetrahydroisoquinolin-2-yl, tetrahydroisoquinolin-3-yl, tetrahydroisoquinolin-4-yl, thiomorpholin-4-yl, thiomorpholin-4-ylsulfoxide, thiomorpholin-4-ylsulfone, 1,3-dioxolanyl, 1,4-oxathianyl, 1,4-dithianyl, 1,3,5-trioxanyl, 1H-pyrrolizinyl, tetrahydro-1,1-dioxothiophenyl, N- formylpiperazinyl, and morpholin-4-yl. The term "aziridinyl" as used herein includes aziridin-l-yl and aziridin-2-yl. The term "oxyranyl" as used herein includes oxyrany1-2-yl. The term "thiiranyl" as used herein includes thiiran-2-yl. The term "azetidinyl"
as used herein includes azetidin-l-yl, azetidin-2-y1 and azetidin-3-yl. The term "oxetanyl" as used herein includes oxetan-2-y1 and oxetan-3-yl. The term "thietanyl" as used herein includes thietan-2-y1 and thietan-3-yl. The term "pyrrolidinyl" as used herein includes pyrrolidin- 1-yl, pyrrolidin-2-y1 and pyrrolidin-3-yl. The term "tetrahydrofuranyl" as used herein includes tetrahydrofuran-2-y1 and tetrahydrofuran-3-yl. The term "tetrahydrothiophenyl" as used herein includes tetrahydrothiophen-2-y1 and tetrahydrothiophen-3-yl.
The term "succinimidyl" as used herein includes suceinimid-1-y1 and succininmid-3-yl. The term "di hydropyrrol yl " as used herein includes 2,3 -di hydropyrrol -1-y1 , 2,3 -dihydro-1H-pyrrol -2-yl, 2,3 -dihydro-1H-pyrrol-3-yl, 2,5 -dihydropyrrol-1 -yl, 2,5 -dihydro-1H-pyrrol-3 -yl and 2,5 -dihydropyrrol-5 -yl. The term "2H-pyrroly1" as used herein includes 2H-pyrrol-2-yl, 2H-pyrrol-3-yl, 2H-pyrrol-4-y1 and 2H-pyrrol-5-yl. The term "3H-pyrroly1" as used herein includes 3H-pyrrol-2-yl, 3H-pyrrol-3-yl, 3H-pyrrol-4-y-1 and 3H-pyrrol-5-yl. The term "dihydrofuranyl" as used herein includes 2,3-dihydrofuran-2-yl, 2,3-dihydrofuran-3-yl, 2,3-dihydrofuran-4-yl, 2,3-dihydrofuran-5-yl, 2,5-dihydrofuran-2-yl, 2,5-dihydrofuran-3-yl, 2,5-dihydrofuran-4-y1 and 2,5-dihydrofuran-5-yl. The term "dihydrothiophenyl" as used herein includes 2,3-dihydrothiophen-2-yl, 2,3-dihydrothiophen-3-yl, 2,3-dihydrothiophen-4-yl, 2,3 -dihydrothiophen-5 -yl, 2,5 -dihydrothiophen-2-yl, 2,5 -dihydrothiophen-3 -yl, 2,5 -dihydrothiophen-4-y1 and 2,5-dihydrothiophen-5-yl. The term "imidazolidinyl" as used herein includes imidazolidin- 1 -yl, imidazolidin-2-y1 and imidazolidin-4-yl. The term "pyrazolidinyl" as used herein includes pyrazolidin-l-yl, pyrazolidin-3-y1 and pyrazolidin-4-yl. The term "imidazolinyl" as used herein includes imidazolin- 1 -yl, imidazolin-2-yl, imidazolin-4-y1 and imidazolin-5-yl. The term "pyrazolinyl"
as used herein includes 1-pyrazolin-3-yl, 1-pyrazolin-4-yl, 2-pyrazolin-l-yl, 2-pyrazolin-3-yl, 2-pyrazolin-4-yl, 2 -pyrazolin-5 -yl, 3-pyrazolin-1-yl, 3 -pyrazolin-2-yl, 3 -pyrazolin-3 -yl, 3 -pyrazolin-4 -y1 and 3-pyrazolin-5-yl. The term "dioxolanyl" also known as "1,3-dioxolanyl" as used herein includes dioxolan-2-yl, dioxolan-4-y1 and dioxolan-5-yl. The term "dioxoly1" also known as "1,3-dioxoly1" as used herein includes dioxo1-2-yl, dioxo1-4-y1 and dioxo1-5-yl. The term "oxazolidinyl" as used herein includes oxazolidin-2-yl, oxazolidin-3-yl, oxazolidin-4-y1 and oxazolidin-5-yl. The term "isoxazolidinyl" as used herein includes isoxazolidin-2-yl, isoxazolidin-3-yl, isoxazolidin-4-y1 and isoxazolidin-5-yl. The term "oxazolinyl" as used herein includes 2-oxazoliny1-2-yl, 2-oxazoliny1-4-yl, 2-oxazoliny1-5-yl, 3-oxazoliny1-2-yl, 3-oxazoliny1-4-yl, 3-oxazoliny-1-5-yl, 4-oxazoliny1-2-yl, 4-oxazoliny1-3-yl, 4-oxazoliny1-4-y1 and 4-oxazoliny1-5-yl. The term "isoxazolinyl" as used herein includes 2-isoxazoliny1-3-yl, 2-isoxazoliny1-4-yl, 2-isoxazoliny1-5-yl, 3-isoxazoliny1-3-yl, 3-isoxazoliny1-4-yl. 3-isoxazoliny1-5-yl, 4-isoxazoliny1-2-yl, 4-isoxazoliny1-3-yl, 4-isoxazoliny1-4-y1 and 4-isoxazoliny1-5-yl. The term "thiazolidinyl" as used herein includes thiazolidin-2-yl, thiazolidin-3-yl, thiazolidin-4-y1 and thiazolidin-5-yl. The term "isothiazolidinyl" as used herein includes isothiazolidin-2-yl, isothiazolidin-3-yl, isothiazolidin-4-y1 and isothiazolidin-5-yl. The term -chromanyl" as used herein includes chroman-2-yl, chroman-3-yl, chroman-4-yl, chroman-5-yl, chroman-6-yl, chroman-7-yl and chroman-8-yl. The term "-thiazolinyl" as used herein includes 2-thiazoliny1-2-yl, 2-thiazoliny1-4-yl, 2-thiazoliny1-5-yl, 3-thiazoliny1-2-yl, 3-thiazoliny1-4-yl, 3-thiazoliny1-5-yl, 4-thiazoliny1-2-yl, 4-thiazoliny1-3-yl, 4-thiazoliny1-4-y1 and 4-thiazoliny1-5-yl. The term "isothiazolinyl- as used herein includes 2-isothiazoliny1-3-yl, 2-isothiazoliny1-4-yl, 2-isothiazoliny1-5-yl,
3-isothiazoliny1-3-yl, 3-isothiazoliny1-4-yl, 3-isothiazoliny1-5-yl, 4-isothiazoliny1-2-yl, 4-isothiazoliny1-3-yl, 4-isothiazolinyl-
4-y1 and 4-isothiazoliny1-5-yl. The term "piperidyl- also known as "piperidinyl- as used herein includes piperid-l-yl, piperid-2-yl, piperid-3-y1 and piperid-4-yl. The term -dihydropyridinyl" as used herein includes 1,2-dihydropyridin-1-yl, 1,2-dihydropyridin-2-yl, 1,2-dihydropyridin-3-yl, 1,2-di hydropyri din -4-y1 , 1,2-di hydropyri di n -5 -yl, 1,2-dihydropyri di n-6-y1 , 1,4-di hydropyri di n -1-y1 , 1,4 -dihydropyridin-2 -yl, 1,4-dihydropyridin-3-yl, 1,4-dihydropyridin-4-yl, 2,3 -dihydropyridin-2-yl, 2,3 -dihydropyridin-3-yl, 2,3 -dihydropyridin-4-yl, 2,3 -dihydropyridin-5-y1 , 2,3 -dihydropyridin-6-yl, 2,5 -dihydropyridin-2-yl, 2,5 -dihydropyridin-3 -yl, 2,5 -dihydropyridin-4-y1 , 2,5 -dihydropyridin-5 -yl, 2,5 -dihydropyridin-6-yl, 3,4-dihydropyridin-2-yl, 3,4-dihydropyridin-3-yl, 3,4-dihydropyridin-4-yl, 3,4-dihydropyridin-5-y1 and 3,4-dihydropyridin-6-yl. The term "tetrahydropyridinyl" as used herein includes 1,2,3 ,4-tetrahydropyridin-l-yl, 1,2,3 ,4-tetrahydropyridin-2 -yl, 1,2,3 ,4-tetrahydropyridin-3 -yl, 1,2,3,4-tetrahydropyridin-4-yl, 1,2,3,4-tetrahydropyridin-5-yl, 1,2,3,4-tetrahydropyridin-6-yl, 1,2,3,6-tetrahydropyridin-l-yl, 1,2,3,6-tetrahydropyridin-2-yl, 1,2,3 ,6-tetrahydropyridin-3 -yl, 1,2,3,6-tetrahydropyridin-4-yl, 1,2,3,6-tetrahydropyridin-5-yl, 1,2,3 ,6-tetrahydropyridin-6-yl, 2,3,4,5 -tetrahydropyridin-2-yl, 2,3,4,5 -tetrahydropyri din-3 -yl, 2,3,4,5 -tetrahydropyridin-3-yl, 2,3,4,5 -tetrahydropyridin-4-yl, 2,3,4,5-tetrahydropyridin-5-y1 and 2,3,4,5-tetrahydropyridin-6-yl. The term "tetrahydropyranyl" also known as "oxanyl" or "tetrahydro-2H-pyranyl", as used herein includes tetrahydropyran-2-yl, tetrahydropyran-3-y1 and tetrahydropyran-4-yl. The term -2H-pyranyl" as used herein includes 2H-pyran-2-yl, 2H-pyran-3-yl, 2H-pyran-4-yl, 2H-pyran-5-y1 and 2H-pyran-6-yl. The term -4H-pyranyl" as used herein includes 4H-pyran-2-yl, 4H-pyran-3-y1 and 4H-pyran-4-yl. The term "3,4-dihydro-2H-pyranyl" as used herein includes 3,4-dihydro-2H-pyran-2-yl, 3,4-dihydro-2H-pyran-3-yl, 3,4-dihydro-2H-pyran-4-yl, 3,4-dihydro-2H-pyran-5-y1 and 3,4-dihydro-2H-pyran-6-yl. The term "3,6-dihydro-2H-pyranyl" as used herein includes 3,6-dihydro-2H-pyran-2-yl, 3,6-dihydro-2H-pyran-3-yl, 3,6-dihydro-2H-pyran-4-yl, 3,6-dihydro-2H-pyran-5-y1 and 3,6-dihydro-2H-pyran-6-yl. The term "tetrahydrothiophenyl", as used herein includes tetrahydrothiophen-2-yl, tetrahydrothiophenyl -3-y1 and tetrahydrothiophenyl -4-yl. The term "2H-thiopyranyl" as used herein includes 2H-thiopyran-2-yl,
5 26 2H-thiopyran-3-yl, 2H-thiopyran-4-yl, 2H-thiopyran-5-y1 and 2H-thiopyran-6-yl.
The term "4H-thiopyranyl" as used herein includes 4H-thiopyran-2-yl, 4H-thiopyran-3-y1 and 4H-thiopyran-4-yl. The temi "3,4-dihydro-2H-thiopyranyl" as used herein includes 3,4-dihydro-2H-thiopyran-2-yl, 3,4-dihydro-2H-thiopyran-3-yl, 3,4-dihydro-2H-thiopyran-4-yl, 3,4-dihydro-2H-thiopyran-5-y1 and 3,4-dihydro-2H-thiopyran-6-yl. The term "3,6-dihydro-2H-thiopyranyl" as used herein includes 3,6-dihydro-2H-thiopyran-2-yl, 3,6-dihydro-2H-thiopyran-3-yl, 3 ,6-dihydro-2H-thiopyran-4-yl, 3 ,6-dihydro-2H-thiopyran-5-y1 and 3,6-dihydro-2H-thiopyran-6-yl. The term "piperazinyl" also known as "piperazidinyl" as used herein includes piperazin- 1-y1 and piperazin-2-yl.
The term "morpholinyl" as used herein includes morpholin-2-yl, morpholin-3-y1 and morpholin-4-yl. The term "thiomorpholinyl"
as used herein includes thiomorpholin-2-yl, thiomorpholin-3-y1 and thiomorpholin-4-yl. The term "dioxanyl" as used herein includes 1,2-dioxan-3-yl, 1,2-dioxan-4-yl, 1,3-dioxan-2-yl, 1,3-dioxan-4-yl, 1,3-dioxan-5-y1 and 1,4-dioxan-2-yl. The term "dithianyl" as used herein includes 1,2-dithian-3-yl, 1,2-dithian-4-yl, 1,3-dithian-2-yl, 1,3-dithian-4-yl, 1,3-dithian-5-y1 and 1,4-dithian-2-yl. The term "oxathianyl" as used herein includes oxathian-2-y1 and oxathian-3-yl. The term "trioxanyl" as used herein includes 1,2,3-trioxan-4-yl, 1,2,3-trioxay-5-yl, 1,2,4-trioxay-3-yl, 1,2,4-trioxay-5-yl, 1,2,4-trioxay-6-y1 and 1,3,4-trioxay-2-yl. The term "azepanyl" as used herein includes azepan-l-yl, azepan-2-yl, azepan-l-yl, azepan-3-y1 and azepan-4-yl. The term "homopiperazinyl" as used herein includes homopiperazin-l-yl, homopiperazin-2-yl, homopiperazin-3-y1 and homopiperazin-4-yl. The term "indolinyl" as used herein includes indolin-l-yl, indolin-2-yl, indolin-3-yl, indolin-4-yl, indolin-5-yl, indolin-6-yl, and indolin-7-yl. The term "quinolizinyl" as used herein includes quinolizidin-l-yl, quinolizidin-2-yl, quinolizidin-3-y1 and quinolizidin-4-yl. The term "isoindolinyl" as used herein includes isoindolin-l-yl, isoindolin-2-yl, isoindolin-3-yl, isoindolin-4-yl, isoindolin-5-yl, isoindolin-6-yl, and isoindolin-7-yl. The term -3H-indoly1" as used herein includes 3H-indo1-2-yl, 3H-indo1-3-yl, 3H-indo1-4-yl, 3H-indo1-5-yl, 3H-indo1-6-yl, and 3H-indo1-7-yl. The term "quinolizinyl" as used herein includes quinolizidin-l-yl, quinolizidin-2-yl, quinolizidin-3-y1 and quinolizidin-4-yl. The term "quinolizinyl" as used herein includes quinolizidin-l-yl, quinolizidin-2-yl, quinolizidin-3-y1 and quinolizidin-4-yl. The term "tetrahydroquinolinyl" as used herein includes tetrahydroquinolin-l-yl, tetrahydroquinolin-2-yl, tetrahydroquinolin-3-yl, tetrahydroquinolin-4-yl, tetrahydroquinolin-5-yl, tetrahydroquinolin-6-yl, tetrahydroquinolin-7-y1 and tetrahydroquinolin-8-yl.
The term "tetrahydroisoquinolinyl" as used herein includes tetrahydroisoquinolin-l-yl, tetrahydroisoquinolin-2-Y1, tetrahydroisoquinolin-3-yl, tetrahydroisoquinolin-4-yl, tetrahydroisoquinolin-5-yl, tetrahydroisoquinolin-6-yl, tetrahydroisoquinolin-7-y1 and tetrahydroisoquinolin-8-yl. The term "1H-pyrrolizine" as used herein includes 1H-pyrrolizin- 1 -yl, 1H-pyrrolizin-2-yl, 1H-pyrrolizin-3-yl, 1H-pyrrolizin-5-yl, 1H-pyrrolizin-6-y1 and 1H-pyrrolizin-7-yl. The term "3H-pyrrolizine" as used herein includes 3H-pyrrolizin-1-yl, 3H-pyrrolizin-2-yl, 3H-pyrrolizin-3-yl, 3H-pyrrolizin-5-yl, 3H-pyrrolizin-
The term "4H-thiopyranyl" as used herein includes 4H-thiopyran-2-yl, 4H-thiopyran-3-y1 and 4H-thiopyran-4-yl. The temi "3,4-dihydro-2H-thiopyranyl" as used herein includes 3,4-dihydro-2H-thiopyran-2-yl, 3,4-dihydro-2H-thiopyran-3-yl, 3,4-dihydro-2H-thiopyran-4-yl, 3,4-dihydro-2H-thiopyran-5-y1 and 3,4-dihydro-2H-thiopyran-6-yl. The term "3,6-dihydro-2H-thiopyranyl" as used herein includes 3,6-dihydro-2H-thiopyran-2-yl, 3,6-dihydro-2H-thiopyran-3-yl, 3 ,6-dihydro-2H-thiopyran-4-yl, 3 ,6-dihydro-2H-thiopyran-5-y1 and 3,6-dihydro-2H-thiopyran-6-yl. The term "piperazinyl" also known as "piperazidinyl" as used herein includes piperazin- 1-y1 and piperazin-2-yl.
The term "morpholinyl" as used herein includes morpholin-2-yl, morpholin-3-y1 and morpholin-4-yl. The term "thiomorpholinyl"
as used herein includes thiomorpholin-2-yl, thiomorpholin-3-y1 and thiomorpholin-4-yl. The term "dioxanyl" as used herein includes 1,2-dioxan-3-yl, 1,2-dioxan-4-yl, 1,3-dioxan-2-yl, 1,3-dioxan-4-yl, 1,3-dioxan-5-y1 and 1,4-dioxan-2-yl. The term "dithianyl" as used herein includes 1,2-dithian-3-yl, 1,2-dithian-4-yl, 1,3-dithian-2-yl, 1,3-dithian-4-yl, 1,3-dithian-5-y1 and 1,4-dithian-2-yl. The term "oxathianyl" as used herein includes oxathian-2-y1 and oxathian-3-yl. The term "trioxanyl" as used herein includes 1,2,3-trioxan-4-yl, 1,2,3-trioxay-5-yl, 1,2,4-trioxay-3-yl, 1,2,4-trioxay-5-yl, 1,2,4-trioxay-6-y1 and 1,3,4-trioxay-2-yl. The term "azepanyl" as used herein includes azepan-l-yl, azepan-2-yl, azepan-l-yl, azepan-3-y1 and azepan-4-yl. The term "homopiperazinyl" as used herein includes homopiperazin-l-yl, homopiperazin-2-yl, homopiperazin-3-y1 and homopiperazin-4-yl. The term "indolinyl" as used herein includes indolin-l-yl, indolin-2-yl, indolin-3-yl, indolin-4-yl, indolin-5-yl, indolin-6-yl, and indolin-7-yl. The term "quinolizinyl" as used herein includes quinolizidin-l-yl, quinolizidin-2-yl, quinolizidin-3-y1 and quinolizidin-4-yl. The term "isoindolinyl" as used herein includes isoindolin-l-yl, isoindolin-2-yl, isoindolin-3-yl, isoindolin-4-yl, isoindolin-5-yl, isoindolin-6-yl, and isoindolin-7-yl. The term -3H-indoly1" as used herein includes 3H-indo1-2-yl, 3H-indo1-3-yl, 3H-indo1-4-yl, 3H-indo1-5-yl, 3H-indo1-6-yl, and 3H-indo1-7-yl. The term "quinolizinyl" as used herein includes quinolizidin-l-yl, quinolizidin-2-yl, quinolizidin-3-y1 and quinolizidin-4-yl. The term "quinolizinyl" as used herein includes quinolizidin-l-yl, quinolizidin-2-yl, quinolizidin-3-y1 and quinolizidin-4-yl. The term "tetrahydroquinolinyl" as used herein includes tetrahydroquinolin-l-yl, tetrahydroquinolin-2-yl, tetrahydroquinolin-3-yl, tetrahydroquinolin-4-yl, tetrahydroquinolin-5-yl, tetrahydroquinolin-6-yl, tetrahydroquinolin-7-y1 and tetrahydroquinolin-8-yl.
The term "tetrahydroisoquinolinyl" as used herein includes tetrahydroisoquinolin-l-yl, tetrahydroisoquinolin-2-Y1, tetrahydroisoquinolin-3-yl, tetrahydroisoquinolin-4-yl, tetrahydroisoquinolin-5-yl, tetrahydroisoquinolin-6-yl, tetrahydroisoquinolin-7-y1 and tetrahydroisoquinolin-8-yl. The term "1H-pyrrolizine" as used herein includes 1H-pyrrolizin- 1 -yl, 1H-pyrrolizin-2-yl, 1H-pyrrolizin-3-yl, 1H-pyrrolizin-5-yl, 1H-pyrrolizin-6-y1 and 1H-pyrrolizin-7-yl. The term "3H-pyrrolizine" as used herein includes 3H-pyrrolizin-1-yl, 3H-pyrrolizin-2-yl, 3H-pyrrolizin-3-yl, 3H-pyrrolizin-5-yl, 3H-pyrrolizin-
6-y1 and 3H-pyrrolizin-7-yl.
The term "heterocyclyloxy-, as a group or part of a group, refers to a group having the formula -0-R' wherein Ri is heterocyclyl as defined herein above.
The term "heterocyclylCi_6alkyl", as a group or part of a group, means a Ci_6alkyl as defined herein, wherein at least one hydrogen atom is replaced by at least one heterocyclyl as defined herein.
The term -heteroaryl" as a group or part of a group, refers but is not limited to 5 to 12 carbon-atom aromatic rings or ring systems containing 1 or 2 rings which can be fused together or linked covalently, typically containing 5 to 6 atoms; at least one of which is aromatic in which one or more carbon atoms in one or more of these rings can be replaced by N, 0 and/or S atoms where the N and S heteroatoms may optionally be oxidized and the N heteroatoms may optionally be quatemized, and wherein at least one carbon atom of said heteroaryl can be oxidized to form at least one C=0.
Such rings may be fused to an aryl, cycloalkyl, heteroaryl or heterocyclyl ring. Non-limiting examples of such heteroaryl, include: pyrrolyl, furanyl, thiophenyl, pyrazolyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, i soth i azol yl , tri azol yl , oxadiazolyl, thiadiazolyl , tetrazol yl , oxatriazolyl , thiatriazolyl , pyri di nyl , pyrimidyl, pyrazinyl, pyridazinyl, oxazinyl, dioxinyl, thiazinyl, triazinyl, imidazo[2,1-131[1,3[thiazolyl, thi eno [3 ,2 -131 furanyl, thieno [3 ,2-blthiophenyl, thieno [2,3-d]
[1,31thiaz01y1, thieno [2 ,3 -d] imidaz olyl, tetrazolo[1,5-alpyridinyk indolyl, indolizinyl, isoindolyl, benzofuranyl, isobenzofuranyl, benzothiophenyl, isobenzothiophenyl, indazolyl, benzimidazolyl, 1,3-benzoxazolyl, 1,2-benzisoxazolyl, 2,1-benzisoxazolyl, 1,3-benzothiazolyl, 1,2-benzoisothiazolyl, 2,1-benzoisothiazolyl, ben zotriazol yl , 1,2,3 -ben zoxadi azol yl , 2,1,3 -benzoxadi azolyk 1,2,3-ben zothi adiazol yl , 2,1,3 -benzothiadiazolyl, benzo[dloxazol-2(3H)-one, 2,3-dihydro-benzofuranyl, thienopyridinyl, purinyl, imidazo[1,2-alpyridinyl, 6-oxo-pyridazin-1(6H)-yl, 2-oxopyridin-1(2H)-yl, 6-oxo-pyridazin-1(6H)-yl, 2-ox opyri din -1 (2H)-y1 , 1,3-ben zodi oxolyl , quinolinyl, isoquinolinyl , cinnolinyl , quinazol inyl , quinoxalinyl; preferably said heteroaryl group is selected from the group consisting of pyridyl, 1,3-benzodioxolyl, benzo[dloxazol-2(3H)-one, 2,3-dihydro-benzofuranyl, pyrazinyl, pyrazolyl, pyrrolyl, i soxazol yl , thi phenyl , im dazol yl , ben zim idazolyl, pyrim idinyl , tri azol yl and thiazolyl .
The term "pyrrolyl- (also called azoly1) as used herein includes pyrrol-1-yl, pyrrol-2-y1 and pyrrol-3-yl. The temi "furanyl" (also called "furyl") as used herein includes furan-2-y1 and furan-3-y1 (also called furan-2-y1 and furan-3-y1). The term -thiophcnyl" (also called "thienyl") as used herein includes thiophen-2-y1 and thiophen-3-y1 (also called thien-2-y1 and thien-3-y1). The term "pyrazoly1" (also called 1H-pyrazoly1 and 1,2-diazoly1) as used herein includes pyrazol- 1-yl, pyrazol-3-yl, pyrazol-4-y1 and pyrazol-5-yl. The tenn µ`imidazoly1" as used herein includes imidazol-l-yl, imidazol-2-yl, imidazol-4-y1 and imidazol-5-yl. The term -oxazoly1" (also called 1,3-oxazoly1) as used herein includes oxazol-2-yl, oxazol-4-y1 and oxazol-5-yl. The term "isoxazoly1" (also called 1,2-oxazoly1), as used herein includes isoxazol-3-yl, isoxazol-4-yl, and isoxazol-5-yl. 'lhe term "thiazoly1" (also called 1,3-thiazoly1),as used herein includes thiazol-2-yl, thiazol-4-y1 and thiazol-5-y1 (also called 2-thiazolyl, 4-thiazolyl and 5-thiazoly1). The term "isothiazoly1" (also called 1,2-thiazoly1) as used herein includes isothiazol-3-yl, isothiazol-4-yl, and isothiazol-5-yl. The term "triazolyl- as used herein includes 1H-triazolyl and 4H-1,2,4-triazolyl, "1H-triazoly1" includes 1H-1,2,3-triazol-1-yl, 1H-1,2,3-triazol-4-yl, 1H-1,2,3 -triazol-5 -yl, 1H-1,2,4-triazol-1-yl, 1H-1,2,4-triazol-3-y1 and 1H-1,2,4-triazol-5-yl. "4H-1,2,4 -triazoly1" includes 4H-1,2,4-triazol-4-yl, and 4H-1,2,4-triazol-3-yl. The term "oxadiazoly1" as used herein includes 1,2,3-oxadiazol-4-yl, 1,2,3-oxadiazol-5-yl, 1,2,4-oxadiazol-3-yl, 1,2,4-oxadiazol-5-yl, 1,2,5-oxadiazol-3-y1 and 1,3,4-oxadiazol-2-yl. The term "thiadiazoly1" as used herein includes 1,2,3-thiadiazol-4-yl, 1,2,3-thiadiazol-5-yl, 1,2,4-thiadiazol-3-yl, 1,2,4-thiadiazol-5-yl, 1,2,5-thiadiazol-3-y1 (also called furazan-3-ye and 1,3,4-thiadiazol-2-yl. The term "tetrazoly1" as used herein includes 1H-tetrazol-1-yl, 1H-tetrazol-5-yl, 2H-tetrazol-2-yl, and 2H-tetrazol-5-yl. The term "oxatriazoly1" as used herein includes 1,2,3,4-oxatriazol-5-y1 and 1,2,3,5-oxatriazol-4-yl. The term "thiatriazolyl- as used herein includes 1,2,3,4-thiatriazol-5-y1 and 1,2,3,5-thiatriazol-4-yl. The term "pyridinyl" (also called "pyridy1") as used herein includes pyridin-2-yl, pyridin-3-y1 and pyridin-4-y1 (also called 2-pyridyl, 3-pyridyl and 4-pyridy1). The term "pyrimidyl- as used herein includes pyrimid-2-yl, pyrimid-4-yl, pyrimid-5-y1 and pyrimid-6-yl. The term "pyrazinyl" as used herein includes pyrazin-2-y1 and pyrazin-3-yl. The term "pyridazinyl as used herein includes pyridazin-3-y1 and pyridazin-4-yl. The term "oxazinyl" (also called "1,4-oxazinyl") as used herein includes 1,4-oxazin-4-y1 and 1,4-oxazin-5-yl.
The term "dioxinyl" (also called "1,4-dioxinyl") as used herein includes 1,4-dioxin-2-y1 and 1,4-dioxin-3-yl. The term "thiazinyl" (also called "1,4-thiazinyl") as used herein includes 1,4-thiazin-2-yl, 1,4-thiazin-3-yl, 1,4-thiazin-4-yl, 1,4-thiazin-5-y1 and 1,4-thiazin-6-yl. The term "triazinyl" as used herein includes 1,3,5-triazin-2-yl, 1,2,4-triazin-3-yl, 1,2,4-triazin-5-yl, 1,2,4-triazin-6-yl, 1,2,3-triazin-4-y1 and 1.2.3-triazin-5-yl. The term "imidazo[2,1-b][1,31thiazoly1" as used herein includes imidazo [2,1-b] [1,3[thiazoi-2-yl, imidazo[2,1-b][1,31thiazol-3-yl, imidazo [2,1-1)]
[1,31thiazol-5-y1 and imidazo [2,1-b] [1,3[thiazol-6-yl. The term "thieno[3,2-b]furanyl" as used herein includes thieno[3,2-b]furan-2-yl, thieno[3,2-blfuran-3-yl, thieno[3,2-blfuran-4-yl, and thieno[3,2-b[furan-5-yl.
