CA3215313A1 - Combination therapies - Google Patents
Combination therapies Download PDFInfo
- Publication number
- CA3215313A1 CA3215313A1 CA3215313A CA3215313A CA3215313A1 CA 3215313 A1 CA3215313 A1 CA 3215313A1 CA 3215313 A CA3215313 A CA 3215313A CA 3215313 A CA3215313 A CA 3215313A CA 3215313 A1 CA3215313 A1 CA 3215313A1
- Authority
- CA
- Canada
- Prior art keywords
- formula
- compound
- group
- oxo
- inhibitor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000002648 combination therapy Methods 0.000 title description 207
- 150000001875 compounds Chemical class 0.000 claims abstract description 508
- 239000012453 solvate Substances 0.000 claims abstract description 440
- 150000003839 salts Chemical class 0.000 claims abstract description 430
- 229940034982 antineoplastic agent Drugs 0.000 claims abstract description 271
- 239000002246 antineoplastic agent Substances 0.000 claims abstract description 271
- SRQYLNYQAPCPIR-UHFFFAOYSA-N 4-[4-(5,5-dimethyl-4H-thiazol-2-yl)-1-piperazinyl]-6-propylthieno[2,3-d]pyrimidine Chemical compound N1=CN=C2SC(CCC)=CC2=C1N(CC1)CCN1C1=NCC(C)(C)S1 SRQYLNYQAPCPIR-UHFFFAOYSA-N 0.000 claims abstract description 79
- 229940119544 Menin-MLL inhibitor Drugs 0.000 claims abstract description 79
- 208000018706 hematopoietic system disease Diseases 0.000 claims abstract description 67
- 238000000034 method Methods 0.000 claims abstract description 61
- 239000012664 BCL-2-inhibitor Substances 0.000 claims abstract description 59
- 229940123711 Bcl2 inhibitor Drugs 0.000 claims abstract description 57
- LQBVNQSMGBZMKD-UHFFFAOYSA-N venetoclax Chemical compound C=1C=C(Cl)C=CC=1C=1CC(C)(C)CCC=1CN(CC1)CCN1C(C=C1OC=2C=C3C=CNC3=NC=2)=CC=C1C(=O)NS(=O)(=O)C(C=C1[N+]([O-])=O)=CC=C1NCC1CCOCC1 LQBVNQSMGBZMKD-UHFFFAOYSA-N 0.000 claims description 193
- 229960001183 venetoclax Drugs 0.000 claims description 193
- 229910052739 hydrogen Inorganic materials 0.000 claims description 103
- 239000001257 hydrogen Substances 0.000 claims description 95
- -1 AT101 Chemical compound 0.000 claims description 84
- 125000001424 substituent group Chemical group 0.000 claims description 80
- 239000003112 inhibitor Substances 0.000 claims description 67
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 claims description 53
- 125000004093 cyano group Chemical group *C#N 0.000 claims description 53
- 208000032839 leukemia Diseases 0.000 claims description 53
- 229940083266 Dihydroorotate dehydrogenase inhibitor Drugs 0.000 claims description 47
- 125000003118 aryl group Chemical group 0.000 claims description 39
- 238000011282 treatment Methods 0.000 claims description 37
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical group O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 claims description 36
- 229960002756 azacitidine Drugs 0.000 claims description 35
- 125000005913 (C3-C6) cycloalkyl group Chemical group 0.000 claims description 33
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 claims description 33
- 125000002950 monocyclic group Chemical group 0.000 claims description 32
- 150000002431 hydrogen Chemical class 0.000 claims description 30
- 208000031261 Acute myeloid leukaemia Diseases 0.000 claims description 26
- 229940126062 Compound A Drugs 0.000 claims description 26
- NLDMNSXOCDLTTB-UHFFFAOYSA-N Heterophylliin A Natural products O1C2COC(=O)C3=CC(O)=C(O)C(O)=C3C3=C(O)C(O)=C(O)C=C3C(=O)OC2C(OC(=O)C=2C=C(O)C(O)=C(O)C=2)C(O)C1OC(=O)C1=CC(O)=C(O)C(O)=C1 NLDMNSXOCDLTTB-UHFFFAOYSA-N 0.000 claims description 26
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 claims description 21
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 claims description 20
- 125000004433 nitrogen atom Chemical group N* 0.000 claims description 18
- 239000003795 chemical substances by application Substances 0.000 claims description 16
- 229910052731 fluorine Inorganic materials 0.000 claims description 16
- 239000002253 acid Substances 0.000 claims description 15
- 102100022678 Nucleophosmin Human genes 0.000 claims description 14
- 101001109719 Homo sapiens Nucleophosmin Proteins 0.000 claims description 13
- 229940075628 hypomethylating agent Drugs 0.000 claims description 13
- 229940043355 kinase inhibitor Drugs 0.000 claims description 13
- 239000003757 phosphotransferase inhibitor Substances 0.000 claims description 13
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 claims description 12
- 239000008194 pharmaceutical composition Substances 0.000 claims description 12
- 239000000138 intercalating agent Substances 0.000 claims description 11
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 claims description 9
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 claims description 9
- 230000002519 immonomodulatory effect Effects 0.000 claims description 9
- 229910052801 chlorine Inorganic materials 0.000 claims description 8
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 claims description 6
- 230000002265 prevention Effects 0.000 claims description 6
- 150000003230 pyrimidines Chemical class 0.000 claims description 6
- 239000003814 drug Substances 0.000 claims description 4
- 125000000561 purinyl group Chemical class N1=C(N=C2N=CNC2=C1)* 0.000 claims description 4
- CVCLJVVBHYOXDC-IAZSKANUSA-N (2z)-2-[(5z)-5-[(3,5-dimethyl-1h-pyrrol-2-yl)methylidene]-4-methoxypyrrol-2-ylidene]indole Chemical group COC1=C\C(=C/2N=C3C=CC=CC3=C\2)N\C1=C/C=1NC(C)=CC=1C CVCLJVVBHYOXDC-IAZSKANUSA-N 0.000 claims description 3
- RAYNZUHYMMLQQA-ZEQRLZLVSA-N 2,3,5-trihydroxy-7-methyl-n-[(2r)-2-phenylpropyl]-6-[1,6,7-trihydroxy-3-methyl-5-[[(2r)-2-phenylpropyl]carbamoyl]naphthalen-2-yl]naphthalene-1-carboxamide Chemical compound C1([C@@H](C)CNC(=O)C=2C3=CC(C)=C(C(=C3C=C(O)C=2O)O)C=2C(O)=C3C=C(O)C(O)=C(C3=CC=2C)C(=O)NC[C@H](C)C=2C=CC=CC=2)=CC=CC=C1 RAYNZUHYMMLQQA-ZEQRLZLVSA-N 0.000 claims description 3
- HPLNQCPCUACXLM-PGUFJCEWSA-N ABT-737 Chemical compound C([C@@H](CCN(C)C)NC=1C(=CC(=CC=1)S(=O)(=O)NC(=O)C=1C=CC(=CC=1)N1CCN(CC=2C(=CC=CC=2)C=2C=CC(Cl)=CC=2)CC1)[N+]([O-])=O)SC1=CC=CC=C1 HPLNQCPCUACXLM-PGUFJCEWSA-N 0.000 claims description 3
- PQAPVTKIEGUPRN-UHFFFAOYSA-N N-[4-(2-tert-butylphenyl)sulfonylphenyl]-2,3,4-trihydroxy-5-[(2-propan-2-ylphenyl)methyl]benzamide Chemical compound CC(C)C1=CC=CC=C1CC1=CC(C(=O)NC=2C=CC(=CC=2)S(=O)(=O)C=2C(=CC=CC=2)C(C)(C)C)=C(O)C(O)=C1O PQAPVTKIEGUPRN-UHFFFAOYSA-N 0.000 claims description 3
- 239000003937 drug carrier Substances 0.000 claims description 3
- 229950006584 obatoclax Drugs 0.000 claims description 3
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 claims description 2
- 229940045793 B-cell lymphoma-2 inhibitor Drugs 0.000 claims description 2
- JLYAXFNOILIKPP-KXQOOQHDSA-N navitoclax Chemical compound C([C@@H](NC1=CC=C(C=C1S(=O)(=O)C(F)(F)F)S(=O)(=O)NC(=O)C1=CC=C(C=C1)N1CCN(CC1)CC1=C(CCC(C1)(C)C)C=1C=CC(Cl)=CC=1)CSC=1C=CC=CC=1)CN1CCOCC1 JLYAXFNOILIKPP-KXQOOQHDSA-N 0.000 claims description 2
- 229950004847 navitoclax Drugs 0.000 claims description 2
- 125000001475 halogen functional group Chemical group 0.000 claims 6
- 229940122827 Isocitrate dehydrogenase inhibitor Drugs 0.000 claims 2
- 239000003363 dihydroorotate dehydrogenase inhibitor Substances 0.000 claims 2
- 229910052727 yttrium Inorganic materials 0.000 abstract description 3
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 152
- 239000000203 mixture Substances 0.000 description 115
- 125000005843 halogen group Chemical group 0.000 description 89
- VDBNYAPERZTOOF-UHFFFAOYSA-N isoquinolin-1(2H)-one Chemical compound C1=CC=C2C(=O)NC=CC2=C1 VDBNYAPERZTOOF-UHFFFAOYSA-N 0.000 description 84
- 125000006239 protecting group Chemical group 0.000 description 81
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 74
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 70
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 64
- 239000002904 solvent Substances 0.000 description 64
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 63
- KDLHZDBZIXYQEI-UHFFFAOYSA-N palladium Substances [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 61
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 59
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 51
- 239000002585 base Substances 0.000 description 46
- 239000000243 solution Substances 0.000 description 45
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 44
- FJDQFPXHSGXQBY-UHFFFAOYSA-L caesium carbonate Chemical compound [Cs+].[Cs+].[O-]C([O-])=O FJDQFPXHSGXQBY-UHFFFAOYSA-L 0.000 description 43
- 229910001868 water Inorganic materials 0.000 description 41
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 39
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical group N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 36
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 32
- 238000006243 chemical reaction Methods 0.000 description 32
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 32
- 239000011541 reaction mixture Substances 0.000 description 32
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 31
- 101150041968 CDC13 gene Proteins 0.000 description 30
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 30
- HEDRZPFGACZZDS-MICDWDOJSA-N Trichloro(2H)methane Chemical compound [2H]C(Cl)(Cl)Cl HEDRZPFGACZZDS-MICDWDOJSA-N 0.000 description 30
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 30
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 30
- 239000003208 petroleum Substances 0.000 description 29
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 28
- UOXJNGFFPMOZDM-UHFFFAOYSA-N 2-[di(propan-2-yl)amino]ethylsulfanyl-methylphosphinic acid Chemical compound CC(C)N(C(C)C)CCSP(C)(O)=O UOXJNGFFPMOZDM-UHFFFAOYSA-N 0.000 description 27
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 26
- 239000000377 silicon dioxide Substances 0.000 description 26
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 25
- 239000007832 Na2SO4 Substances 0.000 description 24
- 229910052757 nitrogen Inorganic materials 0.000 description 24
- 229910052938 sodium sulfate Inorganic materials 0.000 description 24
- 235000011152 sodium sulphate Nutrition 0.000 description 24
- SFHYNDMGZXWXBU-LIMNOBDPSA-N 6-amino-2-[[(e)-(3-formylphenyl)methylideneamino]carbamoylamino]-1,3-dioxobenzo[de]isoquinoline-5,8-disulfonic acid Chemical compound O=C1C(C2=3)=CC(S(O)(=O)=O)=CC=3C(N)=C(S(O)(=O)=O)C=C2C(=O)N1NC(=O)N\N=C\C1=CC=CC(C=O)=C1 SFHYNDMGZXWXBU-LIMNOBDPSA-N 0.000 description 23
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 23
- 239000003054 catalyst Substances 0.000 description 23
- 229910000024 caesium carbonate Inorganic materials 0.000 description 22
- 239000000543 intermediate Substances 0.000 description 22
- 239000007787 solid Substances 0.000 description 22
- YLQBMQCUIZJEEH-UHFFFAOYSA-N tetrahydrofuran Natural products C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 22
- FFSJPOPLSWBGQY-UHFFFAOYSA-N triazol-4-one Chemical compound O=C1C=NN=N1 FFSJPOPLSWBGQY-UHFFFAOYSA-N 0.000 description 22
- 239000012044 organic layer Substances 0.000 description 21
- KXDAEFPNCMNJSK-UHFFFAOYSA-N benzene carboxamide Natural products NC(=O)C1=CC=CC=C1 KXDAEFPNCMNJSK-UHFFFAOYSA-N 0.000 description 20
- 238000010828 elution Methods 0.000 description 20
- IJAPPYDYQCXOEF-UHFFFAOYSA-N phthalazin-1(2H)-one Chemical compound C1=CC=C2C(=O)NN=CC2=C1 IJAPPYDYQCXOEF-UHFFFAOYSA-N 0.000 description 20
- 150000001204 N-oxides Chemical class 0.000 description 19
- 101100054666 Streptomyces halstedii sch3 gene Proteins 0.000 description 19
- 238000004440 column chromatography Methods 0.000 description 19
- 125000000876 trifluoromethoxy group Chemical group FC(F)(F)O* 0.000 description 19
- 238000005160 1H NMR spectroscopy Methods 0.000 description 18
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 18
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 18
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 18
- 230000002829 reductive effect Effects 0.000 description 18
- RIOQSEWOXXDEQQ-UHFFFAOYSA-N triphenylphosphine Chemical compound C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 RIOQSEWOXXDEQQ-UHFFFAOYSA-N 0.000 description 18
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 17
- 239000012267 brine Substances 0.000 description 17
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 17
- XAUDJQYHKZQPEU-KVQBGUIXSA-N 5-aza-2'-deoxycytidine Chemical compound O=C1N=C(N)N=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XAUDJQYHKZQPEU-KVQBGUIXSA-N 0.000 description 16
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 16
- IAZDPXIOMUYVGZ-WFGJKAKNSA-N Dimethyl sulfoxide Chemical compound [2H]C([2H])([2H])S(=O)C([2H])([2H])[2H] IAZDPXIOMUYVGZ-WFGJKAKNSA-N 0.000 description 16
- 229960003603 decitabine Drugs 0.000 description 16
- 238000010438 heat treatment Methods 0.000 description 16
- 238000001990 intravenous administration Methods 0.000 description 16
- 229910052763 palladium Inorganic materials 0.000 description 16
- 125000000882 C2-C6 alkenyl group Chemical group 0.000 description 15
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 15
- 206010028980 Neoplasm Diseases 0.000 description 15
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 15
- 229910000027 potassium carbonate Inorganic materials 0.000 description 15
- 229940086542 triethylamine Drugs 0.000 description 15
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 14
- 102100022103 Histone-lysine N-methyltransferase 2A Human genes 0.000 description 14
- 230000000694 effects Effects 0.000 description 14
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 14
- 125000000171 (C1-C6) haloalkyl group Chemical group 0.000 description 13
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 13
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 13
- 125000000217 alkyl group Chemical group 0.000 description 13
- DYLUUSLLRIQKOE-UHFFFAOYSA-N enasidenib Chemical compound N=1C(C=2N=C(C=CC=2)C(F)(F)F)=NC(NCC(C)(O)C)=NC=1NC1=CC=NC(C(F)(F)F)=C1 DYLUUSLLRIQKOE-UHFFFAOYSA-N 0.000 description 13
- 229950010133 enasidenib Drugs 0.000 description 13
- WIJZXSAJMHAVGX-DHLKQENFSA-N ivosidenib Chemical compound FC1=CN=CC(N([C@H](C(=O)NC2CC(F)(F)C2)C=2C(=CC=CC=2)Cl)C(=O)[C@H]2N(C(=O)CC2)C=2N=CC=C(C=2)C#N)=C1 WIJZXSAJMHAVGX-DHLKQENFSA-N 0.000 description 13
- 229950010738 ivosidenib Drugs 0.000 description 13
- 235000015320 potassium carbonate Nutrition 0.000 description 13
- DTQVDTLACAAQTR-UHFFFAOYSA-N trifluoroacetic acid Substances OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 13
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 12
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 12
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 12
- 229960003852 atezolizumab Drugs 0.000 description 12
- YNHIGQDRGKUECZ-UHFFFAOYSA-L bis(triphenylphosphine)palladium(ii) dichloride Chemical compound [Cl-].[Cl-].[Pd+2].C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 YNHIGQDRGKUECZ-UHFFFAOYSA-L 0.000 description 12
- 125000004432 carbon atom Chemical group C* 0.000 description 12
- 238000005859 coupling reaction Methods 0.000 description 12
- 229960000684 cytarabine Drugs 0.000 description 12
- 229960003301 nivolumab Drugs 0.000 description 12
- 239000003921 oil Substances 0.000 description 12
- 229960002621 pembrolizumab Drugs 0.000 description 12
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 12
- 239000000047 product Substances 0.000 description 12
- 229920006395 saturated elastomer Polymers 0.000 description 12
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 12
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 11
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 11
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 11
- 229940045799 anthracyclines and related substance Drugs 0.000 description 11
- 125000004429 atom Chemical group 0.000 description 11
- 230000008878 coupling Effects 0.000 description 11
- 238000010168 coupling process Methods 0.000 description 11
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 11
- 229960004942 lenalidomide Drugs 0.000 description 11
- GOTYRUGSSMKFNF-UHFFFAOYSA-N lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 11
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 11
- 229960000688 pomalidomide Drugs 0.000 description 11
- UVSMNLNDYGZFPF-UHFFFAOYSA-N pomalidomide Chemical compound O=C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O UVSMNLNDYGZFPF-UHFFFAOYSA-N 0.000 description 11
- 235000017557 sodium bicarbonate Nutrition 0.000 description 11
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 11
- HEMHJVSKTPXQMS-UHFFFAOYSA-M sodium hydroxide Inorganic materials [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 11
- 229960003787 sorafenib Drugs 0.000 description 11
- 229960001796 sunitinib Drugs 0.000 description 11
- 125000000037 tert-butyldiphenylsilyl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1[Si]([H])([*]C(C([H])([H])[H])(C([H])([H])[H])C([H])([H])[H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 11
- 229960003433 thalidomide Drugs 0.000 description 11
- KZPYGQFFRCFCPP-UHFFFAOYSA-N 1,1'-bis(diphenylphosphino)ferrocene Chemical compound [Fe+2].C1=CC=C[C-]1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=C[C-]1P(C=1C=CC=CC=1)C1=CC=CC=C1 KZPYGQFFRCFCPP-UHFFFAOYSA-N 0.000 description 10
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 10
- HLFSDGLLUJUHTE-SNVBAGLBSA-N Levamisole Chemical compound C1([C@H]2CN3CCSC3=N2)=CC=CC=C1 HLFSDGLLUJUHTE-SNVBAGLBSA-N 0.000 description 10
- 239000000010 aprotic solvent Substances 0.000 description 10
- 229910052681 coesite Inorganic materials 0.000 description 10
- 229910052906 cristobalite Inorganic materials 0.000 description 10
- NKLCNNUWBJBICK-UHFFFAOYSA-N dess–martin periodinane Chemical compound C1=CC=C2I(OC(=O)C)(OC(C)=O)(OC(C)=O)OC(=O)C2=C1 NKLCNNUWBJBICK-UHFFFAOYSA-N 0.000 description 10
- 229960000390 fludarabine Drugs 0.000 description 10
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 10
- 229960001614 levamisole Drugs 0.000 description 10
- 235000012239 silicon dioxide Nutrition 0.000 description 10
- 229910052682 stishovite Inorganic materials 0.000 description 10
- 229910052905 tridymite Inorganic materials 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 9
- 101001045846 Homo sapiens Histone-lysine N-methyltransferase 2A Proteins 0.000 description 9
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 9
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 9
- 201000010099 disease Diseases 0.000 description 9
- 239000012071 phase Substances 0.000 description 9
- 238000002360 preparation method Methods 0.000 description 9
- 238000006069 Suzuki reaction reaction Methods 0.000 description 8
- 210000004027 cell Anatomy 0.000 description 8
- 239000000460 chlorine Substances 0.000 description 8
- 238000010511 deprotection reaction Methods 0.000 description 8
- 150000002148 esters Chemical class 0.000 description 8
- 239000000284 extract Substances 0.000 description 8
- 239000000706 filtrate Substances 0.000 description 8
- IQZZFVDIZRWADY-UHFFFAOYSA-N isocumarine Natural products C1=CC=C2C(=O)OC=CC2=C1 IQZZFVDIZRWADY-UHFFFAOYSA-N 0.000 description 8
- 239000000651 prodrug Substances 0.000 description 8
- 229940002612 prodrug Drugs 0.000 description 8
- JLTRXTDYQLMHGR-UHFFFAOYSA-N trimethylaluminium Chemical compound C[Al](C)C JLTRXTDYQLMHGR-UHFFFAOYSA-N 0.000 description 8
- 238000005481 NMR spectroscopy Methods 0.000 description 7
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 7
- 229960000583 acetic acid Drugs 0.000 description 7
- 125000003342 alkenyl group Chemical group 0.000 description 7
- 201000011510 cancer Diseases 0.000 description 7
- 239000003085 diluting agent Substances 0.000 description 7
- 125000002147 dimethylamino group Chemical group [H]C([H])([H])N(*)C([H])([H])[H] 0.000 description 7
- 238000000132 electrospray ionisation Methods 0.000 description 7
- 238000003818 flash chromatography Methods 0.000 description 7
- 238000001819 mass spectrum Methods 0.000 description 7