The term "thieno [3,2-blthiophenyl" as used herein includes thienop,2-blthien-2-yl, thieno[3,2-b[thien-3-yl, thienop,2-b]thien-5-y1 and thieno[3,2-b[thien-6-yl. The term "thieno[2,3-d][1,31thiazoly1" as used herein includes thi eno [2,3 -d] [1,3[thiazol-2-yl, thieno [2,3 -d] [1,31thiazol-5 -y1 and thieno [2,3 -c11[1,31thiazol-6-y1 . The term "thieno[2,3-dlimidazoly1" as used herein includes thieno[2,3-dlimidazol-2-yl, thieno [2,3-d]imidazol-4-y1 and thieno[2,3-d]imidazol-5-yl. The term "tetrazolo[1,5-a]pyridinyl" as used herein includes tetrazolo [1,5 pyridine-5 -yl, tetrazolo [1,5 -a[pyridine-6-yl, tetrazolo [1,5 -a] pyridine-7-yl, and tetrazo1o[1,5-alpyridine-8-y1. The term -indoly1" as used herein includes indo1-1-yl, indo1-2-yl, indo1-3-y1,-indo1-4-yl, indo1-5-yl, indo1-6-y1 and indo1-7-yl. The term "indolizinyl" as used herein includes indolizin-l-yl, indolizin-2-yl, indolizin-3-yl, indolizin-5-yl, indolizin-6-yl, indolizin-7-yl, and indolizin-8-yl. The term "isoindoly1" as used herein includes isoindo1-1-yl, isoindo1-2-yl, isoindo1-3-yl, isoindo1-4-yl, isoindo1-5-yl, isoindo1-6-y1 and isoindo1-7-yl. The term "benzofuranyl" (also called benzo[b[furanyl) as used herein includes benzofuran-2-yl, benzofuran-3-yl, benzofuran-4-yl, benzofuran-5-yl, benzofuran-6-y1 and benzofuran-7-yl. The term "isobenzofuranyl" (also called benzo[c]furanyl) as used herein includes isobenzofuran-l-yl, isobenzofuran-3-yl, isobenzofuran-4-yl, isobenzofuran-5-yl, isobenzofuran-6-y1 and isobenzofuran-7-yl. The term "benzothiophenyl" (also called benzo[b]thienyl) as used herein includes 2-benzo[b]thiophenyl, 3-benzo[b]thiophenyl, 4-benzo [b]thiophenyl, 5-benzo[b]thiophenyl, 6-benzo[b]thiophenyl and -7-benzo[b]thiophenyl (also called benzothien-2-yl, benzothien-3-yl, benzothien-4-yl, benzothien-5-yl, benzothien-6-y1 and benzothien-7-y1). The term -isobenzothiophenyl" (also called benzo[c]thienyl) as used herein includes isobenzothien-l-yl, isobenzothien-3-yl, isobenzothien-4-yl, isobenzothien-5-yl, isobenzothien-6-y1 and isobenzothien-7-yl. The term "indazoly1" (also called 1H-indazoly1 or 2-azaindoly1) as used herein includes 1H-indazol-1-yl, 1H-indazol-3-yl, 1H-indazol-4-yl, 1H-indazol-5-yl, 1H-indazol-6-yl, 1H-indazol-7-yl, 2H-indazol-2-yl, 2H-indazol-3-yl, 2H-indazol-4-yl, 2H-indazol-5-yl, 2H-indazol-6-yl, and 211-indazol-7-yl. The term "benzimidazoly1" as used herein includes benzimidazol- 1-yl, benzimidazol-2-yl, benzimidazol-4-yl, benzimidazol-5-yl, benzimidazol-6-y1 and benzimidazol-7-yl.
The term "1,3-benzoxazolyl- as used herein includes 1,3-benzoxazol-2-yl, 1,3-benzoxazol-4-yl, 1,3 -benzoxazol-5-yl, 1,3-benzoxazol-6-y1 and 1,3-benzoxazol-7-yl. The term -1,2-benzisoxazoly1" as used herein includes 1,2-benzisoxazol-3-yl, 1,2-benzisoxazol-4-yl, 1,2-benzisoxazol-5-yl, 1,2-benzisoxazol-6-y1 and 1,2-benzisoxazol-7-yl. The term "2,1-benzisoxazoly1" as used herein includes 2,1-benzisoxazol-3 -yl, 2,1-benzisoxazol-4-yl, 2,1-benzisoxazol-5-yl, 2, 1-benzisoxazol-6-y1 and 2 ,1 -benzisoxazol-7-yl. The term "1,3-benzothiazoly1" as used herein includes 1,3-benzothiazol-2-yl, 1,3 -benzothiazol-4-yl, 1,3-benzothiazol-5-yl, 1,3-benzothiazol-6-y1 and 1,3-benzothiazol-7-yl. The term "1,2-benzoisothiazoly1" as used herein includes 1,2-benzisothiazol-3-yl, 1,2-benzisothiazol-4-yl, 1,2-benzisothiazol-5-yl, 1,2-benzisothiazol-6-y1 and 1,2-benzisothiazol-7-yl. The term -2,1-benzoisothiazoly1" as used herein includes 2,1-benzisothiazol-3-yl, 2,1-benzisothiazol-4-yl, 2,1-benzisothiazol-5-yl, 2,1-benzisothiazol-6-y1 and 2,1-benzisothiazol-7-yl. The term -benzotriazoly1" as used herein includes benzotriazol-l-yl, benzotriazol-4-yl, benzotriazol-5-yl, benzotriazol-6-y1 and benzotriazol-7-yl. The term "1,2,3-benzoxacliazoly1" as used herein includes 1,2,3-benzoxacliazol-4-yl, 1,2,3-benzoxadiazol-5-yl, 1,2,3-benzoxadiazol-6-y1 and 1,2,3-benzoxadiazol-7-yl. The term "2,1,3 -benzoxadiazoly1" as used herein includes 2,1,3-benzoxadiazol-4-yl, 2,1,3 -benzoxadiazol-5 -yl, 2,1,3 -benzoxadiazol-6-y1 and 2,1,3-benzoxadiazol-7-yl. The term "1,2,3-benzothiadiazoly1" as used herein includes 1,2,3-benzothiadiazol-4-yl, 1,2,3-benzothiadiazol-5-yl, 1,2,3-benzothiadiazol-6-y1 and 1,2,3 -benzothiadiazol-7-yl. The term "2.1.3-benzothiadiazoly1" as used herein includes 2,1,3 -benzothiadiazol-4-yl, 2,1,3-benzothiadiazol-5-yl, 2, 1,3-benzothiadi azol-6-y1 and 2,1,3 -benzothiadiazol-7-yl. The term "thienopyridinyl" as used herein includes thieno[2,3-b]pyridinyl, thieno[2,3-c]pyridinyl, thieno[3,2-c]pyridinyl and thieno[3,2-1)Thyridinyl.
The term "purinyl" as used herein includes purin-2-yl, purin-6-yl, purin-7-y1 and purin-8-yl. The term "imidazo[1,2-alpyridinyl", as used herein includes imidazo[1,2-alpyridin-2-yl, imidazo[1,2-a]pyridin-4-yl, imidazo[1,2-alpyridin-6-y1 and imidazo[1,2-alpyridin-7-yl. The term "1,3-benzodioxoly1", as used herein includes 1,3-benzodioxo1-4-yl, 1,3-benzodioxo1-5-yl, 1,3 -benzodioxo1-6-yl, and 1,3-benzodioxo1-7-yl. The term "quinolinyl" as used herein includes quinolin-2-yl, quinolin-3-yl, quinolin-4-yl, quinolin-5-yl, quinolin-6-yl, quinolin-7-y1 and quinolin-8-yl. The term "isoquinolinyl" as used herein includes isoquinolin-l-yl, isoquinolin-3-yl, isoquinolin-4-yl, isoquinolin-5-yl, isoquinolin-6-yl, isoquinolin-7-y1 and isoquinolin-8-yl. The term "cinnolinyl- as used herein includes cinnolin-3-yl, cinnolin-4-yl, cinnolin-5-yl, cinnolin-6-yl, cinnolin-7-y1 and cinnolin-8-yl. The term "quinazolinyl" as used herein includes quinazolin-2-yl, quinazolin-4-yl, quinazolin-5-yl, quinazolin-6-yl, quinazolin-7-y1 and quinazolin-8-yl. The term "quinoxalinyl"
as used herein includes quinoxalin-2-yl, quinoxalin-5-yl, and quinoxalin-6-yl.
The term "heteroaryloxy", as a group or part of a group, refers to a group having the formula -O-R"
wherein Rk is heteroaryl as defined herein above.
The term "heteroary1C1_6alkyl", as a group or part of a group, means a Ci_6alkyl as defined herein, wherein at least one hydrogen atom is replaced by at least one heteroaryl as defined herein. Non limiting examples of heteroarylCi_6alkyl are 2-quinolinylmethyl, 2-(4-pyridy1)-ethyl, and the like.
The term "Ci_6alkylthioCt_6alkylene", as a group or part of a group, refers to a group of formula -R'-S-le wherein RU is Cl_6alkylene as defined herein, and ba is Ci_6alkyl as defined herein.
The term "mercaptoCt_6alkyl" or "Ct_6alkylthio", as a group or part of a group, refers to a group of formula -SRa wherein Ra is Ci_6alkyl as defined herein.
The term "arylthio", as a group or part of a group, refers to a group of formula -SRa wherein W is aryl as defined herein.
The term "Ct_6alkyarylthio", as a group or part of a group, refers to a group of formula -SRa wherein Ra is Ci_6alkylaryl as defined herein.
The term "aminoCi_6alkyl", as a group or part of a group, refers to a group of formula -W-NWRP
wherein W is Ci_6alkylene, R is hydrogen or Ci_6alkyl as defined herein, and RP is hydrogen or CI_ 6a1ky1 as defined herein.
The term "mono- or di-Ct_6alkylamino", as a group or part of a group, refers to a group of formula -N(W)(RP) wherein RI' and RP are each independently selected from hydrogen, or Ci_6alkyl, wherein at least one of R or RP is Ci_6alkyl. Thus, Ci_6alkylamino include mono-alkyl amino group (e.g.
mono-C1_6alkylamino group such as methylamino and ethylamino), and di-alkylamino group (e.g. di-C1_6a1ky1amin0 group such as dimethylamino and diethylamino). Non-limiting examples of suitable mono- or di-C1_6a1kylamino groups include n-propylamino, isopropylamino, n-butylamino, butylamino, sec-butylamino, t-butylamino, pentylamino, n-hexylamino, di-n-propylamino, di-i-propylamino, ethylmethylamino, methyl-n-propylamino, methyl-i-propylamino, n-butylmethylamino, i-butylmethylamino, t-butylmethylamino, cthyl-n-propylamino, ethyl-i-propylamino, n-butylethylamino, i-butylethylamino, t-butylethylamino, di-n-butylamino, di-i-butylamino, methylpentylamino, methylhexylamino, ethylpentylamino, ethylhexylamino, propylpentylamino, propylhexylamino, and the like.
The term -mono- or di-arylamino-, as a group or part of a group, refers to a group of formula -N(Rq)(Rr) wherein Rq and Rr are each independently selected from hydrogen, aryl, or alkyl, wherein at least one of Rq or RI. is aryl.
The term "a1kylcarbonyl", as a group or part of a group, refers to a group of formula -CO-Rb, wherein Rb is alkyl as defined herein.
The term "arylCi_6alkylcarbonyl", as a group or part of a group, refers to a group of formula -CO-Rb, wherein Rb is arylCi_6alkyl as defined herein.
The term "arylcarbonyl-, as a group or part of a group, refers to a group of formula -CO-Rh, wherein Rb is aryl as defined herein.
The term "Ci_6alkyloxycarbonyl", as a group or part of a group, refers to a group of formula -COO-RI', wherein Rb is Ci_6alkyl as defined herein.
The term -arylCi_6alkyloxycarbonyl-, as a group or part of a group, refers to a group of formula -COO-Rb, wherein Rb is arylC1_6alkyl as defined herein.
The term "aryloxycarbonyl", as a group or part of a group, refers to a group of formula -COO-Rb, wherein Rb is aryl as defined herein.
The term "Ci_6alky1carbonylamino", as a group or part of a group, refers to a group of formula -NW-CO-Rh, wherein W is selected from hydrogen, or Ci_6a1kyl and Rb is Ci_6a1kyl as defined herein.
The term "arylCi_6alkylcarbonylamino-, as a group or part of a group, refers to a group of formula -NR -CO-Rb, wherein R is selected from hydrogen, or arylCi_6alkyl and Rb is ary1C1_6a1kyl as defined herein.
The tenn "alrylcarbonylamino", as a group or part of a group, refers to a group of formula -NR -CO-Rb, wherein R is selected from hydrogen, or aryl and Rb is aryl as defined herein.
The term "Ci_6alkylsulfonyl", as a group or part of a group, refers to a group of fomiula -S(0)2-Rb, wherein Rh is Ci_6alkyl as defined herein.
The term "arylCi_6alkylsulfonyl", as a group or part of a group, refers to a group of fonnula -S(0)2-Rb, wherein Rb is arylCi_6alkyl as defined herein.
The term "arylsulfonyl", as a group or part of a group, refers to a group of formula -S(0)2-Rb, wherein Rb is aryl as defined herein.
The term "mono- or diCi_6alkylaminocarbonyl", as a group or part of a group, refers to a group of formula -CONR RP wherein R RP are each independently selected from hydrogen, or C1_6alkyl, wherein at least one of R or RP is Ci_6a1kyl.
The term "mono- or diarylCi_oalkylaminocarbonyl", as a group or part of a group, refers to a group of formula ¨CONWRP wherein R"RP are each independently selected from hydrogen, or arylCi_6alkyl, wherein at least one of R or RP is arylCi_6alkyl.
The -term "mono- or diarylaminocarbonyl", as a group or part of a group, refers to a group of formula ¨
CONIMP wherein IMP are each independently selected from hydrogen, or aryl, wherein at least one of R or RP is aryl.
Whenever used in the present invention the term "compounds of the invention"
or a similar term is meant to include the compounds of general formula (I), (IA), (IB), (IC) or (ID) and any subgroup thereof. This term also refers to the compounds as depicted in Table 2 and their derivatives, N-oxides, salts, solvates, hydrates, tautomeric forms, analogues, pro-drugs, esters and metabolites, as well as their quatemized nitrogen analogues. The N-oxide forms of said compounds are meant to comprise compounds wherein one or several nitrogen atoms are oxidized to the so-called N-oxide.
As used herein and unless otherwise stated, the term "stereoisomer" refers to all possible different isomeric as well as conformational forms which the compounds of structural formula herein may possess, in particular all possible stereochemically and conformationally isomeric forms, all diastereomers, enantiomers and/or conformers of the basic molecular structure.
Some compounds of the present invention may exist in different tautomeric forms, all of the latter being included within the scope of the present invention.
The present invention includes all possible stereoisomers compounds of formula (I) and any subgroup thereof. When a compound is desired as a single enantiomer, such may be obtained by stereospecific synthesis, by resolution of the final product or any convenient intermediate, or by chiral chromatographic methods as each are known in the art. Resolution of the final product, an intermediate, or a starting material may be effected by any suitable method known in the art. See, for example, Stercochemistry of Organic Compounds by E. L. Elicl, S. H. Wilen, and L. N.
Mandel- (Wiley-Interscience, 1994), incorporated by reference with regard to stereochemistry.
A structural isomer is a type of isomer in which molecules with the same molecular formula have different bonding patterns and atomic organization. Where structural isomers are interconvertible via a low energy barrier, tautomeric isomerism ('tautomerism) can occur. This can take the form of proton tautomerism in compounds of the invention containing, for example, an imino, keto, or oxime group, or so-called valence tautom eri sm in compounds which contain an aromatic moiety.
The compounds of the invention may be in the fonm of salts, preferably pharmaceutically acceptable salts, as generally described below. Some preferred, but non-limiting examples of suitable pharmaceutically acceptable organic and/or inorganic acids are as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, acetic acid and citric acid, as well as other pharmaceutically acceptable acids known per se (for which reference is made to the prior art referred to below).
When the compounds of the invention contain an acidic group as well as a basic group the compounds of the invention may also form internal salts, and such compounds are within the scope of the invention.
When the compounds of the invention contain a hydrogen-donating heteroatom (e.g. NH), the invention also covers salts and/or isomers formed by transfer of said hydrogen atom to a basic group or atom within the molecule.
Pharmaceutically acceptable salts of the compounds of formula (I) and any subgroup thereof include the acid addition and base salts thereof Suitable acid addition salts are formed from acids which form non-toxic salts. Examples include the acetate, adipate, aspartate, benzoate, besylate, bicarbonate/carbonate, bisulfate/sulfate, borate, camsylate, citrate, cyclamate, edisylate, esylate, formate, fumarate, gluccptatc, gluconatc, glucuronate, hexafluorophosphate, hibenzate, hydrochloride/chloride, hydrobromide/bromide, hydroiodide/iodide, isethionate, lactate, malate, maleate, malonate, mesylate, methylsulphate, naphthylate, 2-napsylate, nicotinate, nitrate, orotate, oxalate, palmitatc, pamoatc, phosphate/hydrogen phosphatc/dihydrogcn phosphate, pyroglutamatc, saccharate, stearate, succinate, tannate, tartrate, tosylate, trifluoroacetate and xinofoate salts. Suitable base salts are formed from bases which form non-toxic salts. Examples include the aluminium, a,rginine, benzathine, calcium, choline, diethylamine, diolamine, glycine, lysine, magnesium, meglumine, olamine, potassium, sodium, tromethamine and zinc salts. Hemisalts of acids and bases may also be formed, for example, hemisulphate and hemicalcium salts. For a review on suitable salts, see Handbook of Pharmaceutical Salts: Properties, Selection, and Use by Stahl and Wermuth (Wiley-VCH, 2002), incorporated herein by reference.
The term "prodrug" as used herein means the pharmacologically acceptable derivatives such as esters, amides and phosphates, such that the resulting in vivo biotransformation product of the derivative is the active drug. The reference by Goodman and Gilman (The Pharmacological Basis of Therapeutics, 8th Ed, McGraw-Hill, Int. Ed. 1992, "Biotransformation of Drugs", p 13-15) describing pro-drugs generally is hereby incorporated. Prodrugs of the compounds of the invention can be prepared by modifying functional groups present in said component in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent component. Typical examples of prodrugs are described for instance in WO 99/33795, WO 99/33815, WO 99/33793 and WO 99/33792 all incorporated herein by reference. Prodrugs are characterized by increased bio-availability and are readily metabolized into the active inhibitors in vivo. The term "prodrug", as used herein, means any compound that will be modified to form a drug species, wherein the modification may take place either inside or outside of the body, and either before or after the pre-drug reaches the area of the body where administration of the drug is indicated.
As used herein, an -element of Group VII of the Periodic Table" corresponds to transition metals manganese (Mn), technetium (Tc), rhenium (Re) and bohrium (Bh).
The term "radionuclide- is to be interpreted in the broad commonly used definition in the art, and thus refers to any atom that contains excess nuclear energy that renders said atom unstable. More particularly the tenn refers to an isotope of natural or artificial origin which shows radioactive properties. Non-limiting examples of radionuclide include 99mTc or 1881te or i86Re.
The term -labeled- as used herein means -radiolabeled- and is more precisely directed to a compound comprising or complexed with at least one radionuclide.
It is understood that when reference is made herein to "prostate-specific membrane antigen", abbreviated herein and in the art as "PSM" and "PSMA" and interchangeably annotated in the art by the non-limiting synonyms "glutamate carboxypeptidase 2" (abbreviation:
"GCP2"), "glutamate carboxypeptidase II" ("GCPII"), "cell growth-inhibiting gene 27 protein", "folate hydrolase 1", "folylpoly-gamma-glutamate carboxypeptidase" ("FGCP"), "membrane glutamate carboxypeptidase"
("mGCP"), "N-acetylated-alpha-linked acidic dipeptidase I" ("NAALADase I"), NAAG peptidase, and "pteroylpoly-gamma-glutamate carboxypeptidase" that reference is made to the protein having as UniProt identifier (www.uniprotorg) Q04609 (FOLHl_FIUMAN) and NCBI reference (ncbi.nlm.nih.gov) NP 004467.1 as encoded in Homo sapiens by the gene FOLH1 unless specified otherwise. PSMA is a zinc metalloenzyme that is categorised as a class 11 membrane glycoprotein that catalises the hydrolysis of hydrolysis of N-acetylaspartylglutamate (NAAG) to glutamate and N-acetylaspartate (NAA). The canonical sequence of PSMA is by means of example reproduced below (SEQ ID NO: 1):
MWNLLHE TDSAVATARRPRWLCAGALVLAGG F FLLG FL FGW F IKS SNEATNI T PKHNMKAFLDELKAE
NIKKFLYNFTQ I PHLAGTEQNFQLAKQIQSQWKE FGLDSVELAHY DVLL SY PNKT HPNY IS I INEDGN
E I FNT SL FE PP P PGY ENVSDI VPP FSAFSPQGMPEGDLVYVNYART
EDFFKLERDMKINCSGKIVIAR
YGKVFRGNKVKNAQLAGAKGVILYSDPADY FAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLT PGY
PANEYAYRRGIAEAVGL PSI PVHP IGYYDAQKLLEKMGGSAP PDS SWRGSLKVPYNVGPGFIGNESTQ
KVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVEGGIDPQSGAAVVHE IVRS FGTLKKE
GWRPRRT IL FASWDAEE FGLLGSTEWAEENSRLLQERGVAY INADS S EGNYTLRVDCT PLMYSLVHN
LTKELKS PDEGFEGKSLYESWTKKSP SPE FSGMPRI SKLGSGNDFEVFFQRLGIASGRARYTKNWETN
KFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANS IVLP FDCRDYAVVLRKYADKIY
S I SMKHPQEMKT YSVS FDSL FSAVKNFTE IASKFSE RLQDFDKSNP IVLRMMNDQLMFL ERAFI DPLG
LPDRP FY RHVI YAPS SHNKYAGE S FPGIYDAL FD I E SKVDPS KAWGEVKRQ I
YVAAFTVQAAAETLS E
VA
While SEQ ID NO: 1 as depicted above is generally accepted as the canonical sequence of PSMA, it is evident that the term "PSMA" and synonyms thereof equally encompass any isoforms of PSMA, truncated versions of PSMA, and genetic polymorphisms of PSMA. In particular, the term "PSMA" is intended to cover any protein sequence having at least 80%, preferably at least 85%, more preferably at least 90%, more preferably at least 95%, yet more preferably at least 97.5%, most preferably at least 99% sequence identity to SEQ ID NO: 1. A skilled person further appreciates that the radiotheranostics described in the present invention are capable of selectively binding any protein that contains at least the extracellular active center of PSMA.
Related hereto, a person skilled in the art is well aware of methods and tools to verify sequence homology, sequence similarity or sequence identity between different sequences of amino acids or nucleic acids. Non-limiting examples of such methods and tools are Protein BLAST
(https://blast.ncbi.nlm .nih.gov/Blast.cgi), ClustalW2 (https ://www .ebi .ac .uk/Tools/msa/clustalw2/), SIM alignment tool (https://web.expasy.org/sim/), TranslatorX
(http://translatorx.co.uk/) and T-COFFEE (https://www.ebi.ac.uk/Tools/msa/tcoffee/). The percentage of identity between two sequences may show minor differences depending on the algorithm choice and parameters.
The term -sequence identity" as used herein refers to the relationship between sequences at the amino acid level. The expression "% identical" is determined by comparing optimally aligned sequences, e.g.
two or more, over a comparison window wherein the portion of the sequence in the comparison window may comprise insertions or deletions as compared to the reference sequence for optimal alignment of the sequences. The reference sequence does not comprise insertions or deletions. A reference window is chosen and the "% identity" is then calculated by determining the number of nucleotides (or amino acids) that are identical between the sequences in the window, dividing the number of identical nucleotides (or amino acids) by the number of nucleotides (or amino acids) in the window and multiplying by 100. Unless indicated otherwise, the sequence identity is calculated over the whole length of the reference sequence. A skilled person is aware of the related, yet different interpretations in the art of the terms "similarity", "homology", and "identity" (explained in detail in e.g. Pearson, Current protocols in bioinformatics, 2014).
As indicated above, the membrane-bound protease PSMA is overexpressed up to 1000-fold on prostate tumor cells and the precise expression level shows a strong correlation with the disease state, as has been described in the art on numerous occasions (e.g. in Hupc et al., Front Oncol, 2018). Furthermore, PSMA is typically expressed in the neovasculature of several solid tumors such as but not limited to renal carcinoma, breast cancer, non-small-cell lung cancer (NSCLC) and oral cancer. Additionally, PSMA is expressed in a number of healthy tissues such as prostate tissue (in the secretory acinar epithelium), the nervous system (astrocytcs and Schvvann cells), intestinal tissue (jejunal brush order in the small bowel), kidney (proximal tubes), and salivary glands. A skilled person is aware that expression levels in mainly the kidneys and salivary glands are crucial for determining the dose-limiting factor of radionuclide therapy since these tissues display the highest nontarget uptake in a subject receiving treatment with a PSMA-selective radionuclide. Structurally, the PSMA is characterised by three main domains: an extracellular domain, a transmembrane domain and an enzymatically active extracellular domain which comprises two zinc ions as part of the enzymatic active site. The enzymatic active site of PSMA is composed of two pockets, Si and Si'. Glutamate-like structures bind to the Si' pocket which is crucial for high-affinity binding while the Si pocket is more flexible (Barinka et al., J Med Chem, 2007).
The term "amino acid" encompasses naturally occurring amino acids, naturally encoded amino acids, non-naturally encoded amino acids, non-naturally occurring amino acids, amino acid analogues and amino acid mimetics that function in a manner similar to the naturally occurring amino acids, all in their D- and L-stereoisomers, provided their structure allows such stereoisomeric forms. Amino acids are referred to herein by either their name, their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. A
"naturally encoded amino acid" refers to an amino acid that is one of the 20 common amino acids or pyrrolysine, pyrroline-carboxy-lysine or selenocysteine. The 20 common amino acids are:
Alanine (A or Ala), Cysteine (C or Cys), Aspartic acid (D or Asp), Glutamic acid (E or Glu), Phenylalanine (F or Phe), Glycine (G or Gly), Histidine (H or His), Isoleucine (I or Ile), Lysine (K or Lys), Leucine (L or Leu), Methionine (M or Met), Asparagine (N or Asn), Proline (P or Pro), Glutamine (Q
or Gln), Arginine (R
or Arg), Serine (S or Ser), Threonine (T or Thr), Valine (V or Val), Tryptophan (W or Trp), and Tyrosine (Y or Tyr). A "non-naturally encoded amino acid" refers to an amino acid that is not one of the 20 common amino acids or pyrrolysine, pyrroline-carboxy-lysine or selenocvsteine.
The term includes without limitation amino acids that occur by a modification (such as a post-translational modification) of a naturally encoded amino acid, but arc not themselves naturally incorporated into a growing polypeptide chain by the translation complex, as exemplified without limitation by N-acetylglucosaminyl-L-serine, N-acetylglucosaminyl-L-threonine, and 0-phosphotyrosine. Further examples of non-naturally encoded, un-natural or modified amino acids include 2-Aminoadipic acid, 3-Aminoadipic acid, beta-Alanine, beta-Aminopropionic acid, 2-Aminobutyric acid, 4-Aminobutyric acid, piperidinic acid, 6-Aminocaproic acid, 2-Aminoheptanoic acid, 2-Aminoisobutyric acid, 3-Aminoisobutyric acid, 2-Aminopimelic acid, 2,4 Diaminobutyric acid, Desmosine, 2,2' -Diaminopimelic acid, 2,3-Diaminopropionic acid, N-Ethylglycine, N-Ethylasparagine, homoserine, homocysteine, Hydroxylysine, allo-Hydroxylysine, 3-Hydroxyproline, 4-Hydroxyproline, Isodesmosine, allo-Isoleucine, N-Methylglycine, N-Methylisoleucine, 6-N-Methyllysine, N-Methylvaline, Norvaline, Norleucine, or Omithine. Also included are amino acid analogues, in which one or more individual atoms have been replaced either with a different atom, an isotope of the same atom, or with a different functional group. Also included are un-natural amino acids and amino acid analogues described in Ellman et al. Methods Enzymol. 1991, vol. 202, 301-36.
Another aspect of the invention is directed to pharmaceutical compositions comprising one or more pharmaceutically acceptable excipients and a therapeutically effective amount of a metal complex as described herein. In preferred embodiments, the pharmaceutical composition comprises a metal complex comprising Rhenium, preferably Rhenium-188 or 186. In alternative preferred embodiments, the pharmaceutical composition comprises a metal complex comprising Technetium-99m.
In view of the above, any reference to the use of the metal complexes in diagnosis, monitoring, therapy or imaging (or any variation of such language) also encompasses such uses of pharmaceutical compositions comprising the metal complexes described in the present disclosure. The terms "pharmaceutical composition", "pharmaceutical formulation", or short "composition" and "formulation" may be used interchangeably and are to be considered synonyms.
The pharmaceutical compositions as taught herein may comprise in addition to the one or more pharmaceutically active ingredients, and/or one or more pharmaceutically acceptable carriers (interchangeably referred to as "excipients". The term "pharmaceutically acceptable" as used herein is consistent with the art and means compatible with the other ingredients of a pharmaceutical composition and not deleterious to the recipient thereof. Suitable pharmaceutical excipients depend on the dosage form and identities of the active ingredients and can be selected by the skilled person (e.g., by reference to Rowe et al., Handbook of Pharmaceutical Excipients 7th Edition 2012). As used herein, the terms "carrier" or "excipient" are used interchangeably and broadly include any and all solvents, diluents, buffers (such as, e.g., neutral buffered saline, phosphate buffered saline, or optionally Tris-HC1, acetate or phosphate buffers), solubilisers (such as, e.g., Tweenk 80, Polysorbate 80), colloids, dispersion media, vehicles, fillers, chelating agents (such as, e.g., EDTA or glutathione), amino acids (such as, e.g., glycine), proteins, disintegrants, binders, lubricants, wetting agents, emulsifiers, sweeteners, colorants, flavourings, aromatiscrs, thickeners, agents for achieving a depot effect, coatings, antifungal agents, preservatives (such as, e.g., Thimerosaff, benzyl alcohol), antioxidants (such as, e.g., ascorbic acid, sodium metabisulfite), tonicity controlling agents, absorption delaying agents, adjuvants, bulking agents (such as, e.g., lactose, mannitol) and the like. The use of such media and agents for the formulation of pharmaceutical compositions is well known in the art. Acceptable diluents and excipients typically do not adversely affect a recipient's homeostasis (e.g., electrolyte balance).
The use of such media and agents for pharmaceutical active substances is well known in the art. It is evident that all of the used ingredients should be non-toxic in the concentration contained in the final pharmaceutical composition and should not negatively interfere with the activity of the estetrol component, said estetrol component preferably being present in the pharmaceutical composition as the predominant pharmaceutically active ingredient. In certain embodiments, more than one excipient which a skilled person would classify as belonging to the same group of excipients is added to the pharmaceutical composition. In further embodiments, more than one excipient wherein the different excipients belong to different groups is added to the pharmaceutical composition. In certain embodiments, the excipients may fulfil more than one function and/or be classified by a skilled person as belonging to different groups or classes of excipients. Further illustrative examples of acceptable excipients may include biocompatible, inert or bioabsorbable salts, buffering agents, oligo- or polysaccharides, polymers, viscosity-improving agents, preservatives and the like. Non-limiting exemplary solvents are physiologic saline (0.15 M NaC1, pH
The term "heterocyclyloxy-, as a group or part of a group, refers to a group having the formula -0-R' wherein Ri is heterocyclyl as defined herein above.
The term "heterocyclylCi_6alkyl", as a group or part of a group, means a Ci_6alkyl as defined herein, wherein at least one hydrogen atom is replaced by at least one heterocyclyl as defined herein.
The term -heteroaryl" as a group or part of a group, refers but is not limited to 5 to 12 carbon-atom aromatic rings or ring systems containing 1 or 2 rings which can be fused together or linked covalently, typically containing 5 to 6 atoms; at least one of which is aromatic in which one or more carbon atoms in one or more of these rings can be replaced by N, 0 and/or S atoms where the N and S heteroatoms may optionally be oxidized and the N heteroatoms may optionally be quatemized, and wherein at least one carbon atom of said heteroaryl can be oxidized to form at least one C=0.
Such rings may be fused to an aryl, cycloalkyl, heteroaryl or heterocyclyl ring. Non-limiting examples of such heteroaryl, include: pyrrolyl, furanyl, thiophenyl, pyrazolyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, i soth i azol yl , tri azol yl , oxadiazolyl, thiadiazolyl , tetrazol yl , oxatriazolyl , thiatriazolyl , pyri di nyl , pyrimidyl, pyrazinyl, pyridazinyl, oxazinyl, dioxinyl, thiazinyl, triazinyl, imidazo[2,1-131[1,3[thiazolyl, thi eno [3 ,2 -131 furanyl, thieno [3 ,2-blthiophenyl, thieno [2,3-d]
[1,31thiaz01y1, thieno [2 ,3 -d] imidaz olyl, tetrazolo[1,5-alpyridinyk indolyl, indolizinyl, isoindolyl, benzofuranyl, isobenzofuranyl, benzothiophenyl, isobenzothiophenyl, indazolyl, benzimidazolyl, 1,3-benzoxazolyl, 1,2-benzisoxazolyl, 2,1-benzisoxazolyl, 1,3-benzothiazolyl, 1,2-benzoisothiazolyl, 2,1-benzoisothiazolyl, ben zotriazol yl , 1,2,3 -ben zoxadi azol yl , 2,1,3 -benzoxadi azolyk 1,2,3-ben zothi adiazol yl , 2,1,3 -benzothiadiazolyl, benzo[dloxazol-2(3H)-one, 2,3-dihydro-benzofuranyl, thienopyridinyl, purinyl, imidazo[1,2-alpyridinyl, 6-oxo-pyridazin-1(6H)-yl, 2-oxopyridin-1(2H)-yl, 6-oxo-pyridazin-1(6H)-yl, 2-ox opyri din -1 (2H)-y1 , 1,3-ben zodi oxolyl , quinolinyl, isoquinolinyl , cinnolinyl , quinazol inyl , quinoxalinyl; preferably said heteroaryl group is selected from the group consisting of pyridyl, 1,3-benzodioxolyl, benzo[dloxazol-2(3H)-one, 2,3-dihydro-benzofuranyl, pyrazinyl, pyrazolyl, pyrrolyl, i soxazol yl , thi phenyl , im dazol yl , ben zim idazolyl, pyrim idinyl , tri azol yl and thiazolyl .
The term "pyrrolyl- (also called azoly1) as used herein includes pyrrol-1-yl, pyrrol-2-y1 and pyrrol-3-yl. The temi "furanyl" (also called "furyl") as used herein includes furan-2-y1 and furan-3-y1 (also called furan-2-y1 and furan-3-y1). The term -thiophcnyl" (also called "thienyl") as used herein includes thiophen-2-y1 and thiophen-3-y1 (also called thien-2-y1 and thien-3-y1). The term "pyrazoly1" (also called 1H-pyrazoly1 and 1,2-diazoly1) as used herein includes pyrazol- 1-yl, pyrazol-3-yl, pyrazol-4-y1 and pyrazol-5-yl. The tenn µ`imidazoly1" as used herein includes imidazol-l-yl, imidazol-2-yl, imidazol-4-y1 and imidazol-5-yl. The term -oxazoly1" (also called 1,3-oxazoly1) as used herein includes oxazol-2-yl, oxazol-4-y1 and oxazol-5-yl. The term "isoxazoly1" (also called 1,2-oxazoly1), as used herein includes isoxazol-3-yl, isoxazol-4-yl, and isoxazol-5-yl. 'lhe term "thiazoly1" (also called 1,3-thiazoly1),as used herein includes thiazol-2-yl, thiazol-4-y1 and thiazol-5-y1 (also called 2-thiazolyl, 4-thiazolyl and 5-thiazoly1). The term "isothiazoly1" (also called 1,2-thiazoly1) as used herein includes isothiazol-3-yl, isothiazol-4-yl, and isothiazol-5-yl. The term "triazolyl- as used herein includes 1H-triazolyl and 4H-1,2,4-triazolyl, "1H-triazoly1" includes 1H-1,2,3-triazol-1-yl, 1H-1,2,3-triazol-4-yl, 1H-1,2,3 -triazol-5 -yl, 1H-1,2,4-triazol-1-yl, 1H-1,2,4-triazol-3-y1 and 1H-1,2,4-triazol-5-yl. "4H-1,2,4 -triazoly1" includes 4H-1,2,4-triazol-4-yl, and 4H-1,2,4-triazol-3-yl. The term "oxadiazoly1" as used herein includes 1,2,3-oxadiazol-4-yl, 1,2,3-oxadiazol-5-yl, 1,2,4-oxadiazol-3-yl, 1,2,4-oxadiazol-5-yl, 1,2,5-oxadiazol-3-y1 and 1,3,4-oxadiazol-2-yl. The term "thiadiazoly1" as used herein includes 1,2,3-thiadiazol-4-yl, 1,2,3-thiadiazol-5-yl, 1,2,4-thiadiazol-3-yl, 1,2,4-thiadiazol-5-yl, 1,2,5-thiadiazol-3-y1 (also called furazan-3-ye and 1,3,4-thiadiazol-2-yl. The term "tetrazoly1" as used herein includes 1H-tetrazol-1-yl, 1H-tetrazol-5-yl, 2H-tetrazol-2-yl, and 2H-tetrazol-5-yl. The term "oxatriazoly1" as used herein includes 1,2,3,4-oxatriazol-5-y1 and 1,2,3,5-oxatriazol-4-yl. The term "thiatriazolyl- as used herein includes 1,2,3,4-thiatriazol-5-y1 and 1,2,3,5-thiatriazol-4-yl. The term "pyridinyl" (also called "pyridy1") as used herein includes pyridin-2-yl, pyridin-3-y1 and pyridin-4-y1 (also called 2-pyridyl, 3-pyridyl and 4-pyridy1). The term "pyrimidyl- as used herein includes pyrimid-2-yl, pyrimid-4-yl, pyrimid-5-y1 and pyrimid-6-yl. The term "pyrazinyl" as used herein includes pyrazin-2-y1 and pyrazin-3-yl. The term "pyridazinyl as used herein includes pyridazin-3-y1 and pyridazin-4-yl. The term "oxazinyl" (also called "1,4-oxazinyl") as used herein includes 1,4-oxazin-4-y1 and 1,4-oxazin-5-yl.
The term "dioxinyl" (also called "1,4-dioxinyl") as used herein includes 1,4-dioxin-2-y1 and 1,4-dioxin-3-yl. The term "thiazinyl" (also called "1,4-thiazinyl") as used herein includes 1,4-thiazin-2-yl, 1,4-thiazin-3-yl, 1,4-thiazin-4-yl, 1,4-thiazin-5-y1 and 1,4-thiazin-6-yl. The term "triazinyl" as used herein includes 1,3,5-triazin-2-yl, 1,2,4-triazin-3-yl, 1,2,4-triazin-5-yl, 1,2,4-triazin-6-yl, 1,2,3-triazin-4-y1 and 1.2.3-triazin-5-yl. The term "imidazo[2,1-b][1,31thiazoly1" as used herein includes imidazo [2,1-b] [1,3[thiazoi-2-yl, imidazo[2,1-b][1,31thiazol-3-yl, imidazo [2,1-1)]
[1,31thiazol-5-y1 and imidazo [2,1-b] [1,3[thiazol-6-yl. The term "thieno[3,2-b]furanyl" as used herein includes thieno[3,2-b]furan-2-yl, thieno[3,2-blfuran-3-yl, thieno[3,2-blfuran-4-yl, and thieno[3,2-b[furan-5-yl.
The term "thieno [3,2-blthiophenyl" as used herein includes thienop,2-blthien-2-yl, thieno[3,2-b[thien-3-yl, thienop,2-b]thien-5-y1 and thieno[3,2-b[thien-6-yl. The term "thieno[2,3-d][1,31thiazoly1" as used herein includes thi eno [2,3 -d] [1,3[thiazol-2-yl, thieno [2,3 -d] [1,31thiazol-5 -y1 and thieno [2,3 -c11[1,31thiazol-6-y1 . The term "thieno[2,3-dlimidazoly1" as used herein includes thieno[2,3-dlimidazol-2-yl, thieno [2,3-d]imidazol-4-y1 and thieno[2,3-d]imidazol-5-yl. The term "tetrazolo[1,5-a]pyridinyl" as used herein includes tetrazolo [1,5 pyridine-5 -yl, tetrazolo [1,5 -a[pyridine-6-yl, tetrazolo [1,5 -a] pyridine-7-yl, and tetrazo1o[1,5-alpyridine-8-y1. The term -indoly1" as used herein includes indo1-1-yl, indo1-2-yl, indo1-3-y1,-indo1-4-yl, indo1-5-yl, indo1-6-y1 and indo1-7-yl. The term "indolizinyl" as used herein includes indolizin-l-yl, indolizin-2-yl, indolizin-3-yl, indolizin-5-yl, indolizin-6-yl, indolizin-7-yl, and indolizin-8-yl. The term "isoindoly1" as used herein includes isoindo1-1-yl, isoindo1-2-yl, isoindo1-3-yl, isoindo1-4-yl, isoindo1-5-yl, isoindo1-6-y1 and isoindo1-7-yl. The term "benzofuranyl" (also called benzo[b[furanyl) as used herein includes benzofuran-2-yl, benzofuran-3-yl, benzofuran-4-yl, benzofuran-5-yl, benzofuran-6-y1 and benzofuran-7-yl. The term "isobenzofuranyl" (also called benzo[c]furanyl) as used herein includes isobenzofuran-l-yl, isobenzofuran-3-yl, isobenzofuran-4-yl, isobenzofuran-5-yl, isobenzofuran-6-y1 and isobenzofuran-7-yl. The term "benzothiophenyl" (also called benzo[b]thienyl) as used herein includes 2-benzo[b]thiophenyl, 3-benzo[b]thiophenyl, 4-benzo [b]thiophenyl, 5-benzo[b]thiophenyl, 6-benzo[b]thiophenyl and -7-benzo[b]thiophenyl (also called benzothien-2-yl, benzothien-3-yl, benzothien-4-yl, benzothien-5-yl, benzothien-6-y1 and benzothien-7-y1). The term -isobenzothiophenyl" (also called benzo[c]thienyl) as used herein includes isobenzothien-l-yl, isobenzothien-3-yl, isobenzothien-4-yl, isobenzothien-5-yl, isobenzothien-6-y1 and isobenzothien-7-yl. The term "indazoly1" (also called 1H-indazoly1 or 2-azaindoly1) as used herein includes 1H-indazol-1-yl, 1H-indazol-3-yl, 1H-indazol-4-yl, 1H-indazol-5-yl, 1H-indazol-6-yl, 1H-indazol-7-yl, 2H-indazol-2-yl, 2H-indazol-3-yl, 2H-indazol-4-yl, 2H-indazol-5-yl, 2H-indazol-6-yl, and 211-indazol-7-yl. The term "benzimidazoly1" as used herein includes benzimidazol- 1-yl, benzimidazol-2-yl, benzimidazol-4-yl, benzimidazol-5-yl, benzimidazol-6-y1 and benzimidazol-7-yl.
The term "1,3-benzoxazolyl- as used herein includes 1,3-benzoxazol-2-yl, 1,3-benzoxazol-4-yl, 1,3 -benzoxazol-5-yl, 1,3-benzoxazol-6-y1 and 1,3-benzoxazol-7-yl. The term -1,2-benzisoxazoly1" as used herein includes 1,2-benzisoxazol-3-yl, 1,2-benzisoxazol-4-yl, 1,2-benzisoxazol-5-yl, 1,2-benzisoxazol-6-y1 and 1,2-benzisoxazol-7-yl. The term "2,1-benzisoxazoly1" as used herein includes 2,1-benzisoxazol-3 -yl, 2,1-benzisoxazol-4-yl, 2,1-benzisoxazol-5-yl, 2, 1-benzisoxazol-6-y1 and 2 ,1 -benzisoxazol-7-yl. The term "1,3-benzothiazoly1" as used herein includes 1,3-benzothiazol-2-yl, 1,3 -benzothiazol-4-yl, 1,3-benzothiazol-5-yl, 1,3-benzothiazol-6-y1 and 1,3-benzothiazol-7-yl. The term "1,2-benzoisothiazoly1" as used herein includes 1,2-benzisothiazol-3-yl, 1,2-benzisothiazol-4-yl, 1,2-benzisothiazol-5-yl, 1,2-benzisothiazol-6-y1 and 1,2-benzisothiazol-7-yl. The term -2,1-benzoisothiazoly1" as used herein includes 2,1-benzisothiazol-3-yl, 2,1-benzisothiazol-4-yl, 2,1-benzisothiazol-5-yl, 2,1-benzisothiazol-6-y1 and 2,1-benzisothiazol-7-yl. The term -benzotriazoly1" as used herein includes benzotriazol-l-yl, benzotriazol-4-yl, benzotriazol-5-yl, benzotriazol-6-y1 and benzotriazol-7-yl. The term "1,2,3-benzoxacliazoly1" as used herein includes 1,2,3-benzoxacliazol-4-yl, 1,2,3-benzoxadiazol-5-yl, 1,2,3-benzoxadiazol-6-y1 and 1,2,3-benzoxadiazol-7-yl. The term "2,1,3 -benzoxadiazoly1" as used herein includes 2,1,3-benzoxadiazol-4-yl, 2,1,3 -benzoxadiazol-5 -yl, 2,1,3 -benzoxadiazol-6-y1 and 2,1,3-benzoxadiazol-7-yl. The term "1,2,3-benzothiadiazoly1" as used herein includes 1,2,3-benzothiadiazol-4-yl, 1,2,3-benzothiadiazol-5-yl, 1,2,3-benzothiadiazol-6-y1 and 1,2,3 -benzothiadiazol-7-yl. The term "2.1.3-benzothiadiazoly1" as used herein includes 2,1,3 -benzothiadiazol-4-yl, 2,1,3-benzothiadiazol-5-yl, 2, 1,3-benzothiadi azol-6-y1 and 2,1,3 -benzothiadiazol-7-yl. The term "thienopyridinyl" as used herein includes thieno[2,3-b]pyridinyl, thieno[2,3-c]pyridinyl, thieno[3,2-c]pyridinyl and thieno[3,2-1)Thyridinyl.
The term "purinyl" as used herein includes purin-2-yl, purin-6-yl, purin-7-y1 and purin-8-yl. The term "imidazo[1,2-alpyridinyl", as used herein includes imidazo[1,2-alpyridin-2-yl, imidazo[1,2-a]pyridin-4-yl, imidazo[1,2-alpyridin-6-y1 and imidazo[1,2-alpyridin-7-yl. The term "1,3-benzodioxoly1", as used herein includes 1,3-benzodioxo1-4-yl, 1,3-benzodioxo1-5-yl, 1,3 -benzodioxo1-6-yl, and 1,3-benzodioxo1-7-yl. The term "quinolinyl" as used herein includes quinolin-2-yl, quinolin-3-yl, quinolin-4-yl, quinolin-5-yl, quinolin-6-yl, quinolin-7-y1 and quinolin-8-yl. The term "isoquinolinyl" as used herein includes isoquinolin-l-yl, isoquinolin-3-yl, isoquinolin-4-yl, isoquinolin-5-yl, isoquinolin-6-yl, isoquinolin-7-y1 and isoquinolin-8-yl. The term "cinnolinyl- as used herein includes cinnolin-3-yl, cinnolin-4-yl, cinnolin-5-yl, cinnolin-6-yl, cinnolin-7-y1 and cinnolin-8-yl. The term "quinazolinyl" as used herein includes quinazolin-2-yl, quinazolin-4-yl, quinazolin-5-yl, quinazolin-6-yl, quinazolin-7-y1 and quinazolin-8-yl. The term "quinoxalinyl"
as used herein includes quinoxalin-2-yl, quinoxalin-5-yl, and quinoxalin-6-yl.
The term "heteroaryloxy", as a group or part of a group, refers to a group having the formula -O-R"
wherein Rk is heteroaryl as defined herein above.
The term "heteroary1C1_6alkyl", as a group or part of a group, means a Ci_6alkyl as defined herein, wherein at least one hydrogen atom is replaced by at least one heteroaryl as defined herein. Non limiting examples of heteroarylCi_6alkyl are 2-quinolinylmethyl, 2-(4-pyridy1)-ethyl, and the like.
The term "Ci_6alkylthioCt_6alkylene", as a group or part of a group, refers to a group of formula -R'-S-le wherein RU is Cl_6alkylene as defined herein, and ba is Ci_6alkyl as defined herein.
The term "mercaptoCt_6alkyl" or "Ct_6alkylthio", as a group or part of a group, refers to a group of formula -SRa wherein Ra is Ci_6alkyl as defined herein.
The term "arylthio", as a group or part of a group, refers to a group of formula -SRa wherein W is aryl as defined herein.
The term "Ct_6alkyarylthio", as a group or part of a group, refers to a group of formula -SRa wherein Ra is Ci_6alkylaryl as defined herein.
The term "aminoCi_6alkyl", as a group or part of a group, refers to a group of formula -W-NWRP
wherein W is Ci_6alkylene, R is hydrogen or Ci_6alkyl as defined herein, and RP is hydrogen or CI_ 6a1ky1 as defined herein.
The term "mono- or di-Ct_6alkylamino", as a group or part of a group, refers to a group of formula -N(W)(RP) wherein RI' and RP are each independently selected from hydrogen, or Ci_6alkyl, wherein at least one of R or RP is Ci_6alkyl. Thus, Ci_6alkylamino include mono-alkyl amino group (e.g.
mono-C1_6alkylamino group such as methylamino and ethylamino), and di-alkylamino group (e.g. di-C1_6a1ky1amin0 group such as dimethylamino and diethylamino). Non-limiting examples of suitable mono- or di-C1_6a1kylamino groups include n-propylamino, isopropylamino, n-butylamino, butylamino, sec-butylamino, t-butylamino, pentylamino, n-hexylamino, di-n-propylamino, di-i-propylamino, ethylmethylamino, methyl-n-propylamino, methyl-i-propylamino, n-butylmethylamino, i-butylmethylamino, t-butylmethylamino, cthyl-n-propylamino, ethyl-i-propylamino, n-butylethylamino, i-butylethylamino, t-butylethylamino, di-n-butylamino, di-i-butylamino, methylpentylamino, methylhexylamino, ethylpentylamino, ethylhexylamino, propylpentylamino, propylhexylamino, and the like.
The term -mono- or di-arylamino-, as a group or part of a group, refers to a group of formula -N(Rq)(Rr) wherein Rq and Rr are each independently selected from hydrogen, aryl, or alkyl, wherein at least one of Rq or RI. is aryl.
The term "a1kylcarbonyl", as a group or part of a group, refers to a group of formula -CO-Rb, wherein Rb is alkyl as defined herein.
The term "arylCi_6alkylcarbonyl", as a group or part of a group, refers to a group of formula -CO-Rb, wherein Rb is arylCi_6alkyl as defined herein.
The term "arylcarbonyl-, as a group or part of a group, refers to a group of formula -CO-Rh, wherein Rb is aryl as defined herein.
The term "Ci_6alkyloxycarbonyl", as a group or part of a group, refers to a group of formula -COO-RI', wherein Rb is Ci_6alkyl as defined herein.
The term -arylCi_6alkyloxycarbonyl-, as a group or part of a group, refers to a group of formula -COO-Rb, wherein Rb is arylC1_6alkyl as defined herein.
The term "aryloxycarbonyl", as a group or part of a group, refers to a group of formula -COO-Rb, wherein Rb is aryl as defined herein.
The term "Ci_6alky1carbonylamino", as a group or part of a group, refers to a group of formula -NW-CO-Rh, wherein W is selected from hydrogen, or Ci_6a1kyl and Rb is Ci_6a1kyl as defined herein.
The term "arylCi_6alkylcarbonylamino-, as a group or part of a group, refers to a group of formula -NR -CO-Rb, wherein R is selected from hydrogen, or arylCi_6alkyl and Rb is ary1C1_6a1kyl as defined herein.
The tenn "alrylcarbonylamino", as a group or part of a group, refers to a group of formula -NR -CO-Rb, wherein R is selected from hydrogen, or aryl and Rb is aryl as defined herein.
The term "Ci_6alkylsulfonyl", as a group or part of a group, refers to a group of fomiula -S(0)2-Rb, wherein Rh is Ci_6alkyl as defined herein.
The term "arylCi_6alkylsulfonyl", as a group or part of a group, refers to a group of fonnula -S(0)2-Rb, wherein Rb is arylCi_6alkyl as defined herein.
The term "arylsulfonyl", as a group or part of a group, refers to a group of formula -S(0)2-Rb, wherein Rb is aryl as defined herein.
The term "mono- or diCi_6alkylaminocarbonyl", as a group or part of a group, refers to a group of formula -CONR RP wherein R RP are each independently selected from hydrogen, or C1_6alkyl, wherein at least one of R or RP is Ci_6a1kyl.
The term "mono- or diarylCi_oalkylaminocarbonyl", as a group or part of a group, refers to a group of formula ¨CONWRP wherein R"RP are each independently selected from hydrogen, or arylCi_6alkyl, wherein at least one of R or RP is arylCi_6alkyl.
The -term "mono- or diarylaminocarbonyl", as a group or part of a group, refers to a group of formula ¨
CONIMP wherein IMP are each independently selected from hydrogen, or aryl, wherein at least one of R or RP is aryl.
Whenever used in the present invention the term "compounds of the invention"
or a similar term is meant to include the compounds of general formula (I), (IA), (IB), (IC) or (ID) and any subgroup thereof. This term also refers to the compounds as depicted in Table 2 and their derivatives, N-oxides, salts, solvates, hydrates, tautomeric forms, analogues, pro-drugs, esters and metabolites, as well as their quatemized nitrogen analogues. The N-oxide forms of said compounds are meant to comprise compounds wherein one or several nitrogen atoms are oxidized to the so-called N-oxide.
As used herein and unless otherwise stated, the term "stereoisomer" refers to all possible different isomeric as well as conformational forms which the compounds of structural formula herein may possess, in particular all possible stereochemically and conformationally isomeric forms, all diastereomers, enantiomers and/or conformers of the basic molecular structure.
Some compounds of the present invention may exist in different tautomeric forms, all of the latter being included within the scope of the present invention.
The present invention includes all possible stereoisomers compounds of formula (I) and any subgroup thereof. When a compound is desired as a single enantiomer, such may be obtained by stereospecific synthesis, by resolution of the final product or any convenient intermediate, or by chiral chromatographic methods as each are known in the art. Resolution of the final product, an intermediate, or a starting material may be effected by any suitable method known in the art. See, for example, Stercochemistry of Organic Compounds by E. L. Elicl, S. H. Wilen, and L. N.
Mandel- (Wiley-Interscience, 1994), incorporated by reference with regard to stereochemistry.
A structural isomer is a type of isomer in which molecules with the same molecular formula have different bonding patterns and atomic organization. Where structural isomers are interconvertible via a low energy barrier, tautomeric isomerism ('tautomerism) can occur. This can take the form of proton tautomerism in compounds of the invention containing, for example, an imino, keto, or oxime group, or so-called valence tautom eri sm in compounds which contain an aromatic moiety.
The compounds of the invention may be in the fonm of salts, preferably pharmaceutically acceptable salts, as generally described below. Some preferred, but non-limiting examples of suitable pharmaceutically acceptable organic and/or inorganic acids are as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, acetic acid and citric acid, as well as other pharmaceutically acceptable acids known per se (for which reference is made to the prior art referred to below).
When the compounds of the invention contain an acidic group as well as a basic group the compounds of the invention may also form internal salts, and such compounds are within the scope of the invention.
When the compounds of the invention contain a hydrogen-donating heteroatom (e.g. NH), the invention also covers salts and/or isomers formed by transfer of said hydrogen atom to a basic group or atom within the molecule.
Pharmaceutically acceptable salts of the compounds of formula (I) and any subgroup thereof include the acid addition and base salts thereof Suitable acid addition salts are formed from acids which form non-toxic salts. Examples include the acetate, adipate, aspartate, benzoate, besylate, bicarbonate/carbonate, bisulfate/sulfate, borate, camsylate, citrate, cyclamate, edisylate, esylate, formate, fumarate, gluccptatc, gluconatc, glucuronate, hexafluorophosphate, hibenzate, hydrochloride/chloride, hydrobromide/bromide, hydroiodide/iodide, isethionate, lactate, malate, maleate, malonate, mesylate, methylsulphate, naphthylate, 2-napsylate, nicotinate, nitrate, orotate, oxalate, palmitatc, pamoatc, phosphate/hydrogen phosphatc/dihydrogcn phosphate, pyroglutamatc, saccharate, stearate, succinate, tannate, tartrate, tosylate, trifluoroacetate and xinofoate salts. Suitable base salts are formed from bases which form non-toxic salts. Examples include the aluminium, a,rginine, benzathine, calcium, choline, diethylamine, diolamine, glycine, lysine, magnesium, meglumine, olamine, potassium, sodium, tromethamine and zinc salts. Hemisalts of acids and bases may also be formed, for example, hemisulphate and hemicalcium salts. For a review on suitable salts, see Handbook of Pharmaceutical Salts: Properties, Selection, and Use by Stahl and Wermuth (Wiley-VCH, 2002), incorporated herein by reference.
The term "prodrug" as used herein means the pharmacologically acceptable derivatives such as esters, amides and phosphates, such that the resulting in vivo biotransformation product of the derivative is the active drug. The reference by Goodman and Gilman (The Pharmacological Basis of Therapeutics, 8th Ed, McGraw-Hill, Int. Ed. 1992, "Biotransformation of Drugs", p 13-15) describing pro-drugs generally is hereby incorporated. Prodrugs of the compounds of the invention can be prepared by modifying functional groups present in said component in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent component. Typical examples of prodrugs are described for instance in WO 99/33795, WO 99/33815, WO 99/33793 and WO 99/33792 all incorporated herein by reference. Prodrugs are characterized by increased bio-availability and are readily metabolized into the active inhibitors in vivo. The term "prodrug", as used herein, means any compound that will be modified to form a drug species, wherein the modification may take place either inside or outside of the body, and either before or after the pre-drug reaches the area of the body where administration of the drug is indicated.
As used herein, an -element of Group VII of the Periodic Table" corresponds to transition metals manganese (Mn), technetium (Tc), rhenium (Re) and bohrium (Bh).
The term "radionuclide- is to be interpreted in the broad commonly used definition in the art, and thus refers to any atom that contains excess nuclear energy that renders said atom unstable. More particularly the tenn refers to an isotope of natural or artificial origin which shows radioactive properties. Non-limiting examples of radionuclide include 99mTc or 1881te or i86Re.
The term -labeled- as used herein means -radiolabeled- and is more precisely directed to a compound comprising or complexed with at least one radionuclide.