- YJVFFLUZDVXJQI-UHFFFAOYSA-L palladium(ii) acetate Chemical compound [Pd+2].CC([O-])=O.CC([O-])=O YJVFFLUZDVXJQI-UHFFFAOYSA-L 0.000 description 7
- 230000035755 proliferation Effects 0.000 description 7
- 108090000623 proteins and genes Proteins 0.000 description 7
- 230000004083 survival effect Effects 0.000 description 7
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 7
- CIHOLLKRGTVIJN-UHFFFAOYSA-N tert‐butyl hydroperoxide Chemical compound CC(C)(C)OO CIHOLLKRGTVIJN-UHFFFAOYSA-N 0.000 description 7
- JRMUNVKIHCOMHV-UHFFFAOYSA-M tetrabutylammonium bromide Chemical compound [Br-].CCCC[N+](CCCC)(CCCC)CCCC JRMUNVKIHCOMHV-UHFFFAOYSA-M 0.000 description 7
- ZWEHNKRNPOVVGH-UHFFFAOYSA-N 2-Butanone Chemical compound CCC(C)=O ZWEHNKRNPOVVGH-UHFFFAOYSA-N 0.000 description 6
- YGHRJJRRZDOVPD-UHFFFAOYSA-N 3-methylbutanal Chemical compound CC(C)CC=O YGHRJJRRZDOVPD-UHFFFAOYSA-N 0.000 description 6
- WFDIJRYMOXRFFG-UHFFFAOYSA-N Acetic anhydride Chemical compound CC(=O)OC(C)=O WFDIJRYMOXRFFG-UHFFFAOYSA-N 0.000 description 6
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 6
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 6
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 6
- 201000007224 Myeloproliferative neoplasm Diseases 0.000 description 6
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 6
- IMNFDUFMRHMDMM-UHFFFAOYSA-N N-Heptane Chemical compound CCCCCCC IMNFDUFMRHMDMM-UHFFFAOYSA-N 0.000 description 6
- LQZMLBORDGWNPD-UHFFFAOYSA-N N-iodosuccinimide Chemical compound IN1C(=O)CCC1=O LQZMLBORDGWNPD-UHFFFAOYSA-N 0.000 description 6
- 101100030361 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) pph-3 gene Proteins 0.000 description 6
- JFDZBHWFFUWGJE-UHFFFAOYSA-N benzonitrile Chemical compound N#CC1=CC=CC=C1 JFDZBHWFFUWGJE-UHFFFAOYSA-N 0.000 description 6
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 6
- 229910052799 carbon Inorganic materials 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 230000014509 gene expression Effects 0.000 description 6
- 238000000338 in vitro Methods 0.000 description 6
- 238000001727 in vivo Methods 0.000 description 6
- 239000010410 layer Substances 0.000 description 6
- CTSLXHKWHWQRSH-UHFFFAOYSA-N oxalyl chloride Chemical compound ClC(=O)C(Cl)=O CTSLXHKWHWQRSH-UHFFFAOYSA-N 0.000 description 6
- 239000000546 pharmaceutical excipient Substances 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 230000008707 rearrangement Effects 0.000 description 6
- 230000009467 reduction Effects 0.000 description 6
- 238000006722 reduction reaction Methods 0.000 description 6
- 238000010992 reflux Methods 0.000 description 6
- QBERHIJABFXGRZ-UHFFFAOYSA-M rhodium;triphenylphosphane;chloride Chemical compound [Cl-].[Rh].C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 QBERHIJABFXGRZ-UHFFFAOYSA-M 0.000 description 6
- 238000007363 ring formation reaction Methods 0.000 description 6
- LPXPTNMVRIOKMN-UHFFFAOYSA-M sodium nitrite Chemical compound [Na+].[O-]N=O LPXPTNMVRIOKMN-UHFFFAOYSA-M 0.000 description 6
- DYHSDKLCOJIUFX-UHFFFAOYSA-N tert-butoxycarbonyl anhydride Chemical compound CC(C)(C)OC(=O)OC(=O)OC(C)(C)C DYHSDKLCOJIUFX-UHFFFAOYSA-N 0.000 description 6
- FPGGTKZVZWFYPV-UHFFFAOYSA-M tetrabutylammonium fluoride Chemical compound [F-].CCCC[N+](CCCC)(CCCC)CCCC FPGGTKZVZWFYPV-UHFFFAOYSA-M 0.000 description 6
- WJKHJLXJJJATHN-UHFFFAOYSA-N triflic anhydride Chemical compound FC(F)(F)S(=O)(=O)OS(=O)(=O)C(F)(F)F WJKHJLXJJJATHN-UHFFFAOYSA-N 0.000 description 6
- 229910000404 tripotassium phosphate Inorganic materials 0.000 description 6
- 235000019798 tripotassium phosphate Nutrition 0.000 description 6
- 238000004293 19F NMR spectroscopy Methods 0.000 description 5
- CEBKHWWANWSNTI-UHFFFAOYSA-N 2-methylbut-3-yn-2-ol Chemical compound CC(C)(O)C#C CEBKHWWANWSNTI-UHFFFAOYSA-N 0.000 description 5
- QFXSWGXWZXSGLC-UHFFFAOYSA-N 3-methylpent-2-en-1-ol Chemical compound CCC(C)=CCO QFXSWGXWZXSGLC-UHFFFAOYSA-N 0.000 description 5
- XGADWNHARGAKQG-UHFFFAOYSA-N 3-methylpent-2-enal Chemical compound CCC(C)=CC=O XGADWNHARGAKQG-UHFFFAOYSA-N 0.000 description 5
- 206010000830 Acute leukaemia Diseases 0.000 description 5
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 5
- 238000007341 Heck reaction Methods 0.000 description 5
- 241000282414 Homo sapiens Species 0.000 description 5
- 102000012011 Isocitrate Dehydrogenase Human genes 0.000 description 5
- 108010075869 Isocitrate Dehydrogenase Proteins 0.000 description 5
- 239000002841 Lewis acid Substances 0.000 description 5
- 206010025323 Lymphomas Diseases 0.000 description 5
- 101100521345 Mus musculus Prop1 gene Proteins 0.000 description 5
- 108700017836 Prophet of Pit-1 Proteins 0.000 description 5
- 230000003197 catalytic effect Effects 0.000 description 5
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 description 5
- 229910052736 halogen Inorganic materials 0.000 description 5
- 150000002367 halogens Chemical class 0.000 description 5
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 5
- 238000005984 hydrogenation reaction Methods 0.000 description 5
- XEEYBQQBJWHFJM-UHFFFAOYSA-N iron Substances [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 5
- 150000007517 lewis acids Chemical class 0.000 description 5
- 208000003747 lymphoid leukemia Diseases 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- LXNAVEXFUKBNMK-UHFFFAOYSA-N palladium(II) acetate Substances [Pd].CC(O)=O.CC(O)=O LXNAVEXFUKBNMK-UHFFFAOYSA-N 0.000 description 5
- 235000011056 potassium acetate Nutrition 0.000 description 5
- 239000002244 precipitate Substances 0.000 description 5
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 5
- 125000000714 pyrimidinyl group Chemical group 0.000 description 5
- 150000003254 radicals Chemical class 0.000 description 5
- 239000000741 silica gel Substances 0.000 description 5
- 229910002027 silica gel Inorganic materials 0.000 description 5
- 238000010898 silica gel chromatography Methods 0.000 description 5
- 238000004808 supercritical fluid chromatography Methods 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- 229940121358 tyrosine kinase inhibitor Drugs 0.000 description 5
- 239000005483 tyrosine kinase inhibitor Substances 0.000 description 5
- 239000011995 wilkinson's catalyst Substances 0.000 description 5
- FSPQCTGGIANIJZ-UHFFFAOYSA-N 2-[[(3,4-dimethoxyphenyl)-oxomethyl]amino]-4,5,6,7-tetrahydro-1-benzothiophene-3-carboxamide Chemical compound C1=C(OC)C(OC)=CC=C1C(=O)NC1=C(C(N)=O)C(CCCC2)=C2S1 FSPQCTGGIANIJZ-UHFFFAOYSA-N 0.000 description 4
- 125000004217 4-methoxybenzyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1OC([H])([H])[H])C([H])([H])* 0.000 description 4
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 4
- 101710088194 Dehydrogenase Proteins 0.000 description 4
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- 230000010558 Gene Alterations Effects 0.000 description 4
- UIARLYUEJFELEN-LROUJFHJSA-N LSM-1231 Chemical compound C12=C3N4C5=CC=CC=C5C3=C3C(=O)NCC3=C2C2=CC=CC=C2N1[C@]1(C)[C@](CO)(O)C[C@H]4O1 UIARLYUEJFELEN-LROUJFHJSA-N 0.000 description 4
- 208000006404 Large Granular Lymphocytic Leukemia Diseases 0.000 description 4
- GSCCALZHGUWNJW-UHFFFAOYSA-N N-Cyclohexyl-N-methylcyclohexanamine Chemical compound C1CCCCC1N(C)C1CCCCC1 GSCCALZHGUWNJW-UHFFFAOYSA-N 0.000 description 4
- PCLIMKBDDGJMGD-UHFFFAOYSA-N N-bromosuccinimide Chemical compound BrN1C(=O)CCC1=O PCLIMKBDDGJMGD-UHFFFAOYSA-N 0.000 description 4
- 239000012270 PD-1 inhibitor Substances 0.000 description 4
- 239000012668 PD-1-inhibitor Substances 0.000 description 4
- 206010035226 Plasma cell myeloma Diseases 0.000 description 4
- 208000033759 Prolymphocytic T-Cell Leukemia Diseases 0.000 description 4
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 4
- 101710151245 Receptor-type tyrosine-protein kinase FLT3 Proteins 0.000 description 4
- 150000007513 acids Chemical class 0.000 description 4
- 230000004075 alteration Effects 0.000 description 4
- 230000003321 amplification Effects 0.000 description 4
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical class [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 4
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 4
- 208000024207 chronic leukemia Diseases 0.000 description 4
- 239000012230 colorless oil Substances 0.000 description 4
- OPQARKPSCNTWTJ-UHFFFAOYSA-L copper(ii) acetate Chemical compound [Cu+2].CC([O-])=O.CC([O-])=O OPQARKPSCNTWTJ-UHFFFAOYSA-L 0.000 description 4
- 239000012043 crude product Substances 0.000 description 4
- WDKJGPAUJRARSH-UHFFFAOYSA-N ethyl 3-methylpent-2-enoate Chemical compound CCOC(=O)C=C(C)CC WDKJGPAUJRARSH-UHFFFAOYSA-N 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 201000009277 hairy cell leukemia Diseases 0.000 description 4
- 125000001188 haloalkyl group Chemical group 0.000 description 4
- 230000026030 halogenation Effects 0.000 description 4
- 238000005658 halogenation reaction Methods 0.000 description 4
- 201000005787 hematologic cancer Diseases 0.000 description 4
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 239000011777 magnesium Substances 0.000 description 4
- 238000003199 nucleic acid amplification method Methods 0.000 description 4
- 230000000269 nucleophilic effect Effects 0.000 description 4
- RNVCVTLRINQCPJ-UHFFFAOYSA-N o-toluidine Chemical compound CC1=CC=CC=C1N RNVCVTLRINQCPJ-UHFFFAOYSA-N 0.000 description 4
- 229940121655 pd-1 inhibitor Drugs 0.000 description 4
- NLKNQRATVPKPDG-UHFFFAOYSA-M potassium iodide Substances [K+].[I-] NLKNQRATVPKPDG-UHFFFAOYSA-M 0.000 description 4
- 229910000160 potassium phosphate Inorganic materials 0.000 description 4
- 235000011009 potassium phosphates Nutrition 0.000 description 4
- 238000002953 preparative HPLC Methods 0.000 description 4
- 150000003212 purines Chemical class 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 125000006413 ring segment Chemical group 0.000 description 4
- 229910000077 silane Inorganic materials 0.000 description 4
- 229910001494 silver tetrafluoroborate Inorganic materials 0.000 description 4
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 4
- 239000012279 sodium borohydride Substances 0.000 description 4
- 229910000033 sodium borohydride Inorganic materials 0.000 description 4
- JQWHASGSAFIOCM-UHFFFAOYSA-M sodium periodate Chemical compound [Na+].[O-]I(=O)(=O)=O JQWHASGSAFIOCM-UHFFFAOYSA-M 0.000 description 4
- 239000007858 starting material Substances 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- FYSNRJHAOHDILO-UHFFFAOYSA-N thionyl chloride Chemical compound ClS(Cl)=O FYSNRJHAOHDILO-UHFFFAOYSA-N 0.000 description 4
- 239000003643 water by type Substances 0.000 description 4
- 125000004765 (C1-C4) haloalkyl group Chemical group 0.000 description 3
- SCYULBFZEHDVBN-UHFFFAOYSA-N 1,1-Dichloroethane Chemical compound CC(Cl)Cl SCYULBFZEHDVBN-UHFFFAOYSA-N 0.000 description 3
- NHXDCVFTXJVUGK-UHFFFAOYSA-N 4,5-difluoro-2-iodobenzoic acid Chemical compound OC(=O)C1=CC(F)=C(F)C=C1I NHXDCVFTXJVUGK-UHFFFAOYSA-N 0.000 description 3
- 108010029445 Agammaglobulinaemia Tyrosine Kinase Proteins 0.000 description 3
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 3
- 229940124291 BTK inhibitor Drugs 0.000 description 3
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 3
- GSNUFIFRDBKVIE-UHFFFAOYSA-N DMF Natural products CC1=CC=C(C)O1 GSNUFIFRDBKVIE-UHFFFAOYSA-N 0.000 description 3
- 108010052167 Dihydroorotate Dehydrogenase Proteins 0.000 description 3
- 102100032823 Dihydroorotate dehydrogenase (quinone), mitochondrial Human genes 0.000 description 3
- ROSDSFDQCJNGOL-UHFFFAOYSA-N Dimethylamine Chemical compound CNC ROSDSFDQCJNGOL-UHFFFAOYSA-N 0.000 description 3
- GBQUIPYCMXLLQT-UHFFFAOYSA-N FC1=CC(=C(C(=O)Cl)C=C1F)I Chemical compound FC1=CC(=C(C(=O)Cl)C=C1F)I GBQUIPYCMXLLQT-UHFFFAOYSA-N 0.000 description 3
- 206010064571 Gene mutation Diseases 0.000 description 3
- 239000007818 Grignard reagent Substances 0.000 description 3
- 208000028018 Lymphocytic leukaemia Diseases 0.000 description 3
- NFHFRUOZVGFOOS-UHFFFAOYSA-N Pd(PPh3)4 Substances [Pd].C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 NFHFRUOZVGFOOS-UHFFFAOYSA-N 0.000 description 3
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 3
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 3
- 108010009341 Protein Serine-Threonine Kinases Proteins 0.000 description 3
- 102000009516 Protein Serine-Threonine Kinases Human genes 0.000 description 3
- RWRDLPDLKQPQOW-UHFFFAOYSA-N Pyrrolidine Chemical compound C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 description 3
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical group [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 3
- 201000008717 T-cell large granular lymphocyte leukemia Diseases 0.000 description 3
- 208000026651 T-cell prolymphocytic leukemia Diseases 0.000 description 3
- 229910010066 TiC14 Inorganic materials 0.000 description 3
- 102100029823 Tyrosine-protein kinase BTK Human genes 0.000 description 3
- YYLKKYCXAOBSRM-JXMROGBWSA-N [4-[(e)-2-(1h-indazol-3-yl)ethenyl]phenyl]-piperazin-1-ylmethanone Chemical compound C=1C=C(\C=C\C=2C3=CC=CC=C3NN=2)C=CC=1C(=O)N1CCNCC1 YYLKKYCXAOBSRM-JXMROGBWSA-N 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 239000008186 active pharmaceutical agent Substances 0.000 description 3
- 150000001299 aldehydes Chemical class 0.000 description 3
- 235000012538 ammonium bicarbonate Nutrition 0.000 description 3
- 235000011114 ammonium hydroxide Nutrition 0.000 description 3
- 239000007864 aqueous solution Substances 0.000 description 3
- 238000005808 aromatic amination reaction Methods 0.000 description 3
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical group [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 3
- 239000005441 aurora Substances 0.000 description 3
- YUUVOSXMIOYUGG-UHFFFAOYSA-N benzenesulfonic acid;hydrate Chemical compound O.OS(=O)(=O)C1=CC=CC=C1.OS(=O)(=O)C1=CC=CC=C1 YUUVOSXMIOYUGG-UHFFFAOYSA-N 0.000 description 3
- ZADPBFCGQRWHPN-UHFFFAOYSA-N boronic acid Chemical compound OBO ZADPBFCGQRWHPN-UHFFFAOYSA-N 0.000 description 3
- 239000001569 carbon dioxide Substances 0.000 description 3
- 229910002092 carbon dioxide Inorganic materials 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 239000006071 cream Substances 0.000 description 3
- FAMRKDQNMBBFBR-BQYQJAHWSA-N diethyl azodicarboxylate Substances CCOC(=O)\N=N\C(=O)OCC FAMRKDQNMBBFBR-BQYQJAHWSA-N 0.000 description 3
- UAOMVDZJSHZZME-UHFFFAOYSA-N diisopropylamine Chemical compound CC(C)NC(C)C UAOMVDZJSHZZME-UHFFFAOYSA-N 0.000 description 3
- PHSWWKXTGAJPCQ-UHFFFAOYSA-N ethyl 2-phenylmethoxyacetate Chemical compound CCOC(=O)COCC1=CC=CC=C1 PHSWWKXTGAJPCQ-UHFFFAOYSA-N 0.000 description 3
- 238000001914 filtration Methods 0.000 description 3
- 125000001072 heteroaryl group Chemical group 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- 150000004677 hydrates Chemical class 0.000 description 3
- IKDUDTNKRLTJSI-UHFFFAOYSA-N hydrazine hydrate Chemical compound O.NN IKDUDTNKRLTJSI-UHFFFAOYSA-N 0.000 description 3
- 230000007062 hydrolysis Effects 0.000 description 3
- 238000006460 hydrolysis reaction Methods 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 230000000155 isotopic effect Effects 0.000 description 3
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 3
- 235000019341 magnesium sulphate Nutrition 0.000 description 3
- NXPHGHWWQRMDIA-UHFFFAOYSA-M magnesium;carbanide;bromide Chemical compound [CH3-].[Mg+2].[Br-] NXPHGHWWQRMDIA-UHFFFAOYSA-M 0.000 description 3
- FRIJBUGBVQZNTB-UHFFFAOYSA-M magnesium;ethane;bromide Chemical compound [Mg+2].[Br-].[CH2-]C FRIJBUGBVQZNTB-UHFFFAOYSA-M 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 229940124303 multikinase inhibitor Drugs 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 3
- 239000012454 non-polar solvent Substances 0.000 description 3
- 230000003647 oxidation Effects 0.000 description 3
- 238000007254 oxidation reaction Methods 0.000 description 3
- 239000001301 oxygen Chemical group 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- MUJIDPITZJWBSW-UHFFFAOYSA-N palladium(2+) Chemical compound [Pd+2] MUJIDPITZJWBSW-UHFFFAOYSA-N 0.000 description 3
- 238000007911 parenteral administration Methods 0.000 description 3
- 239000002798 polar solvent Substances 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 102000004169 proteins and genes Human genes 0.000 description 3
- 238000004007 reversed phase HPLC Methods 0.000 description 3
- 229910000029 sodium carbonate Inorganic materials 0.000 description 3
- 235000017550 sodium carbonate Nutrition 0.000 description 3
- QDRKDTQENPPHOJ-UHFFFAOYSA-N sodium ethoxide Chemical compound [Na+].CC[O-] QDRKDTQENPPHOJ-UHFFFAOYSA-N 0.000 description 3
- 235000010288 sodium nitrite Nutrition 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 229910052717 sulfur Inorganic materials 0.000 description 3
- 239000011593 sulfur Chemical group 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 238000011277 treatment modality Methods 0.000 description 3
- 150000004917 tyrosine kinase inhibitor derivatives Chemical group 0.000 description 3
- SSJXIUAHEKJCMH-PHDIDXHHSA-N (1r,2r)-cyclohexane-1,2-diamine Chemical compound N[C@@H]1CCCC[C@H]1N SSJXIUAHEKJCMH-PHDIDXHHSA-N 0.000 description 2
- CGMWMYHEKGCISN-UHFFFAOYSA-N (2-chloro-6-fluorophenyl)hydrazine Chemical compound NNC1=C(F)C=CC=C1Cl CGMWMYHEKGCISN-UHFFFAOYSA-N 0.000 description 2
- AATVXELAYCLVTJ-UHFFFAOYSA-N 2,6-dichloro-5-fluoropyridine-3-carbonyl chloride Chemical compound FC1=CC(C(Cl)=O)=C(Cl)N=C1Cl AATVXELAYCLVTJ-UHFFFAOYSA-N 0.000 description 2
- KYGYCAUNXCVLQM-UHFFFAOYSA-N 2-phenylmethoxyacetohydrazide Chemical compound NNC(=O)COCC1=CC=CC=C1 KYGYCAUNXCVLQM-UHFFFAOYSA-N 0.000 description 2
- STCTWLFYHWUGLV-UHFFFAOYSA-N 3-[2-[tert-butyl(diphenyl)silyl]oxyethoxy]-2-chloroaniline Chemical compound [Si](C1=CC=CC=C1)(C1=CC=CC=C1)(C(C)(C)C)OCCOC=1C(=C(N)C=CC=1)Cl STCTWLFYHWUGLV-UHFFFAOYSA-N 0.000 description 2
- SEPQTYODOKLVSB-UHFFFAOYSA-N 3-methylbut-2-enal Chemical compound CC(C)=CC=O SEPQTYODOKLVSB-UHFFFAOYSA-N 0.000 description 2
- DPGSPRJLAZGUBQ-UHFFFAOYSA-N 4,4,5,5-tetramethyl-2-vinyl-1,3,2-dioxaborolane Substances CC1(C)OB(C=C)OC1(C)C DPGSPRJLAZGUBQ-UHFFFAOYSA-N 0.000 description 2
- OMAPJRUXTMJWMQ-UHFFFAOYSA-N 4-ethyl-3-(phenylmethoxymethyl)-1H-1,2,4-triazol-5-one Chemical compound C(C1=CC=CC=C1)OCC1=NNC(N1CC)=O OMAPJRUXTMJWMQ-UHFFFAOYSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 2
- PAYRUJLWNCNPSJ-UHFFFAOYSA-N Aniline Chemical compound NC1=CC=CC=C1 PAYRUJLWNCNPSJ-UHFFFAOYSA-N 0.000 description 2
- 208000032568 B-cell prolymphocytic leukaemia Diseases 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- 241000193830 Bacillus <bacterium> Species 0.000 description 2
- 239000005711 Benzoic acid Substances 0.000 description 2
- IWPDQCKOHDKGPQ-UHFFFAOYSA-N BrC1=C(C(=O)OC(C)(C)C)C=C(C(=C1)F)C Chemical compound BrC1=C(C(=O)OC(C)(C)C)C=C(C(=C1)F)C IWPDQCKOHDKGPQ-UHFFFAOYSA-N 0.000 description 2
- 101100118680 Caenorhabditis elegans sec-61.G gene Proteins 0.000 description 2
- OKTJSMMVPCPJKN-NJFSPNSNSA-N Carbon-14 Chemical compound [14C] OKTJSMMVPCPJKN-NJFSPNSNSA-N 0.000 description 2
- 238000006964 Chan-Lam coupling reaction Methods 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- QUSNBJAOOMFDIB-UHFFFAOYSA-N Ethylamine Chemical compound CCN QUSNBJAOOMFDIB-UHFFFAOYSA-N 0.000 description 2
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 101000603877 Homo sapiens Nuclear receptor subfamily 1 group I member 2 Proteins 0.000 description 2
- 101001052849 Homo sapiens Tyrosine-protein kinase Fer Proteins 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 2
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 229940123392 Isocitrate dehydrogenase 1 inhibitor Drugs 0.000 description 2
- 229940124202 Isocitrate dehydrogenase 2 inhibitor Drugs 0.000 description 2
- 208000035490 Megakaryoblastic Acute Leukemia Diseases 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- BAVYZALUXZFZLV-UHFFFAOYSA-N Methylamine Chemical compound NC BAVYZALUXZFZLV-UHFFFAOYSA-N 0.000 description 2
- YNAVUWVOSKDBBP-UHFFFAOYSA-N Morpholine Chemical compound C1COCCN1 YNAVUWVOSKDBBP-UHFFFAOYSA-N 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- FXHOOIRPVKKKFG-UHFFFAOYSA-N N,N-Dimethylacetamide Chemical compound CN(C)C(C)=O FXHOOIRPVKKKFG-UHFFFAOYSA-N 0.000 description 2
- JRNVZBWKYDBUCA-UHFFFAOYSA-N N-chlorosuccinimide Chemical compound ClN1C(=O)CCC1=O JRNVZBWKYDBUCA-UHFFFAOYSA-N 0.000 description 2
- 229910017852 NH2NH2 Inorganic materials 0.000 description 2
- 208000033755 Neutrophilic Chronic Leukemia Diseases 0.000 description 2
- 102100038494 Nuclear receptor subfamily 1 group I member 2 Human genes 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- 208000035416 Prolymphocytic B-Cell Leukemia Diseases 0.000 description 2
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 2
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 2
- SMWDFEZZVXVKRB-UHFFFAOYSA-N Quinoline Chemical compound N1=CC=CC2=CC=CC=C21 SMWDFEZZVXVKRB-UHFFFAOYSA-N 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 238000006932 Simmons-Smith cyclopropanation reaction Methods 0.000 description 2
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 2
- WQDUMFSSJAZKTM-UHFFFAOYSA-N Sodium methoxide Chemical compound [Na+].[O-]C WQDUMFSSJAZKTM-UHFFFAOYSA-N 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 102100024537 Tyrosine-protein kinase Fer Human genes 0.000 description 2
- 208000016025 Waldenstroem macroglobulinemia Diseases 0.000 description 2
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 2
- 238000007239 Wittig reaction Methods 0.000 description 2
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 2
- 208000013593 acute megakaryoblastic leukemia Diseases 0.000 description 2
- 208000020700 acute megakaryocytic leukemia Diseases 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 206010002449 angioimmunoblastic T-cell lymphoma Diseases 0.000 description 2
- 238000006254 arylation reaction Methods 0.000 description 2
- 239000012298 atmosphere Substances 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- CECGBBNIUDXSHK-UHFFFAOYSA-N benzamide;oxalic acid Chemical compound OC(=O)C(O)=O.NC(=O)C1=CC=CC=C1 CECGBBNIUDXSHK-UHFFFAOYSA-N 0.000 description 2
- 235000010233 benzoic acid Nutrition 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- YKYOUMDCQGMQQO-UHFFFAOYSA-L cadmium dichloride Chemical compound Cl[Cd]Cl YKYOUMDCQGMQQO-UHFFFAOYSA-L 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 239000003638 chemical reducing agent Substances 0.000 description 2
- 201000010903 chronic neutrophilic leukemia Diseases 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 229910052802 copper Inorganic materials 0.000 description 2
- 239000010949 copper Substances 0.000 description 2
- 238000002425 crystallisation Methods 0.000 description 2
- 230000008025 crystallization Effects 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- DEZRYPDIMOWBDS-UHFFFAOYSA-N dcm dichloromethane Chemical compound ClCCl.ClCCl DEZRYPDIMOWBDS-UHFFFAOYSA-N 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 150000004985 diamines Chemical class 0.000 description 2
- JQVDAXLFBXTEQA-UHFFFAOYSA-N dibutylamine Chemical compound CCCCNCCCC JQVDAXLFBXTEQA-UHFFFAOYSA-N 0.000 description 2
- 235000005911 diet Nutrition 0.000 description 2
- 230000037213 diet Effects 0.000 description 2
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 2
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 2
- HQWPLXHWEZZGKY-UHFFFAOYSA-N diethylzinc Chemical compound CC[Zn]CC HQWPLXHWEZZGKY-UHFFFAOYSA-N 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- NZZFYRREKKOMAT-UHFFFAOYSA-N diiodomethane Chemical compound ICI NZZFYRREKKOMAT-UHFFFAOYSA-N 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 239000003480 eluent Substances 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 235000013355 food flavoring agent Nutrition 0.000 description 2
- 239000012458 free base Substances 0.000 description 2
- 125000000524 functional group Chemical group 0.000 description 2
- 238000002290 gas chromatography-mass spectrometry Methods 0.000 description 2
- GYQYAJJFPNQOOW-UHFFFAOYSA-N gilteritinib Chemical compound N1=C(NC2CCOCC2)C(CC)=NC(C(N)=O)=C1NC(C=C1OC)=CC=C1N(CC1)CCC1N1CCN(C)CC1 GYQYAJJFPNQOOW-UHFFFAOYSA-N 0.000 description 2
- 230000002140 halogenating effect Effects 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 229960000908 idarubicin Drugs 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 238000003402 intramolecular cyclocondensation reaction Methods 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 229960004592 isopropanol Drugs 0.000 description 2
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 2
- AWJUIBRHMBBTKR-UHFFFAOYSA-N isoquinoline Chemical compound C1=NC=CC2=CC=CC=C21 AWJUIBRHMBBTKR-UHFFFAOYSA-N 0.000 description 2
- 150000002576 ketones Chemical class 0.000 description 2
- 229950001845 lestaurtinib Drugs 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 238000004811 liquid chromatography Methods 0.000 description 2
- YNESATAKKCNGOF-UHFFFAOYSA-N lithium bis(trimethylsilyl)amide Chemical compound [Li+].C[Si](C)(C)[N-][Si](C)(C)C YNESATAKKCNGOF-UHFFFAOYSA-N 0.000 description 2
- IUYHWZFSGMZEOG-UHFFFAOYSA-M magnesium;propane;chloride Chemical compound [Mg+2].[Cl-].C[CH-]C IUYHWZFSGMZEOG-UHFFFAOYSA-M 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- ZCGAVEFBZYWYJW-UHFFFAOYSA-N methyl 2-bromo-4,5-difluorobenzoate Chemical compound COC(=O)C1=CC(F)=C(F)C=C1Br ZCGAVEFBZYWYJW-UHFFFAOYSA-N 0.000 description 2
- VAYKANWZAJRNOM-UHFFFAOYSA-N methyl 4-bromo-2-iodobenzoate Chemical compound COC(=O)C1=CC=C(Br)C=C1I VAYKANWZAJRNOM-UHFFFAOYSA-N 0.000 description 2
- 229940095102 methyl benzoate Drugs 0.000 description 2
- BMGQWWVMWDBQGC-IIFHNQTCSA-N midostaurin Chemical compound CN([C@H]1[C@H]([C@]2(C)O[C@@H](N3C4=CC=CC=C4C4=C5C(=O)NCC5=C5C6=CC=CC=C6N2C5=C43)C1)OC)C(=O)C1=CC=CC=C1 BMGQWWVMWDBQGC-IIFHNQTCSA-N 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 239000002808 molecular sieve Substances 0.000 description 2
- 208000025113 myeloid leukemia Diseases 0.000 description 2
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 2
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 2
- 239000012299 nitrogen atmosphere Substances 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 238000000655 nuclear magnetic resonance spectrum Methods 0.000 description 2
- 229960003347 obinutuzumab Drugs 0.000 description 2
- 239000002674 ointment Substances 0.000 description 2
- 150000007530 organic bases Chemical class 0.000 description 2
- 239000012074 organic phase Substances 0.000 description 2
- 230000001590 oxidative effect Effects 0.000 description 2
- PENAXHPKEVTBLF-UHFFFAOYSA-L palladium(2+);prop-1-ene;dichloride Chemical compound [Pd+]Cl.[Pd+]Cl.[CH2-]C=C.[CH2-]C=C PENAXHPKEVTBLF-UHFFFAOYSA-L 0.000 description 2
- 125000006340 pentafluoro ethyl group Chemical group FC(F)(F)C(F)(F)* 0.000 description 2
- ACVYVLVWPXVTIT-UHFFFAOYSA-N phosphinic acid Chemical compound O[PH2]=O ACVYVLVWPXVTIT-UHFFFAOYSA-N 0.000 description 2
- 238000002600 positron emission tomography Methods 0.000 description 2
- 239000011591 potassium Substances 0.000 description 2
- 229910052700 potassium Inorganic materials 0.000 description 2
- 235000011181 potassium carbonates Nutrition 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000000634 powder X-ray diffraction Methods 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- APZAYTTYRHSPCU-UHFFFAOYSA-N propan-2-yl 2,6-dichloro-5-fluoropyridine-3-carboxylate Chemical compound CC(C)OC(=O)C1=CC(F)=C(Cl)N=C1Cl APZAYTTYRHSPCU-UHFFFAOYSA-N 0.000 description 2
- WGYKZJWCGVVSQN-UHFFFAOYSA-N propylamine Chemical compound CCCN WGYKZJWCGVVSQN-UHFFFAOYSA-N 0.000 description 2
- CVWXJKQAOSCOAB-UHFFFAOYSA-N quizartinib Chemical compound O1C(C(C)(C)C)=CC(NC(=O)NC=2C=CC(=CC=2)C=2N=C3N(C4=CC=C(OCCN5CCOCC5)C=C4S3)C=2)=N1 CVWXJKQAOSCOAB-UHFFFAOYSA-N 0.000 description 2
- 239000002516 radical scavenger Substances 0.000 description 2
- 238000001953 recrystallisation Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 239000010948 rhodium Substances 0.000 description 2
- 229930195734 saturated hydrocarbon Natural products 0.000 description 2
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 2
- DUIOPKIIICUYRZ-UHFFFAOYSA-N semicarbazide Chemical compound NNC(N)=O DUIOPKIIICUYRZ-UHFFFAOYSA-N 0.000 description 2
- 238000009097 single-agent therapy Methods 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 239000011877 solvent mixture Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-N succinic acid Chemical compound OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- UXXQOJXBIDBUAC-UHFFFAOYSA-N tandutinib Chemical compound COC1=CC2=C(N3CCN(CC3)C(=O)NC=3C=CC(OC(C)C)=CC=3)N=CN=C2C=C1OCCCN1CCCCC1 UXXQOJXBIDBUAC-UHFFFAOYSA-N 0.000 description 2
- QLAWSKICIIQVQE-UHFFFAOYSA-N tert-butyl 4,5-difluoro-2-iodobenzoate Chemical compound FC1=CC(=C(C(=O)OC(C)(C)C)C=C1F)I QLAWSKICIIQVQE-UHFFFAOYSA-N 0.000 description 2
- 238000004809 thin layer chromatography Methods 0.000 description 2
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 description 2
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 2
- 125000001889 triflyl group Chemical group FC(F)(F)S(*)(=O)=O 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- IIHPVYJPDKJYOU-UHFFFAOYSA-N triphenylcarbethoxymethylenephosphorane Chemical compound C=1C=CC=CC=1P(C=1C=CC=CC=1)(=CC(=O)OCC)C1=CC=CC=C1 IIHPVYJPDKJYOU-UHFFFAOYSA-N 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 2
- CXNIUSPIQKWYAI-UHFFFAOYSA-N xantphos Chemical compound C=12OC3=C(P(C=4C=CC=CC=4)C=4C=CC=CC=4)C=CC=C3C(C)(C)C2=CC=CC=1P(C=1C=CC=CC=1)C1=CC=CC=C1 CXNIUSPIQKWYAI-UHFFFAOYSA-N 0.000 description 2
- 239000011701 zinc Substances 0.000 description 2
- 229910052725 zinc Inorganic materials 0.000 description 2
- IMIGJFNGDJQHMS-UHFFFAOYSA-N (2-chloro-6-fluorophenyl)hydrazine;hydrochloride Chemical compound Cl.NNC1=C(F)C=CC=C1Cl IMIGJFNGDJQHMS-UHFFFAOYSA-N 0.000 description 1
- SCZGZDLUGUYLRV-UHFFFAOYSA-N (2-methylphenyl)hydrazine Chemical compound CC1=CC=CC=C1NN SCZGZDLUGUYLRV-UHFFFAOYSA-N 0.000 description 1
- NWZSZGALRFJKBT-KNIFDHDWSA-N (2s)-2,6-diaminohexanoic acid;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.NCCCC[C@H](N)C(O)=O NWZSZGALRFJKBT-KNIFDHDWSA-N 0.000 description 1
- WWTBZEKOSBFBEM-SPWPXUSOSA-N (2s)-2-[[2-benzyl-3-[hydroxy-[(1r)-2-phenyl-1-(phenylmethoxycarbonylamino)ethyl]phosphoryl]propanoyl]amino]-3-(1h-indol-3-yl)propanoic acid Chemical compound N([C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)O)C(=O)C(CP(O)(=O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1C=CC=CC=1)CC1=CC=CC=C1 WWTBZEKOSBFBEM-SPWPXUSOSA-N 0.000 description 1
- DYLIWHYUXAJDOJ-OWOJBTEDSA-N (e)-4-(6-aminopurin-9-yl)but-2-en-1-ol Chemical compound NC1=NC=NC2=C1N=CN2C\C=C\CO DYLIWHYUXAJDOJ-OWOJBTEDSA-N 0.000 description 1
- NWUYHJFMYQTDRP-UHFFFAOYSA-N 1,2-bis(ethenyl)benzene;1-ethenyl-2-ethylbenzene;styrene Chemical compound C=CC1=CC=CC=C1.CCC1=CC=CC=C1C=C.C=CC1=CC=CC=C1C=C NWUYHJFMYQTDRP-UHFFFAOYSA-N 0.000 description 1
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide Substances CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 1
- LOYZVRIHVZEDMW-UHFFFAOYSA-N 1-bromo-3-methylbut-2-ene Chemical compound CC(C)=CCBr LOYZVRIHVZEDMW-UHFFFAOYSA-N 0.000 description 1
- MICMHFIQSAMEJG-UHFFFAOYSA-N 1-bromopyrrolidine-2,5-dione Chemical compound BrN1C(=O)CCC1=O.BrN1C(=O)CCC1=O MICMHFIQSAMEJG-UHFFFAOYSA-N 0.000 description 1
- ARMNMUCAIHEYDB-UHFFFAOYSA-N 1-ethoxyethenyltin Chemical compound CCOC([Sn])=C ARMNMUCAIHEYDB-UHFFFAOYSA-N 0.000 description 1
- 125000004206 2,2,2-trifluoroethyl group Chemical group [H]C([H])(*)C(F)(F)F 0.000 description 1
- MRAYNLYCQPAZJN-UHFFFAOYSA-N 2-(2-ethoxyethenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane Chemical compound CCOC=CB1OC(C)(C)C(C)(C)O1 MRAYNLYCQPAZJN-UHFFFAOYSA-N 0.000 description 1
- XIDWGTFDBMALGG-UHFFFAOYSA-N 2-[tert-butyl(diphenyl)silyl]oxyethanol Chemical compound C=1C=CC=CC=1[Si](OCCO)(C(C)(C)C)C1=CC=CC=C1 XIDWGTFDBMALGG-UHFFFAOYSA-N 0.000 description 1
- UVSGTNJGIMPLAM-UHFFFAOYSA-N 2-bromo-4-fluoro-5-methylbenzoic acid Chemical compound CC1=CC(C(O)=O)=C(Br)C=C1F UVSGTNJGIMPLAM-UHFFFAOYSA-N 0.000 description 1
- QBGLHYQUZJDZOO-UHFFFAOYSA-N 2-chloro-3-nitrophenol Chemical compound OC1=CC=CC([N+]([O-])=O)=C1Cl QBGLHYQUZJDZOO-UHFFFAOYSA-N 0.000 description 1
- KLRGFHWPMNZXGL-UHFFFAOYSA-N 2-chloro-6-fluoro-N-(3-methylpent-2-enyl)aniline Chemical compound ClC1=C(NCC=C(CC)C)C(=CC=C1)F KLRGFHWPMNZXGL-UHFFFAOYSA-N 0.000 description 1
- ZJLAWMDJTMMTQB-UHFFFAOYSA-N 2-chloro-6-fluoroaniline Chemical compound NC1=C(F)C=CC=C1Cl ZJLAWMDJTMMTQB-UHFFFAOYSA-N 0.000 description 1
- 125000004200 2-methoxyethyl group Chemical group [H]C([H])([H])OC([H])([H])C([H])([H])* 0.000 description 1
- JHUUPUMBZGWODW-UHFFFAOYSA-N 3,6-dihydro-1,2-dioxine Chemical compound C1OOCC=C1 JHUUPUMBZGWODW-UHFFFAOYSA-N 0.000 description 1
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 1
- HRNHLUIYPXDQAX-UHFFFAOYSA-N 3-[[tert-butyl(diphenyl)silyl]oxymethyl]-4-ethyl-1H-1,2,4-triazol-5-one Chemical compound [Si](C1=CC=CC=C1)(C1=CC=CC=C1)(C(C)(C)C)OCC=1N(C(NN=1)=O)CC HRNHLUIYPXDQAX-UHFFFAOYSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- ANIOJFUICYLPSK-UHFFFAOYSA-N 3-methylbut-2-enyl 4,5-difluoro-2-iodobenzoate Chemical compound FC1=CC(=C(C(=O)OCC=C(C)C)C=C1F)I ANIOJFUICYLPSK-UHFFFAOYSA-N 0.000 description 1
- XKJUKVTZSPIGSI-UHFFFAOYSA-N 3-methylbutanal Chemical compound CC(C)CC=O.CC(C)CC=O XKJUKVTZSPIGSI-UHFFFAOYSA-N 0.000 description 1
- DYQXIHALMKCBKY-UHFFFAOYSA-N 4-bromo-2-iodobenzoyl chloride Chemical compound BrC1=CC(=C(C(=O)Cl)C=C1)I DYQXIHALMKCBKY-UHFFFAOYSA-N 0.000 description 1
- NZWUBAGKLOTTJT-UHFFFAOYSA-N 4-ethyl-3-(hydroxymethyl)-1H-1,2,4-triazol-5-one Chemical compound CCN1C(=O)NN=C1CO NZWUBAGKLOTTJT-UHFFFAOYSA-N 0.000 description 1
- XQKOUEBIJOSTKI-UHFFFAOYSA-N 4-methyl-3-(phenylmethoxymethyl)-1h-1,2,4-triazol-5-one Chemical compound N1C(=O)N(C)C(COCC=2C=CC=CC=2)=N1 XQKOUEBIJOSTKI-UHFFFAOYSA-N 0.000 description 1
- BNNMDMGPZUOOOE-UHFFFAOYSA-N 4-methylbenzenesulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1.CC1=CC=C(S(O)(=O)=O)C=C1 BNNMDMGPZUOOOE-UHFFFAOYSA-N 0.000 description 1
- UATBWQQFLABWKR-UHFFFAOYSA-N 5,6-difluoro-2-benzofuran-1,3-dione Chemical compound C1=C(F)C(F)=CC2=C1C(=O)OC2=O UATBWQQFLABWKR-UHFFFAOYSA-N 0.000 description 1
- WTZYTQJELOHMMJ-UHFFFAOYSA-N 5-methyl-4-nitro-1h-pyrazole Chemical compound CC=1NN=CC=1[N+]([O-])=O WTZYTQJELOHMMJ-UHFFFAOYSA-N 0.000 description 1
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 1
- 229910000013 Ammonium bicarbonate Inorganic materials 0.000 description 1
- 206010073478 Anaplastic large-cell lymphoma Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical group [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- JPVYNHNXODAKFH-UHFFFAOYSA-N Cu2+ Chemical compound [Cu+2] JPVYNHNXODAKFH-UHFFFAOYSA-N 0.000 description 1
- 230000007067 DNA methylation Effects 0.000 description 1
- 238000006646 Dess-Martin oxidation reaction Methods 0.000 description 1
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 1
- BUDQDWGNQVEFAC-UHFFFAOYSA-N Dihydropyran Chemical compound C1COC=CC1 BUDQDWGNQVEFAC-UHFFFAOYSA-N 0.000 description 1
- MYMOFIZGZYHOMD-UHFFFAOYSA-N Dioxygen Chemical compound O=O MYMOFIZGZYHOMD-UHFFFAOYSA-N 0.000 description 1
- 101000827763 Drosophila melanogaster Fibroblast growth factor receptor homolog 1 Proteins 0.000 description 1
- 235000004694 Eucalyptus leucoxylon Nutrition 0.000 description 1
- 244000166102 Eucalyptus leucoxylon Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- KRHYYFGTRYWZRS-UHFFFAOYSA-M Fluoride anion Chemical compound [F-] KRHYYFGTRYWZRS-UHFFFAOYSA-M 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical group FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- 208000033962 Fontaine progeroid syndrome Diseases 0.000 description 1
- BDAGIHXWWSANSR-UHFFFAOYSA-N Formic acid Chemical class OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 1
- 230000005526 G1 to G0 transition Effects 0.000 description 1
- 229910003803 Gold(III) chloride Inorganic materials 0.000 description 1
- 101150033506 HOX gene Proteins 0.000 description 1
- 206010066476 Haematological malignancy Diseases 0.000 description 1
- 108050002855 Histone-lysine N-methyltransferase 2A Proteins 0.000 description 1
- 101100237041 Homo sapiens MEIS1 gene Proteins 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 239000002177 L01XE27 - Ibrutinib Substances 0.000 description 1
- 208000032004 Large-Cell Anaplastic Lymphoma Diseases 0.000 description 1
- 229910013470 LiC1 Inorganic materials 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 101150029107 MEIS1 gene Proteins 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- MPCRDALPQLDDFX-UHFFFAOYSA-L Magnesium perchlorate Chemical compound [Mg+2].[O-]Cl(=O)(=O)=O.[O-]Cl(=O)(=O)=O MPCRDALPQLDDFX-UHFFFAOYSA-L 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 101710169972 Menin Proteins 0.000 description 1
- 102100030550 Menin Human genes 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 241000872931 Myoporum sandwicense Species 0.000 description 1
- JLTDJTHDQAWBAV-UHFFFAOYSA-N N,N-dimethylaniline Chemical compound CN(C)C1=CC=CC=C1 JLTDJTHDQAWBAV-UHFFFAOYSA-N 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- IOVCWXUNBOPUCH-UHFFFAOYSA-M Nitrite anion Chemical compound [O-]N=O IOVCWXUNBOPUCH-UHFFFAOYSA-M 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 108010025568 Nucleophosmin Proteins 0.000 description 1
- 238000012879 PET imaging Methods 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical group [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 208000007452 Plasmacytoma Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 238000003477 Sonogashira cross-coupling reaction Methods 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 238000006619 Stille reaction Methods 0.000 description 1
- 238000006859 Swern oxidation reaction Methods 0.000 description 1
- ACWQBUSCFPJUPN-UHFFFAOYSA-N Tiglaldehyde Natural products CC=C(C)C=O ACWQBUSCFPJUPN-UHFFFAOYSA-N 0.000 description 1
- OKJPEAGHQZHRQV-UHFFFAOYSA-N Triiodomethane Natural products IC(I)I OKJPEAGHQZHRQV-UHFFFAOYSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000035508 accumulation Effects 0.000 description 1
- 238000005903 acid hydrolysis reaction Methods 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 150000001263 acyl chlorides Chemical class 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 208000015230 aggressive NK-cell leukemia Diseases 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 125000003172 aldehyde group Chemical group 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 150000001345 alkine derivatives Chemical class 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- 238000005576 amination reaction Methods 0.000 description 1
- 229940024606 amino acid Drugs 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 239000001099 ammonium carbonate Substances 0.000 description 1
- 235000019270 ammonium chloride Nutrition 0.000 description 1
- 239000000908 ammonium hydroxide Substances 0.000 description 1
- 150000003863 ammonium salts Chemical class 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 150000004982 aromatic amines Chemical class 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- 125000002618 bicyclic heterocycle group Chemical group 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 230000036983 biotransformation Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 125000001246 bromo group Chemical group Br* 0.000 description 1
- 125000004369 butenyl group Chemical group C(=CCC)* 0.000 description 1
- 150000003940 butylamines Chemical class 0.000 description 1