It is understood that when reference is made herein to "prostate-specific membrane antigen", abbreviated herein and in the art as "PSM" and "PSMA" and interchangeably annotated in the art by the non-limiting synonyms "glutamate carboxypeptidase 2" (abbreviation:
"GCP2"), "glutamate carboxypeptidase II" ("GCPII"), "cell growth-inhibiting gene 27 protein", "folate hydrolase 1", "folylpoly-gamma-glutamate carboxypeptidase" ("FGCP"), "membrane glutamate carboxypeptidase"
("mGCP"), "N-acetylated-alpha-linked acidic dipeptidase I" ("NAALADase I"), NAAG peptidase, and "pteroylpoly-gamma-glutamate carboxypeptidase" that reference is made to the protein having as UniProt identifier (www.uniprotorg) Q04609 (FOLHl_FIUMAN) and NCBI reference (ncbi.nlm.nih.gov) NP 004467.1 as encoded in Homo sapiens by the gene FOLH1 unless specified otherwise. PSMA is a zinc metalloenzyme that is categorised as a class 11 membrane glycoprotein that catalises the hydrolysis of hydrolysis of N-acetylaspartylglutamate (NAAG) to glutamate and N-acetylaspartate (NAA). The canonical sequence of PSMA is by means of example reproduced below (SEQ ID NO: 1):
MWNLLHE TDSAVATARRPRWLCAGALVLAGG F FLLG FL FGW F IKS SNEATNI T PKHNMKAFLDELKAE
NIKKFLYNFTQ I PHLAGTEQNFQLAKQIQSQWKE FGLDSVELAHY DVLL SY PNKT HPNY IS I INEDGN
E I FNT SL FE PP P PGY ENVSDI VPP FSAFSPQGMPEGDLVYVNYART
EDFFKLERDMKINCSGKIVIAR
YGKVFRGNKVKNAQLAGAKGVILYSDPADY FAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLT PGY
PANEYAYRRGIAEAVGL PSI PVHP IGYYDAQKLLEKMGGSAP PDS SWRGSLKVPYNVGPGFIGNESTQ
KVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVEGGIDPQSGAAVVHE IVRS FGTLKKE
GWRPRRT IL FASWDAEE FGLLGSTEWAEENSRLLQERGVAY INADS S EGNYTLRVDCT PLMYSLVHN
LTKELKS PDEGFEGKSLYESWTKKSP SPE FSGMPRI SKLGSGNDFEVFFQRLGIASGRARYTKNWETN
KFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANS IVLP FDCRDYAVVLRKYADKIY
S I SMKHPQEMKT YSVS FDSL FSAVKNFTE IASKFSE RLQDFDKSNP IVLRMMNDQLMFL ERAFI DPLG
LPDRP FY RHVI YAPS SHNKYAGE S FPGIYDAL FD I E SKVDPS KAWGEVKRQ I
YVAAFTVQAAAETLS E
VA
While SEQ ID NO: 1 as depicted above is generally accepted as the canonical sequence of PSMA, it is evident that the term "PSMA" and synonyms thereof equally encompass any isoforms of PSMA, truncated versions of PSMA, and genetic polymorphisms of PSMA. In particular, the term "PSMA" is intended to cover any protein sequence having at least 80%, preferably at least 85%, more preferably at least 90%, more preferably at least 95%, yet more preferably at least 97.5%, most preferably at least 99% sequence identity to SEQ ID NO: 1. A skilled person further appreciates that the radiotheranostics described in the present invention are capable of selectively binding any protein that contains at least the extracellular active center of PSMA.
Related hereto, a person skilled in the art is well aware of methods and tools to verify sequence homology, sequence similarity or sequence identity between different sequences of amino acids or nucleic acids. Non-limiting examples of such methods and tools are Protein BLAST
(https://blast.ncbi.nlm .nih.gov/Blast.cgi), ClustalW2 (https ://www .ebi .ac .uk/Tools/msa/clustalw2/), SIM alignment tool (https://web.expasy.org/sim/), TranslatorX
(http://translatorx.co.uk/) and T-COFFEE (https://www.ebi.ac.uk/Tools/msa/tcoffee/). The percentage of identity between two sequences may show minor differences depending on the algorithm choice and parameters.
The term -sequence identity" as used herein refers to the relationship between sequences at the amino acid level. The expression "% identical" is determined by comparing optimally aligned sequences, e.g.
two or more, over a comparison window wherein the portion of the sequence in the comparison window may comprise insertions or deletions as compared to the reference sequence for optimal alignment of the sequences. The reference sequence does not comprise insertions or deletions. A reference window is chosen and the "% identity" is then calculated by determining the number of nucleotides (or amino acids) that are identical between the sequences in the window, dividing the number of identical nucleotides (or amino acids) by the number of nucleotides (or amino acids) in the window and multiplying by 100. Unless indicated otherwise, the sequence identity is calculated over the whole length of the reference sequence. A skilled person is aware of the related, yet different interpretations in the art of the terms "similarity", "homology", and "identity" (explained in detail in e.g. Pearson, Current protocols in bioinformatics, 2014).
As indicated above, the membrane-bound protease PSMA is overexpressed up to 1000-fold on prostate tumor cells and the precise expression level shows a strong correlation with the disease state, as has been described in the art on numerous occasions (e.g. in Hupc et al., Front Oncol, 2018). Furthermore, PSMA is typically expressed in the neovasculature of several solid tumors such as but not limited to renal carcinoma, breast cancer, non-small-cell lung cancer (NSCLC) and oral cancer. Additionally, PSMA is expressed in a number of healthy tissues such as prostate tissue (in the secretory acinar epithelium), the nervous system (astrocytcs and Schvvann cells), intestinal tissue (jejunal brush order in the small bowel), kidney (proximal tubes), and salivary glands. A skilled person is aware that expression levels in mainly the kidneys and salivary glands are crucial for determining the dose-limiting factor of radionuclide therapy since these tissues display the highest nontarget uptake in a subject receiving treatment with a PSMA-selective radionuclide. Structurally, the PSMA is characterised by three main domains: an extracellular domain, a transmembrane domain and an enzymatically active extracellular domain which comprises two zinc ions as part of the enzymatic active site. The enzymatic active site of PSMA is composed of two pockets, Si and Si'. Glutamate-like structures bind to the Si' pocket which is crucial for high-affinity binding while the Si pocket is more flexible (Barinka et al., J Med Chem, 2007).
The term "amino acid" encompasses naturally occurring amino acids, naturally encoded amino acids, non-naturally encoded amino acids, non-naturally occurring amino acids, amino acid analogues and amino acid mimetics that function in a manner similar to the naturally occurring amino acids, all in their D- and L-stereoisomers, provided their structure allows such stereoisomeric forms. Amino acids are referred to herein by either their name, their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. A
"naturally encoded amino acid" refers to an amino acid that is one of the 20 common amino acids or pyrrolysine, pyrroline-carboxy-lysine or selenocysteine. The 20 common amino acids are:
Alanine (A or Ala), Cysteine (C or Cys), Aspartic acid (D or Asp), Glutamic acid (E or Glu), Phenylalanine (F or Phe), Glycine (G or Gly), Histidine (H or His), Isoleucine (I or Ile), Lysine (K or Lys), Leucine (L or Leu), Methionine (M or Met), Asparagine (N or Asn), Proline (P or Pro), Glutamine (Q
or Gln), Arginine (R
or Arg), Serine (S or Ser), Threonine (T or Thr), Valine (V or Val), Tryptophan (W or Trp), and Tyrosine (Y or Tyr). A "non-naturally encoded amino acid" refers to an amino acid that is not one of the 20 common amino acids or pyrrolysine, pyrroline-carboxy-lysine or selenocvsteine.
The term includes without limitation amino acids that occur by a modification (such as a post-translational modification) of a naturally encoded amino acid, but arc not themselves naturally incorporated into a growing polypeptide chain by the translation complex, as exemplified without limitation by N-acetylglucosaminyl-L-serine, N-acetylglucosaminyl-L-threonine, and 0-phosphotyrosine. Further examples of non-naturally encoded, un-natural or modified amino acids include 2-Aminoadipic acid, 3-Aminoadipic acid, beta-Alanine, beta-Aminopropionic acid, 2-Aminobutyric acid, 4-Aminobutyric acid, piperidinic acid, 6-Aminocaproic acid, 2-Aminoheptanoic acid, 2-Aminoisobutyric acid, 3-Aminoisobutyric acid, 2-Aminopimelic acid, 2,4 Diaminobutyric acid, Desmosine, 2,2' -Diaminopimelic acid, 2,3-Diaminopropionic acid, N-Ethylglycine, N-Ethylasparagine, homoserine, homocysteine, Hydroxylysine, allo-Hydroxylysine, 3-Hydroxyproline, 4-Hydroxyproline, Isodesmosine, allo-Isoleucine, N-Methylglycine, N-Methylisoleucine, 6-N-Methyllysine, N-Methylvaline, Norvaline, Norleucine, or Omithine. Also included are amino acid analogues, in which one or more individual atoms have been replaced either with a different atom, an isotope of the same atom, or with a different functional group. Also included are un-natural amino acids and amino acid analogues described in Ellman et al. Methods Enzymol. 1991, vol. 202, 301-36.
Another aspect of the invention is directed to pharmaceutical compositions comprising one or more pharmaceutically acceptable excipients and a therapeutically effective amount of a metal complex as described herein. In preferred embodiments, the pharmaceutical composition comprises a metal complex comprising Rhenium, preferably Rhenium-188 or 186. In alternative preferred embodiments, the pharmaceutical composition comprises a metal complex comprising Technetium-99m.
In view of the above, any reference to the use of the metal complexes in diagnosis, monitoring, therapy or imaging (or any variation of such language) also encompasses such uses of pharmaceutical compositions comprising the metal complexes described in the present disclosure. The terms "pharmaceutical composition", "pharmaceutical formulation", or short "composition" and "formulation" may be used interchangeably and are to be considered synonyms.
The pharmaceutical compositions as taught herein may comprise in addition to the one or more pharmaceutically active ingredients, and/or one or more pharmaceutically acceptable carriers (interchangeably referred to as "excipients". The term "pharmaceutically acceptable" as used herein is consistent with the art and means compatible with the other ingredients of a pharmaceutical composition and not deleterious to the recipient thereof. Suitable pharmaceutical excipients depend on the dosage form and identities of the active ingredients and can be selected by the skilled person (e.g., by reference to Rowe et al., Handbook of Pharmaceutical Excipients 7th Edition 2012). As used herein, the terms "carrier" or "excipient" are used interchangeably and broadly include any and all solvents, diluents, buffers (such as, e.g., neutral buffered saline, phosphate buffered saline, or optionally Tris-HC1, acetate or phosphate buffers), solubilisers (such as, e.g., Tweenk 80, Polysorbate 80), colloids, dispersion media, vehicles, fillers, chelating agents (such as, e.g., EDTA or glutathione), amino acids (such as, e.g., glycine), proteins, disintegrants, binders, lubricants, wetting agents, emulsifiers, sweeteners, colorants, flavourings, aromatiscrs, thickeners, agents for achieving a depot effect, coatings, antifungal agents, preservatives (such as, e.g., Thimerosaff, benzyl alcohol), antioxidants (such as, e.g., ascorbic acid, sodium metabisulfite), tonicity controlling agents, absorption delaying agents, adjuvants, bulking agents (such as, e.g., lactose, mannitol) and the like. The use of such media and agents for the formulation of pharmaceutical compositions is well known in the art. Acceptable diluents and excipients typically do not adversely affect a recipient's homeostasis (e.g., electrolyte balance).
The use of such media and agents for pharmaceutical active substances is well known in the art. It is evident that all of the used ingredients should be non-toxic in the concentration contained in the final pharmaceutical composition and should not negatively interfere with the activity of the estetrol component, said estetrol component preferably being present in the pharmaceutical composition as the predominant pharmaceutically active ingredient. In certain embodiments, more than one excipient which a skilled person would classify as belonging to the same group of excipients is added to the pharmaceutical composition. In further embodiments, more than one excipient wherein the different excipients belong to different groups is added to the pharmaceutical composition. In certain embodiments, the excipients may fulfil more than one function and/or be classified by a skilled person as belonging to different groups or classes of excipients. Further illustrative examples of acceptable excipients may include biocompatible, inert or bioabsorbable salts, buffering agents, oligo- or polysaccharides, polymers, viscosity-improving agents, preservatives and the like. Non-limiting exemplary solvents are physiologic saline (0.15 M NaC1, pH
7.0 to 7.4) and 50 mM sodium phosphate, 100 mM sodium chloride. The precise nature of the excipients and solvents will depend on the route of administration. For example, the pharmaceutical composition may be in the form of a parenterally acceptable aqueous solution, which is pyrogen-free and has suitable pH, isotonicity and stability. Preferably, the pH value of the pharmaceutical formulation is in the physiological pH range, such as particularly the pH of the formulation is between about 6 and about
8.5, more preferably between about 6 and about 8.5, even more preferably between about 7 and about 7.5.
While pharmaceutical compositions as intended herein may be formulated for essentially any route of administration, parenteral administration (such as, e.g., subcutaneous, intravenous (IV.), intramuscular, intraperitoneal or intrastemal injection or infusion) or topical administration may be preferred. The effects attainable can be, for example, systemic, local, tissue-specific, etc., depending of the specific needs of a given application. In certain embodiments, an I.V. bolus injection or infusion may advantageously allow the metal complex to enter circulation and be distributed throughout the body, allowing to label cells and tissues that are characterized by PSMA expression.
One skilled in this art will recognise that the above paragraphs on pharmaceutical compositions are merely illustrative and should by no means be interpreted as being an exhaustive list of embodiments..
Indeed, many additional formulations techniques and pharmaceutically-acceptable excipients and solvent solutions are well-known to those skilled in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of administration or treatment regimens.
A further aspect of the invention relates to a metal complex as described herein or a pharmaceutical composition as described herein for use as a medicament. The invention further provides in the use of a metal complex as described herein for the manufacture of a medicament for treatment of a disease in a subject.
Further envisaged are methods of treatment and methods of diagnosis which comprise administration of the metal complexes described herein or pharmaceutical compositions described herein to a subject.
Another aspect of the invention relates to a metal complex as described herein or a pharmaceutical composition as described herein for use in the treatment or prevention of cancer. Therefore, also envisaged by the present invention are methods of treating or preventing cancer comprising administration of at least one metal complex as described herein or pharmaceutical composition as described herein. Furthermore, the use of an effective amount of a metal complex as described herein for the manufacture of a medicament for treating or preventing cancer is also intended. In certain embodiments, preventing cancer indicates inhibition of clinical manifestation of cancer. In certain embodiments, the medical use or method of treatment comprises continuous administration of the metal complexes described herein or the pharmaceutical compositions described herein to a subject. In alternative embodiments, the medical use or method of treatment comprises intermittent administration of the metal complexes described herein or the pharmaceutical compositions described herein to a subject.
The terms "treatment- or "treat- are to be interpreted as both the therapeutic treatment of a disease or condition that has already developed, leading to clinical manifestations, such as but not limited to the therapy of an already developed malignancy such as prostate cancer, as well as prophylactic or preventive measures, wherein the goal of the treatment is to prevent, lessen, or reduce the chances of incidence of an undesired clinical affliction, such as to prevent further development and progression of a clinical condition or disease such as prostate cancer. Beneficial or desired clinical results may include, without limitation, alleviation of one or more symptoms, improvement of one or more biological markers, diminishment of extent of disease, stabilized (i.e. not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, slowing tumor growth, reducing the mass of the (main) tumor body, reducing the number and/or size of metastases, and the like. -Treatment" can also mean prolonging survival as compared to expected survival if not receiving treatment, or a reduced risk of mortality.
As used herein, the terms "therapeutic treatment" or "therapy" and the like, refer to treatments wherein the aim is to change a subjects body or a part of a subjects body from an undesired physiological state, disease or disorder which is caused by an infectious agent, to a desired state, such as a less severe state (e.g., amelioration or palliation), or even back to its normal, healthy state (e.g., restoring the health, the physical integrity and the physical well-being of a subject), to keep it (i.e., not worsening) at said undesired physiological status (e.g., stabilization), or slow down progression to a more severe or worse state compared to said undesired physiological change or disorder. Measurable lessening includes any statistically significant decline in a measurable marker or symptom.
Statistically significant as used herein refers top values below 0.05, which is a commonly accepted cutoff score in statistical analysis as a skilled person appreciates. "Treatment" encompasses both curative treatments and treatments directed to reduce symptoms and/or slow progression and/or stabilize the disease.
A skilled person is aware that in order to achieve an effective therapeutic treatment, a therapeutically effective dose needs to be administered to said subject. Therefore, in the context of the present disclosure when reference is made to a metal complex as described herein or a pharmaceutical composition as described herein it is evident that an "effective amount" is envisaged, wherein the "effective amount" refers to an amount necessary to obtain a physiological effect. The physiological effect may be achieved by a single dose or by multiple doses. A
"therapeutically effective amount" or "therapeutically effective dose" indicates an amount of metal complex described herein or pharmaceutical composition as described herein that when administered brings about a clinical positive response with respect to treatment of a subject afflicted by a malignancy such as but by no means limited to prostate cancer. A skilled person is aware that tenns such as "quantity", "amount" and "level" are synonyms and have a well-defined meaning in the art and appreciates that these may particularly refer to an absolute quantification of a metal complex as described herein which is considered an effective amount for the applications described herein, or to a relative quantification of the metal complex, such as for example a concentration of metal complex in function of the subject's bodyweight. Suitable values or ranges of values may be obtained from one single subject or from a group of subjects (i.e. at least two subjects). The term "to administer" generally means to dispense or to apply, and typically includes both in vivo administration and ex vivo administration to a tissue, preferably in vivo administration. Generally, compositions may be administered systemically or locally.
For therapeutic applications (e.g. with Rhenium), the preferred dose (activity) is about are 1-10 GBq.
Regarding diagnostic use, (e.g. with Technetium) about 200 to 1000 MBq is typically used for administration. More preferably about 500-800 MBq.
As used herein, the tenn "cancer" refers to a malignant neoplasm (i.e. a "malignancy") characterised by deregulated or unregulated cell growth. The term "cancer" includes primary malignant cells or tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor) and secondary malignant cells or tumors (e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor). The term "metastatic" or "metastasis" generally refers to the spread of a cancer from one organ or tissue to another non-adjacent organ or tissue. The occurrence of the neoplastic disease in the other non-adjacent organ or tissue is referred to as metastasis. The term "neoplastic disease" generally refers to any disease or disorder characterised by neoplastic cell growth and proliferation, whether benign (not invading surrounding normal tissues, not forming metastases), pre-malignant (pre-cancerous), or malignant (invading adjacent tissues and capable of producing metastases). The term neoplastic disease generally includes all transformed cells and tissues and all cancerous cells and tissues. Ncoplastic diseases or disorders include, but are not limited to abnormal cell growth, benign tumors, premalignant or precancerous lesions, malignant tumors, and cancer. As used herein, the terms "tumor" or "tumor tissue" refer to an abnormal mass of tissue that results from excessive cell division. A tumor or tumor tissue comprises tumor cells which are neoplastic cells with abnormal growth properties and no useful bodily function. Tumors, tumor tissue and tumor cells may be benign, pre-malignant or malignant, or may represent a lesion without any cancerous potential. A
tumor or tumor tissue may also comprise tumor-associated non-tumor cells, e.g., vascular cells which form blood vessels to supply the tumor or tumor tissue. Non-tumor cells may be induced to replicate and develop by tumor cells, for example, the induction of angiogenesis in a tumor or tumor tissue.
Cancers are typically classified into different stages of disease progression in the art. It is envisaged that each of the commonly annotated cancer stages may benefit from treatment with a metal complex as described herein or a pharmaceutical composition as described herein.
Furthermore, it is envisaged that the present metal complexes and phannaceutical compositions described herein are particularly useful for cancers categorized by the TNM staging system as N (node) and M
(metastasis) cancer stages (Tio, Gastrointest Endosc, 1996). In certain embodiments, the cancer stage, such as for example the cancer stage of prostate cancer is selected from one or more of the following cancer stages: stage 1, stage 11, stage IIA, stage JIB, stage ITC, stage III, stage IIIA, stage IIIB, stage BIC, stage IV, stage IVA, stage IVB. By means of illustration, for prostate cancer these stages correspond to the following clinical images depicted in Table 1:
Prostate Clinical manifestation cancer stage Slow growing. The tumor cannot bc physically felt and involves one-half of a side of the prostate or less than one-half of a side of the prostate. Prostate-specific Stage I
antigen (PSA) levels are low (i.e. PSA < lOng/m1). The cancer cells do not show significant morphological abnormalities.
Tumor localisation is restricted to the prostate. Low to medium (i.e. between Stage II
and 20 mg/ml) PSA levels.
The tumor cannot be physically felt and involves half of 1 side of the prostate or less than one-half of a side of the prostate. Medium PSA levels and well - Stage IIA
differentiated cancer cells. This stage further includes larger tumors whereof localisation is restricted to the prostate.
Tumor localisation restricted to the prostate and may be felt during digital rectal - Stage JIB
examination (DRE). Medium PSA levels. Moderately differentiated cancer cells.
Tumor localisation restricted to the prostate, and may be felt during DRE. The - Stage IIC
PSA level is medium. Moderately or poorly differentiated cancer cells.
High PSA levels. Growing tumor and/or high grade. Reasonable chance to grow Stage III
and at risk of spreading.
Loss of restricted prostate localisation of malignant cells (i.e. tumors) and - Stage IIIA dissemination to nearby tissues, optionally including the seminal vesicles. High PSA levels (i.e. > 20 ng/ml).
Further dissemination of malignant cells (i.e. tumors) to nearby structures, - Stage IIIB
optionally including bladder and/or rectum.
- Stage 111C Poorly differentiated cancer cells Stage IV Metastasis beyond the prostate.
- Stage IVA Metastasis to the regional lymph nodes.
- Stage IVB Metastasis to distant lymph nodes, other body parts and/or bones.
Table 1. prostate cancer stages and associated clinical manifestation.
Information taken from WWW.cancer.net.
In certain embodiments, the prostate cancer to be treated by a metal complex as described herein or a pharmaceutical composition as described herein is a prostate cancer having a Gleason score of from between 2 and 10, preferably a Gleason score of from between 4 and 10, more preferably a Gleason score of from between 6 and 10, most preferably a Gleason score of from between 7 and 10. The Gleason scoring system is known to a person skilled in the art (Munjal and Leslie, StatPearls, 2020).
Yet another aspect of the invention relates to a metal complex as described herein or a pharmaceutical composition as described herein for use in a method of in vivo diagnosis.
Further envisaged are metal complexes as described hcrcin or pharmaceutical compositions as described herein for use as a radiodiagnostic agent in a method of in vivo diagnosis. Therefore, also envisaged by the present invention are methods of diagnosis of PSMA-positive cancer types comprising administration of a detectable quantity of the metal complexes or pharmaceutical compositions as described herein to a subject and subsequent in vivo imaging of said metal complex. Also envisaged is the use of a metal complex as described herein for the manufacture of an in vivo diagnostic pharmaceutical composition.
A further aspect of the invention relates to a metal complex as described herein or a pharmaceutical composition as described herein for use in a method of in vivo monitoring of PSMA expression and/or PSMA-expressing cells, more preferably PSMA-expressing cancer cells, most preferably PSMA-expressing prostate cancer cells. Further envisaged are metal complexes as described herein or pharmaceutical compositions as described herein for use as a radioimaging agent in a method of in vivo monitoring of PSMA expression and/or PSMA-expressing cells, preferably PSMA
expressing cancer cells, most preferably PSMA-expressing prostate cancer cells. Therefore, also envisaged by the present invention are methods of in vivo monitoring PSMA expression and/or PSMA-expressing cells, preferably PSMA-positive cancer cells, most preferably PSMA positive prostate cancer cells comprising administration of a detectable quantity of a metal complex as described herein or a pharmaceutical compositions as described herein to a subject and subsequent in vivo imaging of said metal complex. In preferred embodiments, the use or method comprises conducting the step of administrating a detectable quantity of the metal complex or the pharmaceutical composition on at least two distinct time points. In further preferred embodiments, a first time point may be prior to the start of a given therapy that aims to reduce an aberrant amount and/or localisation of PSMA-expressing cells in a subject. Accordingly, a second, subsequent time point may be defined during or after the therapy.
By means of illustration and not limitation, the imaging time points may be scheduled before and after a change in the type and/or dosage regiment of a therapy. By further means of illustration and not limitation, the imaging time points may be scheduled before and after a change in one or more changes in biomolecular parameters of a subject and/or before and after a change in clinical parameters of a subject. For example, the imaging time points may be scheduled at substantially regular intervals during or after a therapy, for example to monitor cancer regression, remission or relapse, preferably wherein the cancer is a PSMA-expressing cancer type, more preferably wherein the cancer type is prostate cancer. In certain embodiments, the in vivo monitoring is conducted in a context of preventive screening to detect formation of aberrant PSMA-expressing cells in a subject (i.e. a preventive and/or routine cancer screening procedure). In alternative embodiments, the in vivo monitoring is conducted in a context of therapy monitoring to assess therapy efficacy, optionally therapy efficacy of a radionuclide.
In yet alternative embodiments, the in vivo monitoring is conducted in a context of periodical screening for recurrence (i.e. relapse) of a PSMA-expressing malignancy, such as but not limited to prostate cancer. Other appropriate embodiments of the imaging methods adapted for diagnosis and monitoring of any of the herein described indications will be apparent to the skilled person who is capable of defining further appropriate time points for imaging.
Further envisaged by the present invention is a metal complex as described herein or a pharmaceutical composition as described herein for use as a radiodiagnostic agent, preferably for use as a radiodiagnostic agent for in vivo imaging of cells expressing PSMA, preferably for use as a radiodiagnostic agent for in vivo imaging of cancer cells expressing PSMA, most preferably for use as a radiodiagnostic agent for in vivo imaging of prostate cancer cells expressing PSMA. Also envisaged is the use of a metal complex as described herein for the manufacture of a radiodiagnostic agent, optionally comprised in a radiodiagnostic composition.
"Diagnosed with", "diagnosing", and diagnosis are indicative for a process of recognising, deciding on, or concluding on a disease, condition, or (adverse side effect) in a subject on the basis of symptoms and signs and/or from results of various diagnostic procedures (such as, for example, from knowing the presence, absence and/or quantity of one or more biomarkers of or clinical symptoms characteristic for the diagnosed disease or condition). "Diagnosis of' the diseases, conditions, or (adverse) side effects as taught herein in a subject may particularly mean that the subject has such disease or condition. A subject may be diagnosed as not having such despite displaying one or more conventional symptoms or signs reminiscent of such. "Diagnosis of' the diseases or conditions as taught herein in a subject may particularly mean that the subject has respiratory infection disease.
"Prognosticating" in the context of the invention is indicative for anticipation on the progression of a malignancy such as prostate cancer in a subject and the prospect (e.g. the probability, duration, and/or extent) of recovery, and/or the severity of experiencing or amelioration of said infection. The term "a good prognosis of' generally encompasses anticipation of a satisfactory partial or complete recovery from a diagnosed disease or pain condition, optionally within an acceptable time period. Alternatively, the term may encompass anticipation of not further worsening or aggravating of such, preferably within a given time period. The term "a poor prognosis of' the disease or condition typically encompass an anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or no recovery at all, or further worsening of the malignancy and/or any clinical manifestation associated with said malignancy.
"Radiodiagnosis" and "Radiodiagnostic agent" as used in the context of the present disclosure are tenns that respectively indicate specific methods of diagnosis and diagnostic agents that allow a skilled (healthcare) practitioner to evaluate whether a subject is considered to have or has a specific medical condition by means of a clinical imaging method (i.e. by means of radiology) as defined further in the present disclosure. In certain embodiments, the diagnosis of aberrant PSMA expression, and therefore diagnosis of a PSMA-expressing cancer type is established by combining the images obtained after administration of the radiodiagnostic agent to a subject with any other means of diagnosis for a malignant neoplastic disease, such as prostate cancer. In further embodiments, the diagnosis of aberrant PSMA expression and therefore diagnosis of a PSMA-expressing cancer type such as prostate cancer is established by combining the images obtained after administration of the radiodiagnostic agent to a subject with a diagnosis method selected from the group of diagnosis methods consisting of: a digital rectal examination, a prostate-specific antigen (PSA) test, ultrasound imaging, magnetic resonance imaging, biopsy (e.g. transperineal biopsy or transrectal biopsy), or any combination thereof Related to the foregoing, "predicting" or "prediction" generally refer to a statement, declaration, indication or forecasting of a disease or condition in a subject not (yet) showing any, or a limited, clinical manifestation of said disease, condition, or (adverse) side effects.
A prediction of a certain clinical disease manifestation, condition, or adverse effect in a subject may indicate a probability, chance, or risk that said subject will develop said clinical manifestation, condition, or (adverse) side effect, for example within a certain time period after diagnosis of the malignancy such as but not limited to prostate cancer. Said probability, chance or risk may be indicated as any suitable qualitative or quantitative expression, wherein non-limiting examples of a quantitative expression include absolute values, ranges or statistics. Alternatively, probabilities, chances, or risks may be indicated relative to a suitable control subject or group of control subject (i.e. a control subject population (such as, e.g., relative to a general, normal or healthy subject or subject population)).
Therefore, any probability, chance or risk may be advantageously indicated as increased or decreased, upregulated or downregulated, as fold-increased or fold-decreased relative to a suitable control subject or subject population, or relative to a baseline value which may be derived from either a control subject (population), textbook reference values. It is evident that when a population of subjects is used to define the baseline value, said baseline value will be a centre size of one or more values (parameters) of a population, such as the mean or median of said value. A skilled person further appreciates that monitoring of a malignancy such as but not limited to prostate cancer may allow to predict the progression, aggravation, alleviation or recurrence of the clinical image or severity of said malignancy.
Furthermore, monitoring may be applied in the course of a medical treatment of a subject. Such monitoring may be comprised, e.g., in decision making whether a patient may be discharged from a controlled clinical or health practice environment, needs a change in treatment or therapy, or requires (extended) hospitalisation.
A further aspect of the invention is directed to a metal complex as described herein or a pharmaceutical composition as described herein for use as a theranostic agent. Also envisaged are methods of simultaneous diagnosis and treatment, comprising administering a metal complex as described herein or a pharmaceutical composition as described herein in a detectable and pharmaceutically active amount to a subject. Further intended is the use of a metal complex as described herein for the manufacture of a theranostic composition. The term "theranostic agent" is known to a skilled person (described in detail e.g. in Langbein et al., J Nucl Med, 2019) and refers in the context of the present invention to a suitability of a single metal complex as described herein which preferentially or selectively binds to PSMA that is suitable for use as both a diagnostic agent, a therapeutic agent, and optionally a means for monitoring disease progression and/or therapy efficacy. Several suitable atoms for use in theranostics have been described and include without limitation lutetium-177 (177Lu), actinium-255 (225Acs.), iodine-123 (123I), iodine-131 (131I), yttrium-86, yttrium-90, terbium-152 (152Tb), terbium-155 (155Tb), terbium 149 (149Tb), and terbium-161 ('61T
b). Criteria for suitability of an atom as part of a theranostic agent have been described in the art (Yordanova et al., Onco Targets Ther, 2017).
Yet a further aspect of the invention is directed to a metal complex as described herein for use in radioguided surgery. Therefore also envisaged are methods of radioguided surgery comprising administration of a detectable quantity of the metal complex and a subsequent step of invasive surgery to remove PSMA-expressing tumor tissue that is radiolabeled by said probe.
Hence, the use of a metal complex as described herein for the manufacture of a pharmaceutical labelling composition for use in radiosurgery is accordingly envisaged. "Radioguided surgery" is a medical procedure known to a skilled person and is has been described at numerous occasions (e.g. in Povoski et al., World J Surg Oncol, 2009). Briefly, radioguided surgery relies on radiolabeling a certain target tissue or target cell type, in the context of the present invention typically PSMA-expressing cells and/or PSMA-expressing tumor cells, whereafter said radiolabeled tissues or cells are surgically removed.
During the surgical procedure, a probe is utilised to "scan" the surgical wound area for radiolabeled tissues and cells, which indicates to the surgeon(s) which tissue was radiolabeled, and hence in the context of PSMA-expressing cancer tissue or cells need to be surgically removed.
The term "imaging" as used ubiquitously throughout the present disclosure is to be interpreted in its broadest context and hence encompasses any medical imaging technique or process for creating visual representations of the interior of a body and/or visual representation of the function of organs or tissues of a subject. Non-limiting examples of imaging methodologies and techniques as envisaged by the present disclose include X-ray radiography, X-ray computed tomography (CT), magnetic resonance imaging (MR1), positron emission tomography (PET), PET-CT, and single-photon emission computed tomography (SPECT). In preferred embodiments, the imaging modality may be PET, PET-CT, or SPECT since these imaging methods are particularly suited for visualising a detectable signal of the metal complexes described herein. In more preferred embodiments, the emitted signal by a detectable quantity of a metal complex described herein is detected by positron emission tomography (PET) and a PET image is generated. In alternative preferred embodiments, the emitted signal by a detectable quantity of a metal complex described herein is detected by single photon emission computed tomography (SPECT) and a SPECT image is generated. In certain embodiments, the imaging methods described herein may further comprise superimposing a PET or SPECT image with a computed tomography (CT) image or a magnetic resonance image (MRI).
In certain embodiments, the imaging methods described herein may be used to monitor, follow-up or track the progression of a malignancy such as but not limited to prostate cancer over time by generating images that lend themselves to a side-by-side comparison (e.g., images generated with the same quantity of the antibody per kg subject weight and the same route and manner of administration; using substantially the same settings on the imaging system; etc.) at two or more sequential time points, optionally where the patient has received or may be receiving a treatment aimed at slowing and/or inhibiting disease progression.
In certain embodiments, two or more distinct metal complexes may be detected in the imaging methods described herein. A simultaneous or consecutive detection of two or more metal complexes enables detection and optionally visualisation of multiple entities such as but not limited to distinct molecular markers, distinct cell types, and/or distinct tissues. Hence, in certain embodiments, the imaging methods described herein comprise detecting at least two metal complexes, of which at least one metal complex binds preferentially or selectively to PSMA. In alternative embodiments, the imaging methods comprise detection of at least one metal complex which binds preferentially or selectively to PSMA and one further signal emitting molecule which does not bind preferentially or selectively to PSMA.
In preferred embodiments wherein the metal complex or pharmaceutical composition is used in the treatment, prevention, and/or diagnosis of cancer or tumor, the cancer or tumor is a PSMA-expressing cancer or tumor. In further preferred embodiments, the cancer specified herein is selected from the group of cancers selected from the group consisting of: renal cancer, bladder cancer, lung cancer, and cancers of the oral cavity, and prostate cancer. In further preferred embodiments, the cancer specified herein is selected from the group of cancers selected from the group consisting of: conventional renal cell cancer, transitional cell of the bladder cancer, non-small-cell lung cancer, testicular-embryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer. In highly preferred embodiments, the cancer is prostate cancer.
A skilled person is aware that certain individuals may experience yet improved benefits from medical treatment by the metal complex by further optimisation of the dose of said component by considering a wide range of parameters including but by no means limited to the disease stage of the subject, gender, age, body weight, other medical indications, nutrition, mode of administration, metabolic state, interference or influence by or efficacy of other pharmaceutically active ingredients, etc. Furthermore each individual may have a certain intrinsic degree of responsiveness to the metal complex that is used.
It is envisaged by the present disclosure that a metal complex as described herein or a pharmaceutical composition as described herein can be combined with one or more anti-cancer treatment methods or anti-cancer therapies, including but not limited to surgery, radiotherapy, chemotherapy, biological therapy, or any combinations thereof. Therefore, in certain embodiments the metal complex as described herein, optionally comprised in a pharmaceutical composition, is used and/or administered as the sole active pharmaceutical agent. In equally envisaged embodiments, the metal complex as described herein, optionally comprised in a pharmaceutical composition, is used and/or administered in conjunction with at least one additional active pharmaceutical agent on condition that the combined use of the metal complex and the additional active pharmaceutical agent does not invoke any adverse effects on the subject. The term "chemotherapy" should be interpreted broadly and hence encompasses any treatment relying on the use of a chemical substance or composition.
Therefore, in certain embodiments, a chemotherapeutic agent that is combined with the metal complex as described herein or the pharmaceutical composition as described herein is selected from the group consisting of: alkylating agents, cytotoxic compounds, anti-metabolites, plant alkaloids, terpenoids, topoisomerase inhibitors, or any combination thereof. The term "biological therapy" should be interpreted equally broadly and encompasses treatments relying on the use of biological substances or compositions comprising one or more biological substance, such as biomolecules, or biological agents. By means of illustration, such biological substances include viral cells, and illustrative biomolecules include peptides, polypeptides, proteins, nucleic acids, small molecules (e.g. metabolites or natural products), or any combination thereof. In certain embodiments wherein a metal complex or a pharmaceutical compositions comprising a metal complex as described herein is used in conjunction with a biomolecule, the biomolecule is selected from the group consisting of: interleukins, cytokines, anti-cytokines, tumor necrosis factor (TNF), cytokine receptors, vaccines, interferons, enzymes, therapeutic antibodies, antibody fragments, antibody-like protein scaffolds, or any combination thereof. In further embodiments, the biomolecule is selected from the group consisting of: aldesleukine, alemtuzumab, atezolizumab, bevacizumab, blinatumomab, brentuximab vedotine, catumaxomab, cetuximab, daratumumab, denileukin diftitox, denosumab, dinutuximab, elotuzumab, gemtuzumab ozogamicin, 90Y-ibritumomab tiuxetan, idarucizumab, interferon a, ipilimumab, necitumumab, nivolumab, obinutuzumab, ofatumumab, olaratumab, panitumumab, pembrolizumab, ramucirumab, rituximab, tasonermin, 131I-tositumomab, trastuzumab, Ado-trastuzumab emtan sine, and any combination thereof.
Further examples of anti-cancer therapy strategies include hormone therapy, immunotherapy, and stem cell therapy, which are commonly considered as falling within the umbrella term "biological therapies"
and are each suitable for use in combination with a metal complex as described herein or a pharmaceutical composition described herein. In certain embodiments a metal complex described herein or pharmaceutical composition as described herein may therefore be used in conjunction with a hormone therapy. Illustrative examples of such substances include without limitation tamoxifen, aromatase inhibitors, luteinizing hormone blockers, anti-androgens, gonadotrophin releasing hormone blockers, and any combination thereof. In alternative certain embodiments a metal complex as described herein or a pharmaceutical composition as described herein may therefore be used in conjunction with immunotherapy, said therapy broadly indicating any treatment that is capable of modulating the immune system of a subject. Particular, the term "immunotherapy" comprises any treatment that modulates an immune response, such as a humoral immune response, a cell-mediated immune response, or any combination thereof. "Immunotherapy" additionally comprises cell-based immunotherapies in which immune cells are transferred into the patient, for example T cells and/or dendritic cells. The term also comprises an administration of substances or compositions, such as chemical compounds and/or biomolecules (e.g., antibodies, antigens, interleukins, cytokines, or combinations thereof), that modulate a subject's immune system. Illustrative examples include the use of monoclonal antibodies (e.g. Fe-engineered monoclonal antibodies against proteins expressed by tumor cells), immune checkpoint inhibitors, prophylactic or therapeutic cancer vaccines, adoptive cell therapy, and combinations thereof. A further examples of a therapy which is suitable for combination with the metal complexes described herein or the pharmaceutical compositions described herein is adoptive cell therapy. Adoptive cell therapy generally refers to the transfer of cells such as immune-derived cells (e.g. cytotoxic T cells), back into the same patient or into a new recipient host with the goal of transferring the immunologic functionality and characteristics into the new host. Alternatively, chimeric antigen receptors may be used in order to generate immune responsive cells (such as T cells; CAR-T) specific for selected targets such as malignant cells. Methods to genetically modify T cells have been described in the art (e.g. in Li et al, Signal Transduct Target Ther, 2019).
Hence, in certain embodiments a metal complex as described herein or a pharmaceutical composition as described herein may therefore be used in conjunction with adoptive cell therapy or CAR-T cell therapy. A
final illustrative treatment strategy which may be employed in combination with one or more presently described metal complexes or presently described pharmaceutical compositions is stem cell therapy. In cancer stem cell therapy, bone marrow stem cells are destroyed by e.g. radiation therapy or chemotherapy, prior to transplantation of stem cells (autologous, syngeneic, or allogeneic) into the subject.
A skilled person is knowledgeable of administration routes, doses, and treatment regimens of anti-cancer agents known in the art since these have been described in detail at numerous instances (e.g. in Schellens et al., Oxford University Press "Cancer Clinical Pharmacology", 2005). It is further evident that any of the above combination therapies may be administered prior to, simultaneously with, or after administration of a metal complex described herein or pharmaceutical composition comprised herein.
A further aspect of the invention relates to a radiolabeling kit comprising a compound (labelling precursor) of formula (I), and a suitable buffering system. In preferred embodiments, the radiolabelling kit is designed for coordination of technetium-99m or rhenium-188. In preferred embodiments, the compound of formula (I) and/or the suitable buffering system comprised in the kit are contained in glass vials, optionally provided with a deformable stopper as closure means, preferably a rubber stopper as closure means. In further preferred embodiments, the compound of formula (1) and/or the suitable buffering system comprised in the kit are contained in siliconized vials such as borosilicate glass vials, more preferably type I neutral borosilicate glass vials. In further preferred embodiments, the kit comprises water for injection which may be included in the kit of parts as suitable buffering system or as a further component of the kit. A skilled person is aware of the regulatory standards set for water for injection and is therefore knowledgeable of the criteria that need to be adhered to according to USP 30 and/or EP addendum 2001. In certain embodiments, the water for injection is USP 30 water for injection. Alternatively, the water for injection is EP addendum 2001 water for injection. In certain embodiments, at least one of the components are freeze dried (i.e.
lyophilised). In alternative embodiments, the kit of parts may comprise a formate. phosphate, HEPES and/or acetate buffer as suitable buffering system. Hence in certain embodiments, the suitable buffering system is selected or comprises a buffering agent selected from the group consisting of: water for injection, monobasic sodium phosphate, dibasic sodium phosphate, sodium acetate, acetic acid, or any combination thereof.
It is evident that any of the components of the kit may further contain additional excipients to improve long term storage of said component(s), improve the range of storage conditions which are possible, stability of the component(s) before, during, or after admixing or constitution of the final pharmaceutical product, or any combination thereof.
In some embodiments, the kit comprises the following components:
- the labeling precursor (or compound) as defined herein in any one of the aspects or embodiments;
- a reducing agent, enabling the reduction of the pertechnetate/perrhenate to Tc(V)0/Re(V)0 such as ascorbic acid, sodium borohydridc, sodium dithionitc, phosphincs such as TCEP, and stannous chloride (Tin(II)chloride), preferably stannous chloride most preferably stannous chloride (tin(II)chloride), - an antioxidant, enabling the protection of the product against radiolytix oxidation such as ascorbic acid, sodium borohydride, sodium dithionite, and stannous chloride, - optionally auxiliary agents or ligands enabling the protection against reoxidation of Tc(V)0/Rc(V)0 as competing reaction to coordination, such as for tartrate/citrate/glucoheptonate, - optionally a stabilizer enabling the storage of the kit known in the art, - optionally further excipients such as lyophilization agents, matrix reagents or solubilizers known in the art.
Additional substances such as sequesters of metal impurities derived from the radionuclide generator, can be present as well. Non-limiting examples of such sequestering agents can be mono-, di-, or oligosaccharides as disclosed in e.g. W02016030103A1 and W02016030104A1 or polysaccharides and other polynucleate sequestering agents as disclosed in e.g.
W02013024013A2. Such sequestering agents will typically compete with the chelator part of the labelling precursor for the impurities derived from the radionuclide generator thereby avoiding the need for cumbersome purification after radiolabelling.
While the invention has been described in conjunction with specific embodiments thereof, it is evident that many alternatives, modifications, and variations will be apparent to those skilled in the art in light of the foregoing description. Accordingly, it is intended to embrace all such alternatives, modifications, and variations as follows in the spirit and broad scope of the appended claims. The herein disclosed aspects and embodiments of the invention are further supported by the following non-limiting examples.
EXAMPLES
Example 1: Synthesis of the Labeling Precursors The synthesis of the pharmacophore was accomplished by a well-known procedure such as reported in Eder et al., 2014 (Prostate 2014 May;74(6):659-68): The isocyanate of the glutamyl moiety was generated in situ by adding a mixture of 3 mmol of bis(tert-butyl) L-glutamate hydrochloride and 1.5 mL of N-ethyldiisopropylamine (DIPEA) in 200 mL of dry CH2C12 to a solution of 1 mmol triphosgene in 10 mL of dry CH2C12 at 0 C over 4 h. After agitation of the reaction mixture for 1 hat 25 C, 0.5 mmol of the resin-immobilized (2-chloro-tritylrcsin) a-allyloxycarbonyl protected lysine in 4 mL DCM
was added and reacted for 16 h with gentle agitation. Subsequently the resin was filtered off and dried.
The syntheses of the labeling precursors were conducted with aliquots of the resin carrying approx. 50 imol pharmacophore. For deprotection, the resin was swelled in CH2C12 (Dichloromethane, DCM) and reacted with a mixture of 10 mg (PPh3)413d and 60 mg dimethylaminoborane in 3 ml DCM for 15-30 minutes. Subsequently the resin was washed with DCM, 5% aminoethanol in DCM (5 min shaking), Methanol, Dimethylformamide (DMF) (3-5 times each).
The linkers were build-up by means of standard solid phase peptide synthesis (SPPS) using fluorenylmethoxycarbonyl (Fmoc) as protective group. Protective groups for the side-chains were tert-butyl for carboxylic acids and tert-butoxycarbonyl (Boc) for amino-groups.
Each coupling was conducted with 3 equivalents of the respective Fmoc protected aminoacid, 2.96 equivalents of HATU
and 8-12 equivalents of diisopropylamine (DIPEA) for 30 minutes at room temperature under agitation in DMF. Removal of the fmoc group was conducted by reaction with 20 %
piperidine in DMF for 5 minutes at roomt temperature (3 times each). Between the individual steps, the resin was washed with DMF (5 times each).
The chelator usually consisting of 2-3 aminoacids and a termial mercaptoacetyl group was build using the same procedure as described for the linker. The coupling of the mercaptoacetylgroup was conducted using acetyl protected 2-mercaptoacetic acid (same procedure as for the linker/chelator). For removal of the terminal acetyl-protective group, the solvent was changed to acetonitrile (MeCN) and the deprotection was conducted with 35 1,t1 hydrazinehydrate in 2 ml MeCN for 20-20 minutes at room temperature under agitation. Then the resin was washed with MeCN, DMF and DCM
(5 times each).
Finally, the compounds were cleaved from the resin using TFA containing 2.5 %
water and 2.5 %
triisopropylsilane (TIS) (2-3 ml) for 30-45 min at room temperature. The cleavage cocktail was filtered, diluted with 20 ml DCM and the solvents removed under reduced pressure. The crude product was purified by preparative HPLC. Identity of the compounds was confirmed by HPLC-MS.
Example 2: Syntheses of the "'Re-coordinated reference compounds Approx. 0.1-0.2 mot of the respective precursor (GCK-XX) were reacted with 2 eq. of Trichloro-oxo-bis-(triphenylphosphine)-rhenium(V) in 200 ul water/methanol (1:1) at 96 C
for 90 minutes. The pH
of the solution was adjusted to 8.0-8.5 using NaOH. The product was extracted by solid phase extraction (Waters SepPak plus light tC18 preconditioned with 5 ml EtOH and 10 mL water), washed with approx.
2 mL saline and eluted in 1 ml 70 % ethanol. The product was analyzed using HPLC/MS and used to demonstrate co-elution with the respective labeled compounds.
Example 3: Radiosyntheses of the 99mTc-coordinated compounds for in vitro application Phosphate buffer was prepared from 890 mg Na2P042 H20 in 9.5 mL water for injection and 0.5 mL 2 m NaOH. After dissolution of the salts, the buffer was sterile filtered, the pH was determined using pH
stripes (pH = 11.5-12.0). The labeling mixture consisted of 1 pl precursor solution (1 mg / ml in MeCH/H20 20:50; approx. 1 nmol), 20 ul phosphate buffer, 10 ul tris-carboxyphenylphosphin (TCEP;
28.7 mg / mL in phosphate buffer; 0.1 molar solution) and 4-10 ML
pertechnetate in saline (0.9 % NaCl;
generator eluate) containing an activity of approx. 7.5 MBq. The mixture was filled to 100 1 with saline (0.9 % NaCl; 59-65 ML). The pH of the reaction mixture was 8.0-8.5 (tendency towards 8.5). The mixture was heated at 98 "V for 10 minutes. After cooling to room temperature, the mixture was diluted to 1 mL by addition of saline (0.9 % NaCl, ligand concentration 1 p.m). An aliquot was analyzed by HPLC to determine the radiochemical yield (RCY) (method B, see example 9).
Aliquots of the product mixture containing the 99"1Tc-labeled ligand were further diluted to a concentration of approx. 100 nM
(precursor) in PBS with and without a 10000 fold excess of 2-(Phosphonomethyl)-pentandioic acid, 2-Phosphonomethyl pcntanedioic acid (2-PMPA) as competitor.
RCY and RCP were determined via analytical HPLC. Since the RCY was usually =95 % the product could be used without further purification (RCY = RCP in this case).
Example 4: Cellular Uptake experiments / Competitive Binding Cellular uptake experiments were conducted in analogy to previously described procedures (Lindner et al., Doi.: 10.2967/jnumed.118.210443). Briefly, LNCaP cells were seeded in 6-Well plates in RPMI
medium containing 20 % FBS (two day of incubation prior to the experiment) and grown to a confluency of 70-80 %. For the uptake experiment, the medium was removed and the cells were incubated with 1 mL of a 1:99 dilution of the 100 nM product mixture dilutions (with and without competitor) described in Example 3. After an incubation period of 1 h the medium containing the 99mTc-ligand was removed, the cells were washed two times with 1 mL PBS and lysed using lysis buffer (two times 700 LL each; 3.0 M NaOH containing 0.2 % SDS). The cellular uptake was determined from the activity in the lysed fraction. The unspecific uptake was determined from the cellular uptake of the cells incubated with the ligand in presence of the competitor. For the determination of the specific uptake, the unspecific uptake was subtracted the cellular uptake. Each experiment was conducted as triplicate.
The results are depicted in Table 2.
For determination of Ki, competitive binding experiments were conducted. Four six-well plates were seeded as described above. The cells were incubated with 1 mL of a 1:99 dilutions of the 100 nM
product mixture described in Example 3 in medium containing different concentrations of competitor (2-PMPA, 10E-4/-5/-6/-7/-8/-9 mol/L). After an incubation time of lh the medium was removed, the cells washed with two times with 1 mL PBS and lysed using lysis buffer (two times 700 ji1_, each; 3.0 M NaOH containing 0.2 % SDS). The cellular uptake was determined from the activity in the lysed fraction. From this data-set the 50% inhibitory concentration (IC50) was determined and the Ki calculated using the cheng-prusoff equation.
Substance Uptake Unspecific uptake Specific uptake Ki [%AD/106cells] [%AD/106cells] [%AD/106cells] [nm]
[99mTc]TLX-598 20.3+0.3 1.64+0.07 18.7+0.3 (38) (reference compound) [99mTc]Tc-GCK01 19.6+4.8 1.2+0.6 18.4+4.2 (26) [99mTc]Tc-GCK02 16.5+0.9 3.3+0.2 13.2+1.0 [991"Tc]Tc-GCK03 25.3+3.7 6.1+0.4 19.2+3.3 [99mTc]Tc-GCK05 22.8+1.1 1.2+0.1 21.5+1.2 [99mTc]Tc-GCK06 25.3+1.4 7.6+0.9 17.7+2.3 [99mTc]Tc-GCK07 8.2+1.6 1.3+0.1 6.9+1.6 [99mTc]Tc-GCK09 30.0+10.7 3.8+1.5 26.2+9.3 [99mTc]Tc-GCK011 57.8+12.4 11.9+3.9 45.9+8.5 Table 2. Cellular uptake of synthesized candidate molecules.
Example 5: 99mTc-labe1ing for in vivo application Phosphate buffer was prepared from 890 mg Na2P042 H20 in 9.5 mL water for injection and 0.5 mL 2 m NaOH. After dissolution of the salts, the buffer was sterile filtered, the pH was determined using pH
stripes (pH = 11.5-12.0). The labeling mixture consisted of 20 id precursor solution (1 mg / ml in MeCH/1-120 20:50), 200 !al phosphate buffer, 100 jil tris-carboxyphenylphosphin (TCEP; 28.7 mg / mL
in phosphate buffer; 0.1 molar solution) and 500-800 viL pertechnetate in saline (0.9 % NaCl; generator eluate). The pH of the reaction mixture was 8.0-8.5 (tendency towards 8.5).
The mixture was heated at 98 C for 10 minutes. After cooling to room temperature an aliquot was analyzed by HPLC to determine the radiochemical yield (method B, see example 9). The remaining solution was diluted with approx.
0.5-1.0 ml saline (0.9 % NaCl), passed through and SepPak plus light tC18 cartridge (Waters corp., Eschbom, Germany) preconditioned with 5 mL ethanol and 10 ml water for injection), washed with 2 mL saline (0.9 %NaC1) and eluted in 1 mL 70 % Ethanol (prepared from Ethanol Ph. Eur. (VWR) and water ad injectabilia (BBraun)). An aliquot of the eluate was analyzed by HPLC
to determine the amount of remaining TCEP (not detectable in all cases; spike was detectable).
The remaining solution was diluted with 9 mL PBS (prepared from 9 mL 0.9 % NaCl and 1 mL
sodiumphosphate concentrate;
BBraun ad injectabilia, both) and filtered via a 0.22 pm sterile filter in a 15 mL glass vial.
Example 6: 188Re-labeling for in vivo application was eluted from a 188W/188Re radionuclide generator (OnkoBeta, OnkoBeta GmbH, Garching, Munich) using 10 mL 0.9 & NaCl (BBraun). The generator eluate was postprocessed according to the procedures described by Guhlke et al. (S. Guhlke et al. XVM 2000, 41, 1271-1278). Briefly, potential tungsten breakthrough was retained on an SepPak Alumina(N) cartridge. The eluate was dechlorinated using a Dionex OnGuard II Ag cartridge and the perrhenate was concentrated using a SepPak QMA
cartridge, preconditioned with 5 mL 1 m K9CO3, followed by 10 mL deionized water. The perrhenate was eluted from the cartridge using 1 mL of 0.9 'A NaCl (BBraun). The recovery during this process was usually >80 %.
A typical ''Re-labeling mixture consisted of 30 iaL citrate solution (100 mg /
mL), 10 [IL GCK-XX
precursor solution (1 mg/mL in MeCN/H20 50:50 v/v), 10 il 30 % ascorbic acid solution (in water), 200 [IL perrhenate in 0.9 % NaCl (postprocessed as described above) and 12 [IL
SnCl? (50 mg/mL in 1 m HC1). The pH of the mixture was usually 2.0-3.5. The mixture was heated for 60 min at 96 C. After cooling to ambient temperature, the mixture was diluted with 1 mL 0.9 'A NaCl and passed through a SepPak plus light tC18 cartridge. The cartridge was washed with 2-3 mL 0.9 %
NaCl and the product elated with 1 mL 70 % Et0H. The solution containing the product was usually diluted et least 1:9 into PBS (prepared from 9 mL 0.9 %NaC1 and 1 mL sodiumphosphate concentrate; BBraun ad injectabilia, both) containing 1-3 vol% 30 % ascorbic acid solution.
The (radiochemical) yield was determined by division of the isolated product activity by the starting activity. Due to the long half-life, decay correction was omitted (Approx. 4 `)/0 decay per h). The radiochemical purity was determined by radio HPLC for the isolated product (after cartridge separation and formulation).
Example 7: In-vivo planar imaging For the in-vivo planar imaging, 100 41 of a formulation containing 5-10 MBq "InTc-labelled compound (approx. 0.1 lag precursor, 1 vtg precursor / mL; formulation in PBS as described in example 5) were injected into the tail vein of a LnCAP Tumor bearing mouse. The animals were anesthetized with Sevorane (Abbvie, Wiesbaden, Germany), placed on the Gamma IMAGER ¨ S/C
(Paris, France)in prone position to perform planar imaging (using Gamma Acquisition und GammaVision+ software).
An activity standard (approx. 1 MBq of the respective tracer) was prepared in a closed HPLC-sample flask and placed next to the animal during all timepoints of the measurement.
The results of the planar imaging at different time points with [99mTc]Tc-GCK01, 6, 9 and 11 are shown in Figure 1.
From this we can deduct that all compounds have good tumor radiolabeling capabilities and show rapid clearance.
Example 8: Ex-vivo organ distribution For ex-vivo biodistribution, LnCAP tumor bearing mice were injected with 100 ul of a formulation containing approx. 1 MBq of the respective '"Re-labelled compound GCK01 (approx. 0.1 us precursor, 1 vtg precursor / mL; formulation in PBS as described in example 6), each. The animals were sacrificed at 1 h p.i. and 3 h p.i., respectively. Organs of interest were dissected, blotted dry, weighted and the radioactivity was determined on a gamma counter (Packard Cobra 11, GM1, Minnesota, USA) and calculated as %1D/g. The results are provided in Table 3.
Organ %ID/g %ID/g 1 h p.i. 3 h p.i.
Urin 36+24 71+18 Blood 2.1+0.7 0.74+0.08 Heart 0.9+0.3 0.46+0.03 Lung 2.0+0.6 1.01+0.08 Spleen 11+3 3_9+1.7 Liver 0.68+0.05 0.28+0.01 Kidneys 70+23 91+7 Muscle 0.3+0.1 0.18+0.06 Intestines 0.36+0.06 0.24+0.04 brain 0.04+0.02 0.030+0.004 Stomach 1.0+0.5 0.8+0.5 Tumor 5 .1 1 . 4 10 . 7 1.9 Table 3. Ex-vivo biodistribution of approx. 1 MBq of the respective [1"Re+GCK01.
Example 9: GCK01 HO HO
j:)H
SH
NH
HN
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-tACHC-ser-ser-ser-MA (* = bound to the E-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; tACHC = trans-4-aminocyclohexane carboxylic acid; MA = 2-Mercaptoacetic acid) Chemical formula: C43H601\18016S (Mw: 977.04 g/mol) MS (HPLC-ESI-MS): m/z (11\4+1-1T)= 977.26 (found); 977.37 (calc.); tr = 11.66 min (gradient A: 0 % A (Omin) 100 % A (20 min) linear gradient, 0.2 ml/min; A + B = 100 %;
solvent A: MeCN + 0.1 %
trifluoroacetic acid, solvent B: water + 0.1 % trifluoroacetic acid; Column:
Hypersil Gold aQ 200X2.1 mm, 1.9 IAM particle size) Purity (HPLC): >90 %, t = 2.24 min (gradient B: 0 % A (Omin) 100 % A (5 min) linear gradient, 2 ml/min; A + B = 100 %; solvent A: MeCN + 0.1 % trifluoroacetic acid, solvent B: water + 0.1 %
trifluoroacetic acid: Column: Chromolith Performance Cl8e 100X3 mm) Cold reference standard ("Re coordinated) Chemical formula: C4.3H57N8017ReS (Mw: 1176.23 g/mol) MS (HPLC-ESI-MS): m/z = 1177.29 (found): 1177.32 (calc.); t, = 11.64 min (gradient: A ¨ see above) Purity (HPLC): >90 %, t = 2.30 min (gradient: B ¨ see above) [188Re]Re-GCK01 RCY/RCP: 75 % / >95 %
HPLC (gradient B): t. = 2.12/2.17 min [99111Tc]Tc-GCK01 RCY/RCP:>95 %
HPLC (gradient B): t, = 2.33 min Example 10: GCK02 HO
NH
HN
0 f GC KO2 OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-Inp-ser-ser-ser-MA (* = bound to the a-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; Inp = isonipecotic acid; MA
= 2-Mercaptoacetic acid) Chemical formula: Ci2H58N8016S (Mw: 963.02 g/mol) MS (HPLC-ESI-MS): m/z (1M-PHT)= 963.38 (found); 963.35 (calc.); ti = 11.58 min (gradient A, see example 9) Purity (HPLC): >95 %, t, = 2.455 min (gradient B, see example 9) [188Re]Re-GCK02 RCY/RCP: n.d. / >90 %
HPLC (gradient B, see Example 9): t, = 2.216 min [99111Tc]Tc-GCK02 RCY/RCP: >90 %
HPLC (gradient B, see Example 9): t = 2.212 min Example H: GCK03 NH
N H
0 01111.