- 229910052792 caesium Inorganic materials 0.000 description 1
- TVFDJXOCXUVLDH-UHFFFAOYSA-N caesium atom Chemical compound [Cs] TVFDJXOCXUVLDH-UHFFFAOYSA-N 0.000 description 1
- 159000000007 calcium salts Chemical class 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 150000004657 carbamic acid derivatives Chemical class 0.000 description 1
- 150000001721 carbon Chemical group 0.000 description 1
- 229910002091 carbon monoxide Inorganic materials 0.000 description 1
- 238000005810 carbonylation reaction Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000005660 chlorination reaction Methods 0.000 description 1
- 125000001309 chloro group Chemical group Cl* 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 238000009096 combination chemotherapy Methods 0.000 description 1
- 229940126208 compound 22 Drugs 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- LSXDOTMGLUJQCM-UHFFFAOYSA-M copper(i) iodide Chemical compound I[Cu] LSXDOTMGLUJQCM-UHFFFAOYSA-M 0.000 description 1
- GBRBMTNGQBKBQE-UHFFFAOYSA-L copper;diiodide Chemical compound I[Cu]I GBRBMTNGQBKBQE-UHFFFAOYSA-L 0.000 description 1
- 238000006880 cross-coupling reaction Methods 0.000 description 1
- 238000011461 current therapy Methods 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 125000000753 cycloalkyl group Chemical group 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- GCUVBACNBHGZRS-UHFFFAOYSA-N cyclopenta-1,3-diene cyclopenta-2,4-dien-1-yl(diphenyl)phosphane iron(2+) Chemical compound [Fe++].c1cc[cH-]c1.c1cc[c-](c1)P(c1ccccc1)c1ccccc1 GCUVBACNBHGZRS-UHFFFAOYSA-N 0.000 description 1
- NXQGGXCHGDYOHB-UHFFFAOYSA-L cyclopenta-1,4-dien-1-yl(diphenyl)phosphane;dichloropalladium;iron(2+) Chemical compound [Fe+2].Cl[Pd]Cl.[CH-]1C=CC(P(C=2C=CC=CC=2)C=2C=CC=CC=2)=C1.[CH-]1C=CC(P(C=2C=CC=CC=2)C=2C=CC=CC=2)=C1 NXQGGXCHGDYOHB-UHFFFAOYSA-L 0.000 description 1
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000003493 decenyl group Chemical group [H]C([*])=C([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 239000002274 desiccant Substances 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 229910052805 deuterium Inorganic materials 0.000 description 1
- 238000002059 diagnostic imaging Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 125000000664 diazo group Chemical group [N-]=[N+]=[*] 0.000 description 1
- 238000006193 diazotization reaction Methods 0.000 description 1
- YNHIGQDRGKUECZ-UHFFFAOYSA-N dichloropalladium;triphenylphosphanium Chemical compound Cl[Pd]Cl.C1=CC=CC=C1[PH+](C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1[PH+](C=1C=CC=CC=1)C1=CC=CC=C1 YNHIGQDRGKUECZ-UHFFFAOYSA-N 0.000 description 1
- 125000001028 difluoromethyl group Chemical group [H]C(F)(F)* 0.000 description 1
- 150000004683 dihydrates Chemical class 0.000 description 1
- 229940043279 diisopropylamine Drugs 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- UXGNZZKBCMGWAZ-UHFFFAOYSA-N dimethylformamide dmf Chemical compound CN(C)C=O.CN(C)C=O UXGNZZKBCMGWAZ-UHFFFAOYSA-N 0.000 description 1
- 229910001873 dinitrogen Inorganic materials 0.000 description 1
- 229910001882 dioxygen Inorganic materials 0.000 description 1
- VDCSGNNYCFPWFK-UHFFFAOYSA-N diphenylsilane Chemical compound C=1C=CC=CC=1[SiH2]C1=CC=CC=C1 VDCSGNNYCFPWFK-UHFFFAOYSA-N 0.000 description 1
- JMVOCSLPMGHXPG-UHFFFAOYSA-N dipotassium;dioxido(dioxo)osmium Chemical compound [K+].[K+].[O-][Os]([O-])(=O)=O JMVOCSLPMGHXPG-UHFFFAOYSA-N 0.000 description 1
- DGODWNOPHMXOTR-UHFFFAOYSA-N dipotassium;dioxido(dioxo)osmium;dihydrate Chemical compound O.O.[K+].[K+].[O-][Os]([O-])(=O)=O DGODWNOPHMXOTR-UHFFFAOYSA-N 0.000 description 1
- WEHWNAOGRSTTBQ-UHFFFAOYSA-N dipropylamine Chemical compound CCCNCCC WEHWNAOGRSTTBQ-UHFFFAOYSA-N 0.000 description 1
- KPUWHANPEXNPJT-UHFFFAOYSA-N disiloxane Chemical compound [SiH3]O[SiH3] KPUWHANPEXNPJT-UHFFFAOYSA-N 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- UZZWBUYVTBPQIV-UHFFFAOYSA-N dme dimethoxyethane Chemical compound COCCOC.COCCOC UZZWBUYVTBPQIV-UHFFFAOYSA-N 0.000 description 1
- CETRZFQIITUQQL-UHFFFAOYSA-N dmso dimethylsulfoxide Chemical compound CS(C)=O.CS(C)=O CETRZFQIITUQQL-UHFFFAOYSA-N 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000010410 dusting Methods 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 150000002081 enamines Chemical class 0.000 description 1
- 238000003821 enantio-separation Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- LHWWETDBWVTKJO-UHFFFAOYSA-N et3n triethylamine Chemical compound CCN(CC)CC.CCN(CC)CC LHWWETDBWVTKJO-UHFFFAOYSA-N 0.000 description 1
- 125000005448 ethoxyethyl group Chemical group [H]C([H])([H])C([H])([H])OC([H])([H])C([H])([H])* 0.000 description 1
- FAMRKDQNMBBFBR-UHFFFAOYSA-N ethyl n-ethoxycarbonyliminocarbamate Chemical compound CCOC(=O)N=NC(=O)OCC FAMRKDQNMBBFBR-UHFFFAOYSA-N 0.000 description 1
- KCWYOFZQRFCIIE-UHFFFAOYSA-N ethylsilane Chemical compound CC[SiH3] KCWYOFZQRFCIIE-UHFFFAOYSA-N 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000011737 fluorine Chemical group 0.000 description 1
- 125000001153 fluoro group Chemical group F* 0.000 description 1
- UHCBBWUQDAVSMS-UHFFFAOYSA-N fluoroethane Chemical compound CCF UHCBBWUQDAVSMS-UHFFFAOYSA-N 0.000 description 1
- VUWZPRWSIVNGKG-UHFFFAOYSA-N fluoromethane Chemical compound F[CH2] VUWZPRWSIVNGKG-UHFFFAOYSA-N 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 239000012362 glacial acetic acid Substances 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- RJHLTVSLYWWTEF-UHFFFAOYSA-K gold trichloride Chemical compound Cl[Au](Cl)Cl RJHLTVSLYWWTEF-UHFFFAOYSA-K 0.000 description 1
- 239000003979 granulating agent Substances 0.000 description 1
- 150000004795 grignard reagents Chemical class 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 125000000262 haloalkenyl group Chemical group 0.000 description 1
- 206010066957 hepatosplenic T-cell lymphoma Diseases 0.000 description 1
- 125000006342 heptafluoro i-propyl group Chemical group FC(F)(F)C(F)(*)C(F)(F)F 0.000 description 1
- 125000005842 heteroatom Chemical group 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- VHHHONWQHHHLTI-UHFFFAOYSA-N hexachloroethane Chemical compound ClC(Cl)(Cl)C(Cl)(Cl)Cl VHHHONWQHHHLTI-UHFFFAOYSA-N 0.000 description 1
- 125000006038 hexenyl group Chemical group 0.000 description 1
- XGIHQYAWBCFNPY-AZOCGYLKSA-N hydrabamine Chemical class C([C@@H]12)CC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC[C@@]1(C)CNCCNC[C@@]1(C)[C@@H]2CCC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC1 XGIHQYAWBCFNPY-AZOCGYLKSA-N 0.000 description 1
- LURQBQNWDYASPJ-UHFFFAOYSA-N hydrazinyl Chemical compound N[NH] LURQBQNWDYASPJ-UHFFFAOYSA-N 0.000 description 1
- 150000002430 hydrocarbons Chemical group 0.000 description 1
- IXCSERBJSXMMFS-UHFFFAOYSA-N hydrogen chloride Substances Cl.Cl IXCSERBJSXMMFS-UHFFFAOYSA-N 0.000 description 1
- 229910000041 hydrogen chloride Inorganic materials 0.000 description 1
- IKGLACJFEHSFNN-UHFFFAOYSA-N hydron;triethylazanium;trifluoride Chemical compound F.F.F.CCN(CC)CC IKGLACJFEHSFNN-UHFFFAOYSA-N 0.000 description 1
- 125000004356 hydroxy functional group Chemical group O* 0.000 description 1
- XYFPWWZEPKGCCK-GOSISDBHSA-N ibrutinib Chemical compound C1=2C(N)=NC=NC=2N([C@H]2CN(CCC2)C(=O)C=C)N=C1C(C=C1)=CC=C1OC1=CC=CC=C1 XYFPWWZEPKGCCK-GOSISDBHSA-N 0.000 description 1
- 229960001507 ibrutinib Drugs 0.000 description 1
- 125000002883 imidazolyl group Chemical group 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical group II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 1
- 125000002346 iodo group Chemical group I* 0.000 description 1
- HVTICUPFWKNHNG-UHFFFAOYSA-N iodoethane Chemical compound CCI HVTICUPFWKNHNG-UHFFFAOYSA-N 0.000 description 1
- INQOMBQAUSQDDS-UHFFFAOYSA-N iodomethane Chemical compound IC INQOMBQAUSQDDS-UHFFFAOYSA-N 0.000 description 1
- 239000003456 ion exchange resin Substances 0.000 description 1
- 229920003303 ion-exchange polymer Polymers 0.000 description 1
- SYJRVVFAAIUVDH-UHFFFAOYSA-N ipa isopropanol Chemical compound CC(C)O.CC(C)O SYJRVVFAAIUVDH-UHFFFAOYSA-N 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- ODBLHEXUDAPZAU-UHFFFAOYSA-N isocitric acid Chemical compound OC(=O)C(O)C(C(O)=O)CC(O)=O ODBLHEXUDAPZAU-UHFFFAOYSA-N 0.000 description 1
- 239000012948 isocyanate Substances 0.000 description 1
- 150000002513 isocyanates Chemical class 0.000 description 1
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 1
- 229940057995 liquid paraffin Drugs 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000003738 lymphoid progenitor cell Anatomy 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- BCVXHSPFUWZLGQ-UHFFFAOYSA-N mecn acetonitrile Chemical compound CC#N.CC#N BCVXHSPFUWZLGQ-UHFFFAOYSA-N 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 239000012046 mixed solvent Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 206010028537 myelofibrosis Diseases 0.000 description 1
- PSHKMPUSSFXUIA-UHFFFAOYSA-N n,n-dimethylpyridin-2-amine Chemical compound CN(C)C1=CC=CC=N1 PSHKMPUSSFXUIA-UHFFFAOYSA-N 0.000 description 1
- PEECTLLHENGOKU-UHFFFAOYSA-N n,n-dimethylpyridin-4-amine Chemical compound CN(C)C1=CC=NC=C1.CN(C)C1=CC=NC=C1 PEECTLLHENGOKU-UHFFFAOYSA-N 0.000 description 1
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 1
- 125000000740 n-pentyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 1
- 229910000069 nitrogen hydride Inorganic materials 0.000 description 1
- 125000005187 nonenyl group Chemical group C(=CCCCCCCC)* 0.000 description 1
- VIKNJXKGJWUCNN-XGXHKTLJSA-N norethisterone Chemical compound O=C1CC[C@@H]2[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 VIKNJXKGJWUCNN-XGXHKTLJSA-N 0.000 description 1
- 101150083701 npm1 gene Proteins 0.000 description 1
- 238000007339 nucleophilic aromatic substitution reaction Methods 0.000 description 1
- 125000004365 octenyl group Chemical group C(=CCCCCCC)* 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 125000001181 organosilyl group Chemical group [SiH3]* 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 238000005949 ozonolysis reaction Methods 0.000 description 1
- PIBWKRNGBLPSSY-UHFFFAOYSA-L palladium(II) chloride Chemical compound Cl[Pd]Cl PIBWKRNGBLPSSY-UHFFFAOYSA-L 0.000 description 1
- QJPQVXSHYBGQGM-UHFFFAOYSA-N palladium;triphenylphosphane Chemical compound [Pd].C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 QJPQVXSHYBGQGM-UHFFFAOYSA-N 0.000 description 1
- UQPUONNXJVWHRM-UHFFFAOYSA-N palladium;triphenylphosphane Chemical compound [Pd].C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 UQPUONNXJVWHRM-UHFFFAOYSA-N 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 235000019371 penicillin G benzathine Nutrition 0.000 description 1
- 125000002255 pentenyl group Chemical group C(=CCCC)* 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 125000004437 phosphorous atom Chemical group 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000011574 phosphorus Chemical group 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- LJCNRYVRMXRIQR-OLXYHTOASA-L potassium sodium L-tartrate Chemical compound [Na+].[K+].[O-]C(=O)[C@H](O)[C@@H](O)C([O-])=O LJCNRYVRMXRIQR-OLXYHTOASA-L 0.000 description 1
- 229940074439 potassium sodium tartrate Drugs 0.000 description 1
- 230000036515 potency Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 208000003476 primary myelofibrosis Diseases 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 125000004368 propenyl group Chemical group C(=CC)* 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 239000003586 protic polar solvent Substances 0.000 description 1
- 125000003373 pyrazinyl group Chemical group 0.000 description 1
- 125000003226 pyrazolyl group Chemical group 0.000 description 1
- 125000002098 pyridazinyl group Chemical group 0.000 description 1
- 125000004076 pyridyl group Chemical group 0.000 description 1
- INTJZENRAYCATA-UHFFFAOYSA-N pyrrol-3-one Chemical compound O=C1C=CN=C1 INTJZENRAYCATA-UHFFFAOYSA-N 0.000 description 1
- SBYHFKPVCBCYGV-UHFFFAOYSA-N quinuclidine Chemical compound C1CC2CCN1CC2 SBYHFKPVCBCYGV-UHFFFAOYSA-N 0.000 description 1
- 229910052705 radium Inorganic materials 0.000 description 1
- 238000006268 reductive amination reaction Methods 0.000 description 1
- 238000006049 ring expansion reaction Methods 0.000 description 1
- 238000009118 salvage therapy Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 229910000108 silver(I,III) oxide Inorganic materials 0.000 description 1
- WRIKHQLVHPKCJU-UHFFFAOYSA-N sodium bis(trimethylsilyl)amide Chemical compound C[Si](C)(C)N([Na])[Si](C)(C)C WRIKHQLVHPKCJU-UHFFFAOYSA-N 0.000 description 1
- 235000011006 sodium potassium tartrate Nutrition 0.000 description 1
- WGRULTCAYDOGQK-UHFFFAOYSA-M sodium;sodium;hydroxide Chemical compound [OH-].[Na].[Na+] WGRULTCAYDOGQK-UHFFFAOYSA-M 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 206010062113 splenic marginal zone lymphoma Diseases 0.000 description 1
- 238000011255 standard chemotherapy Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000000707 stereoselective effect Effects 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 125000003107 substituted aryl group Chemical group 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 229960005137 succinic acid Drugs 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 125000000472 sulfonyl group Chemical group *S(*)(=O)=O 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 238000011361 targeted radionuclide therapy Methods 0.000 description 1
- GCRNGPNGNJSZCC-UHFFFAOYSA-N tert-butyl 3-amino-3a,4,6,6a-tetrahydro-1h-pyrrolo[3,4-c]pyrazole-5-carboxylate Chemical compound N1N=C(N)C2CN(C(=O)OC(C)(C)C)CC21 GCRNGPNGNJSZCC-UHFFFAOYSA-N 0.000 description 1
- ICVRQBVDCWVKQV-UHFFFAOYSA-N tert-butyl-[2-(2-chloro-3-nitrophenoxy)ethoxy]-diphenylsilane Chemical compound C(C)(C)(C)[Si](C1=CC=CC=C1)(C1=CC=CC=C1)OCCOC1=C(C(=CC=C1)[N+](=O)[O-])Cl ICVRQBVDCWVKQV-UHFFFAOYSA-N 0.000 description 1
- MHYGQXWCZAYSLJ-UHFFFAOYSA-N tert-butyl-chloro-diphenylsilane Chemical compound C=1C=CC=CC=1[Si](Cl)(C(C)(C)C)C1=CC=CC=C1 MHYGQXWCZAYSLJ-UHFFFAOYSA-N 0.000 description 1
- 150000003510 tertiary aliphatic amines Chemical class 0.000 description 1
- 125000006337 tetrafluoro ethyl group Chemical group 0.000 description 1
- PHCBRBWANGJMHS-UHFFFAOYSA-J tetrasodium;disulfate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O PHCBRBWANGJMHS-UHFFFAOYSA-J 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000003354 tissue distribution assay Methods 0.000 description 1
- XJDNKRIXUMDJCW-UHFFFAOYSA-J titanium tetrachloride Chemical compound Cl[Ti](Cl)(Cl)Cl XJDNKRIXUMDJCW-UHFFFAOYSA-J 0.000 description 1
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 1
- 125000004306 triazinyl group Chemical group 0.000 description 1
- 230000004102 tricarboxylic acid cycle Effects 0.000 description 1
- FAQYAMRNWDIXMY-UHFFFAOYSA-N trichloroborane Chemical compound ClB(Cl)Cl FAQYAMRNWDIXMY-UHFFFAOYSA-N 0.000 description 1
- AQRLNPVMDITEJU-UHFFFAOYSA-N triethylsilane Substances CC[SiH](CC)CC AQRLNPVMDITEJU-UHFFFAOYSA-N 0.000 description 1
- 125000004205 trifluoroethyl group Chemical group [H]C([H])(*)C(F)(F)F 0.000 description 1
- CWMFRHBXRUITQE-UHFFFAOYSA-N trimethylsilylacetylene Chemical compound C[Si](C)(C)C#C CWMFRHBXRUITQE-UHFFFAOYSA-N 0.000 description 1
- MHNHYTDAOYJUEZ-UHFFFAOYSA-N triphenylphosphane Chemical compound C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 MHNHYTDAOYJUEZ-UHFFFAOYSA-N 0.000 description 1
- RIOQSEWOXXDEQQ-UHFFFAOYSA-O triphenylphosphanium Chemical compound C1=CC=CC=C1[PH+](C=1C=CC=CC=1)C1=CC=CC=C1 RIOQSEWOXXDEQQ-UHFFFAOYSA-O 0.000 description 1
- YFTHZRPMJXBUME-UHFFFAOYSA-N tripropylamine Chemical compound CCCN(CCC)CCC YFTHZRPMJXBUME-UHFFFAOYSA-N 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/53—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with three nitrogens as the only ring hetero atoms, e.g. chlorazanil, melamine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/63—Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide
- A61K31/635—Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide having a heterocyclic ring, e.g. sulfadiazine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
- A61K31/7052—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
- A61K31/706—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Chemical & Material Sciences (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Molecular Biology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Disclosed are combinations comprising a therapeutically effective amount of a menin-MLL inhibitor of Formula (I) or a pharmaceutically acceptable salt or a solvate thereof; and a therapeutically effective amount of a BCL-2 inhibitor; and optionally, a therapeutically effective amount of at least one other antineoplastic agent. Also disclosed are methods for treating a subject who has been diagnosed with a hematopoietic disorder using such combinations. Compounds are represented by Formula (I) as follows: wherein R 1a, R 1b, R 2, R 3, R 4, U, Y 1, X 1, X 2, n1, n2, n3 and n4 are defined herein.
Description
COMBINATION THERAPIES
FIELD OF THE INVENTION
[0001] The present invention relates to novel combinations comprising a therapeutically effective amount of a menin-mixed-lineage leukemia 1 (menin-MLL) inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof; and a therapeutically effective amount of a B-cell lymphoma 2 (BCL-2) inhibitor; and optionally, a therapeutically effective amount of at least one other antineoplastic agent; as well as to methods for treating a subject who has been diagnosed with a hematopoietic disorder.
BACKGROUND OF THE INVENTION
FIELD OF THE INVENTION
[0001] The present invention relates to novel combinations comprising a therapeutically effective amount of a menin-mixed-lineage leukemia 1 (menin-MLL) inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof; and a therapeutically effective amount of a B-cell lymphoma 2 (BCL-2) inhibitor; and optionally, a therapeutically effective amount of at least one other antineoplastic agent; as well as to methods for treating a subject who has been diagnosed with a hematopoietic disorder.
BACKGROUND OF THE INVENTION
[0002] Of the 10 million cancer deaths recorded by GLOBOCAN in 2020, 7.1% are attributed to hematopoietic disorders. Accordingly, new treatment modalities are urgently needed for hematopoietic disorders, including acute myeloid leukemia (AML), myelodysplastic syndrome (MDS) and acute lymphoblastic leukemia (ALL) as further detailed below.
[0003] AML is a common hematological malignancy whose incidence rises from 3:100,000 in young adults to greater than 20:100,000 in older adults. For patients <60 years of age, overall survival (OS) is 40 to 50%, but is only 5% for patients >60 years of age. The majority of newly diagnosed patients with AML are over the age of 60. In this patient population, standard induction chemotherapy is often not an option due to increased treatment-related mortality as a result of age and co-morbidities. Standard of care for AML patients unfit for combination chemotherapy is treatment with hypomethylating agents (azacitidine or decitabine) or low dose cytarabine. Despite these frontline treatments, median OS is only about 10 months. In all types of AML, disease relapse is common despite an initial therapeutic response and is the most common reason for death. Standard chemotherapy and allogeneic stem cell transplant (when used) often fail to eradicate all tumor-propagating cells and select for chemotherapy-resistant leukemia-propagating subclones. Patients refractory to salvage therapy are treated palliatively, as current treatment options are extremely limited. These patients have a median survival of 2 months. In addition, patients with newly diagnosed intermediate or higher-risk MDS and those who relapse after standard care have a poor prognosis and high risk of progression to AN/It.
Therefore, there is an urgent need for new treatment modalities for relapsed/refractory (R/R) AML and MDS patients, newly diagnosed AML patients ineligible for induction chemotherapy based on age and co-morbidities, and newly diagnosed intermediate/high/very high risk MDS
patients.
Therefore, there is an urgent need for new treatment modalities for relapsed/refractory (R/R) AML and MDS patients, newly diagnosed AML patients ineligible for induction chemotherapy based on age and co-morbidities, and newly diagnosed intermediate/high/very high risk MDS
patients.
[0004] ALL is a hematologic malignancy propagated by impaired differentiation, proliferation, and accumulation of lymphoid progenitor cells in the bone marrow and/or extramedullary sites.
ALL represents 12% of all leukemia cases and is the most common childhood acute leukemia, with a worldwide incidence projected to be 1 to 4.75 per 100,000 people. ALL
represents about 20% of adult leukemias. Despite high rates of complete remission (CR) (80% to 90%) with current therapies, the majority of adult patients with ALL relapse. The 5-year overall survival rate is approximately 30 to 40% in adults and elderly patients. Therefore, there is an urgent need for new treatment modalities for relapsed/refractory ALL particularly in adult and especially elderly patients.
SUMMARY OF THE INVENTION
ALL represents 12% of all leukemia cases and is the most common childhood acute leukemia, with a worldwide incidence projected to be 1 to 4.75 per 100,000 people. ALL
represents about 20% of adult leukemias. Despite high rates of complete remission (CR) (80% to 90%) with current therapies, the majority of adult patients with ALL relapse. The 5-year overall survival rate is approximately 30 to 40% in adults and elderly patients. Therefore, there is an urgent need for new treatment modalities for relapsed/refractory ALL particularly in adult and especially elderly patients.
SUMMARY OF THE INVENTION
[0005] Embodiments of the present invention relate to novel combinations of a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof; and a BCL-2 inhibitor; and optionally, at least one other antineoplastic agent.
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof; and a BCL-2 inhibitor; and optionally, at least one other antineoplastic agent.
[0006] Embodiments of the present invention relate to uses of such combinations for treating a subject who has been diagnosed with a hematopoietic disorder, including but not limited to, blood cancers, using a menin-MLL inhibitor described herein in combination with a BCL-2 inhibitor; and optionally, at least one other antineoplastic agent.
[0007] Embodiments of the present invention relate to novel methods for treating a subject who has been diagnosed with a hematopoietic disorder using such combinations.
Embodiments of the novel methods comprise administering to the subject a therapeutically effective amount of a menin-MLL inhibitor as described herein; and a therapeutically effective amount of a BCL-2 inhibitor; and optionally, a therapeutically effective amount of at least one other antineoplastic agent; wherein the menin-MLL inhibitor is a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof.
Embodiments of the novel methods comprise administering to the subject a therapeutically effective amount of a menin-MLL inhibitor as described herein; and a therapeutically effective amount of a BCL-2 inhibitor; and optionally, a therapeutically effective amount of at least one other antineoplastic agent; wherein the menin-MLL inhibitor is a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof.
[0008] Embodiments of the present invention relate to novel methods for treating a subject who has been diagnosed with a hematopoietic disorder using such combinations.
Embodiments of the novel methods comprise administering to the subject a therapeutically effective amount of a menin-MLL inhibitor as described herein; and a therapeutically effective amount of a BCL-2 inhibitor, and a therapeutically effective amount of at least one other antineoplastic agent;
wherein the menin-MLL inhibitor is a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof
Embodiments of the novel methods comprise administering to the subject a therapeutically effective amount of a menin-MLL inhibitor as described herein; and a therapeutically effective amount of a BCL-2 inhibitor, and a therapeutically effective amount of at least one other antineoplastic agent;
wherein the menin-MLL inhibitor is a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof
[0009] In some embodiments, the present invention is directed to methods for treating a subject who has been diagnosed with a hematopoietic disorder, the methods comprising administering to the subject a therapeutically effective amount of a menin-MLL inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, and a therapeutically effective amount of venetoclax, or a pharmaceutically acceptable salt or solvate thereof; and a therapeutically effective amount of azacitidine or a pharmaceutically acceptable salt or solvate thereof.
100101 In some embodiments, the present invention is directed to methods for treating a subject who has been diagnosed with a hematopoietic disorder, the methods comprising administering to the subject a therapeutically effective amount of a menin-MLL inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof; a therapeutically effective amount of venetoclax, or a pharmaceutically acceptable salt or solvate thereof; and a therapeutically effective amount of azacitidine or a pharmaceutically acceptable salt or solvate thereof; wherein the venetoclax, or a pharmaceutically acceptable salt or solvate thereof, is administered to the subject prior to, simultaneous with, or after the administration of the menin-MLL inhibitor; and wherein the azacitidine, or a pharmaceutically acceptable salt or solvate thereof, is administered to the subject prior to, simultaneous with, or after the administration of the menin-MLL
inhibitor.
100111 In embodiments, the menin-MLL inhibitor of Formula (1) is:
X
X
n3(X )n4 n1( )n2 Ri a (I) Yu Rib 1011 and the tautomers and the stereoisomeric forms thereof, wherein xa R
xb Rla represents -C(=0)- xNR aRxb; Het; or NR
Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety;
wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalkyl and C1_4alkyl;
IV and IVb are each independently selected from the group consisting of hydrogen, Ci-4alkyl and C3_6cycloalkyl;
Rib represents F or Cl;
Y' represents -CR5aR5b-, -0- or R2 is selected from the group consisting of hydrogen, halo, CI-alkyl, -0-Ci-4alkyl, and -NR7aR7b;
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
Xl represents CH, and X2 represents N;
R4 represents isopropyl;
R5a, R5b, R5c, R7a, and km, are each independently selected from the group consisting of hydrogen, C1_4a1ky1 and C3_6cycloalkyl;
R3 represents -C3_6alkyl_NR8aR8b, -c _6 al kyl -C (=0)-NR9aR9b, -C _6 al kyl-OH, or 6alkyl-NR11-C(=0)-0-Ch4alky1-0-C(=0)-Ci_4a1ky1; wherein each of the CI-alkyl or C16alky1 moieties in the R3 definitions independently of each other may be substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C14alkyl;
Rsa and leb are each independently selected from the group consisting of hydrogen; C1-6alkyl; -C(=0)-Ci_4alky1; -C(=0)-0-C3_4alky1; -C(=0)-NR12aRl2b; and C3_6a1kyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S (=0)2-C 3_4alkyl, -0-C 3_4a1ky1, -C(=0)-NR10aRlOb, and _NRioc_c(=o)_c 1_ 4alkyl; and R9a, R9b, Rtoa, Riob, Rioc, R12a, and R' are each independently selected from the group consisting of hydrogen and C3_6alky1;
and the pharmaceutically acceptable salts and the solvates thereof.
[0012] In particular embodiments, the menin-NILL inhibitor of Formula (I) is (R)-N-ethyl--fluoro-N-i sopropy1-245-(2-(64(2-methoxyethyl)(methypamino)-2-methylhexan-3 -y1)-2, 6-diazaspiro [3 .4] octan-6-y1)- 1, 2,4-tri azin-6 -yl)oxy)b enzami de besylate salt (benzenesulfonate salt):
/N \-0/
rNR-re-j besylate salt and solvates thereof.
[0013] A skilled person will understand that the 'and solvates thereof' refer to the besylate salt of (R)-N-ethyl-5 -fluoro-N-i sopropy1-2-((5 -(2-(6-((2-m ethoxy ethyl)(m ethyl)ami no)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3 .4]octan-6-y1)-1 ,2,4-tri azin-6-yl)oxy)b enzami de.
[0014] In particular embodiments, the menin-MLL inhibitor of Formula (I) is (R)-N-ethyl--fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide besylate salt or hydrates thereof.
[0015] In particular embodiments, the menin-MLL inhibitor of Formula (I) is (R)-N-ethyl-5 -fluoro-N-i sop ropy1-2-((5 -(2-(6-((2-m ethoxy ethyl)(m ethyl)ami no)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt or solvates thereof.
[0016] In particular embodiments, the menin-MLL inhibitor of Formula (I) is (R)-N-ethyl-5 -fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt or hydrates thereof.
[0017] In particular the present invention is directed to (R)-N-ethy1-5-fluoro-N-isopropyl-2-45 -(2-(6-((2-methoxyethyl)(m ethyl)amino)-2-m ethylhexan-3 -y1)-2,6-diazaspiro[3 .4] octan-6-y1)4,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt 0.5-2.0 equivalents hydrate.
[0018] In particular the present invention is directed to (R)-N-ethy1-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3 . octan-6-y1)4,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt 2.0 equivalents hydrate.
[0019] In particular embodiments, the menin-MLL inhibitor of Formula (I) is a crystalline form A of (R)-N-ethyl -5-fl uoro-N-i sopropy1-2-((5-(2-(6-42-m ethoxyethyl )(m ethyl ami n o)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3 . 4-]octan-6-y1)-1,2,4-tri azin-6-yl)oxy)b enzami de bis-besylate salt hydrate.
[0020] In particular embodiments, the menin-MLL inhibitor of Formula (I) is a crystalline form A of (R)-N-ethyl-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3 4]octan-6-y1)-1,2,4-tri azin-6-yl)oxy)b enzami de bis-besylate salt 0.5-2.0 equivalents hydrate.
[0021] More in particular the present invention is directed to a crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-245-(2-(6-((2-methoxyethyl)(methyl)amino)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3 .4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt 2.0 equivalents hydrate.
[0022] Additional embodiments, features, and advantages of the invention will be apparent from the following detailed description and through practice of the invention.
BRIEF DESCRIPTION OF THE DRAWINGS
[0023] FIG. 1 is an X-ray powder diffraction (XRPD) pattern of Compound A4: a crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2 -m ethyl hexan-3 -y1)-2, 6 -di azaspiro [3 .4] octan-6 -y1)-1,2, 4 -tri azi n-6 -yl)oxy)b enzami de bis-besylate salt hydrate.
[0024] FIG. 2 depicts a comparison of tumor volumes as a function of time for the control group and for the treatment groups treated with a regimen comprising various amounts of Compound A3.
[0025] FIG. 3 depicts a comparison of tumor percent survival as a function of time (e.g., Kaplan-Meier survival curves) for the control group and for the treatment groups treated with a regimen comprising various amounts of Compound A3.
[0026] FIG. 4A depicts a comparison of percent survival as a function of time of mice bearing established OCI-AML3 tumors following treatment with vehicle, monotherapy with either venetoclax, azacitidine or Compound Al, the doublet combination of either venetoclax and azacitidine, or Compound Al and venetoclax, or the triplet combination of Compound Al, venetoclax and azacitidine.
[0027] FIG. 4B depicts a comparison of percent survival as a function of time of mice bearing established MOLM-13 tumors following treatment with vehicle, monotherapy with either venetoclax, azacitidine or Compound Al, the doublet combination of either venetoclax and azacitidine, or Compound Al and venetoclax, or the triplet combination of Compound Al, venetoclax and azacitidine.
[0028] FIG. 5A is a contour plot for maxR which illustrates the effect of Compound A3 in combination with venetoclax on proliferation of MOT ,M- I 3 cells in vitro [0029] FIG. 5B is a contour plot for maxR which illustrates the effect of Compound A3 in combination with azacitidine and venetoclax on proliferation of MOLM-13 cells in vitro.
[0030] FIG. 6A is a contour plot for maxR which illustrates the effect of Compound A4 in combination with decitabine on proliferation of MOLM-13 cells in vitro.
[0031] FIG. 6B is a contour plot for maxR which illustrates the effect of Compound A4 in combination with decitabine and venetoclax on proliferation of MOLM-13 cells in vitro.
[0032] FIG. 7A is a contour plot for maxR which illustrates the effect of Compound A4 in combination with decitabine on proliferation of OCI-AML3 cells in vitro.
[0033] FIG. 7B is a contour plot for maxR which illustrates the effect of Compound A4 in combination with decitabine and venetoclax on proliferation of OCI-AML3 cells in vitro.
DESCRIPTION OF THE INVENTION
[0034] The term 'halo' or 'halogen' as used herein represents fluoro, chloro, bromo and iodo.
[0035] The prefix (where x and y are integers) as used herein refers to the number of carbon atoms in a given group. Thus, a Ci_6alkyl group contains from 1 to 6 carbon atoms, and so on.
[0036] The term `C1_4alkyr as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 1 to 4 carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, s-butyl, t-butyl and the like.
[0037] Similar, the term 'C1_6alkyl' as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 1 to 6 carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, s-butyl, t-butyl, n-pentyl, n-hexyl and the like [0038] The term C3_6cycloalkyr as used herein as a group or part of a group defines a saturated, cyclic hydrocarbon radical having from 3 to 6 carbon atoms, such as cyclopropyl, cyclobutyl, cyclopentyl and cyclohexyl.
[0039] It will be clear for the skilled person that S(=0)2 or SO2 represents a sulfonyl moiety.
[0040] It will be clear for the skilled person that CO or C(=0) represents a carbonyl moiety.
[0041] It will be clear for the skilled person that a group such as -CRR-represents R R
[0042] ¨C¨
. An example of such a group is -CR5aR5b-.
[0043] It will be clear for the skilled person that a group such as -NR-represents -N-. An example of such a group is -N12-10044] Non-limiting examples of monocyclic 5-or 6-membered aromatic rings containing one, two or three nitrogen atoms and optionally a carbonyl moiety', include, but are not limited to pyrazolyl, imidazolyl, pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl, triazinyl or 1,2-dihydro-2-oxo-4-pyridinyl.
[0045] The skilled person will understand that a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and a carbonyl moiety includes, but is not limited to H
,and [0046] When any variable occurs mole than one time in any constituent, each definition is independent.
[0047] When any variable occurs more than one time in any formula (e.g., Formula (I)), each definition is independent.
[0048] In general, whenever the term 'substituted' is used in the present invention, it is meant, unless otherwise indicated or clear from the context, to indicate that one or more hydrogens, in particular from 1 to 4 hydrogens, more in particular from 1 to 3 hydrogens, preferably 1 or 2 hydrogens, more preferably 1 hydrogen, on the atom or radical indicated in the expression using 'substituted' are replaced with a selection from the indicated group, provided that the normal valency is not exceeded, and that the substitution results in a chemically stable compound, i.e., a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture (isolation after a reaction e g , purification by silica gel chromatography) In a particular embodiment, when the number of sub stituents is not explicitly specified, the number of substituents is one [0049] Combinations of substituents and/or variables are permissible only if such combinations result in chemically stable compounds. 'Stable compound' is in this context meant to indicate a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture (isolation after a reaction e.g., purification by silica gel chromatography).
[0050] The skilled person will understand that the term 'optionally substituted' means that the atom or radical indicated in the expression using 'optionally substituted' may or may not be substituted (this means substituted or unsubstituted respectively).
[0051] When two or more substituents are present on a moiety they may, where possible and unless otherwise indicated or clear from the context, replace hydrogens on the same atom or they may replace hydrogen atoms on different atoms in the moiety.
[0052] Within the context of this invention 'saturated' means 'fully saturated', if not otherwise specified.
[0053] Unless otherwise specified or clear from the context, aromatic rings groups, can be attached to the remainder of the molecule of Formula (1) through any available ring carbon atom (C-linked) or nitrogen atom (N-linked).
[0054] Unless otherwise specified or clear from the context, aromatic rings groups, may optionally be substituted, where possible, on carbon and/or nitrogen atoms according to the embodiments.
[0055] The term "comprising" as used herein, encompasses the terms "consisting of" and "consisting essentially of." All embodiments described herein using the term "comprising" are also applicable for embodiments of the invention wherein the term "comprising"
is limited to "consisting of." Likewise, all embodiments described herein using the term"
comprising" are also applicable for embodiments of the invention wherein the term "comprising"
is limited to "consisting essentially of."
[0056] The term "subject" as used herein, refers to an animal, preferably a mammal (e.g., cat, dog, primate or human), more preferably a human, who is or has been the object of treatment, observation or experiment [0057] The term "therapeutically effective amount" as used herein, means that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human that is being sought by a researcher, veterinarian, medicinal doctor or other clinician, which includes alleviation or reversal of the symptoms of the disease or disorder being treated.
[0058] The term "composition" is intended to encompass a product including the specified ingredients in the specified amounts, as well as any product which results, directly or indirectly, from combinations of the specified ingredients in the specified amounts.
[0059] The terms "treatment" and "treating," as used herein, are intended to refer to all processes wherein there may be a slowing, interrupting, arresting or stopping of the progression of a disorder, or amelioration of one or more symptoms thereof, but does not necessarily indicate a total elimination of all symptoms [0060] As used herein, any chemical formula with bonds shown only as solid lines and not as solid wedged or hashed wedged bonds, or otherwise indicated as having a particular configuration (e.g., R, S) around one or more atoms, contemplates each possible stereoisomer, or mixture of two or more stereoisomers.
[0061] Hereinbefore and hereinafter, the term "compound(s) of Formula (I)" is meant to include the tautomers thereof and the stereoisomeric forms thereof.
[0062] Hereinbefore and hereinafter, the term "compound(s) of Formula (Z)" is meant to include the tautomers thereof and the stereoisomeric forms thereof.
[0063] The terms "stereoisomers", "stereoisomeric forms" or "stereochemically isomeric forms"
hereinbefore or hereinafter are used interchangeably.
[0064] The invention includes all stereoisomers of the compounds of the invention either as a pure stereoisomer or as a mixture of two or more stereoisomers.
[0065] Enantiomers are stereoisomers that are non-superimposable mirror images of each other.
A 1:1 mixture of a pair of enantiomers is a racemate or racemic mixture.
[0066] Atropisomers (or atropoisomers) are stereoisomers which have a particular spatial configuration, resulting from a restricted rotation about a single bond, due to large steric hindrance. All atropisomeric forms of the compounds of Formula (I) are intended to be included within the scope of the present invention.
[0067] Diastereomers (or diastereoisomers) are stereoisomers that are not enantiomers, i.e., they are not related as mirror images. If a compound contains a double bond, the substituents may be in the E or the Z configuration.
[0068] Substituents on bivalent cyclic saturated or partially saturated radicals may have either the cis- or trans-configuration; for example, if a compound contains a disubstituted cycloalkyl group, the substituents may be in the cis or trans configuration.
[0069] Therefore, the invention includes enantiomers, atropisomers, diastereomers, racemates, E isomers, Z isomers, cis isomers, trans isomers and mixtures thereof, whenever chemically possible.
[0070] The meaning of all those terms, i.e., enantiomers, atropisomers, diastereomers, racemates, E isomers, Z isomers, cis isomers, trans isomers and mixtures thereof are known to the skilled person.
[0071] The absolute configuration is specified according to the Cahn-Ingold-Prelog system.
The configuration at an asymmetric atom is specified by either R or S.
Resolved stereoisomers whose absolute configuration is not known can be designated by (+) or (-) depending on the direction in which they rotate plane polarized light. For instance, resolved enantiomers whose absolute configuration is not known can be designated by (+) or (-) depending on the direction in which they rotate plane polarized light.
[0072] When a specific stereoisomer is identified, this means that said stereoisomer is substantially free, i.e., associated with less than 50%, preferably less than 20%, more preferably less than 10%, even more preferably less than 5%, in particular less than 2%
and most preferably less than 1%, of the other stereoisomers. Thus, when a compound of Formula (I) is for instance specified as (R), this means that the compound is substantially free of the (S) isomer;
when a compound of Formula (I) is for instance specified as E, this means that the compound is substantially free of the Z isomer; when a compound of Formula (I) is for instance specified as cis, this means that the compound is substantially free of the trans isomer.
[0073] Some of the compounds according to Formula (I) may also exist in their tautomeric form. Such forms in so far as they may exist, although not explicitly indicated in the above Formula (I) are intended to be included within the scope of the present invention. It follows that a single compound may exist in both stereoisomeric and tautomeric form.
[0074] Pharmaceutically acceptable salts include acid addition salts and base addition salts.
Such salts may be formed by conventional means, for example by reaction of a free acid or a free base form with one or more equivalents of an appropriate base or acid, optionally in a solvent, or in a medium in which the salt is insoluble, followed by removal of said solvent, or said medium, using standard techniques (e.g., in vacno, by freeze-drying or by filtration) Salts may also be prepared by exchanging a counter-ion of a compound of the invention in the form of a salt with another counter-ion, for example using a suitable ion exchange resin.
[0075] The pharmaceutically acceptable salts as mentioned hereinabove or hereinafter are meant to comprise the therapeutically active non-toxic acid and base salt forms which the compounds of Formula (I) and solvates thereof, are able to form [0076] Appropriate acids comprise, for example, inorganic acids such as hydrohalic acids, e.g., hydrochloric or hydrobromic acid, sulfuric, nitric, phosphoric and the like acids; or organic acids such as, for example, acetic, propanoic, hydroxyacetic, lactic, pyruvic, oxalic (i.e., ethanedioic), malonic, succinic (i.e., butanedioic acid), maleic, fumaric, malic, tartaric, citric, methanesulfonic, ethanesulfonic, benzenesulfonic, p-toluenesulfonic, cyclamic, salicylic, p-aminosalicylic, pamoic and the like acids. Conversely said salt forms can be converted by treatment with an appropriate base into the free base form.
[0077] The compounds of Formula (I) and solvates thereof containing an acidic proton may also be converted into their non-toxic metal or amine salt forms by treatment with appropriate organic and inorganic bases.
[0078] Appropriate base salt forms comprise, for example, the ammonium salts, the alkali and earth alkaline metal salts, e.g., the lithium, sodium, potassium, cesium, magnesium, calcium salts and the like, salts with organic bases, e.g., primary, secondary and tertiary aliphatic and aromatic amines such as methylamine, ethylamine, propylamine, isopropylamine, the four butylamine isomers, dimethylamine, diethylamine, diethanolamine, dipropylamine, diisopropylamine, di-n-butylamine, pyrrolidine, piperidine, morpholine, trimethylamine, triethylamine, tripropylamine, quinuclidine, pyridine, quinoline and isoquinoline; the benzathine, N-methyl-D-glucamine, hydrabamine salts, and salts with amino acids such as, for example, arginine, lysine and the like. Conversely the salt form can be converted by treatment with acid into the free acid form.