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): G1i1-(urea)-Lys-2Na1*-(Inp)-Dap(MA)-MA (* = bound to the E-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; lnp = isonipecotic acid; MA
= 2-Mercaptoacetic acid) Chemical formula: C38H51N7012S2 (Mw: 861.91 g/mol); Disulfide C38H49N7012S2 (Mw: 859.96 g/mol) MS (HPLC-ESI-MS): m/z ([1\4+HI11) = 860.270 (found); 860.296 (calc., disulfide); t, = 12.5 min (gradient A, see example 9) Purity (HPLC): >90 %, t = 2.222 min (gradient B, see example 9) [188Reille-GCK03 RCY/RCP: n.d. / >90 %
I IPLC (gradient B, see Example 9): -I, = 2.523 min I99117c1Tc-GCK03 RCY/RCP: >95 %
HPLC (gradient B, see Example 9): t, = 2.52 min Example 12: GCK05 HO
NH
HN
0 ejj GO K05 H H
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-Inp-f3Ala-ser-ser-ser-MA (* = bound to the c-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; Inp = isonipecotic acid;
r3A1a = Beta-alanine;
MA = 2-Mercaptoacetic acid) Chemical formula: Ci5H63N9017S (Mw: 1034.10 g/mol) MS (HPLC-ESI-MS): m/z ([1\4-FHT) = 1034.39 (found); 1034.41 (calc.); tr = 11.7 min (gradient A, see example 9) Purity (HPLC): >95 %, t, = 2.147 min (gradient B, see example 9) [188RetRe-GCK05 RCY/RCP: 81 %I >90%
HPLC (gradient B, see Example 9): tr = 2.210 min [99111Tc]Tc-GCK05 RCY/RCP: >95 %
HPLC (gradient B, see Example 9): tr = 2.203 min Example 13: GCK06 H
NNy SH
0y HN
H
otµ10 Nr.0 GC KO6 Fi H
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-Inp-3Ala-asp-asp-asp-MA (* = bound to the c-amino group of the neighboring lysine; 2Na1 = L-2-Naphtylalanine; Inp = isonipecotic acid; 13A1a = Beta-alanine; MA = 2-Mercaptoacetic acid) Chemical formula: Ca.8H63N9O2oS (Mw: 1118.13 g/mol) MS (HPLC-ES1-MS): m/z (I_M+HT) = 1118.37 (found); 1118.40 (calc.); t, = 11.9 mm (gradient A, see example 9) Purity (HPLC): >95 %, t, = 2.173 min (gradient B, see example 9) [188Re]Re-GCK06 RCY/RCP: 66%! >90%
HPLC (gradient B, see Example 9): t, = 2.278 min [99111Te]Te-GCK06 RCY/RCP: >98 %
HPLC (gradient B, see Example 9): tr = 2.237 min Example 14: GCK07 j 0 NH
ss, All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-Inp-dap-dap-MA (* = bound to the c-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; lnp = isonipecotic acid; dap =
2,3-diaminopropionic acid; MA = 2-Mercaptoacetic acid) Chemical formula: C39H55N9012S (Mw: 873.97 g/mol) Purity (HPLC): >95 %, t = 2.010 min (gradient B, see example 9) rinTc]Tc-GCK07 RCYJRCP: >98 %
HPLC (gradient B, see Example 9): tr = 2.260 min Example 15: GCNO9 SH
o NH
HN
H
0 f GCKID9 H H
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-Inp-13Ala-dap-dap-MA (* = bound to the 6-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; Inp = isonipecotic acid;
13Ala = Beta-alanine;
dap = 2,3-diaminopropionic acid; MA = 2-Mercaptoacetic acid) Chemical formula: C45H66N12014S (Mw: 1031.14 g/mol) MS (HPLC-ESI-MS): m/z = 1031 471 (found); 1031_462 (cale.); tr = 10.99 min (gradient A, see example 9) Purity (HPLC): >90 %, t = 2.051 min (gradient B, see example 9) iRe-GCK09 RCY/RCP: 81 %/ >80 %
HPLC (gradient B, see Example 9): tr = 2.063 min [99111Tc]Tc-GCK09 RCY/RCP: >90 %
HPLC (gradient B, see Example 9): t = 2.085 min Example 16: GCK11 SH
NH OH
HN
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-tACHC-asp-asp-asp-MA (* = bound to the E-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; tACHC = trans-4-aminocyclohexane carboxylic acid; MA = 2-Mercaptoacetic acid) Chemical formula: C46H60N8019S (Mw: 1061.08 g/mol) MS (HPLC-ESI-MS): m/z = 1061.345 (found); 1061.377 (calc.); t, = 12.04 min (gradient A, see example 9) Purity (HPLC): >95 %, t = 2.219 min (gradient B, see example 9) [99111Tc]Tc-GCK11 RCY/RCP: >95 %
HPLC (gradient B, see Example 9): tr = 2.361 min Example 17: GCK13 NH
HN NH
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence). Glu-(urea)-Lys-2Nal*-tACHC-arg-arg-arg-MA (* ¨ bound to the E-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; tACHC = trans-4-aminocyclohexane carboxylic acid; MA = 2-Mercaptoacetic acid) Chemical formula: C52H81N17013S (Mw: 1184.37 g/mol) MS (HPLC-ESI-MS): m/z = 1184.574 (found); 1184.600 (calc.); t, = 10.98 min (gradient A, see example 9) Purity (HPLC): >90 %, t, = 2.294 min (gradient B, see example 9) [188Re]Re-GCK13 RCY/RCP: 79 % / >90%
HPLC (gradient B, see Example 9): tr = 2.234 min [99111Tc]Tc-GCK13 RCY/RCP: >90 %
HPLC (gradient B, see Example 9): t, = 2.382 min
While pharmaceutical compositions as intended herein may be formulated for essentially any route of administration, parenteral administration (such as, e.g., subcutaneous, intravenous (IV.), intramuscular, intraperitoneal or intrastemal injection or infusion) or topical administration may be preferred. The effects attainable can be, for example, systemic, local, tissue-specific, etc., depending of the specific needs of a given application. In certain embodiments, an I.V. bolus injection or infusion may advantageously allow the metal complex to enter circulation and be distributed throughout the body, allowing to label cells and tissues that are characterized by PSMA expression.
One skilled in this art will recognise that the above paragraphs on pharmaceutical compositions are merely illustrative and should by no means be interpreted as being an exhaustive list of embodiments..
Indeed, many additional formulations techniques and pharmaceutically-acceptable excipients and solvent solutions are well-known to those skilled in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of administration or treatment regimens.
A further aspect of the invention relates to a metal complex as described herein or a pharmaceutical composition as described herein for use as a medicament. The invention further provides in the use of a metal complex as described herein for the manufacture of a medicament for treatment of a disease in a subject.
Further envisaged are methods of treatment and methods of diagnosis which comprise administration of the metal complexes described herein or pharmaceutical compositions described herein to a subject.
Another aspect of the invention relates to a metal complex as described herein or a pharmaceutical composition as described herein for use in the treatment or prevention of cancer. Therefore, also envisaged by the present invention are methods of treating or preventing cancer comprising administration of at least one metal complex as described herein or pharmaceutical composition as described herein. Furthermore, the use of an effective amount of a metal complex as described herein for the manufacture of a medicament for treating or preventing cancer is also intended. In certain embodiments, preventing cancer indicates inhibition of clinical manifestation of cancer. In certain embodiments, the medical use or method of treatment comprises continuous administration of the metal complexes described herein or the pharmaceutical compositions described herein to a subject. In alternative embodiments, the medical use or method of treatment comprises intermittent administration of the metal complexes described herein or the pharmaceutical compositions described herein to a subject.
The terms "treatment- or "treat- are to be interpreted as both the therapeutic treatment of a disease or condition that has already developed, leading to clinical manifestations, such as but not limited to the therapy of an already developed malignancy such as prostate cancer, as well as prophylactic or preventive measures, wherein the goal of the treatment is to prevent, lessen, or reduce the chances of incidence of an undesired clinical affliction, such as to prevent further development and progression of a clinical condition or disease such as prostate cancer. Beneficial or desired clinical results may include, without limitation, alleviation of one or more symptoms, improvement of one or more biological markers, diminishment of extent of disease, stabilized (i.e. not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, slowing tumor growth, reducing the mass of the (main) tumor body, reducing the number and/or size of metastases, and the like. -Treatment" can also mean prolonging survival as compared to expected survival if not receiving treatment, or a reduced risk of mortality.
As used herein, the terms "therapeutic treatment" or "therapy" and the like, refer to treatments wherein the aim is to change a subjects body or a part of a subjects body from an undesired physiological state, disease or disorder which is caused by an infectious agent, to a desired state, such as a less severe state (e.g., amelioration or palliation), or even back to its normal, healthy state (e.g., restoring the health, the physical integrity and the physical well-being of a subject), to keep it (i.e., not worsening) at said undesired physiological status (e.g., stabilization), or slow down progression to a more severe or worse state compared to said undesired physiological change or disorder. Measurable lessening includes any statistically significant decline in a measurable marker or symptom.
Statistically significant as used herein refers top values below 0.05, which is a commonly accepted cutoff score in statistical analysis as a skilled person appreciates. "Treatment" encompasses both curative treatments and treatments directed to reduce symptoms and/or slow progression and/or stabilize the disease.
A skilled person is aware that in order to achieve an effective therapeutic treatment, a therapeutically effective dose needs to be administered to said subject. Therefore, in the context of the present disclosure when reference is made to a metal complex as described herein or a pharmaceutical composition as described herein it is evident that an "effective amount" is envisaged, wherein the "effective amount" refers to an amount necessary to obtain a physiological effect. The physiological effect may be achieved by a single dose or by multiple doses. A
"therapeutically effective amount" or "therapeutically effective dose" indicates an amount of metal complex described herein or pharmaceutical composition as described herein that when administered brings about a clinical positive response with respect to treatment of a subject afflicted by a malignancy such as but by no means limited to prostate cancer. A skilled person is aware that tenns such as "quantity", "amount" and "level" are synonyms and have a well-defined meaning in the art and appreciates that these may particularly refer to an absolute quantification of a metal complex as described herein which is considered an effective amount for the applications described herein, or to a relative quantification of the metal complex, such as for example a concentration of metal complex in function of the subject's bodyweight. Suitable values or ranges of values may be obtained from one single subject or from a group of subjects (i.e. at least two subjects). The term "to administer" generally means to dispense or to apply, and typically includes both in vivo administration and ex vivo administration to a tissue, preferably in vivo administration. Generally, compositions may be administered systemically or locally.
For therapeutic applications (e.g. with Rhenium), the preferred dose (activity) is about are 1-10 GBq.
Regarding diagnostic use, (e.g. with Technetium) about 200 to 1000 MBq is typically used for administration. More preferably about 500-800 MBq.
As used herein, the tenn "cancer" refers to a malignant neoplasm (i.e. a "malignancy") characterised by deregulated or unregulated cell growth. The term "cancer" includes primary malignant cells or tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor) and secondary malignant cells or tumors (e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor). The term "metastatic" or "metastasis" generally refers to the spread of a cancer from one organ or tissue to another non-adjacent organ or tissue. The occurrence of the neoplastic disease in the other non-adjacent organ or tissue is referred to as metastasis. The term "neoplastic disease" generally refers to any disease or disorder characterised by neoplastic cell growth and proliferation, whether benign (not invading surrounding normal tissues, not forming metastases), pre-malignant (pre-cancerous), or malignant (invading adjacent tissues and capable of producing metastases). The term neoplastic disease generally includes all transformed cells and tissues and all cancerous cells and tissues. Ncoplastic diseases or disorders include, but are not limited to abnormal cell growth, benign tumors, premalignant or precancerous lesions, malignant tumors, and cancer. As used herein, the terms "tumor" or "tumor tissue" refer to an abnormal mass of tissue that results from excessive cell division. A tumor or tumor tissue comprises tumor cells which are neoplastic cells with abnormal growth properties and no useful bodily function. Tumors, tumor tissue and tumor cells may be benign, pre-malignant or malignant, or may represent a lesion without any cancerous potential. A
tumor or tumor tissue may also comprise tumor-associated non-tumor cells, e.g., vascular cells which form blood vessels to supply the tumor or tumor tissue. Non-tumor cells may be induced to replicate and develop by tumor cells, for example, the induction of angiogenesis in a tumor or tumor tissue.
Cancers are typically classified into different stages of disease progression in the art. It is envisaged that each of the commonly annotated cancer stages may benefit from treatment with a metal complex as described herein or a pharmaceutical composition as described herein.
Furthermore, it is envisaged that the present metal complexes and phannaceutical compositions described herein are particularly useful for cancers categorized by the TNM staging system as N (node) and M
(metastasis) cancer stages (Tio, Gastrointest Endosc, 1996). In certain embodiments, the cancer stage, such as for example the cancer stage of prostate cancer is selected from one or more of the following cancer stages: stage 1, stage 11, stage IIA, stage JIB, stage ITC, stage III, stage IIIA, stage IIIB, stage BIC, stage IV, stage IVA, stage IVB. By means of illustration, for prostate cancer these stages correspond to the following clinical images depicted in Table 1:
Prostate Clinical manifestation cancer stage Slow growing. The tumor cannot bc physically felt and involves one-half of a side of the prostate or less than one-half of a side of the prostate. Prostate-specific Stage I
antigen (PSA) levels are low (i.e. PSA < lOng/m1). The cancer cells do not show significant morphological abnormalities.
Tumor localisation is restricted to the prostate. Low to medium (i.e. between Stage II
and 20 mg/ml) PSA levels.
The tumor cannot be physically felt and involves half of 1 side of the prostate or less than one-half of a side of the prostate. Medium PSA levels and well - Stage IIA
differentiated cancer cells. This stage further includes larger tumors whereof localisation is restricted to the prostate.
Tumor localisation restricted to the prostate and may be felt during digital rectal - Stage JIB
examination (DRE). Medium PSA levels. Moderately differentiated cancer cells.
Tumor localisation restricted to the prostate, and may be felt during DRE. The - Stage IIC
PSA level is medium. Moderately or poorly differentiated cancer cells.
High PSA levels. Growing tumor and/or high grade. Reasonable chance to grow Stage III
and at risk of spreading.
Loss of restricted prostate localisation of malignant cells (i.e. tumors) and - Stage IIIA dissemination to nearby tissues, optionally including the seminal vesicles. High PSA levels (i.e. > 20 ng/ml).
Further dissemination of malignant cells (i.e. tumors) to nearby structures, - Stage IIIB
optionally including bladder and/or rectum.
- Stage 111C Poorly differentiated cancer cells Stage IV Metastasis beyond the prostate.
- Stage IVA Metastasis to the regional lymph nodes.
- Stage IVB Metastasis to distant lymph nodes, other body parts and/or bones.
Table 1. prostate cancer stages and associated clinical manifestation.
Information taken from WWW.cancer.net.
In certain embodiments, the prostate cancer to be treated by a metal complex as described herein or a pharmaceutical composition as described herein is a prostate cancer having a Gleason score of from between 2 and 10, preferably a Gleason score of from between 4 and 10, more preferably a Gleason score of from between 6 and 10, most preferably a Gleason score of from between 7 and 10. The Gleason scoring system is known to a person skilled in the art (Munjal and Leslie, StatPearls, 2020).
Yet another aspect of the invention relates to a metal complex as described herein or a pharmaceutical composition as described herein for use in a method of in vivo diagnosis.
Further envisaged are metal complexes as described hcrcin or pharmaceutical compositions as described herein for use as a radiodiagnostic agent in a method of in vivo diagnosis. Therefore, also envisaged by the present invention are methods of diagnosis of PSMA-positive cancer types comprising administration of a detectable quantity of the metal complexes or pharmaceutical compositions as described herein to a subject and subsequent in vivo imaging of said metal complex. Also envisaged is the use of a metal complex as described herein for the manufacture of an in vivo diagnostic pharmaceutical composition.
A further aspect of the invention relates to a metal complex as described herein or a pharmaceutical composition as described herein for use in a method of in vivo monitoring of PSMA expression and/or PSMA-expressing cells, more preferably PSMA-expressing cancer cells, most preferably PSMA-expressing prostate cancer cells. Further envisaged are metal complexes as described herein or pharmaceutical compositions as described herein for use as a radioimaging agent in a method of in vivo monitoring of PSMA expression and/or PSMA-expressing cells, preferably PSMA
expressing cancer cells, most preferably PSMA-expressing prostate cancer cells. Therefore, also envisaged by the present invention are methods of in vivo monitoring PSMA expression and/or PSMA-expressing cells, preferably PSMA-positive cancer cells, most preferably PSMA positive prostate cancer cells comprising administration of a detectable quantity of a metal complex as described herein or a pharmaceutical compositions as described herein to a subject and subsequent in vivo imaging of said metal complex. In preferred embodiments, the use or method comprises conducting the step of administrating a detectable quantity of the metal complex or the pharmaceutical composition on at least two distinct time points. In further preferred embodiments, a first time point may be prior to the start of a given therapy that aims to reduce an aberrant amount and/or localisation of PSMA-expressing cells in a subject. Accordingly, a second, subsequent time point may be defined during or after the therapy.
By means of illustration and not limitation, the imaging time points may be scheduled before and after a change in the type and/or dosage regiment of a therapy. By further means of illustration and not limitation, the imaging time points may be scheduled before and after a change in one or more changes in biomolecular parameters of a subject and/or before and after a change in clinical parameters of a subject. For example, the imaging time points may be scheduled at substantially regular intervals during or after a therapy, for example to monitor cancer regression, remission or relapse, preferably wherein the cancer is a PSMA-expressing cancer type, more preferably wherein the cancer type is prostate cancer. In certain embodiments, the in vivo monitoring is conducted in a context of preventive screening to detect formation of aberrant PSMA-expressing cells in a subject (i.e. a preventive and/or routine cancer screening procedure). In alternative embodiments, the in vivo monitoring is conducted in a context of therapy monitoring to assess therapy efficacy, optionally therapy efficacy of a radionuclide.
In yet alternative embodiments, the in vivo monitoring is conducted in a context of periodical screening for recurrence (i.e. relapse) of a PSMA-expressing malignancy, such as but not limited to prostate cancer. Other appropriate embodiments of the imaging methods adapted for diagnosis and monitoring of any of the herein described indications will be apparent to the skilled person who is capable of defining further appropriate time points for imaging.
Further envisaged by the present invention is a metal complex as described herein or a pharmaceutical composition as described herein for use as a radiodiagnostic agent, preferably for use as a radiodiagnostic agent for in vivo imaging of cells expressing PSMA, preferably for use as a radiodiagnostic agent for in vivo imaging of cancer cells expressing PSMA, most preferably for use as a radiodiagnostic agent for in vivo imaging of prostate cancer cells expressing PSMA. Also envisaged is the use of a metal complex as described herein for the manufacture of a radiodiagnostic agent, optionally comprised in a radiodiagnostic composition.
"Diagnosed with", "diagnosing", and diagnosis are indicative for a process of recognising, deciding on, or concluding on a disease, condition, or (adverse side effect) in a subject on the basis of symptoms and signs and/or from results of various diagnostic procedures (such as, for example, from knowing the presence, absence and/or quantity of one or more biomarkers of or clinical symptoms characteristic for the diagnosed disease or condition). "Diagnosis of' the diseases, conditions, or (adverse) side effects as taught herein in a subject may particularly mean that the subject has such disease or condition. A subject may be diagnosed as not having such despite displaying one or more conventional symptoms or signs reminiscent of such. "Diagnosis of' the diseases or conditions as taught herein in a subject may particularly mean that the subject has respiratory infection disease.
"Prognosticating" in the context of the invention is indicative for anticipation on the progression of a malignancy such as prostate cancer in a subject and the prospect (e.g. the probability, duration, and/or extent) of recovery, and/or the severity of experiencing or amelioration of said infection. The term "a good prognosis of' generally encompasses anticipation of a satisfactory partial or complete recovery from a diagnosed disease or pain condition, optionally within an acceptable time period. Alternatively, the term may encompass anticipation of not further worsening or aggravating of such, preferably within a given time period. The term "a poor prognosis of' the disease or condition typically encompass an anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or no recovery at all, or further worsening of the malignancy and/or any clinical manifestation associated with said malignancy.
"Radiodiagnosis" and "Radiodiagnostic agent" as used in the context of the present disclosure are tenns that respectively indicate specific methods of diagnosis and diagnostic agents that allow a skilled (healthcare) practitioner to evaluate whether a subject is considered to have or has a specific medical condition by means of a clinical imaging method (i.e. by means of radiology) as defined further in the present disclosure. In certain embodiments, the diagnosis of aberrant PSMA expression, and therefore diagnosis of a PSMA-expressing cancer type is established by combining the images obtained after administration of the radiodiagnostic agent to a subject with any other means of diagnosis for a malignant neoplastic disease, such as prostate cancer. In further embodiments, the diagnosis of aberrant PSMA expression and therefore diagnosis of a PSMA-expressing cancer type such as prostate cancer is established by combining the images obtained after administration of the radiodiagnostic agent to a subject with a diagnosis method selected from the group of diagnosis methods consisting of: a digital rectal examination, a prostate-specific antigen (PSA) test, ultrasound imaging, magnetic resonance imaging, biopsy (e.g. transperineal biopsy or transrectal biopsy), or any combination thereof Related to the foregoing, "predicting" or "prediction" generally refer to a statement, declaration, indication or forecasting of a disease or condition in a subject not (yet) showing any, or a limited, clinical manifestation of said disease, condition, or (adverse) side effects.
A prediction of a certain clinical disease manifestation, condition, or adverse effect in a subject may indicate a probability, chance, or risk that said subject will develop said clinical manifestation, condition, or (adverse) side effect, for example within a certain time period after diagnosis of the malignancy such as but not limited to prostate cancer. Said probability, chance or risk may be indicated as any suitable qualitative or quantitative expression, wherein non-limiting examples of a quantitative expression include absolute values, ranges or statistics. Alternatively, probabilities, chances, or risks may be indicated relative to a suitable control subject or group of control subject (i.e. a control subject population (such as, e.g., relative to a general, normal or healthy subject or subject population)).
Therefore, any probability, chance or risk may be advantageously indicated as increased or decreased, upregulated or downregulated, as fold-increased or fold-decreased relative to a suitable control subject or subject population, or relative to a baseline value which may be derived from either a control subject (population), textbook reference values. It is evident that when a population of subjects is used to define the baseline value, said baseline value will be a centre size of one or more values (parameters) of a population, such as the mean or median of said value. A skilled person further appreciates that monitoring of a malignancy such as but not limited to prostate cancer may allow to predict the progression, aggravation, alleviation or recurrence of the clinical image or severity of said malignancy.
Furthermore, monitoring may be applied in the course of a medical treatment of a subject. Such monitoring may be comprised, e.g., in decision making whether a patient may be discharged from a controlled clinical or health practice environment, needs a change in treatment or therapy, or requires (extended) hospitalisation.
A further aspect of the invention is directed to a metal complex as described herein or a pharmaceutical composition as described herein for use as a theranostic agent. Also envisaged are methods of simultaneous diagnosis and treatment, comprising administering a metal complex as described herein or a pharmaceutical composition as described herein in a detectable and pharmaceutically active amount to a subject. Further intended is the use of a metal complex as described herein for the manufacture of a theranostic composition. The term "theranostic agent" is known to a skilled person (described in detail e.g. in Langbein et al., J Nucl Med, 2019) and refers in the context of the present invention to a suitability of a single metal complex as described herein which preferentially or selectively binds to PSMA that is suitable for use as both a diagnostic agent, a therapeutic agent, and optionally a means for monitoring disease progression and/or therapy efficacy. Several suitable atoms for use in theranostics have been described and include without limitation lutetium-177 (177Lu), actinium-255 (225Acs.), iodine-123 (123I), iodine-131 (131I), yttrium-86, yttrium-90, terbium-152 (152Tb), terbium-155 (155Tb), terbium 149 (149Tb), and terbium-161 ('61T
b). Criteria for suitability of an atom as part of a theranostic agent have been described in the art (Yordanova et al., Onco Targets Ther, 2017).
Yet a further aspect of the invention is directed to a metal complex as described herein for use in radioguided surgery. Therefore also envisaged are methods of radioguided surgery comprising administration of a detectable quantity of the metal complex and a subsequent step of invasive surgery to remove PSMA-expressing tumor tissue that is radiolabeled by said probe.
Hence, the use of a metal complex as described herein for the manufacture of a pharmaceutical labelling composition for use in radiosurgery is accordingly envisaged. "Radioguided surgery" is a medical procedure known to a skilled person and is has been described at numerous occasions (e.g. in Povoski et al., World J Surg Oncol, 2009). Briefly, radioguided surgery relies on radiolabeling a certain target tissue or target cell type, in the context of the present invention typically PSMA-expressing cells and/or PSMA-expressing tumor cells, whereafter said radiolabeled tissues or cells are surgically removed.
During the surgical procedure, a probe is utilised to "scan" the surgical wound area for radiolabeled tissues and cells, which indicates to the surgeon(s) which tissue was radiolabeled, and hence in the context of PSMA-expressing cancer tissue or cells need to be surgically removed.
The term "imaging" as used ubiquitously throughout the present disclosure is to be interpreted in its broadest context and hence encompasses any medical imaging technique or process for creating visual representations of the interior of a body and/or visual representation of the function of organs or tissues of a subject. Non-limiting examples of imaging methodologies and techniques as envisaged by the present disclose include X-ray radiography, X-ray computed tomography (CT), magnetic resonance imaging (MR1), positron emission tomography (PET), PET-CT, and single-photon emission computed tomography (SPECT). In preferred embodiments, the imaging modality may be PET, PET-CT, or SPECT since these imaging methods are particularly suited for visualising a detectable signal of the metal complexes described herein. In more preferred embodiments, the emitted signal by a detectable quantity of a metal complex described herein is detected by positron emission tomography (PET) and a PET image is generated. In alternative preferred embodiments, the emitted signal by a detectable quantity of a metal complex described herein is detected by single photon emission computed tomography (SPECT) and a SPECT image is generated. In certain embodiments, the imaging methods described herein may further comprise superimposing a PET or SPECT image with a computed tomography (CT) image or a magnetic resonance image (MRI).
In certain embodiments, the imaging methods described herein may be used to monitor, follow-up or track the progression of a malignancy such as but not limited to prostate cancer over time by generating images that lend themselves to a side-by-side comparison (e.g., images generated with the same quantity of the antibody per kg subject weight and the same route and manner of administration; using substantially the same settings on the imaging system; etc.) at two or more sequential time points, optionally where the patient has received or may be receiving a treatment aimed at slowing and/or inhibiting disease progression.
In certain embodiments, two or more distinct metal complexes may be detected in the imaging methods described herein. A simultaneous or consecutive detection of two or more metal complexes enables detection and optionally visualisation of multiple entities such as but not limited to distinct molecular markers, distinct cell types, and/or distinct tissues. Hence, in certain embodiments, the imaging methods described herein comprise detecting at least two metal complexes, of which at least one metal complex binds preferentially or selectively to PSMA. In alternative embodiments, the imaging methods comprise detection of at least one metal complex which binds preferentially or selectively to PSMA and one further signal emitting molecule which does not bind preferentially or selectively to PSMA.
In preferred embodiments wherein the metal complex or pharmaceutical composition is used in the treatment, prevention, and/or diagnosis of cancer or tumor, the cancer or tumor is a PSMA-expressing cancer or tumor. In further preferred embodiments, the cancer specified herein is selected from the group of cancers selected from the group consisting of: renal cancer, bladder cancer, lung cancer, and cancers of the oral cavity, and prostate cancer. In further preferred embodiments, the cancer specified herein is selected from the group of cancers selected from the group consisting of: conventional renal cell cancer, transitional cell of the bladder cancer, non-small-cell lung cancer, testicular-embryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer. In highly preferred embodiments, the cancer is prostate cancer.
A skilled person is aware that certain individuals may experience yet improved benefits from medical treatment by the metal complex by further optimisation of the dose of said component by considering a wide range of parameters including but by no means limited to the disease stage of the subject, gender, age, body weight, other medical indications, nutrition, mode of administration, metabolic state, interference or influence by or efficacy of other pharmaceutically active ingredients, etc. Furthermore each individual may have a certain intrinsic degree of responsiveness to the metal complex that is used.
It is envisaged by the present disclosure that a metal complex as described herein or a pharmaceutical composition as described herein can be combined with one or more anti-cancer treatment methods or anti-cancer therapies, including but not limited to surgery, radiotherapy, chemotherapy, biological therapy, or any combinations thereof. Therefore, in certain embodiments the metal complex as described herein, optionally comprised in a pharmaceutical composition, is used and/or administered as the sole active pharmaceutical agent. In equally envisaged embodiments, the metal complex as described herein, optionally comprised in a pharmaceutical composition, is used and/or administered in conjunction with at least one additional active pharmaceutical agent on condition that the combined use of the metal complex and the additional active pharmaceutical agent does not invoke any adverse effects on the subject. The term "chemotherapy" should be interpreted broadly and hence encompasses any treatment relying on the use of a chemical substance or composition.
Therefore, in certain embodiments, a chemotherapeutic agent that is combined with the metal complex as described herein or the pharmaceutical composition as described herein is selected from the group consisting of: alkylating agents, cytotoxic compounds, anti-metabolites, plant alkaloids, terpenoids, topoisomerase inhibitors, or any combination thereof. The term "biological therapy" should be interpreted equally broadly and encompasses treatments relying on the use of biological substances or compositions comprising one or more biological substance, such as biomolecules, or biological agents. By means of illustration, such biological substances include viral cells, and illustrative biomolecules include peptides, polypeptides, proteins, nucleic acids, small molecules (e.g. metabolites or natural products), or any combination thereof. In certain embodiments wherein a metal complex or a pharmaceutical compositions comprising a metal complex as described herein is used in conjunction with a biomolecule, the biomolecule is selected from the group consisting of: interleukins, cytokines, anti-cytokines, tumor necrosis factor (TNF), cytokine receptors, vaccines, interferons, enzymes, therapeutic antibodies, antibody fragments, antibody-like protein scaffolds, or any combination thereof. In further embodiments, the biomolecule is selected from the group consisting of: aldesleukine, alemtuzumab, atezolizumab, bevacizumab, blinatumomab, brentuximab vedotine, catumaxomab, cetuximab, daratumumab, denileukin diftitox, denosumab, dinutuximab, elotuzumab, gemtuzumab ozogamicin, 90Y-ibritumomab tiuxetan, idarucizumab, interferon a, ipilimumab, necitumumab, nivolumab, obinutuzumab, ofatumumab, olaratumab, panitumumab, pembrolizumab, ramucirumab, rituximab, tasonermin, 131I-tositumomab, trastuzumab, Ado-trastuzumab emtan sine, and any combination thereof.
Further examples of anti-cancer therapy strategies include hormone therapy, immunotherapy, and stem cell therapy, which are commonly considered as falling within the umbrella term "biological therapies"
and are each suitable for use in combination with a metal complex as described herein or a pharmaceutical composition described herein. In certain embodiments a metal complex described herein or pharmaceutical composition as described herein may therefore be used in conjunction with a hormone therapy. Illustrative examples of such substances include without limitation tamoxifen, aromatase inhibitors, luteinizing hormone blockers, anti-androgens, gonadotrophin releasing hormone blockers, and any combination thereof. In alternative certain embodiments a metal complex as described herein or a pharmaceutical composition as described herein may therefore be used in conjunction with immunotherapy, said therapy broadly indicating any treatment that is capable of modulating the immune system of a subject. Particular, the term "immunotherapy" comprises any treatment that modulates an immune response, such as a humoral immune response, a cell-mediated immune response, or any combination thereof. "Immunotherapy" additionally comprises cell-based immunotherapies in which immune cells are transferred into the patient, for example T cells and/or dendritic cells. The term also comprises an administration of substances or compositions, such as chemical compounds and/or biomolecules (e.g., antibodies, antigens, interleukins, cytokines, or combinations thereof), that modulate a subject's immune system. Illustrative examples include the use of monoclonal antibodies (e.g. Fe-engineered monoclonal antibodies against proteins expressed by tumor cells), immune checkpoint inhibitors, prophylactic or therapeutic cancer vaccines, adoptive cell therapy, and combinations thereof. A further examples of a therapy which is suitable for combination with the metal complexes described herein or the pharmaceutical compositions described herein is adoptive cell therapy. Adoptive cell therapy generally refers to the transfer of cells such as immune-derived cells (e.g. cytotoxic T cells), back into the same patient or into a new recipient host with the goal of transferring the immunologic functionality and characteristics into the new host. Alternatively, chimeric antigen receptors may be used in order to generate immune responsive cells (such as T cells; CAR-T) specific for selected targets such as malignant cells. Methods to genetically modify T cells have been described in the art (e.g. in Li et al, Signal Transduct Target Ther, 2019).
Hence, in certain embodiments a metal complex as described herein or a pharmaceutical composition as described herein may therefore be used in conjunction with adoptive cell therapy or CAR-T cell therapy. A
final illustrative treatment strategy which may be employed in combination with one or more presently described metal complexes or presently described pharmaceutical compositions is stem cell therapy. In cancer stem cell therapy, bone marrow stem cells are destroyed by e.g. radiation therapy or chemotherapy, prior to transplantation of stem cells (autologous, syngeneic, or allogeneic) into the subject.
A skilled person is knowledgeable of administration routes, doses, and treatment regimens of anti-cancer agents known in the art since these have been described in detail at numerous instances (e.g. in Schellens et al., Oxford University Press "Cancer Clinical Pharmacology", 2005). It is further evident that any of the above combination therapies may be administered prior to, simultaneously with, or after administration of a metal complex described herein or pharmaceutical composition comprised herein.
A further aspect of the invention relates to a radiolabeling kit comprising a compound (labelling precursor) of formula (I), and a suitable buffering system. In preferred embodiments, the radiolabelling kit is designed for coordination of technetium-99m or rhenium-188. In preferred embodiments, the compound of formula (I) and/or the suitable buffering system comprised in the kit are contained in glass vials, optionally provided with a deformable stopper as closure means, preferably a rubber stopper as closure means. In further preferred embodiments, the compound of formula (1) and/or the suitable buffering system comprised in the kit are contained in siliconized vials such as borosilicate glass vials, more preferably type I neutral borosilicate glass vials. In further preferred embodiments, the kit comprises water for injection which may be included in the kit of parts as suitable buffering system or as a further component of the kit. A skilled person is aware of the regulatory standards set for water for injection and is therefore knowledgeable of the criteria that need to be adhered to according to USP 30 and/or EP addendum 2001. In certain embodiments, the water for injection is USP 30 water for injection. Alternatively, the water for injection is EP addendum 2001 water for injection. In certain embodiments, at least one of the components are freeze dried (i.e.
lyophilised). In alternative embodiments, the kit of parts may comprise a formate. phosphate, HEPES and/or acetate buffer as suitable buffering system. Hence in certain embodiments, the suitable buffering system is selected or comprises a buffering agent selected from the group consisting of: water for injection, monobasic sodium phosphate, dibasic sodium phosphate, sodium acetate, acetic acid, or any combination thereof.
It is evident that any of the components of the kit may further contain additional excipients to improve long term storage of said component(s), improve the range of storage conditions which are possible, stability of the component(s) before, during, or after admixing or constitution of the final pharmaceutical product, or any combination thereof.
In some embodiments, the kit comprises the following components:
- the labeling precursor (or compound) as defined herein in any one of the aspects or embodiments;
- a reducing agent, enabling the reduction of the pertechnetate/perrhenate to Tc(V)0/Re(V)0 such as ascorbic acid, sodium borohydridc, sodium dithionitc, phosphincs such as TCEP, and stannous chloride (Tin(II)chloride), preferably stannous chloride most preferably stannous chloride (tin(II)chloride), - an antioxidant, enabling the protection of the product against radiolytix oxidation such as ascorbic acid, sodium borohydride, sodium dithionite, and stannous chloride, - optionally auxiliary agents or ligands enabling the protection against reoxidation of Tc(V)0/Rc(V)0 as competing reaction to coordination, such as for tartrate/citrate/glucoheptonate, - optionally a stabilizer enabling the storage of the kit known in the art, - optionally further excipients such as lyophilization agents, matrix reagents or solubilizers known in the art.
Additional substances such as sequesters of metal impurities derived from the radionuclide generator, can be present as well. Non-limiting examples of such sequestering agents can be mono-, di-, or oligosaccharides as disclosed in e.g. W02016030103A1 and W02016030104A1 or polysaccharides and other polynucleate sequestering agents as disclosed in e.g.
W02013024013A2. Such sequestering agents will typically compete with the chelator part of the labelling precursor for the impurities derived from the radionuclide generator thereby avoiding the need for cumbersome purification after radiolabelling.
While the invention has been described in conjunction with specific embodiments thereof, it is evident that many alternatives, modifications, and variations will be apparent to those skilled in the art in light of the foregoing description. Accordingly, it is intended to embrace all such alternatives, modifications, and variations as follows in the spirit and broad scope of the appended claims. The herein disclosed aspects and embodiments of the invention are further supported by the following non-limiting examples.
EXAMPLES
Example 1: Synthesis of the Labeling Precursors The synthesis of the pharmacophore was accomplished by a well-known procedure such as reported in Eder et al., 2014 (Prostate 2014 May;74(6):659-68): The isocyanate of the glutamyl moiety was generated in situ by adding a mixture of 3 mmol of bis(tert-butyl) L-glutamate hydrochloride and 1.5 mL of N-ethyldiisopropylamine (DIPEA) in 200 mL of dry CH2C12 to a solution of 1 mmol triphosgene in 10 mL of dry CH2C12 at 0 C over 4 h. After agitation of the reaction mixture for 1 hat 25 C, 0.5 mmol of the resin-immobilized (2-chloro-tritylrcsin) a-allyloxycarbonyl protected lysine in 4 mL DCM
was added and reacted for 16 h with gentle agitation. Subsequently the resin was filtered off and dried.
The syntheses of the labeling precursors were conducted with aliquots of the resin carrying approx. 50 imol pharmacophore. For deprotection, the resin was swelled in CH2C12 (Dichloromethane, DCM) and reacted with a mixture of 10 mg (PPh3)413d and 60 mg dimethylaminoborane in 3 ml DCM for 15-30 minutes. Subsequently the resin was washed with DCM, 5% aminoethanol in DCM (5 min shaking), Methanol, Dimethylformamide (DMF) (3-5 times each).
The linkers were build-up by means of standard solid phase peptide synthesis (SPPS) using fluorenylmethoxycarbonyl (Fmoc) as protective group. Protective groups for the side-chains were tert-butyl for carboxylic acids and tert-butoxycarbonyl (Boc) for amino-groups.
Each coupling was conducted with 3 equivalents of the respective Fmoc protected aminoacid, 2.96 equivalents of HATU
and 8-12 equivalents of diisopropylamine (DIPEA) for 30 minutes at room temperature under agitation in DMF. Removal of the fmoc group was conducted by reaction with 20 %
piperidine in DMF for 5 minutes at roomt temperature (3 times each). Between the individual steps, the resin was washed with DMF (5 times each).
The chelator usually consisting of 2-3 aminoacids and a termial mercaptoacetyl group was build using the same procedure as described for the linker. The coupling of the mercaptoacetylgroup was conducted using acetyl protected 2-mercaptoacetic acid (same procedure as for the linker/chelator). For removal of the terminal acetyl-protective group, the solvent was changed to acetonitrile (MeCN) and the deprotection was conducted with 35 1,t1 hydrazinehydrate in 2 ml MeCN for 20-20 minutes at room temperature under agitation. Then the resin was washed with MeCN, DMF and DCM
(5 times each).
Finally, the compounds were cleaved from the resin using TFA containing 2.5 %
water and 2.5 %
triisopropylsilane (TIS) (2-3 ml) for 30-45 min at room temperature. The cleavage cocktail was filtered, diluted with 20 ml DCM and the solvents removed under reduced pressure. The crude product was purified by preparative HPLC. Identity of the compounds was confirmed by HPLC-MS.
Example 2: Syntheses of the "'Re-coordinated reference compounds Approx. 0.1-0.2 mot of the respective precursor (GCK-XX) were reacted with 2 eq. of Trichloro-oxo-bis-(triphenylphosphine)-rhenium(V) in 200 ul water/methanol (1:1) at 96 C
for 90 minutes. The pH
of the solution was adjusted to 8.0-8.5 using NaOH. The product was extracted by solid phase extraction (Waters SepPak plus light tC18 preconditioned with 5 ml EtOH and 10 mL water), washed with approx.
2 mL saline and eluted in 1 ml 70 % ethanol. The product was analyzed using HPLC/MS and used to demonstrate co-elution with the respective labeled compounds.
Example 3: Radiosyntheses of the 99mTc-coordinated compounds for in vitro application Phosphate buffer was prepared from 890 mg Na2P042 H20 in 9.5 mL water for injection and 0.5 mL 2 m NaOH. After dissolution of the salts, the buffer was sterile filtered, the pH was determined using pH
stripes (pH = 11.5-12.0). The labeling mixture consisted of 1 pl precursor solution (1 mg / ml in MeCH/H20 20:50; approx. 1 nmol), 20 ul phosphate buffer, 10 ul tris-carboxyphenylphosphin (TCEP;
28.7 mg / mL in phosphate buffer; 0.1 molar solution) and 4-10 ML
pertechnetate in saline (0.9 % NaCl;
generator eluate) containing an activity of approx. 7.5 MBq. The mixture was filled to 100 1 with saline (0.9 % NaCl; 59-65 ML). The pH of the reaction mixture was 8.0-8.5 (tendency towards 8.5). The mixture was heated at 98 "V for 10 minutes. After cooling to room temperature, the mixture was diluted to 1 mL by addition of saline (0.9 % NaCl, ligand concentration 1 p.m). An aliquot was analyzed by HPLC to determine the radiochemical yield (RCY) (method B, see example 9).
Aliquots of the product mixture containing the 99"1Tc-labeled ligand were further diluted to a concentration of approx. 100 nM
(precursor) in PBS with and without a 10000 fold excess of 2-(Phosphonomethyl)-pentandioic acid, 2-Phosphonomethyl pcntanedioic acid (2-PMPA) as competitor.
RCY and RCP were determined via analytical HPLC. Since the RCY was usually =95 % the product could be used without further purification (RCY = RCP in this case).
Example 4: Cellular Uptake experiments / Competitive Binding Cellular uptake experiments were conducted in analogy to previously described procedures (Lindner et al., Doi.: 10.2967/jnumed.118.210443). Briefly, LNCaP cells were seeded in 6-Well plates in RPMI
medium containing 20 % FBS (two day of incubation prior to the experiment) and grown to a confluency of 70-80 %. For the uptake experiment, the medium was removed and the cells were incubated with 1 mL of a 1:99 dilution of the 100 nM product mixture dilutions (with and without competitor) described in Example 3. After an incubation period of 1 h the medium containing the 99mTc-ligand was removed, the cells were washed two times with 1 mL PBS and lysed using lysis buffer (two times 700 LL each; 3.0 M NaOH containing 0.2 % SDS). The cellular uptake was determined from the activity in the lysed fraction. The unspecific uptake was determined from the cellular uptake of the cells incubated with the ligand in presence of the competitor. For the determination of the specific uptake, the unspecific uptake was subtracted the cellular uptake. Each experiment was conducted as triplicate.
The results are depicted in Table 2.
For determination of Ki, competitive binding experiments were conducted. Four six-well plates were seeded as described above. The cells were incubated with 1 mL of a 1:99 dilutions of the 100 nM
product mixture described in Example 3 in medium containing different concentrations of competitor (2-PMPA, 10E-4/-5/-6/-7/-8/-9 mol/L). After an incubation time of lh the medium was removed, the cells washed with two times with 1 mL PBS and lysed using lysis buffer (two times 700 ji1_, each; 3.0 M NaOH containing 0.2 % SDS). The cellular uptake was determined from the activity in the lysed fraction. From this data-set the 50% inhibitory concentration (IC50) was determined and the Ki calculated using the cheng-prusoff equation.
Substance Uptake Unspecific uptake Specific uptake Ki [%AD/106cells] [%AD/106cells] [%AD/106cells] [nm]
[99mTc]TLX-598 20.3+0.3 1.64+0.07 18.7+0.3 (38) (reference compound) [99mTc]Tc-GCK01 19.6+4.8 1.2+0.6 18.4+4.2 (26) [99mTc]Tc-GCK02 16.5+0.9 3.3+0.2 13.2+1.0 [991"Tc]Tc-GCK03 25.3+3.7 6.1+0.4 19.2+3.3 [99mTc]Tc-GCK05 22.8+1.1 1.2+0.1 21.5+1.2 [99mTc]Tc-GCK06 25.3+1.4 7.6+0.9 17.7+2.3 [99mTc]Tc-GCK07 8.2+1.6 1.3+0.1 6.9+1.6 [99mTc]Tc-GCK09 30.0+10.7 3.8+1.5 26.2+9.3 [99mTc]Tc-GCK011 57.8+12.4 11.9+3.9 45.9+8.5 Table 2. Cellular uptake of synthesized candidate molecules.
Example 5: 99mTc-labe1ing for in vivo application Phosphate buffer was prepared from 890 mg Na2P042 H20 in 9.5 mL water for injection and 0.5 mL 2 m NaOH. After dissolution of the salts, the buffer was sterile filtered, the pH was determined using pH
stripes (pH = 11.5-12.0). The labeling mixture consisted of 20 id precursor solution (1 mg / ml in MeCH/1-120 20:50), 200 !al phosphate buffer, 100 jil tris-carboxyphenylphosphin (TCEP; 28.7 mg / mL
in phosphate buffer; 0.1 molar solution) and 500-800 viL pertechnetate in saline (0.9 % NaCl; generator eluate). The pH of the reaction mixture was 8.0-8.5 (tendency towards 8.5).
The mixture was heated at 98 C for 10 minutes. After cooling to room temperature an aliquot was analyzed by HPLC to determine the radiochemical yield (method B, see example 9). The remaining solution was diluted with approx.
0.5-1.0 ml saline (0.9 % NaCl), passed through and SepPak plus light tC18 cartridge (Waters corp., Eschbom, Germany) preconditioned with 5 mL ethanol and 10 ml water for injection), washed with 2 mL saline (0.9 %NaC1) and eluted in 1 mL 70 % Ethanol (prepared from Ethanol Ph. Eur. (VWR) and water ad injectabilia (BBraun)). An aliquot of the eluate was analyzed by HPLC
to determine the amount of remaining TCEP (not detectable in all cases; spike was detectable).
The remaining solution was diluted with 9 mL PBS (prepared from 9 mL 0.9 % NaCl and 1 mL
sodiumphosphate concentrate;
BBraun ad injectabilia, both) and filtered via a 0.22 pm sterile filter in a 15 mL glass vial.
Example 6: 188Re-labeling for in vivo application was eluted from a 188W/188Re radionuclide generator (OnkoBeta, OnkoBeta GmbH, Garching, Munich) using 10 mL 0.9 & NaCl (BBraun). The generator eluate was postprocessed according to the procedures described by Guhlke et al. (S. Guhlke et al. XVM 2000, 41, 1271-1278). Briefly, potential tungsten breakthrough was retained on an SepPak Alumina(N) cartridge. The eluate was dechlorinated using a Dionex OnGuard II Ag cartridge and the perrhenate was concentrated using a SepPak QMA
cartridge, preconditioned with 5 mL 1 m K9CO3, followed by 10 mL deionized water. The perrhenate was eluted from the cartridge using 1 mL of 0.9 'A NaCl (BBraun). The recovery during this process was usually >80 %.
A typical ''Re-labeling mixture consisted of 30 iaL citrate solution (100 mg /
mL), 10 [IL GCK-XX
precursor solution (1 mg/mL in MeCN/H20 50:50 v/v), 10 il 30 % ascorbic acid solution (in water), 200 [IL perrhenate in 0.9 % NaCl (postprocessed as described above) and 12 [IL
SnCl? (50 mg/mL in 1 m HC1). The pH of the mixture was usually 2.0-3.5. The mixture was heated for 60 min at 96 C. After cooling to ambient temperature, the mixture was diluted with 1 mL 0.9 'A NaCl and passed through a SepPak plus light tC18 cartridge. The cartridge was washed with 2-3 mL 0.9 %
NaCl and the product elated with 1 mL 70 % Et0H. The solution containing the product was usually diluted et least 1:9 into PBS (prepared from 9 mL 0.9 %NaC1 and 1 mL sodiumphosphate concentrate; BBraun ad injectabilia, both) containing 1-3 vol% 30 % ascorbic acid solution.
The (radiochemical) yield was determined by division of the isolated product activity by the starting activity. Due to the long half-life, decay correction was omitted (Approx. 4 `)/0 decay per h). The radiochemical purity was determined by radio HPLC for the isolated product (after cartridge separation and formulation).
Example 7: In-vivo planar imaging For the in-vivo planar imaging, 100 41 of a formulation containing 5-10 MBq "InTc-labelled compound (approx. 0.1 lag precursor, 1 vtg precursor / mL; formulation in PBS as described in example 5) were injected into the tail vein of a LnCAP Tumor bearing mouse. The animals were anesthetized with Sevorane (Abbvie, Wiesbaden, Germany), placed on the Gamma IMAGER ¨ S/C
(Paris, France)in prone position to perform planar imaging (using Gamma Acquisition und GammaVision+ software).
An activity standard (approx. 1 MBq of the respective tracer) was prepared in a closed HPLC-sample flask and placed next to the animal during all timepoints of the measurement.
The results of the planar imaging at different time points with [99mTc]Tc-GCK01, 6, 9 and 11 are shown in Figure 1.
From this we can deduct that all compounds have good tumor radiolabeling capabilities and show rapid clearance.
Example 8: Ex-vivo organ distribution For ex-vivo biodistribution, LnCAP tumor bearing mice were injected with 100 ul of a formulation containing approx. 1 MBq of the respective '"Re-labelled compound GCK01 (approx. 0.1 us precursor, 1 vtg precursor / mL; formulation in PBS as described in example 6), each. The animals were sacrificed at 1 h p.i. and 3 h p.i., respectively. Organs of interest were dissected, blotted dry, weighted and the radioactivity was determined on a gamma counter (Packard Cobra 11, GM1, Minnesota, USA) and calculated as %1D/g. The results are provided in Table 3.
Organ %ID/g %ID/g 1 h p.i. 3 h p.i.
Urin 36+24 71+18 Blood 2.1+0.7 0.74+0.08 Heart 0.9+0.3 0.46+0.03 Lung 2.0+0.6 1.01+0.08 Spleen 11+3 3_9+1.7 Liver 0.68+0.05 0.28+0.01 Kidneys 70+23 91+7 Muscle 0.3+0.1 0.18+0.06 Intestines 0.36+0.06 0.24+0.04 brain 0.04+0.02 0.030+0.004 Stomach 1.0+0.5 0.8+0.5 Tumor 5 .1 1 . 4 10 . 7 1.9 Table 3. Ex-vivo biodistribution of approx. 1 MBq of the respective [1"Re+GCK01.
Example 9: GCK01 HO HO
j:)H
SH
NH
HN
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-tACHC-ser-ser-ser-MA (* = bound to the E-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; tACHC = trans-4-aminocyclohexane carboxylic acid; MA = 2-Mercaptoacetic acid) Chemical formula: C43H601\18016S (Mw: 977.04 g/mol) MS (HPLC-ESI-MS): m/z (11\4+1-1T)= 977.26 (found); 977.37 (calc.); tr = 11.66 min (gradient A: 0 % A (Omin) 100 % A (20 min) linear gradient, 0.2 ml/min; A + B = 100 %;
solvent A: MeCN + 0.1 %
trifluoroacetic acid, solvent B: water + 0.1 % trifluoroacetic acid; Column:
Hypersil Gold aQ 200X2.1 mm, 1.9 IAM particle size) Purity (HPLC): >90 %, t = 2.24 min (gradient B: 0 % A (Omin) 100 % A (5 min) linear gradient, 2 ml/min; A + B = 100 %; solvent A: MeCN + 0.1 % trifluoroacetic acid, solvent B: water + 0.1 %
trifluoroacetic acid: Column: Chromolith Performance Cl8e 100X3 mm) Cold reference standard ("Re coordinated) Chemical formula: C4.3H57N8017ReS (Mw: 1176.23 g/mol) MS (HPLC-ESI-MS): m/z = 1177.29 (found): 1177.32 (calc.); t, = 11.64 min (gradient: A ¨ see above) Purity (HPLC): >90 %, t = 2.30 min (gradient: B ¨ see above) [188Re]Re-GCK01 RCY/RCP: 75 % / >95 %
HPLC (gradient B): t. = 2.12/2.17 min [99111Tc]Tc-GCK01 RCY/RCP:>95 %
HPLC (gradient B): t, = 2.33 min Example 10: GCK02 HO
NH
HN
0 f GC KO2 OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-Inp-ser-ser-ser-MA (* = bound to the a-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; Inp = isonipecotic acid; MA
= 2-Mercaptoacetic acid) Chemical formula: Ci2H58N8016S (Mw: 963.02 g/mol) MS (HPLC-ESI-MS): m/z (1M-PHT)= 963.38 (found); 963.35 (calc.); ti = 11.58 min (gradient A, see example 9) Purity (HPLC): >95 %, t, = 2.455 min (gradient B, see example 9) [188Re]Re-GCK02 RCY/RCP: n.d. / >90 %
HPLC (gradient B, see Example 9): t, = 2.216 min [99111Tc]Tc-GCK02 RCY/RCP: >90 %
HPLC (gradient B, see Example 9): t = 2.212 min Example H: GCK03 NH
N H
0 01111.
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): G1i1-(urea)-Lys-2Na1*-(Inp)-Dap(MA)-MA (* = bound to the E-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; lnp = isonipecotic acid; MA
= 2-Mercaptoacetic acid) Chemical formula: C38H51N7012S2 (Mw: 861.91 g/mol); Disulfide C38H49N7012S2 (Mw: 859.96 g/mol) MS (HPLC-ESI-MS): m/z ([1\4+HI11) = 860.270 (found); 860.296 (calc., disulfide); t, = 12.5 min (gradient A, see example 9) Purity (HPLC): >90 %, t = 2.222 min (gradient B, see example 9) [188Reille-GCK03 RCY/RCP: n.d. / >90 %
I IPLC (gradient B, see Example 9): -I, = 2.523 min I99117c1Tc-GCK03 RCY/RCP: >95 %
HPLC (gradient B, see Example 9): t, = 2.52 min Example 12: GCK05 HO
NH
HN
0 ejj GO K05 H H
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-Inp-f3Ala-ser-ser-ser-MA (* = bound to the c-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; Inp = isonipecotic acid;
r3A1a = Beta-alanine;
MA = 2-Mercaptoacetic acid) Chemical formula: Ci5H63N9017S (Mw: 1034.10 g/mol) MS (HPLC-ESI-MS): m/z ([1\4-FHT) = 1034.39 (found); 1034.41 (calc.); tr = 11.7 min (gradient A, see example 9) Purity (HPLC): >95 %, t, = 2.147 min (gradient B, see example 9) [188RetRe-GCK05 RCY/RCP: 81 %I >90%
HPLC (gradient B, see Example 9): tr = 2.210 min [99111Tc]Tc-GCK05 RCY/RCP: >95 %
HPLC (gradient B, see Example 9): tr = 2.203 min Example 13: GCK06 H
NNy SH
0y HN
H
otµ10 Nr.0 GC KO6 Fi H
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-Inp-3Ala-asp-asp-asp-MA (* = bound to the c-amino group of the neighboring lysine; 2Na1 = L-2-Naphtylalanine; Inp = isonipecotic acid; 13A1a = Beta-alanine; MA = 2-Mercaptoacetic acid) Chemical formula: Ca.8H63N9O2oS (Mw: 1118.13 g/mol) MS (HPLC-ES1-MS): m/z (I_M+HT) = 1118.37 (found); 1118.40 (calc.); t, = 11.9 mm (gradient A, see example 9) Purity (HPLC): >95 %, t, = 2.173 min (gradient B, see example 9) [188Re]Re-GCK06 RCY/RCP: 66%! >90%
HPLC (gradient B, see Example 9): t, = 2.278 min [99111Te]Te-GCK06 RCY/RCP: >98 %
HPLC (gradient B, see Example 9): tr = 2.237 min Example 14: GCK07 j 0 NH
ss, All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-Inp-dap-dap-MA (* = bound to the c-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; lnp = isonipecotic acid; dap =
2,3-diaminopropionic acid; MA = 2-Mercaptoacetic acid) Chemical formula: C39H55N9012S (Mw: 873.97 g/mol) Purity (HPLC): >95 %, t = 2.010 min (gradient B, see example 9) rinTc]Tc-GCK07 RCYJRCP: >98 %
HPLC (gradient B, see Example 9): tr = 2.260 min Example 15: GCNO9 SH
o NH
HN
H
0 f GCKID9 H H
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-Inp-13Ala-dap-dap-MA (* = bound to the 6-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; Inp = isonipecotic acid;
13Ala = Beta-alanine;
dap = 2,3-diaminopropionic acid; MA = 2-Mercaptoacetic acid) Chemical formula: C45H66N12014S (Mw: 1031.14 g/mol) MS (HPLC-ESI-MS): m/z = 1031 471 (found); 1031_462 (cale.); tr = 10.99 min (gradient A, see example 9) Purity (HPLC): >90 %, t = 2.051 min (gradient B, see example 9) iRe-GCK09 RCY/RCP: 81 %/ >80 %
HPLC (gradient B, see Example 9): tr = 2.063 min [99111Tc]Tc-GCK09 RCY/RCP: >90 %
HPLC (gradient B, see Example 9): t = 2.085 min Example 16: GCK11 SH
NH OH
HN
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence): Glu-(urea)-Lys-2Nal*-tACHC-asp-asp-asp-MA (* = bound to the E-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; tACHC = trans-4-aminocyclohexane carboxylic acid; MA = 2-Mercaptoacetic acid) Chemical formula: C46H60N8019S (Mw: 1061.08 g/mol) MS (HPLC-ESI-MS): m/z = 1061.345 (found); 1061.377 (calc.); t, = 12.04 min (gradient A, see example 9) Purity (HPLC): >95 %, t = 2.219 min (gradient B, see example 9) [99111Tc]Tc-GCK11 RCY/RCP: >95 %
HPLC (gradient B, see Example 9): tr = 2.361 min Example 17: GCK13 NH
HN NH
OH OH
All syntheses were conducted as described under the examples 1-5.