[0079] The term "prodrug" includes any compound that, following oral or parenteral administration, in particular oral administration, is metabolised in vivo to a (more) active form in an experimentally-detectable amount, and within a predetermined time (e.g., within a dosing interval of between 0.5 and 24 hours, or e.g., within a dosing interval of between 6 and 24 hours (i.e., once to four times daily)). For the avoidance of doubt, the term "parenteral" administration includes all forms of administration other than oral administration, in particular intravenous (IV), intramuscular (IM), and subcutaneous (SC) injection.
[0080] Prodrugs may be prepared by modifying functional groups present on a compound in such a way that the modifications are cleaved in vivo when such prodrug is administered to a mammalian subject. The modifications typically are achieved by synthesizing the parent compound with a prodrug substituent. In general, prodrugs include compounds wherein a hydroxyl, amino, sulfhydryl, carboxy or carbonyl group is bonded to any group that may be cleaved in vivo to regenerate the free hydroxyl, amino, sulfhydryl, carboxy or carbonyl group, respectively.
[0081] Examples of prodrugs include, but are not limited to, esters and carbamates of hydroxy functional groups, esters groups of carboxyl functional groups, N-acyl derivatives and N-Mannich bases. General information on prodrugs may be found e.g., in Bundegaard, H. "Design of Prodrugs" p. 1-92, Elesevier, New York-Oxford (1985).
[0082] The term solvate comprises the solvent addition forms as well as the salts thereof, which the compounds of Formula (I) are able to form. Examples of such solvent addition forms are e.g., hydrates, alcoholates and the like.
[0083] The compounds of the invention as prepared in the processes described below may be synthesized in the form of mixtures of enantiomers, in particular racemic mixtures of enantiomers, that can be separated from one another following art-known resolution procedures.
A manner of separating the enantiomeric forms of the compounds of Formula (I), and pharmaceutically acceptable salts, and solvates thereof, involves liquid chromatography using a chiral stationary phase. Said pure stereochemically isomeric forms may also be derived from the corresponding pure stereochemically isomeric forms of the appropriate starting materials, provided that the reaction occurs stereospecifically. Preferably if a specific stereoisomer is desired, said compound would be synthesized by stereospecific methods of preparation. These methods will advantageously employ enantiomerically pure starting materials.
[0084] The term "enantiomerically pure" as used herein means that the product contains at least 80% by weight of one enantiomer and 20% by weight or less of the other enantiomer. Preferably the product contains at least 90% by weight of one enantiomer and 10% by weight or less of the other enantiomer. In the most preferred embodiment the term "enantiomerically pure"
means that the composition contains at least 99% by weight of one enantiomer and 1% or less of the other enantiomer.
[0085] The present invention also embraces isotopically-labeled compounds which are identical to those recited herein, but for the fact that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature (or the most abundant one found in nature).
[0086] All isotopes and isotopic mixtures of any particular atom or element as specified herein are contemplated within the scope of the invention, either naturally occurring or synthetically produced, either with natural abundance or in an isotopically enriched form.
Exemplary isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine, chlorine and iodine, such as 2H, 3H, 13c, 14c, 13N, 150, 170, 180, 32P, 33p, 35s, 18F, 36c1, 1221, 1231, 1251, 131-, 1 75Br, 76Br, 77Br and 82Br.
Preferably, the isotope is selected from the group of 2H, 3H, 11( 13C and "F.
Preferably, the isotope is selected from the group of 2H, 3H, 11C and 18F. More preferably, the isotope is 2H, 3H
or 13C. More preferably, the isotope is 2H or 'C. More preferably, the isotope is 2H. In particular, deuterated compounds and 13C-enriched compounds are intended to be included within the scope of the present invention. In particular, deuterated compounds are intended to be included within the scope of the present invention.
[0087] Certain isotopically-labeled compounds (e.g., those labeled with 3H and NC) may be useful for example in substrate tissue distribution assays. Tritiated (3H) and carbon-14 (mC) isotopes are useful for their ease of preparation and detectability. Further, substitution with heavier isotopes such as deuterium (i.e., 2H) may afford certain therapeutic advantages resulting from greater metabolic stability (e.g., increased in vivo half-life or reduced dosage requirements) and hence may be preferred in some circumstances. Positron emitting isotopes such as 150, 13N, "C and "F are useful for positron emission tomography (PET) studies. PET
imaging in cancer finds utility in helping locate and identify tumors, stage the disease and determine suitable treatment. Human cancer cells overexpress many receptors or proteins that are potential disease-specific molecular targets. Radiolabelled tracers that bind with high affinity and specificity to such receptors or proteins on tumor cells have great potential for diagnostic imaging and targeted radionuclide therapy (Charron, Carlie L. et al.
Tetrahedron Lett. 2016, 57(37), 4119-4127). Additionally, target-specific PET radiotracers may be used as biomarkers to examine and evaluate pathology, by for example, measuring target expression and treatment response (Austin R. etal. Cancer Letters (2016), doi: 10.1016/j .canlet.2016.05.008).
[0088] Solid oral dosage forms such as, tablets or capsules, containing one or more compounds described herein may be administered in at least one dosage form at a time, as appropriate. It is also possible to administer the compounds in sustained release formulations.
[0089] Additional oral forms in which the compounds described herein may be administered include elixirs, solutions, syrups, and suspensions; each optionally containing flavoring agents and coloring agents.
[0090] Alternatively, one or more compounds described herein can be administered by inhalation (intratracheal or intranasal) or in the form of a suppository or pessary, or they may be applied topically in the form of a lotion, solution, cream, ointment or dusting powder. For example, they can be incorporated into a cream comprising, consisting of, and/or consisting essentially of an aqueous emulsion of polyethylene glycols or liquid paraffin.
They can also be incorporated, at a concentration of between about 1 % and about 10 % by weight of the cream, into an ointment comprising, consisting of, and/or consisting essentially of a wax or soft paraffin base together with any stabilizers and preservatives as may be required. An alternative means of administration includes transdermal administration by using a skin or transdermal patch.
[0091] The pharmaceutical compositions used in the methods of the present invention (as well as the compounds alone) can also be injected parenterally, for example, intracavernosally, intravenously, intramuscularly, subcutaneously, intradermally, or intrathecally. In this case, the compositions will also include at least one of a suitable carrier, a suitable excipient, and a suitable diluent.
[0092] For parenteral administration, the pharmaceutical compositions of the present invention are best used in the form of a sterile aqueous solution that may contain other substances, for example, enough salts and monosaccharides to make the solution isotonic with blood.
[0093] For buccal or sublingual administration, the pharmaceutical compositions of the present invention may be administered in the form of tablets or lozenges, which can be formulated in a conventional manner.
[0094] By way of further example, pharmaceutical compositions containing a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, and a BCL-2 inhibitor and optionally, at least one other antineoplastic agent as an active ingredient can be prepared by mixing the compound(s) with a pharmaceutically acceptable carrier, a pharmaceutically acceptable diluent, and/or a pharmaceutically acceptable excipient according to conventional pharmaceutical compounding techniques. The carrier, excipient, and diluent may take a wide variety of forms depending upon the desired route of administration (e.g., oral, parenteral, etc.).
Thus, for liquid oral preparations such as, suspensions, syrups, elixirs and solutions, suitable carriers, excipients and diluents include water, glycols, oils, alcohols, flavoring agents, preservatives, stabilizers, coloring agents and the like; for solid oral preparations such as, powders, capsules, and tablets, suitable carriers, excipients and diluents include starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like. Solid oral preparations also may be optionally coated with substances such as, sugars, or be enterically coated so as to modulate the major site of absorption and disintegration. For parenteral administration, the carrier, excipient and diluent will usually include sterile water, and other ingredients may be added to increase solubility and preservation of the composition. Injectable suspensions or solutions may also be prepared utilizing aqueous carriers along with appropriate additives such as, solubilizers and preservatives.
[0095] According to particular embodiments, methods using a therapeutically effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, and a BCL-2 inhibitor and optionally, at least one other antineoplastic agent, may comprise a dose range from about 0.1 mg to about 3000 mg, or any particular amount or range therein, in particular from about 1 mg to about 1000 mg, or any particular amount or range therein, of active ingredient in a regimen of about 1 to about (4x) per day for an average (70 kg) human;
although, it is apparent to one skilled in the art that the therapeutically effective amount for a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, and a BCL-2 inhibitor and optionally, at least one other antineoplastic agent, will vary as will the diseases, syndromes, conditions, and disorders being treated.
[0096] An embodiment of the present invention is directed to methods of using pharmaceutical compositions for oral administration, comprising a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof in an amount of from about 1 mg to about 500 mg. Advantageously, a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof may be administered in a single daily dose, or the total daily dosage may be administered in divided doses of two, three and (4x) daily.
[0097] Optimal dosages of a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof to be administered may be readily determined and will vary with the particular compound used, the mode of administration, the strength of the preparation, and the advancement of the hematopoietic disorder. In addition, factors associated with the particular subject being treated, including subject gender, age, weight, diet and time of administration, will result in the need to adjust the dose to achieve an appropriate therapeutic level and desired therapeutic effect. The above dosages are thus exemplary of the average case.
There can be, of course, individual instances wherein higher or lower dosage ranges are merited, and such are within the scope of this invention.
[0098] Compounds of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof may be administered in any of the foregoing compositions and dosage regimens or by means of those compositions and dosage regimens established in the art whenever use of a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered to a subject in need thereof [0099] An embodiment of the present invention is directed to methods of using pharmaceutical compositions for intravenous or subcutaneous administration, comprising a BCL-2 inhibitor in an amount of from about 1 mg to about 500 mg. Advantageously, the BCL-2 inhibitor may be administered in a single daily dose, or the total daily dosage may be administered in divided doses of two, three and (4x) daily.
[0100] Optimal dosages of the BCL-2 inhibitor to be administered may be readily determined and will vary with the particular compound used, the mode of administration, the strength of the preparation, and the advancement of the disease, syndrome, condition or disorder. In addition, factors associated with the particular subject being treated, including subject gender, age, weight, diet and time of administration, will result in the need to adjust the dose to achieve an appropriate therapeutic level and desired therapeutic effect. The above dosages are thus exemplary of the average case. There can be, of course, individual instances wherein higher or lower dosage ranges are merited, and such are within the scope of this invention.
[0101] The BCL-2 inhibitor may be administered in any of the foregoing compositions and dosage regimens or by means of those compositions and dosage regimens established in the art whenever use of a BCL-2 inhibitor is administered to a subject in need thereof.
[0102] As used herein, the term "menin-MLL inhibitor" refers to an inhibitor of the protein-protein interaction between menin and mixed-lineage leukemia 1 (MLL1) (also known as histone-lysine N-methyltransferase 2A (KMT2A) protein in the scientific field (UniProt Accession # Q03164)) which inhibits or reduces menin-MLL 1 activity. Menin-MLL
inhibitors described herein are disclosed in PCT/CN2020/137266 (which published as WO
on June 24, 2021), which is incorporated by reference herein in its entirety, and which also discloses corresponding synthetic schemes and analytical characterizations.
[0103] As used herein, the term "BCL-2 inhibitor" refers to an agent that inhibits or reduces BCL-2 activity.
[0104] As used herein, the term "antineoplastic agent" refers to any agent that treats cancer.
[0105] As used herein, the term "hypomethylating agent" refers to an agent that inhibits or reduces DNA methylation.
[0106] As used herein, the term "kinase inhibitor" refers to an agent that inhibits or reduce the activity of at least one kinase (e.g., tyrosine and/or serine kinases such as fms-like receptor tyrosine kinase-3 (FLT3), Bruton tyrosine kinase (BTK), an Abelson tyrosine kinase 1 (ABL), an Aurora serine/tyrosine kinase).
[0107] As used herein, the term "FLT-3 inhibitor" refers to tyrosine kinase inhibitors (TKI) classified into first and next generation inhibitors based on their potency and specificity for fms-like receptor tyrosine kinase-3 (FLT3) and their associated downstream targets.
[0108] As used herein, the term "CD20 inhibitor" refers to any agent that reduces activity of CD20.
[0109] As used herein, the term "isocitrate dehydrogenase (1DH) inhibitor"
refers to any agent that interferes with the conversion of isocitrate to a-ketoglutarate (a-KG) in the tricarboxylic acid (TCA) cycle [0110] As used herein, the term "immunomodulatory antineoplastic agent" refers to any agent that enhances antitumor immune cell activity.
[0111] As used herein, the term "programmed cell death protein 1 (PD-1) inhibitor" refers to any agent that inhibits or reduces PD-1 activity.
[0112] As used herein, the term "dihydroorotate dehydrogenase (DHODH) inhibitor" refers to any agent that inhibits or reduces dihydroorotate dehydrogenase activity.
[0113] As used herein, unless otherwise noted, the term "affect" or "affected"
(when referring to a disease, disorder, or medical condition that is affected by the inhibition or alteration of menin-MLL activity) includes a reduction in the frequency and/or severity of one or more symptoms or manifestations of said hematopoietic disorder; and/or includes the prevention of the development of one or more symptoms or manifestations of said hematopoietic disorder or the development of the hematopoietic disorder.
[0114] As used herein, the term "hematopoietic disorder" refers to any disorder associated with the production of the cellular components of blood and blood plasma, including but not limited to blood cancers.
[0115] According to an embodiment, the invention provides combinations as described herein.
[0116] According to an embodiment, the invention provides combinations as described herein for use as a medicament.
[0117] According to an embodiment, the invention provides combinations as described herein for the manufacture of a medicament.
[0118] According to an embodiment, the invention provides combinations as described herein for the manufacture of a medicament for the treatment or prevention of any one of the disease conditions mentioned herein.
[0119] According to an embodiment, the invention provides combinations as described herein for use in the prevention or treatment, in particular treatment, of diseases as described herein.
[0120] According to an embodiment, the invention provides combinations as described herein for use in the prevention or treatment, in particular treatment, of a hematopoietic disorder, including but not limited to blood cancers, including but not limited to lymphomas, myelomas and leukemias.
[0121] According to an embodiment, the invention provides combinations as described herein for use in the prevention or treatment, in particular treatment, of a hematopoietic disorder.
[0122] According to an embodiment, the hematopoietic disorder is selected from, but not limited to, lymphomas, myelomas, myelodysplasia and leukemias.
[0123] According to an embodiment, the hematopoietic disorder is a lymphoma selected from Hodgkin's disease lymphomas and Non-Hodgkin's lymphomas.
[0124] According to an embodiment, the lymphoma is a Non-Hodgkin's disease that is Burkitt's lymphoma, anaplastic large cell lymphoma, splenic marginal zone lymphoma, hepatosplenic T-cell lymphoma or angioimmunoblastic T-cell lymphoma (AILT).
[0125] According to an embodiment, the hematopoietic disorder is a myeloma.
According to an embodiment, the hematopoietic disorder is a multiple myeloma, Waldenstrom macroglobulinemia or plasmacytoma.
[0126] According to an embodiment the hematopoietic disorder is a myelodysplasia including, but not limited to, myelodysplastic syndrome (MDS).
[0127] According to an embodiment, the hematopoietic disorder is a leukemia.
[0128] According to an embodiment, the hematopoietic disorder is a leukemia selected from acute leukemias and chronic leukemias. According to an embodiment, the leukemia is an acute leukemia. According to an embodiment, the leukemia is chronic leukemia.
[0129] According to an embodiment, the hematopoietic disorder is a myeloid leukemia, myelogeneous leukemia, lymphoblastic leukemia, or lymphocytic leukemia, According to an embodiment, the hematopoietic disorder is a leukemia selected from, but not limited to, acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), small lymphocytic leukemia (SLL), acute myeloid leukemia (AML), chronic idiopathic myelofibrosis (MF), chronic myelogenous leukemia (CML), T-cell prolymphocytic leukemia (T-PLL), B-cell prolymphocytic leukemia (B-PLL), chronic neutrophilic leukemia (CNL), Hairy cell leukemia lg (HCL), T-cell large granular lymphocyte leukemia (T-LGL) and aggressive NK-cell leukemia.
According to an embodiment, the AML is acute megakaryoblastic leukemia (AMKL).
[0130] According to an embodiment, the leukemia is MDS, CLL, SLL, ALL or AML.
According to an embodiment, the leukemia is CLL, SLL or AML. According to an embodiment, the leukemia is CLL or SLL. In some embodiments, the CLL or SLL is a CD20 expressing cancer. According to an embodiment, the leukemia is ALL or AML. According to an embodiment, the leukemia is ALL. According to an embodiment, the leukemia is AML.
According to an embodiment, the hematopoietic disorder is Waldenstrom macroglobulinemia.
[0131] According to an embodiment, the hematopoietic disorder is a MILL-rearranged leukemia, MILL-partial tandem duplication (PTD) leukemia, MILL amplified leukemia, MILL-positive leukemia, or leukemia exhibiting elevated HOX/MEIS1 gene expression signatures.
[0132] According to an embodiment, the leukemia is a MILL-rearranged leukemia &/or a nucleophosmin 1 (NPM1)-mutated leukemia.According to an embodiment, the hematopoietic disorder is a MILL-rearranged leukemia.
[0133] According to an embodiment, the hematopoietic disorder is a nucleophosmin 1 (NPM1)-mutated leukemia (e.g., NPM1c).
[0134] According to an embodiment, the invention provides methods for treatment of a hematopoietic disorder that is myelodysplastic syndrome (MDS), a myeloproliferative neoplasm (MPN), acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), a small lymphocytic lymphoma (SLL) or chronic lymphocytic leukemia (CLL), comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, and a BCL-2 inhibitor, and optionally, at least one other antineoplastic agent.
[0135] According to an embodiment, the hematopoietic disorder is myelodysplastic syndrome (MDS) or a myeloproliferative neoplasm (MPN).
[0136] According to an embodiment, the hematopoietic disorder is acute lymphocytic leukemia (ALL).
[0137] According to an embodiment, the hematopoietic disorder is acute myeloid leukemia (AML).
[0138] According to an embodiment, the hematopoietic disorder is a small lymphocytic lymphoma (SLL) or chronic lymphocytic leukemia (CLL).
[0139] According to an embodiment, the hematopoietic disorder is a SLL or CLL
where SLL
or CLL is a CD20-expressing cancer.
[0140] According to an embodiment, the hematopoietic disorder is myelodysplastic syndrome (MDS).
[0141] According to an embodiment, the hematopoietic disorder is a my eloproliferative neoplasm (1VIPN).
[0142] According to an embodiment, the hematopoietic disorder is a NPM1-mutated leukemia with a FLT3 mutation.
[0143] According to an embodiment, the hematopoietic disorder is a FLT3-dependent leukemia.
[0144] According to an embodiment, the hematopoietic disorder is a MEF2G-dependent leukemia.
[0145] According to an embodiment, the hematopoietic disorder harbours one or more MLL1 (KMT2A) gene rearrangements or alterations (e.g., duplications or amplification) and/or NPM1 mutations.
[0146] According to an embodiment, the hematopoietic disorder harbours (i) one or more MLL1 (KMT2A) gene rearrangements or alterations (e.g., duplications or amplification) and/or NPM1 mutations plus (ii) a FLT3 mutation.
[0147] According to an embodiment, the hematopoietic disorder is an MLL-rearranged leukemia.
[0148] According to an embodiment, the hematopoietic disorder is acute myeloid leukemia (AML).
[0149] According to an embodiment, the hematopoietic disorder is a small lymphocytic lymphoma (SLL).
[0150] According to an embodiment, the hematopoietic disorder is a chronic lymphocytic leukemia (CLL).
[0151] According to an embodiment, the hematopoietic disorder is an acute leukemia, chronic leukemia, myeloid leukemia, myelogeneous leukemia, lymphoblastic leukemia, lymphocytic leukemia, acute myelogeneous leukemia (AML), chronic myelogenous leukemia (CIVIL), acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), T cell prolymphocytic leukemias (T-PLL), large granular lymphocytic leukemia, Hairy cell leukemia (HCL), MLL-rearranged leukemia, MLL-PTD leukemia, MLL amplified leukemia, MLL-positive leukemia, or leukemia exhibiting elevated IIOXIMEISI gene expression signatures.
[0152] According to an embodiment, the hematopoietic disorder is AML, in particular nucleophosmin (NPM1)-mutated AML (i.e., NPM1" AML), more in particular abstract NPM I -mutated AML.
[0153] According to an embodiment, the hematopoietic disorder is a IVILL-rearranged leukemia, in particular MLL-rearranged AML or ALL.
[0154] According to an embodiment, the hematopoietic disorder includes a MLL gene alteration, in particular the hematopoietic disorder is AML or ALL
with MLL gene alteration(s). In certain embodiments, the MLL gene alteration is a duplication.
In certain embodiments the MLL gene alteration is an amplification.
[0155] According to an embodiment, the hematopoietic disorder includes a NPM1 gene mutation and/or MILLI (also known as KiVIT2A) gene mutation.
[0156] According to an embodiment, MLL1 gene mutations include, but are not limited to, 1VILL1 gene rearrangements, duplications or amplification.
[0157] According to an embodiment, the hematopoietic disorder is a mixed-lineage leukemia (MIL), MLL-related leukemia, MLL-associated leukemia, MILL-positive leukemia, MILL-induced leukemia, leukemia associated with a MLL, acute leukemia, chronic leukemia, myelodysplastic syndrome (MD S), or myeloproliferative neoplasms (MPN).
[0158] All embodiments described herein for methods for treating a hematopoietic disorder, are also applicable for use in treating said hematopoietic disorder.
[0159] All embodiments described herein for use in treating a hematopoietic disorder, are also applicable for methods for treating said hematopoietic disorder.
[0160] All embodiments described herein for methods for treating a hematopoietic disorder, are also applicable for use in a method for treating said hematopoietic disorder.
[0161] All embodiments described herein for use in a method for treating a hematopoietic disorder, are also applicable for methods for treating said hematopoietic disorder.
[0162] In an embodiment, the present invention relates to a novel combination comprising:
= a therapeutically effective amount of a menin-MLL inhibitor of Formula (I), or a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt or a solvate thereof;
= a therapeutically effective amount of a BCL-2 inhibitor; and = optionally, a therapeutically effective amount of at least one other antineoplastic agent.
[0163] According to an embodiment, compounds of Foimula (I) are menin-MLL
inhibitors having the structure:
X
n3( ) )n4 n1( ('>)n2 1 a (I) Ribyu and the tautomers and the stereoisomeric forms thereof, wherein xa xb R" represents -C(=0)-NR ax Rxb, Het, or NR R
Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety;
wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalky1 and C1_4alkyl;
R' and WI' are each independently selected from the group consisting of hydrogen, Ci-4alkyl and C3_6cycloalkyl;
Rib represents F or Cl;
Y' represents -CR5aR5b-, -0- or R2 is selected from the group consisting of hydrogen, halo, Ch4alkyl, -0-Ci_4alkyl, and -NR7aR7b;
U represents N or CH, nl, n2, n3 and n4 are each independently selected from 1 and 2;
Xl represents CH, and X2 represents N;
R4 represents isopropyl, Rsa, R5b, R5C, R7a, and WI', are each independently selected from the group consisting of hydrogen, Ci¨talkyl and C3_6eycloalkyl, R3 represents -CI -6 alkyl-NR"R8b, -C1-6 alkyl-C (=0)-NR9aR9b, -C 1- 6 alkyl-OH, or -C1-6a1ky1-NR11-C(=0)-0-Ci_4a1kyl-O-C(=0)-Ci_4alkyl; wherein each of the Ci4alkyl or Ci_6alky1 moieties in the R3 definitions independently of each other may be substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo, -OH, and -0-Ci_4alky1;
R'a and R" are each independently selected from the group consisting of hydrogen; Ci-6alkyl, -C(=0)-0-Ci_4alkyl, _c(=0)_NRI2aRi2b, and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -s(=0)2-C3_4alkyl, -0-C3_4a1ky1, -C(=0)-NR10aRlOb, and _N-Rioc_c(=o)_c 1_ 4a1ky1; and R9a, R9b, R10a, R1013, R10c, R12a, and R12b are each independently selected from the group consisting of hydrogen and C 1-6 alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0164] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein xa xb Rla represents -C(=0)-NWa Rxb; Het; or N R R
Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety;
wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalky1 and C1_4alkyl;
R' and Wb are each independently selected from the group consisting of hydrogen, Ci-4alkyl and C3_6cycloalky1;
Rib represents F or Cl;
Y1 represents -CR5aR5b-, -0- or -NR5e-;
R2 is selected from the group consisting of hydrogen, halo, C3_4alkyl, -0-C3_4alkyl, and -NR7aR7b;
U represents N or CH;
n 1, n2, n3 and n4 are each independently selected from 1 and 2;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R5a, R5b, R5e, R7a, and R7b, are each independently selected from the group consisting of hydrogen, Ci_4alkyl and C3_6cycloalkyl;
R3 represents -Ch6alkyl-NR'R8b, -Ci_6alkyl-C(=0)-N1eaR9b, -Ci_6alkyl-OH, or -Ci-6alkyl-NR11-C(=0)-0 -C 1_4alkyl-O-C(=0)-C 3_4alkyl wherein each of the Ci_4alkyl or C3_6alkyl moieties in the R3 definitions independently of each other may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo or -0-C1_4alkyl;
R a and leb are each independently selected from the group consisting of hydrogen, Ci-6alkyl; -C(=0)-C1_4alky1; -C(=0)-0-C1_4alkyl; -C(=0)-NR12aRl2b; and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-C1_4alkyl, -0-C1_4alkyl, and -C(=0)-NRiOaRlOb; and R9a, R9b, Rioa, R10b, R12a, and R12b are each independently selected from the group consisting of hydrogen and Ci_6alky1;
and the pharmaceutically acceptable salts and the solvates thereof.
[0165] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein xa xb Itla represents -C(=0)-NRxa Rxb; Het; or N R R
=
Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety;
wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalky1 and C1_4alkyl;
R' and Wb are each independently selected from the group consisting of hydrogen, Ci--talkyl and C3_6cycloalkyl;
Rib represents F or Cl;
Y1 represents -CR5aR5b-, -0- or -NR5e-;
R2 is selected from the group consisting of hydrogen, halo, C1_4alkyl, -0-C1_4alkyl, and -NR7aR7b;
U represents N or CH;
n 1, n2, n3 and n4 are each independently selected from 1 and 2;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R5a, R5b, R5e, R7a, and R7b, are each independently selected from the group consisting of hydrogen, Ci_4alkyl and C3_6cycloalkyl;
R3 represents -C1_6alkyl-NR'le1); wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, OH, and -0-C1_4alkyl;
R' and R'b are each independently selected from the group consisting of hydrogen; C1-6a1ky1; and C3_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci_4alkyl, -C(=0)- 1NR OaR1 013, and -NR"c-C(=0)-Ci_4a1kyl; and R10a, R10b, R1 Oc are each independently selected from the group consisting of hydrogen and C1_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0166] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein xa x b R1a represents -C(=0)-NR ax Rxb; Het; or N R R
Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety;
wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalky1 and C3_4alkyl;
R' and It'th are each independently selected from the group consisting of hydrogen, Ci-4alkyl and C3_6cycloalkyl;
Rib represents F or Cl;
Y1 represents -CR5aR5b-, -0- or -NR5c-;
R2 is selected from the group consisting of hydrogen, halo, C1_4alkyl, -0-C1_4a1ky1, and -NR7aR7b;
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R5a, R5b, R5c, R7a, and R7b, are each independently selected from the group consisting of hydrogen, Ci_4alkyl and C3_6cycloalkyl;
R3 represents -Ci -6alkyl-NR8aR8b; wherein the Ci_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C1_4alkyl;
R8 and R8b are each independently selected from the group consisting of hydrogen; Ci_ 6alkyl; and C3_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-C3_4alkyl, -0-C3_4alkyl, and -C(=0)-NRiOaRl0b, and R'0a and leth are each independently selected from the group consisting of hydrogen and Ci_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
101671 According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rla represents -C(=0)-NR"Wb or Het;
Het represents a 6-membered monocyclic aromatic ring containing two nitrogen atoms;
wherein said 6-membered monocyclic aromatic ring is substituted with one C3_6cycloalkyl;
R' and Wb represent C1_4a1kyl;
Rib represents F;
Y1 represents -0-;
R2 represents hydrogen;
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2, X' represents CH, and X2 represents N, R4 represents isopropyl;
R3 represents -C1-6alkyl-NR8aR8b, -C1-6alkyl-C(=0)-NR9aR9b, -C 1- 6alkyl-OH, or -Ci-6alkyl-NR11-C(=0)-0-C1_4alkyl-O-C(=0)-C1_4a1 kyl ;
wherein each of the CI-alkyl or Ch6alkyl moieties in the R3 definitions independently of each other may be substituted with one, two or three substituents each independently selected from the group consisting of -OH and -0-C1_4a1kyl;
R" and R" are each independently selected from the group consisting of hydrogen; Ci-6alkyl; -C(=0)-Ci_4a1ky1; -C(=0)-0-C1_4a1ky1; _c (=co_NR12aR12b; and C1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -s(=0)2-C1_4alkyl, -C(=0)-NR10aRlOb, and -NR1 c-C(=0)-C,_ 4a1ky1; and R9a, R9b, R10a, R10b, R10c, Rn, R12a, and R12b are each independently selected from the group consisting of hydrogen and C1_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0168] According to an embodiment, compounds of Formula q) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rla represents -C(=0)-NR"Rth or Het, Het represents a 6-membered monocyclic aromatic ring containing two nitrogen atoms, wherein said 6-membered monocyclic aromatic ring is substituted with one C3_6cycloalkyl;
R' and 1Vb represent C1_4a1kyl, Rib represents F;
Yl represents -0-;
R2 represents hydrogen;
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
Xl represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -Ci_6alkyl-NR8aR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of -OH and -0-Ci_4alky1;
Rsa and leb are each independently selected from the group consisting of hydrogen; Ci 6alkyl; and Ci_6a1kyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci4a1kyl, -C(=0)-NR1 OaR1 and -NR1cc-C(=0)-Ci_4a1ky1; and R10a, R10b, and Rthc are each independently selected from the group consisting of hydrogen and Ci_6alkyl, and the pharmaceutically acceptable salts and the solvates thereof.
101691 According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rh a represents -C(=0)- xNR aRxb;
R' and 1Vb represent C1_4a1kyl;
Rib represents F;
Yl represents -0-;
R2 represents hydrogen;
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
X' represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -C1-6 alkyl-NR'R'; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of -OH and -0-Ci_4alky1, R8a and Itsb are each independently selected from the group consisting of hydrogen, Ci 6a1ky1; and Ci_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyan , halo, -S(-0)2-Ci_4alkyl, -0-C1_4alkyl, -C(-0)-NR10aRlOb, and _NRi0e-C(=0)-Ci4alkyl; and R10a, R10b, and R' are each independently selected from the group consisting of hydrogen and Ci_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0170] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R' represents -C(=0)-NR"Wb or Het;
Het represents pyrimidinyl substituted with one C3-6cycloalkyl;
It and Itxb represent Ci_4a1kyl;
Rib represents F;
Y1 represents -0-;
R2 represents hydrogen;
U represents N, nl, n2, n3 and n4 are each independently selected from 1 and 2, X1 represents CH, and X2 represents N, R4 represents isopropyl;
R3 represents -Ci_6alkyl-NR8aR8b, wherein the C1_6alkyl moiety in the R3 definition may be substituted with one -OH;
R8a- and Rsb are each independently selected from the group consisting of hydrogen; CI-6alkyl; and C1_6alkyl substituted with one or two substituents each independently selected from the group consisting of halo, -0-C1_4a1ky1, and -NR"-C(=0)-C1_4alkyl; and R10a, R10b, and R1 ' are each independently selected from the group consisting of hydrogen and C1_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0171] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R' represents -C(=0)-NRxaRxb or Het;
Het represents pyrimidinyl substituted with one C3_6cycloalkyl;
It' and It'd' represent C14a1kyl;
Rib represents F;
Y1 represents -0-, R2 represents hydrogen;
U represents N;
n2 is 2, nl, n3 and n4 are I;
X3 represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -C1_6alkyl-NleaR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one -OH;
R8a- and leb are each independently selected from the group consisting of hydrogen; Ci-6alkyl; and Ci_6alkyl substituted with one or two substituents each independently selected from the group consisting of halo, -0-0 _aalkyl, and -NR1 c-C(=0)-0-talkyl; and R10a, R10b, and R1 ' are each independently selected from the group consisting of hydrogen and Ci_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0172] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R1a represents -C(=0)-NR"R", R' and R' represent Ci-talkyl, Rib represents F, Y3 represents -0-;
R2 represents hydrogen;
U represents N;
n2 is 2, nl, n3 and n4 are 1;
X3 represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -C1_6alkyl-NR8aR8b;
R8a- and R8b are each independently selected from the group consisting of hydrogen; CI-6alkyl; and C16alkyl substituted with one or two substituents each independently selected from the group consisting of halo, -0-CI_4alkyl, and -NR"c-C(=0)-CI_4alkyl; and Riod, Riob, and Rme are each independently selected from the group consisting of hydrogen and C1-6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0173] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R" represents -C(=0)-NR ax Rxb;
R' and It represent C1_4a1kyl, Rib represents F;
Y1 represents -0-;
R2 represents hydrogen;
U represents N;
n2 is 2, nl, n3 and n4 are I;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -CH2-CH2-CH2-NR8aR81);
R8a- and R8b are each independently selected from the group consisting of hydrogen; CI
-(alkyl; and C16alkyl substituted with one or two substituents each independently selected from the group consisting of halo, -0-C1_4alky1, and -NR1 c-C(=0)-Ci_4alkyl; and R10", R10', and Itme are each independently selected from the group consisting of hydrogen and Ci_6alkyl, and the pharmaceutically acceptable salts and the solvates thereof.
101741 According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R' represents -C(=0)-NR ax Rxb;
R.' and It' represent C1_4a1kyl;
Rib represents F;
Y1 represents -0-;
R2 represents hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from I and 2;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -Ci_6alkyl-NR8aR8b;
R8a and R8b are each independently selected from the group consisting of hydrogen; C
6a1ky1; and Ch6a1kyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-C1-4alkyl, -0-Ci4alkyl, and -C(=0)-NR10aRlOb, and Rioa and Rmb are each independently selected from the group consisting of hydrogen and Ci_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0175] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rla represents -C(=0)- amtx Rxb;
R' and It'd' represent Ci_4a1kyl;
Rib represents F;
Yl represents -0-;
R2 represents hydrogen;
U represents N;
n I, n2, n3 and n4 are each independently selected from 1 and 2;
Xl represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -CH2-CH2-CH24\asaRsb;
R8a and leb are each independently selected from the group consisting of hydrogen, Ci-6alkyl, and Ci_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-C1-4alkyl, -0-C1_4alkyl, and -C(=0)-NR10aRlOb, and RI" and Rlob are each independently selected from the group consisting of hydrogen and Ci_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0176] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein ¨ la tc represents -C(=0)- aNRx Rxb;
R' and Itxb represent hydrogen or Ci_4alkyl;
Rib tc represents F;
Yl represents -0-;
R2 represents hydrogen;
U represents N;
n I, n2, n3 and n4 are each independently selected from 1 and 2;
X' represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -CH2-CH2-CH2-Nlealt";
R8a and Itsb are each independently selected from the group consisting of hydrogen, Ci-6a1ky1, and Ci_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(-0)2-Ci-4alkyl, -0-C14alkyl, and -C(-0)-NR10aRlOb, and RWa and R1' are each independently selected from the group consisting of hydrogen and Ci_oalkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0177] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R' represents -C(=0)-NR"Wb;
R' and Wb represent hydrogen or C1_4a1ky1;
Rib represents F;
Y3 represents -0-;
R2 represents hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from 1 and 2, X' represents CH, and X2 represents N, R4 represents isopropyl, R3 represents -CH2-CH2-CH2-NR8aR"; and R8a and R" are each independently selected from the group consisting of hydrogen, Ci-6alkyl; and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH and -0-Ci_4alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0178] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Ria represents -C(=0)- aNRx Rxb;
R' and Wb represent Ci_aalkyl;
lb I( represents F;
Y3 represents -0-, R2 represents hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from 1 and 2, X' represents CH, and X2 represents N, R4 represents isopropyl, R3 represents -C1_6alkyl-NR"R", and R' and R81' are each independently selected from the group consisting of Ci_6alkyl; and C1_6alkyl substituted with one -0-C1_4alkyl, and the pharmaceutically acceptable salts and the solvates thereof.
[0179] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rla represents -C(=0)- aNw wb;
R' and It'th represent Ci¨talkyl;
Rib represents F;
Yl represents -0-;
R2 represents hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
Xl represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -CH2-CH2-CH2-NR'R"; and RS a and le are each independently selected from the group consisting of C1_6alkyl, and C1_6alkyl substituted with one -0-Ci_4alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0180] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rla represents -C(=0)-N-RxaRxh; or Het;
Het represents a 6-membered monocyclic aromatic ring containing two nitrogen atoms;
wherein said 6-membered monocyclic aromatic ring is optionally substituted with one C3-6cycloalkyl;
Rxa- and WI' represent Ci_4alkyl;
-=-= lb lc represents F;
Yl represents -0-;
R2 is hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
X' represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -C1-6alkyl-NleaRsb, -C1-6alkyl-C(=0)-NR9aR9b, -Ci_6alkyl-OH, or -6alkyl-Nlel-C(=0)-0-C1_4alkyl-O-C(=0)-C1_4alkyl, R'a and R" are each independently selected from the group consisting of hydrogen; Ci-6alkyl, -C(=0)-0-Ci4alkyl, _c(=0)_NRI2aRi 2h, and C1_6a1kyl substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo, -S(=0)2-Ci_4alkyl, and -0-C1_4alkyl; and R9a, R9b, R12a, and R' are each independently selected from the group consisting of hydrogen and C1_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0181] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R1a represents -C(=0)- aNRx Rxb;
It and Itxb represent Ci_4alkyl;
Rib represents F;
Y1 represents -0-;
R2 is hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -Ci_6alkyl-NR8aR", -Ci_6alkyl-C(=0)-NR94R9b, or -Ci_6alkyl-OH;
R a and R" are each independently selected from the group consisting of hydrogen; Ci-6alkyl; -C(=0)-C 1_4a1ky1; -C(=0)-0-C1_4alkyl; -C(=0)-NR12aRl2b; and C 1-6 alkyl substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo, -S(=0)2-Ci_4alkyl, and -0-Ci_4alky1; and R9a, R9b, Rua., and R12b are each independently selected from the group consisting of hydrogen and Ci_oalkyl;
and the pharmaceutically acceptable salts and the solvates thereof [0182] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Rib represents F.
[0183] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R2 represents hydrogen.
[0184] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein n1 is 1, n2 is 2, n3 is 1, and n4 is 1.
[0185] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Yi represents -0-.
[0186] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Yi represents -0-; and U
represents N.
[0187] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Yi represents -0-; U
represents N; Rib represents F; and R2 represents hydrogen.
[0188] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het represents NN
[0189] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het represents a monocyclic 5- or 6-membered aromatic ring containing one or two nitrogen atoms, wherein said monocyclic 5- or 6-membered aromatic ring is substituted with one C3_6cycloalkyl.
[0190] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het represents a monocyclic 5- or 6-membered aromatic ring containing one or two nitrogen atoms, wherein said monocyclic 5- or 6-membered aromatic ring is substituted with one C3_6cycloalkyl, and Rib represents F.
[0191] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het represents a monocyclic 6-membered aromatic ring containing one or two nitrogen atoms; wherein said monocyclic 6-membered aromatic ring is substituted with one C3_6cycloalkyl.
[0192] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het represents a monocyclic 6-membered aromatic ring containing one or two nitrogen atoms; and wherein said monocyclic 6-membered aromatic ring is substituted with one C3_6cycloalkyl; and Rib represents F.
[0193] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NleaR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C1_4alkyl.
[0194] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1_6alkyl-NleaR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl [0195] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alky1-NleaR8b.
[0196] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NR8aR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo and -0-Ci_4alky1; R8a. and R8b are each independently selected from the group consisting of hydrogen;
Ci_6alkyl; and Ci-6alkyl substituted with one, two or three substituents each independently selected from the _c(=0)_NRio _1( 10b group consisting of -OH, cyano, halo, -S(=0)2-C1_4alkyl, , and -NR1 c-C(=0)-C1 _4a1ky1 [0197] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1_6alkyl-NR8aR8b; wherein the Ci_6alkyl moiety in the R3 definition may be substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8a and R81' are each independently selected from the group consisting of hydrogen; Ci_6alkyl;
and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci4alkyl, _c(=0)_NRioaRiob, and -Nit' 'c-C(=0)-C 1_4alkyl [0198] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NR8aR8b; wherein the Ci_oalkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C
i_4alkyl; lea and Ieb are each independently selected from the group consisting of hydrogen;
Ci_6alkyl; and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-Ci_4alkyl, -0-Ci_4alkyl, and -C(=0)-ONR1 aRlOb.
[0199] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NR8aR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C
i_4alkyl; R8a and It' are each independently selected from the group consisting of hydrogen, C1_6alkyl, and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-C1_4alkyl, -0-C 1_4alkyl, _c(=c)_NR10aRlOb, and -NRI c-C(=0)-C1_4alkyl.
[0200] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-INVaR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8 a and R8b are each independently selected from the group consisting of hydrogen; C1_6alkyl;
and Ci_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-Ci_4alkyl, -0-C1_4alkyl, and -C(=0)- ONR1 aRlOb.
[0201] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NR8aR8b; wherein the Ci_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8a. and R81' are each independently selected from the group consisting of hydrogen; Ci_6alkyl;
and Ci_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(-0)2-C1_4alkyl, -C(-0)-ONR1 aRl0b, and -NR1'e-C(=0)-C t-talkyl [0202] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR5b; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-Ci_4alkyl.
[0203] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR"; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-Ci_4alkyl.
[0204] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR"; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-Ci_4alky1, lea and R" are each independently selected from the group consisting of hydrogen, C
i_6alkyl, and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-C1_4alkyl, -C(=0)-NR 01 aR1013, and _NR' LA 0)-C
[0205] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR"; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8a and R" are each independently selected from the group consisting of hydrogen; C1_6alkyl;
and C1_6alkyl substituted with one, two or three sub stituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-CI_4alkyl, -C(=0)-NR10aR101), and -NR1 c-C(=0)-C hztalkyl [0206] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R1 represents -C2_6alkyl-NR8aR"; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C14alkyl, It, and WI' are each independently selected from the group consisting of hydrogen; C1_6a1kyl;
and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-Ci_4alkyl, -0-C1_4alkyl, and -C(=0)- ONR1 aRlOb.
[0207] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR8b; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C
i_4alkyl; R8a and R8b are each independently selected from the group consisting of hydrogen;
Ci_6alkyl; and Ci-6alkyl substituted with one, two or three substituents each independently selected from the =
group consisting of cyano, halo, -S(=0)2-C1_4alkyl, -0-C1_4alkyl, and _c(0)_NRioaRtob.
[0208] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1_6alky1-NRsaR8b;
R8a and leb are each independently selected from the group consisting of C1_6alkyl, and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ct-4alkyl, -0-Ci4alkyl, and _c(=0)_NRioaRtob.
[0209] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR8b; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8 a and R8b are each independently selected from the group consisting of hydrogen; C1_6alkyl;
and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-C1_4alkyl, -0-C1_4alkyl, -C(=0)-ONR1 aR1013, and -NRmc-C(=0)-C _aalkyl [0210] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NleaR8b; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C1_4alkyl; lea and R8b are each independently selected from the group consisting of hydrogen;
Ci_6alkyl; and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(-0)2-C1_4alkyl, -0-C1_4alkyl, _c(=c)_NR10aRlOb, and -NR1'e-C(=0)-C t-talkyl [0211] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NR8aR";
R8 a and R8b are each independently selected from the group consisting of C1_6alkyl; and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci-4alkyl, -C(=0)-NR'a-=-=_1( 10b , and -NR1 c-C(=0)-Calkyl [0212] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl_NR8aR8b; Rsa represents C1_6alkyl; and R" represents C1_6alkyl substituted with one -0-C
i_Ltalkyl.
[0213] In an embodiment, the present invention relates to methods of using the compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1_6alkyl-NR8aR8b, -Ci_6alkyl-C(=0)-NR9aR9b, -C1_6alkyl-OH, or -Ci_6alkyl-NR11-C(=0)-0-C1_4alkyl-O-C(=0)-CiAalkyl, wherein each of the Ci-talkyl or Ci_6alkyl moieties in the R3 definitions independently of each other may be substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo or -0-Ci4alkyl [0214] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1_6alkyl-NR8aR8b, -C1-6alkyl-C(=0)-NR9aR9b, or -C1_6alkyl _NR i-C(=0)-0-C 1_4alkyl -0 -C(=0)-C
; wherein each of the C1_4alkyl or Ci_6alkyl moieties in the R3 definitions independently of each other may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl.
[0215] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -CH2-CH2-CH2-NR8aR8b.
[0216] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1-12-0-12-NR8aR8b R a represents methyl, and R" represents -CH2-CH2-0CH3.
[0217] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein C1_6alkyl in the R3 definition -Ci_6alkyl-NR8aR8b s =
I limited to ¨CH2-CH2-CH2-.
[0218] In an embodiment, the present invention includes compounds of Formula (I) or the pharmaceutically acceptable salts or the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (Ia) or Formula (Ib):
x n3( ) )n4 n3( ) )n4 n1( )n2 n1( )n2 R1' R1 a N
R5' U U
N'N halo Rib halo Rib (Ia) or (Ib), wherein R' Rib, R3, R4, R5a, R5b, X2, nl, n2, n3, n4 and halo are as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0219] In an embodiment, the compounds of Formula (1), or the pharmaceutically acceptable salts or the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, are restricted to compounds of Formula (Ia), or the pharmaceutically acceptable salts or the solvates thereof. In an embodiment, the compounds of Formula (I), or the pharmaceutically acceptable salts or the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, are restricted to compounds of Formula (Ib), or the pharmaceutically acceptable salts or the solvates thereof.