Precursor (sequence). Glu-(urea)-Lys-2Nal*-tACHC-arg-arg-arg-MA (* ¨ bound to the E-amino group of the neighboring lysine; 2Nal = L-2-Naphtylalanine; tACHC = trans-4-aminocyclohexane carboxylic acid; MA = 2-Mercaptoacetic acid) Chemical formula: C52H81N17013S (Mw: 1184.37 g/mol) MS (HPLC-ESI-MS): m/z = 1184.574 (found); 1184.600 (calc.); t, = 10.98 min (gradient A, see example 9) Purity (HPLC): >90 %, t, = 2.294 min (gradient B, see example 9) [188Re]Re-GCK13 RCY/RCP: 79 % / >90%
HPLC (gradient B, see Example 9): tr = 2.234 min [99111Tc]Tc-GCK13 RCY/RCP: >90 %
HPLC (gradient B, see Example 9): t, = 2.382 min
Claims (31)
1. A compound of formula (I) or a stereoisomer or tautomer, thereof, whcrcin, RI is selected from the group consisting of hydrogen, -C(0)1211, -C(0)21212, -C(0)NRuRn, Ci_nalkyl, ary1Ci_6a1kyl, heteroary1Ci_6a1kyl, heterocyclylCi_balkyl, aryl, hctcroaryl, hetcrocycly1;
wherein said Ci_6alkyl, aiylC,6alkyl, heteroarylCi_6alkyl, heterocycly1C1_6alkyk aryl, heteroaryl, or heterocycly1 can be unsubstituted or substituted with one or more Z';
LI is ; wherein * represents where LI is bound to the carbonyl group; and ** represents where LI is bound to Al;
A' is , wherein * represents where A' is bound LI; and ** represents where Al is bound to A2; and wherein, n is an integer selected from 1, 2, 3, 4 or 5;
R2 is selected from the group consisting of hydroxyCi_6alkyl, Ch6a1ky1NHR3, C3_6a1ky1C(0)0H, CI_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6alkyl, C2,6a1keny1, aminoCi_6alkyl, mercaptoCi_6alkyl, CI_ 6a1ky1thioCi_6a1ky1ene, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, Ci_6a1ky1(CO2H)2, -SO3H, CI_ 6alkylhete roaryl, Ci_6alkyl SeH, C 3_6alkylS (0)CH3, C
S (CH3)2 Ci_6a1ky1NHC(0)heterocycle and C 1_6alkylC (0)NH2;
R3 is H or -C(0)(CH2)SH;
A2 is selected from:
; wherein * represents where A2 is bound Al; and ** represents where A2 is bound to A3 ; or wherein A3 is absent; and wherein, m is an integer selected from 1, 2, 3, 4 or 5;
R4 is selected from the group consisting of hydroxyCi_6a1kyk Ci_6a1ky1NHR3, Ci_6a1ky1C(0)0H, CI_ 6a1ky1NHC(NH)N1-12, hydrogen, Ci_6a1ky1, C2_6a1keny1, aminoC1_6a1ky1, mercaptoCi_6a1ky1, Cl_ 6a1ky1thioC1_6a1ky1ene, ary1C1_6alkyl, -CH(OH)CH3, -C(0)0H, C1_6a1ky1(CO2H)2, -SO3H, C1_ 6alkylheteroaryl, C1_6a1ky1SeH, C1_6a1ky1S(0)CH3, C1_6alkylS(CH3)2', Ci_6a1ky1NHC(0)heterocycle and C1_6a1ky1C(0)NHz;
le is H or -C(0)(CH2)SH;
A3 is selected from:
; wherein * represents where A3 is bound A2; and ** represents where A3 is bound to A4; or wherein A3 is absent; and wherein, o is an integer selected from 1, 2, 3, 4 or 5;
R6 is selected from the group consisting of hydroxyCl_nalkyl, C1_6a1ky1NHR7, C1_6a1ky1C(0)0H, C 1_ 6a1ky1NHC(NH)N1-13, hydrogen, Ci_6a1ky1, C2_6a1keny1, aminoC1_6a1ky1, mereaptoCi_6a1ky1, CI_ 6a1ky1thioCi_6a1ky1enc, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, C1_6a1ky1(CO2H)3, -SO3H, Cl_ 6alkylhetcroaryl, Ci_6alkylSeH, CI -halkylS(0)CH C 1_6a1ky1S(CH 3)2% C
_6alkylNHC(0)hctcrocycle and Ci_6a1ky1C(0)1\11-12;
R7 is H or -C(0)(CH2)SH;
A4 is selected from:
; wherein * represents where A4 is bound A3; and ** represents where A4 is bound to the carbonyl group; or wherein A4 is absent; and wherein, t is an integer selected from 1, 2, 3, 4 or 5;
R8 is selected from the group consisting of hydroxyCi_6alkyl, Ci_6a1kyINHR9, Ci_6a1ky1C(0)0H, CI_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6a1ky1, C2_6a1keny1, aminoCi_6a1ky1, mercaptoCi_6a1ky1, CI_ 6alkylthioCi_6alkylene, aryl Ch6a1ky1, -CH(OH)CH3, -C(0)0H, Ch6a1ky1(CO2H)2, -SO3H, Ci_ 6alkylhete roaryl, Ci_6a1ky1 SeH, Ci_6a1ky1S(0)CH3, C 1_6a1ky1 S (CH3)24, Ci_6a1ky1NHC(0)heterocycle and C 1_6alkylC (0)NH2;
R9 is H or -C(0)(CH2)SH;
R49 is selected from the group consisting of Ci_6a1ky1, heterocycle, aryl, and heteroaryl;
or R1-0 is a group of formula (i);
wherein the wavy line ( ) indicates the point of attachment to the S
atom and LI, Al, A2, A3, and A4 are as defined for structure (I);
each R11 is independently selected from the group consisting of Ci_6alkyl, haloCi_6alkyl, aryl. haloCi-6alkyl, arylC l_6alkyl, hctcrocyclyl, hctcroaryl;
each R" is independently selected from the group consisting of hydrogen, Ci_6alkyl, aryl, haloCi_ 6alkyl, CH2CC13, CH2OCH3, arylCi_6alkyl, heterocyclyl, heteroaryl;
each R" is independently selected from the group consisting of hydrogen, C1_6alkyl, aryl, haloCI_ 6alkyl, arylC1_6alkyl, heterocyclyl, heteroaryl;
each Z' is independently selected from the group consisting of -OR", -C(0)R11, nitro, hydroxyl, CI_ 6alkyl, aryl, heteroaryl, -SR", -NR42C(0)R43, -C(0)2R', cyano, -S(0)2124 , halo, haloC1_6alkyl, haloC1_6alkyloxy, heterocyclyl, amino, -NR"R", -C(0)NR42R1-3, -S(0)Rm, -S(0)2N
R1-2R42; wherein said Cl_6alkyl, or aryl, can be unsubstituted or substituted with one or more C 1 4alkyl, methoxy, nitro, -C(0)aryl , hal o, tri flu ororn eth yl , tri flu ororn oxy;
or a solvate, hydrate, salt or prodrug thereof.
wherein said Ci_6alkyl, aiylC,6alkyl, heteroarylCi_6alkyl, heterocycly1C1_6alkyk aryl, heteroaryl, or heterocycly1 can be unsubstituted or substituted with one or more Z';
LI is ; wherein * represents where LI is bound to the carbonyl group; and ** represents where LI is bound to Al;
A' is , wherein * represents where A' is bound LI; and ** represents where Al is bound to A2; and wherein, n is an integer selected from 1, 2, 3, 4 or 5;
R2 is selected from the group consisting of hydroxyCi_6alkyl, Ch6a1ky1NHR3, C3_6a1ky1C(0)0H, CI_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6alkyl, C2,6a1keny1, aminoCi_6alkyl, mercaptoCi_6alkyl, CI_ 6a1ky1thioCi_6a1ky1ene, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, Ci_6a1ky1(CO2H)2, -SO3H, CI_ 6alkylhete roaryl, Ci_6alkyl SeH, C 3_6alkylS (0)CH3, C
S (CH3)2 Ci_6a1ky1NHC(0)heterocycle and C 1_6alkylC (0)NH2;
R3 is H or -C(0)(CH2)SH;
A2 is selected from:
; wherein * represents where A2 is bound Al; and ** represents where A2 is bound to A3 ; or wherein A3 is absent; and wherein, m is an integer selected from 1, 2, 3, 4 or 5;
R4 is selected from the group consisting of hydroxyCi_6a1kyk Ci_6a1ky1NHR3, Ci_6a1ky1C(0)0H, CI_ 6a1ky1NHC(NH)N1-12, hydrogen, Ci_6a1ky1, C2_6a1keny1, aminoC1_6a1ky1, mercaptoCi_6a1ky1, Cl_ 6a1ky1thioC1_6a1ky1ene, ary1C1_6alkyl, -CH(OH)CH3, -C(0)0H, C1_6a1ky1(CO2H)2, -SO3H, C1_ 6alkylheteroaryl, C1_6a1ky1SeH, C1_6a1ky1S(0)CH3, C1_6alkylS(CH3)2', Ci_6a1ky1NHC(0)heterocycle and C1_6a1ky1C(0)NHz;
le is H or -C(0)(CH2)SH;
A3 is selected from:
; wherein * represents where A3 is bound A2; and ** represents where A3 is bound to A4; or wherein A3 is absent; and wherein, o is an integer selected from 1, 2, 3, 4 or 5;
R6 is selected from the group consisting of hydroxyCl_nalkyl, C1_6a1ky1NHR7, C1_6a1ky1C(0)0H, C 1_ 6a1ky1NHC(NH)N1-13, hydrogen, Ci_6a1ky1, C2_6a1keny1, aminoC1_6a1ky1, mereaptoCi_6a1ky1, CI_ 6a1ky1thioCi_6a1ky1enc, arylCi_6alkyl, -CH(OH)CH3, -C(0)0H, C1_6a1ky1(CO2H)3, -SO3H, Cl_ 6alkylhetcroaryl, Ci_6alkylSeH, CI -halkylS(0)CH C 1_6a1ky1S(CH 3)2% C
_6alkylNHC(0)hctcrocycle and Ci_6a1ky1C(0)1\11-12;
R7 is H or -C(0)(CH2)SH;
A4 is selected from:
; wherein * represents where A4 is bound A3; and ** represents where A4 is bound to the carbonyl group; or wherein A4 is absent; and wherein, t is an integer selected from 1, 2, 3, 4 or 5;
R8 is selected from the group consisting of hydroxyCi_6alkyl, Ci_6a1kyINHR9, Ci_6a1ky1C(0)0H, CI_ 6a1ky1NHC(NH)NH2, hydrogen, Ci_6a1ky1, C2_6a1keny1, aminoCi_6a1ky1, mercaptoCi_6a1ky1, CI_ 6alkylthioCi_6alkylene, aryl Ch6a1ky1, -CH(OH)CH3, -C(0)0H, Ch6a1ky1(CO2H)2, -SO3H, Ci_ 6alkylhete roaryl, Ci_6a1ky1 SeH, Ci_6a1ky1S(0)CH3, C 1_6a1ky1 S (CH3)24, Ci_6a1ky1NHC(0)heterocycle and C 1_6alkylC (0)NH2;
R9 is H or -C(0)(CH2)SH;
R49 is selected from the group consisting of Ci_6a1ky1, heterocycle, aryl, and heteroaryl;
or R1-0 is a group of formula (i);
wherein the wavy line ( ) indicates the point of attachment to the S
atom and LI, Al, A2, A3, and A4 are as defined for structure (I);
each R11 is independently selected from the group consisting of Ci_6alkyl, haloCi_6alkyl, aryl. haloCi-6alkyl, arylC l_6alkyl, hctcrocyclyl, hctcroaryl;
each R" is independently selected from the group consisting of hydrogen, Ci_6alkyl, aryl, haloCi_ 6alkyl, CH2CC13, CH2OCH3, arylCi_6alkyl, heterocyclyl, heteroaryl;
each R" is independently selected from the group consisting of hydrogen, C1_6alkyl, aryl, haloCI_ 6alkyl, arylC1_6alkyl, heterocyclyl, heteroaryl;
each Z' is independently selected from the group consisting of -OR", -C(0)R11, nitro, hydroxyl, CI_ 6alkyl, aryl, heteroaryl, -SR", -NR42C(0)R43, -C(0)2R', cyano, -S(0)2124 , halo, haloC1_6alkyl, haloC1_6alkyloxy, heterocyclyl, amino, -NR"R", -C(0)NR42R1-3, -S(0)Rm, -S(0)2N
R1-2R42; wherein said Cl_6alkyl, or aryl, can be unsubstituted or substituted with one or more C 1 4alkyl, methoxy, nitro, -C(0)aryl , hal o, tri flu ororn eth yl , tri flu ororn oxy;
or a solvate, hydrate, salt or prodrug thereof.
2. The compound according to claim 1, having structural formula (IA), wherein A', Al-, re, 124, and R6 have the same meaning as that defined in claim 1.
3. The compound according to claim 1 or 2, having structural fonnula (IB), wherein A', RI, R4, R6, and R8 have the same meaning as that defined in claim 1.
4. The compound according to any one of claims 1 to 3, wherein, R2 is selected from the group consisting of -CH2OH, -CH2NHie, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_ 6alkyl, -CH(OH)CH3, -C(0)0H, -SO3H, Ci_6alkylheteroaryl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R4 is selected from the group consisting of -CH2OH, -CH2NHie, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_ 6alkyl, -CH(OH)CH3, -C(0)0H, -SO3H, Ci_6alkylheteroatyl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R6 is selected from the group consisting of -CH2OH, -CH2NHR2, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_ 6alkyl, -CH(OH)CH3, -C(0)0H, -SO3H, Ci_6alkylheteroaiyl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
re is selected from the group consisting of -CH2OH, -CH2NHR5, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, ary1Ci-6alkyl, -CH(OH)CH3, -C(0)0H, -SO3H, Ci_6alkylheteroar0, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
preferably vvherein, 121 is hydrogen, acetyl or -SR', wherein le" is a group of formula (i).
R4 is selected from the group consisting of -CH2OH, -CH2NHie, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_ 6alkyl, -CH(OH)CH3, -C(0)0H, -SO3H, Ci_6alkylheteroatyl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
R6 is selected from the group consisting of -CH2OH, -CH2NHR2, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, arylCi_ 6alkyl, -CH(OH)CH3, -C(0)0H, -SO3H, Ci_6alkylheteroaiyl, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
re is selected from the group consisting of -CH2OH, -CH2NHR5, -CH2C(0)0H, -(CH2)3NHC(NH)NH2, hydrogen, Ci_6a1ky1, -(CH2)20H, -(CH2)4NH2, -CH2SH, -(CH2)2SCH3, ary1Ci-6alkyl, -CH(OH)CH3, -C(0)0H, -SO3H, Ci_6alkylheteroar0, -CH2C(0)NH2, and -(CH2)2C(0)NH2;
preferably vvherein, 121 is hydrogen, acetyl or -SR', wherein le" is a group of formula (i).
5. Thc compound according to any one of claims 1 to 4, selected from the group consisting of:
CA
CA
6 A solvate, hydrate, salt or prodnig of the compound of any one of claims 1 to 5
7. A metal complex comprising a compound of foimula (I) according to any one of claims 1 to 6, and an element of Group VII of the Periodic Table.
8. A metal complex according to claim 7 wherein the element is a radionuclide.
9. A metal complex according to claim 7 wherein the element is 99mTc or 188Re or 186Re.
10. A pharmaceutical composition comprising one or more pharmaceutically acceptable excipients and a metal complex according to claims 7 to 9.
11. A metal complex according to claims 7 to 10, or a pharmaceutical composition according to claim 9, for use as a medicament.
12. A metal complex according to claims 7 to 10 or a pharmaceutical composition according to claim 8, for use in the treatment or prevention of cancer.
13. A metal complex according to claims 7 to 10, or a pharmaceutical composition according to claim 8, for use as a radiodiagnostic agent for use in in-vivo imaging of tumor cells.
14. The metal complex or pharmaceutical composition for use according to claim 12 or 13, wherein said cancer is a PSMA-cxpressing cancer or tumor.
15. The metal complex or pharmaceutical composition for use according to claim 14, wherein said cancer is selected from the group consisting of: convcntional rcnal ccll canccr, transitional cell of the bladdcr cancer, non-small-ccll lung cancer, tcsticular-cmbryonal cancer, ncurocndocrinc cancer, colon cancer, prostate cancer, and breast cancer, preferably prostate cancer.
16. A method of treating or preventing cancer in a subject comprising administering a therapeutically effective amount of the metal complex according to any one of claims 7 to 9, or a pharmaceutical composition according to claim 10 to said patient.
17. The method according to claim 16, wherein the radionuclide used for therapeutic use is 188Re or 186Re.
18. A method of in-vivo imaging or detection of tumor or cancer cells or of in-vivo diagnosis of cancer in a subject, comprising administering a suitable amount of the metal complex according to any one of claims 7 to 9, or a pharmaceutical composition according to claim 10 to said patient and visualizing said metal complex using an in-vivo radio-imaging method.
19. The method according to claim 18, wherein the imaging method is positron emission tomography (PET), PET computed tomography (PET-CT) or single-photon emission tomography (SPECT).
20. The method according to claim 18 or 19, wherein the radionuclide used for imaging is 99mTc.
21. The method according to any one of claims 16 to 20, wherein said cancer is a PSMA-expressing cancer or tumor, more preferably wherein said cancer is selected from the group consisting of:
conventional renal cell cancer, transitional cell of thc bladder cancer, non-small-cell lung cancer, testicular-embryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer, preferably prostate cancer.
conventional renal cell cancer, transitional cell of thc bladder cancer, non-small-cell lung cancer, testicular-embryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer, preferably prostate cancer.
22. A radiolabeling kit comprising:
- the compound according to any one of claims 1-6, - a suitable buffering system, preferably selected from the group consisting of: phosphate buffers, acetate buffers, formate buffers, and HEPES buffers, more preferably phosphate buffers, even more preferably a sodium-phosphate buffer; and - a suitable reducing agcnt, enabling the reduction of the pertechnetate/perrhenate to Tc(V)0/Rc(V)0, such as but not limited to: ascorbic acid, sodium borohydride, sodium dithionite, phosphines such as TCEP, and stannous chloride (Tin(II)chloride), preferably stannous chloride most preferably stannous chloride (tin(11)chloride).
- the compound according to any one of claims 1-6, - a suitable buffering system, preferably selected from the group consisting of: phosphate buffers, acetate buffers, formate buffers, and HEPES buffers, more preferably phosphate buffers, even more preferably a sodium-phosphate buffer; and - a suitable reducing agcnt, enabling the reduction of the pertechnetate/perrhenate to Tc(V)0/Rc(V)0, such as but not limited to: ascorbic acid, sodium borohydride, sodium dithionite, phosphines such as TCEP, and stannous chloride (Tin(II)chloride), preferably stannous chloride most preferably stannous chloride (tin(11)chloride).
23. The radiolabelling kit according to claim 22, further comprising any one or more of:
- a suitable anti-oxidant agent such as but not limited to: sodium ascorbate/ascorbic acid mixtures, sodium borohydride, sodium dithionite, and stannous chloride, - a suitable auxiliary agent or ligand enabling the protection against reoxidation of Tc(V)0/Re(V)0 as competing reaction to coordination, such as but not limited to: tartrate, citrate or glucolieptonate, - a sequestering agent competing with the chelator for radiometal impurities - a stabilizer enabling the storage of the kit, and/or - an excipient such as lyophilization agent, matrix reagent or solubilizer.
- a suitable anti-oxidant agent such as but not limited to: sodium ascorbate/ascorbic acid mixtures, sodium borohydride, sodium dithionite, and stannous chloride, - a suitable auxiliary agent or ligand enabling the protection against reoxidation of Tc(V)0/Re(V)0 as competing reaction to coordination, such as but not limited to: tartrate, citrate or glucolieptonate, - a sequestering agent competing with the chelator for radiometal impurities - a stabilizer enabling the storage of the kit, and/or - an excipient such as lyophilization agent, matrix reagent or solubilizer.
24. A method of radiolabelling a compound according to any one of claims 1 to 6, comprising the steps of:
- providing a compound or labelling precursor according to any one of claims 1 to 6, - providing a suitable buffering system - providing a radionuclide, preferably selected from 99'Tc or "8Re and 186Re - providing a suitable reducing agent - mixing all components at a suitable pH and allowing the complexation of the radionuclide and labelling precursor to occur, thereby obtaining a radiolabelled compound.
- providing a compound or labelling precursor according to any one of claims 1 to 6, - providing a suitable buffering system - providing a radionuclide, preferably selected from 99'Tc or "8Re and 186Re - providing a suitable reducing agent - mixing all components at a suitable pH and allowing the complexation of the radionuclide and labelling precursor to occur, thereby obtaining a radiolabelled compound.
25. The method of claim 24, wherein said buffering system is selected from the group consisting of: phosphate buffers, acetate buffers, formate buffers, and HEPES buffers, more preferably phosphate buffers, even more preferably a sodium-phosphate buffer.
26. The method of claims 24 or 25, wherein when the radionuclide used is 99mTc, the precursor and buffer are mixed and a suitable amount of pertechnetate is eluted in saline from a molybdenum-99 (99Mo/99Tc) generator into said mixture.
27. The method of any one of claims 24 to 25, wherein when the radionuclide used is "8Re, the precursor and buffer are mixed and a suitable amount of Rhenium is eluted in saline from a tungsten-188 (iss\v/1"Re) generator into said mixture.
28. The method of any one of claims 24 to 25, wherein when the radionuclide used is "'Re, the precursor and buffer are mixed and a suitable amount of Rhenium-186 is produced from a cyclotron or reactor and added into said mixture.
29. Use of the metal complex according to any one of claims 7 to 9, or a pharmaceutical composition according to claim 10 for the manufacturing of a medicament for treating or preventing cancer in a subject. In a preferred embodiment of said aspect, the radionuclide used for therapeutic use is "sRe or "6Re.
30. Use of the metal complex according to any one of claims 7 to 9, or a pharmaceutical composition according to claim 10 for the manufacturing of a medicament for in-vivo imaging or detection of tumor or cancer cells or of in-vivo diagnosis of cancer in a subject. Preferred imaging methods are: positron emission tomography (PET), PET computed tomography (PET-CT) or single-photon emission tomography (SPECT). In a preferred embodiment of said aspect, the radionuclide used for imaging is 991flTc.
31. The use according to claim 29 or 30, wherein said cancer is a PSMA-expressing cancer or tumor, more preferably wherein said cancer is selected from the group consisting of: conventional renal cell canccr, transitional ccll of the bladder cancer, non-small-cell lung cancer, tcsticular-cmbryonal cancer, neuroendocrine cancer, colon cancer, prostate cancer, and breast cancer, preferably prostate canc er.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP21176899 | 2021-05-31 | ||
EP21176899.9 | 2021-05-31 | ||
PCT/EP2022/064668 WO2022253785A2 (en) | 2021-05-31 | 2022-05-31 | Improved prostate-specific membrane antigen targeting radiopharmaceuticals and uses thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
CA3217589A1 true CA3217589A1 (en) | 2022-12-08 |
Family
ID=76197364
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA3217589A Pending CA3217589A1 (en) | 2021-05-31 | 2022-05-31 | Improved prostate-specific membrane antigen targeting radiopharmaceuticals and uses thereof |
Country Status (7)
Country | Link |
---|---|
US (1) | US20240238460A1 (en) |
EP (1) | EP4347541A2 (en) |
CN (1) | CN117500772A (en) |
AU (1) | AU2022286613A1 (en) |
CA (1) | CA3217589A1 (en) |
MX (1) | MX2023014255A (en) |
WO (1) | WO2022253785A2 (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP4400505A1 (en) * | 2021-09-03 | 2024-07-17 | Bivision Pharmaceuticals, Inc | Peptide-urea derivative, pharmaceutical composition containing same and application thereof |
Family Cites Families (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2010299A (en) | 1997-12-24 | 1999-07-19 | Vertex Pharmaceuticals Incorporated | Prodrugs os aspartyl protease inhibitors |
TR200002402T2 (en) | 1997-12-24 | 2001-01-22 | Vertex Pharmaceuticals Incorporated | Aspartil protease inhibitor prodrugs. |
US6436989B1 (en) | 1997-12-24 | 2002-08-20 | Vertex Pharmaceuticals, Incorporated | Prodrugs of aspartyl protease inhibitors |
WO1999033795A1 (en) | 1997-12-24 | 1999-07-08 | Vertex Pharmaceuticals Incorporated | Prodrugs of aspartyl protease inhibitors |
ITFI20110180A1 (en) | 2011-08-12 | 2013-02-13 | Advanced Accelerator Applic S A | PROCESS FOR THE PREPARATION OF COMPLEXES OF 68GA. |
BE1021191B1 (en) | 2014-08-29 | 2015-10-27 | Anmi S.A. | KIT FOR RADIOMARKING. |
MX2016008466A (en) | 2016-06-24 | 2017-12-25 | Instituto Nac De Investigaciones Nucleares | 99mtc-edda/hynic-ipsma as a radiopharmaceutical for detecting the overexpression of prostate-specific membrane antigen. |
US11850291B2 (en) * | 2019-10-25 | 2023-12-26 | National Atomic Research Institute | PSMA targeted radiotherapy medicine and preparation method thereof |
WO2022167681A1 (en) * | 2021-02-08 | 2022-08-11 | Stichting Radboud Universitair Medisch Centrum | Psma-targeting ligands for multimodal applications |
-
2022
- 2022-05-31 MX MX2023014255A patent/MX2023014255A/en unknown
- 2022-05-31 EP EP22731550.4A patent/EP4347541A2/en active Pending
- 2022-05-31 CN CN202280038991.5A patent/CN117500772A/en active Pending
- 2022-05-31 WO PCT/EP2022/064668 patent/WO2022253785A2/en active Application Filing
- 2022-05-31 AU AU2022286613A patent/AU2022286613A1/en active Pending
- 2022-05-31 US US18/563,673 patent/US20240238460A1/en active Pending
- 2022-05-31 CA CA3217589A patent/CA3217589A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
AU2022286613A9 (en) | 2023-11-30 |
EP4347541A2 (en) | 2024-04-10 |
WO2022253785A3 (en) | 2023-03-23 |
WO2022253785A2 (en) | 2022-12-08 |
MX2023014255A (en) | 2024-01-18 |
CN117500772A (en) | 2024-02-02 |
US20240238460A1 (en) | 2024-07-18 |
AU2022286613A1 (en) | 2023-11-23 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2017281940B2 (en) | Compositions and methods of treating melanoma | |
CN112074526B (en) | 177Lu-DOTA-HYNIC-iPSMA as a therapeutic radiopharmaceutical | |
KR102233726B1 (en) | 18F-tagged inhibitor of prostate specific membrane antigen (PSMA) and its use as a contrast agent for prostate cancer | |
JP7515023B2 (en) | Dual targeting compounds and their preparation methods and applications | |
US20240066155A1 (en) | Dual mode radiotracer and -therapeutics | |
US20240238460A1 (en) | Improved prostate-specific membrane antigen targeting radiopharmaceuticals and uses thereof | |
US20230144360A1 (en) | Stabilized compositions of radionuclides and uses thereof | |
KR20070106731A (en) | Radiolabeled gallium complexes, methods for synthesis and use for pet imaging of egfr expression in malignant tumors | |
EP2795317B1 (en) | Composition for use in a method for cancer selection | |
EP4267204A1 (en) | Ligands and their use | |
WO2022115799A1 (en) | Radiopharmaceutical conjugates targeting guanylyl cyclase c, and compositions and uses thereof | |
WO2019246445A1 (en) | Triazamacrocycle-derived chelator compositions for coordination of imaging and therapy metal ions and methods of using same | |
Krutzek et al. | Design, Synthesis, and Biological Evaluation of Small-Molecule-Based Radioligands with Improved Pharmacokinetic Properties for Imaging of Programmed Death Ligand 1 | |
TW200539886A (en) | Radiohalogenated benzamide derivatives and their use in tumor diagnosis and tumor therapy | |
Zhao et al. | Validation study of 131I‑RRL: Assessment of biodistribution, SPECT imaging and radiation dosimetry in mice | |
KR101646577B1 (en) | Folate receptor targeted compound and pharmacologically acceptable salts thereof, and composition containing the same as an active ingredient for prevention, diagnosis or treatment of cancer | |
Yu et al. | Evaluation of 111In-DOTA-F56 peptide targeting VEGFR1 for potential non-invasive gastric cancer xenografted tumor mice Micro-SPECT imaging | |
KR101551232B1 (en) | Novel N3S1 chelator-folate derivatives, preparation method thereof and composition for diagnosis or treatment of cancer containing the same as an active ingredient | |
Fernanda Garcia et al. | Synthesis of 99mTc-Nimotuzumab with Tricarbonyl Ion: in vitro and in vivo Studies | |
WO2023091689A1 (en) | Combined use of mcr1-directed radiotherapy and immune checkpoint inhibition in the treatment of melanoma | |
KR20230171964A (en) | Folate receptor-targeted radiotherapy agents and uses thereof | |
KR20230134539A (en) | PSMA-targeted conjugates and uses thereof | |
KR20150143995A (en) | GRP-R antagonistic 177-Lutetium-labeled bombesin analogue for diagnosis and treatment of prostate cancer | |
CN116217505A (en) | Novel marker targeting agents for diagnosis or treatment of cancers expressing prostate specific membrane antigen | |
CN118591549A (en) | Carbonic anhydrase IX ligands |