[0220] In an embodiment, the present invention includes compounds of Formula (I), or the pharmaceutically acceptable salts or the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (I-y):
cR3 , (1-Y) fl(1 N'N
wherein R3 is as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0221] In Formula (I-y) n1 is 1, n2 is 2, n3 is 1, and n4 is 1.
[0222] In a particular embodiment, the compound of Formula (I) is Compound A:
0 \
N¨N
Compound A
or a pharmaceutically acceptable salt or solvate thereof.
[0223] In a particular embodiment, the compound of Formula (I) is Compound Al:
x H20 N (x : 2-3) N¨N
Compound Al.
[0224] In a particular embodiment, the compound of Formula (I) is Compound A2:
0 \
N¨N
Compound A2.
[0225] In a particular embodiment, the compound of Formula (I) is Compound A3:
0 co N- N
oxalate salt Compound A3.
[0226] In a particular embodiment, the compound of Formula (1) is Compound A4-a.
N is __________________________________________ / __ 0 \ _____________________________________________________ /
N
I
N -N besylate salt Compound A4-a or a solvate thereof.
[0227] In a particular embodiment, the menin-MLL inhibitor of Formula (I) is (R)-N-ethyl--fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide besylate salt or a hydrate thereof.
[0228] In a particular embodiment, the menin-MLL inhibitor of Formula (I) is (R)-N-ethyl-5 -fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt or a solvate thereof.
[0229] In a particular embodiment, the menin-MLL inhibitor of Formula (I) is (R)-N-ethy1-5-fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt (Compound A4-b) or a hydrate thereof.
[0230] In a particular embodiment, the menin-MLL inhibitor of Formula (I) is Compound A4:
crystalline form A of (R)-N-ethy1-5 -flu oro-N-i sopropyl-2-((5 -(2-(6-((2-methoxyethyl)(m ethyl)amino)-2-m ethylhexan-3 -y1)-2,6-diazaspiro[3 .4] octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate.
[0231] In a particular embodiment, the menin-MLL inhibitor of Formula (I) is a crystalline form A of (R)-N-ethyl-5 -fl uoro-N-i sopropy1-2-((5 -(2-(6-((2-m ethoxy ethyl)(m ethyl)ami no)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3 .4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt 0.5-2.0 equivalents hydrate.
[0232] In an embodiment, the present invention relates to a subgroup of Formula (I) as defined in the general reaction schemes.
[0233] In an embodiment the compound of Formula (I) is selected from the group consisting of any of the exemplified compounds, tautomers and stereoisomeric forms thereof, and the free bases, any pharmaceutically acceptable salts, and the solvates thereof.
[0234] In some embodiments, provided is a pharmaceutical composition comprising a pharmaceutically acceptable carrier, and as active ingredient a therapeutically effective amount of a combination as described in any of the other embodiments.
[0235] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and optionally, at least one other antineoplastic agent.
[0236] According to embodiments, the menin-MLL inhibitor is a compound of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof.
[0237] According to particular embodiments, the menin-MLL inhibitor is Compound A or a pharmaceutically acceptable salt or solvate thereof.
[0238] According to particular embodiments, the menin-MLL inhibitor is Compound Al.
[0239] According to particular embodiments, the menin-MLL inhibitor is Compound A2.
[0240] According to particular embodiments, the menin-MLL inhibitor is Compound A3.
[0241] According to particular embodiments, the menin-MLL inhibitor is Compound A4-a or a solvate thereof.
[0242] According to particular embodiments, the menin-MLL inhibitor is Compound A4-b or a hydrate thereof.
[0243] According to particular embodiments, the menin-MLL inhibitor is Compound A4.
[0244] In particular embodiments, the menin-MLL inhibitor may have improved metabolic stability properties.
[0245] In particular embodiments, the menin-MLL inhibitor may have extended in vivo half-life (T1/2).
[0246] In particular embodiments, the menin-MLL inhibitor may have improved oral bioavailability.
[0247] In particular embodiments, the menin-MLL inhibitor may reduce tumor growth e.g., tumors harbouring MILL (KMT2A) gene rearrangements/alterations and/or NPM1 mutations.
[0248] In particular embodiments, the menin-MLL inhibitor may have improved PD
properties in vivo during a prolonged period of time, e.g. inhibition of target gene expression such as IVLEIS1 and upregulation of differentiation marker over a period of at least 16 hours.
[0249] In particular embodiments, the menin-MLL inhibitor may have an improved safety profile (e.g., reduced hERG inhibition; improved cardiovascular safety).
[0250] In particular embodiments, the menin-MLL inhibitor may be suitable for Q.D. dosing (once daily).
[0251] According to embodiments, the BCL-2 inhibitor is selected from obatoclax, HA14-1, navitoclax, ABT-737, TW-37, AT 1 0 1, sabutoclax, gamgogic acid and venetoclax, or pharmaceutically acceptable salts or solvates thereof.
[0252] According to particular embodiments, the BCL-2 inhibitor is venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0253] According to embodiments, at least one other antineoplastic agent is a hypomethylating agent, a DNA intercalating agent, a pyrimidine analog, a purine analog, a kinase inhibitor, a CD20 inhibitor, an 1DH inhibitor, immunomodulatory antineoplastic agent or a DHODH
inhibitor.
[0254] According to embodiments, at least one other antineoplastic agent is a hypomethylating agent, a DNA intercalating agent, a pyrimidine analog, a purine analog, a kinase inhibitor, a CD20 inhibitor, an isocitrate dehydrogenase (IDH) inhibitor.
[0255] According to embodiments, the hypomethylating agent includes, but is not limited to, azacitidine, decitabine, or pharmaceutically acceptable salts or solvates thereof.
[0256] According to embodiments, the DNA intercalating agent includes, but is not limited to, an anthracycline (e.g., daunorubicin, doxorubicin, idarubicin).
[0257] According to embodiments, the DNA intercalating agent is daunorubicin.
[0258] According to embodiments, the DNA intercalating agent is doxorubicin.
[0259] According to embodiments, the DNA intercalating agent is idarubicin.
[0260] According to embodiments, the pyrimidine analog includes, but is not limited to, cytarabine (ARA-C).
[0261] According to embodiments, the purine analog is fiudarabine.
[0262] According to embodiments, the kinase inhibitor is a FLT-3 inhibitor, a BTK inhibitor, an ABL inhibitor, an Aurora inhibitor or a multi-kinase inhibitor of two or more kinase inhibitors thereof [0263] According to embodiments, the kinase inhibitor is a multi-kinase inhibitor of FLT-3 inhibitor, ABL inhibitor, and Aurora inhibitor. According to embodiments, such multi-kinase inhibitor includes, but is not limited to KW-2449.
[0264] According to embodiments, the kinase inhibitor is a tyrosine kinase inhibitor.
[0265] According to embodiments, the tyrosine kinase inhibitor is a FLT-3 inhibitor or a BTK
inhibitor.
[0266] According to embodiments, the FLT3 inhibitor includes, but is not limited to, sorafenib, sunitinib, midostaurin (PKC412), lestaurtinib (CEP-701), tandutinib (MLN518), quizartinib (AC220), gilteritinib (ASP2215), and KW-2449.
[0267] According to embodiments, the BTK inhibitor includes, but is not limited to, ibrutinib.
[0268] According to embodiments, the CD20 inhibitor includes, but is not limited to, an anti-CD20 antibody (e.g., obinutuzumab (GA101)).
[0269] According to embodiments, the 1DH inhibitor includes, but is not limited to, ivosidenib and enasidenib.
[0270] According to embodiments, the isocitrate dehydrogenase-1 inhibitor includes, but is not limited to, ivosidenib.
[0271] According to embodiments, the isocitrate dehydrogenase-2 inhibitor includes, but is not limited to, enasidenib.
[0272] According to embodiments, the immunomodulatory antineoplastic agent includes, but is not limited to, PD-1 inhibitors (e.g., nivolumab, atezolizumab and pembrolizumab), thalidomide, lenalidomide, pomalidomide, Bacillus Calmette¨Guerin (BCG) and levami sole.
[0273] According to embodiments, the PD-1 inhibitor includes, but is not limited to, nivolumab, atezolizumab and pembrolizumab.
[0274] According to embodiments, the DHODH inhibitor includes, but is not limited to, a compound having the structure of Formula (Z):
R.1 XT( (Z), wherein Xis CH or N;
Y is CH or N;
R1 is selected from the group consisting of: Ci_6alky1; Ci_6alkyl substituted with OH, or OCH3; C2_6alkenyl; Ci_6haloa1kyl; Ci_6ha1oalkyl substituted with OH, or OCH3;
6haloalkenyl; N(CH3)2; C3_6cyc1oalkyl; C3_6cycloalkyl substituted with Ci_6alkyl; and phenyl, Rb NK
N ¨Ra R2 is 0 wherein Rd is selected from the group consisting of: Ci_6alkyl, C1_6haloalkyl, and C3_6cycloalkyl;
Rb is Ci_6a1kyl or Ci_6alkyl substituted with a member selected from the group consisting of:
OH, halo, CN, OCi_6alkyl, OCi_6haloalkyl and 0C3_6cycloalkyl;
R3 is selected from the group consisting of: H, halo, CH3 and OCH3;
R4 is selected from the group consisting of:
= C1_6alkyl; Ci_6alkyl substituted with one or two OCH3; C3-6cycloalkyl; C3-6cycloalkyl substituted with CH3, or OCH3; CH2-C3_6cycloalkyl; and (ReL_ = - Rd (RG
IRc< N Re\ Rc [1 N
I I
= Rd, N Rd NRd,N N
and and Rc Rc Rc¨<\I R9 ¨N
= NRd N Rd and µN---". Rd wherein each RC is independently selected from the group consisting of: H; halo;
C1_6alkyl; C1_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci_6haloalkyl; Ci_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; NO2; OH; 0-CH2CH2OH; and OCi_6a1kyl;
Rd is selected from the group consisting of: H; halo; Ci_6alkyl; Ci_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3;
C1_6haloalkyl; C1_6haloa1kyl substituted with a member selected from the group consisting of: OH, and OCH3; CN; and OCi_6alkyl;
Rg is selected from the group consisting of: H; Ci_6alkyl; Ci_6alkyl substituted with a member selected from the group consisting of. OH, OCH3, SCH3, and OCF3, Ci-6haloalkyl; and Ci_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and n is 1, or 2;
or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof;
or a compound selected from HO
N-' - \
r F-HC
N
N. \
.N
F HO
I N
N
ci [rya rIO
_,õ
N
or a pharmaceutically acceptable salt, N-oxide, solvate, or stereoisomer thereof [0275] According to embodiments, the DHODH inhibitor includes, but is not limited to, a compound having the structure of Formula (Z):
X i R2 N
Fcr (Z), wherein Xis CH or N;
Y is CH or N;
R1 is selected from the group consisting of: Ci_6alkyl; Ci_6alkyl substituted with OH, or OCH3; C2_6alkenyl; Ci_6haloalkyl; Ci_6haloalkyl substituted with OH, or OCH3;
6haloalkenyl; N(CH3)2; C3_6cyc1oalkyl; C3_6cycloalkyl substituted with C1_6alkyl; and phenyl;
Rb N
N ¨1Ra ,k \I
R2 is 0 ; wherein Ra is selected from the group consisting of: C1_6alkyl, C1_6haloalkyl, and C3_6cycloalky1;
Rb is C1_6alkyl or C1_6a1kyl substituted with a member selected from the group consisting of:
OH, halo, CN, OC1_6alkyl, 0C1_6haloalkyl and 0C3_6cycloa1kyl;
R3 is selected from the group consisting of: H, halo, CH3 and OCH3;
R4 is selected from the group consisting of:
= C1_6alkyl; C1_6alky1 substituted with one or two OCH3; C3-6cycloalkyl; C3-6cycloalkyl substituted with CH3, or OCH3; CH2-C3_6cycloalkyl; and =
(Rc = Rd =
(Rc IRc< N Rcv__ Rc N I
N
= Rd, Rd, N Rd N Rd, N N N
N
and and Rc Rc S
Rc¨<, IRg¨N
= A s ; - N Rd , and N Rd wherein each It' is independently selected from the group consisting of. H, halo, C1_6alkyl, C1_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; C1_6haloalkyl; C1_6ha1oa1ky1 substituted with a member selected from the group consisting of: OH, and OCH3; NO2; OH; 0-CH2CH2OH; and 0C1_6a1kyl;
Rd is selected from the group consisting of: H; halo; Ci_6alkyl; C1_6alkyl substituted with a member selected from the group consisting of. OH, OCH3, SCH3, and OCF3;
C1_6haloalkyl; C1_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; CN; and OCi_6alkyl;
Rg is selected from the group consisting of: H; Ci_oalkyl; Ci_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci-6haloalkyl; and Ci_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and n is 1, or 2;
or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0276] In the context of Formula (Z), the following definitions apply:
[0277] The term ''alkenyl" includes unsaturated aliphatic groups analogous in length and possible substitution to the alkyls described above, but that contain at least one double bond.
For example, the term "alkenyl" includes straight-chain alkenyl groups (e.g., ethenyl, propenyl, butenyl, pentenyl, hexenyl, heptenyl, octenyl, nonenyl, decenyl, etc.). The term alkenyl further includes alkenyl groups which include oxygen, nitrogen, sulfur or phosphorous atoms replacing one or more carbons of the hydrocarbon backbone. In certain embodiments, a straight chain or branched chain alkenyl group has 6 or fewer carbon atoms in its backbone (e.g., C2-6 for straight chain, C3-6 for branched chain).
[0278] The term "haloalkyl" refers to a straight- or branched-chain alkyl group having from 1 to 6 carbon atoms in the chain optionally substituting hydrogens with halogens. The term "CI-6 haloalkyl" as used here refers to a straight- or branched-chain alkyl group having from 1 to 6 carbon atoms in the chain, optionally substituting hydrogens with halogens.
The term "Ci-4 haloalkyl" as used here refers to a straight- or branched-chain alkyl group having from 1 to 4 carbon atoms in the chain, optionally substituting hydrogens with halogens.
Examples of "haloalkyl" groups include trifluoromethyl (CF3), difluoromethyl (CF2H), monofluoromethyl (CH2F), pentafluoroethyl (CF2CF3), tetrafluoroethyl (CHFCF3), monofluoroethyl (CH2CH2F), trifluoroethyl (CH2CF3), tetrafluorotrifluoromethylethyl (CF(CF3)2), and groups that in light of the ordinary skill in the art and the teachings provided herein would be considered equivalent to any one of the foregoing examples.
[0279] The term ''haloalkenyl" includes unsaturated aliphatic groups analogous in length and possible substitution to the alkyls described above, but that contain at least one double bond and having from 1 to 6 carbon atoms in the chain optionally substituting hydrogens with halogens.
[0280] The term "aryl" refers to a monocyclic, aromatic carbocycle (ring structure having ring atoms that are all carbon) having 6 atoms per ring. (Carbon atoms in the aryl groups are sp2 hybridized.) [0281] The term "heteroaryl" refers to a monocyclic or fused bicyclic heterocycle (ring structure having ring atoms selected from carbon atoms and up to four heteroatoms selected from nitrogen, oxygen, and sulfur) having from 3 to 9 ring atoms per heterocycle. Illustrative examples of heteroaryl groups include the following entities, in the form of properly bonded moieties:
,S
N
\ ¨ / N
I ' I I
t N , , and [0282] Those skilled in the art will recognize that the species listed or illustrated above are not exhaustive, and that additional species within the scope of these defined terms may also be selected.
[0283] The term "variable point of attachment" means that a group is allowed to be attached at more than one alternative position in a structure. The attachment will always replace a hydrogen atom on one of the ring atoms. In other words, all permutations of bonding are represented by the single diagram, as shown in the illustrations below.
N
r R N N )zz_, represent y- , Or [0284] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein X is CH.
[0285] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein X is N.
[0286] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein Y is CH.
[0287] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein Y is N.
[0288] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein Rl is C1_4alkyl; C1_4alkyl substituted with OH, or OCH3;
C2_4a1keny1; Ci_4ha1oa1ky1;
C1_4haloalkyl substituted with OH, or OCH3; C2_4haloalkenyl; N(CH3)2;
cyclopropyl;
cyclopropyl substituted with Ci_zialkyl; or phenyl.
[0289] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein RI is CH3, CH2CH3, / 0 _______ F, \N _____________ F
, Or F
[0290] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula F
,or -L4 (Z) wherein R1 is [0291] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein Rb I N¨Re N
wherein Rb is Ci_4a1kyl substituted with OH, halo, CN, OC1_4a1kyl, OCi4haloalkyl or 0C3_6cycloalkyl; and Ra is Ci-talkyl, Ci-thaloalkyl, or C3_6cyc1oalky1.
[0292] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula HO
N
) N
N
(Z) wherein R2 is 0 [0293] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R3 is H.
[0294] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R3 is F.
[0295] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R3 is CH3.
[0296] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R3 is OCH3.
[0297] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R4 is CD\sµ 0 , or [0298] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein (Rc R4 is Rd ;wherein each RC is independently selected from the group consisting of: H; halo;
C1_4alkyl, CI
-alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci_4haloalkyl; C1_4haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and NO2;
Rd is selected from the group consisting of: H; halo; Ci_zialkyl; Ci_zialkyl substituted with OH, OCH3, SCH3, or OCF3; Ci_4haloalkyl; Ci-ihaloalkyl substituted with OH, or OCH3;
or OCI-4alkyl; CN; and OCI-6alkyl; and n is 1, or 2.
[0299] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein (Rc R4 is Rd ;
each Rc is independently selected from the group consisting of: H, halo, Ci_4a1kyl, Ci_4haloalkyl, NO2, 0-CH2CH2OH, and OCi4alkyl;
Rd is selected from the group consisting of: H, halo, C1_4alkyl, CN, and OCi_6alkyl; and f/ is 1, or 2.
[0300] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R4 is F ' CI ' DQFO
0 ' CI
F CI , CI F
oI
oI F
0:
, CI , F ' CI ' CI , CI , CI , or .- --- , HO
103011 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula CI
(Z) wherein le is or F=
103021 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein c Rc,<Nµ, Rc .. (R
\ _ Rc N `z, N ''--I
U.. --- ---. --i--..
R4 is -'"---7-'Rd I.L.-C"'-'-' Rd N ',,,d N R-d , , , N N-N
II '-N .-- ft,,,,,, .
, or wherein each Re is independently selected from the group consisting of: H; halo;
Ci_4alkyl; Ci_alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci_4haloalkyl; Ci_4haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and Rd is selected from the group consisting of:
halo;
C1_4alky1; C1-4alkyl substituted with OH, OCH3, SCH3, or OCF3; Ci_4haloalkyl;
Ci-4haloalkyl substituted with OH, or OCH3; or 0C1_4alkyl; CN; and 0C1_6alky1.
103031 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein IR
(F2' Rc><N...,,,µ, IR\
n N
_, I ,---`-'.---"- ------N -1 ,õ-r21 I _, I. ..--, II ------_------------ d N'------''Rd N''¨' Rd 1\( -- ''- N ---9- N -- ---R4 is ..'",---;----.."-Rd - R
, , , NN
or ----%---- ; wherein each RC is independently selected from the group consisting of: H, halo, C1_4a1kyl, Ci_4haloalkyl, OC1_4a1ky1, and OH;
Rd is selected from the group consisting of: halo, Ci-talkyl, and CI-alkyl;
and ri is 1, or 2.
103041 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R4 is I
, -(21 CI
N[
NK NNO' NC I
I , oI
N , N ,N N ,N N
CI CI
HO N CN NN
I I
N, N , , or HO
.
103051 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula c NI)/ 5' (Z) wherein R4 is \-103061 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein Re Rc RC I R9¨N
R4 is NRd, N Rd , orRd , wherein Re is H; halo; Ci_4alkyl; Ci_4alkyl substituted with OH, OCH3, SCH3, or OCF3;
Cl_4haloalkyl; C1_4haloa1kyl substituted with OH, or OCH3; or CI-alkyl;
Rd is halo; CI-alkyl; Ci-talkyl substituted with OH, OCH3, SCH3, or OCF3; Ci-thaloalkyl;
or C1_4haloalky1 substituted with OH, or OCH3; and Rg is H; Ci_4alkyl; Ci_4alkyl substituted with OH, OCH3, SCH3, or OCF3;
Ci_4haloalkyl; or C1_4haloalkyl substituted with OH, or OCH3.
103071 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein S
F2c¨I Rg¨N
R4 is N Rd , N Rd , or snr"---'-- a =
R , wherein Re is H or halo;
Rd is C1_4alkyl; and Rg is H.
103081 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula CI
S
N I
HN, \S"-, , µ1\1-- , or N =
(Z) wherein R4 is N
103091 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) selected from the group consisting of:
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-(prop-1-en-2-y1)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-phenylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1, 2,4-tri azol -1-y1)-4-(prop-1-en-2-yl)i soquinol in-1(21-1)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1, 2,4-triazol-1-y1)-4-(3,3,3 -trifluoroprop-1-en-2-yl)isoquinolin-1(2H)-one, 2-(2,6-Dichloropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-4-(1-methylcy el opropyl)isoquinolin-1(2H)-one, 2-(2,6-Dichloropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-4-(prop-1-en-2-yl)isoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-4-cyclopropy1-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4,5-di hydro-1H-1,2,4-tri azol-1-yl)i soquinolin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-44 sopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxym ethyl)-5 -oxo-4,5-di hy dro-1H- 1,2,4-triazol-1-y1)-4-(prop- 1-en-2-y1)-2-(2-(trifluoromethyl)phenyl)isoquinolin- 1(2H)-one;
2-(6-(4-Ethy1-3 -(hydroxymethyl)-5-oxo-4, 5 -dihydro- 1H- 1,2,4-tri azol - 1 -y1)- 1 -oxo-4-(prop- 1-en-2-yl)i soquinolin-2(1H)-yl)benzonitrile;
2-(2-Chloropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-4-(prop- 1-en-2-yl)i soquinolin-1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-4-(prop- 1 -en-2-y1)-2-(o-tolyl)i soquinolin-1(2H)-one;
2-(2-Chloropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol- 1 -y1)-4-i sopropylphthal azin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-44 sopropylphthal azin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-4-i sopropylphthalazin- 1 (2H)-one;
4-Ethyl-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihy dro- 1H- 1,2,4-tri azol-1 -y1)-2-(3 -fluorophenyl)phthalazin-1(2H)-one;
4-Ethyl-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihy dro- 1H- 1,2,4-tri azol-1 -y1)-2-(o-tolyl)phthalazin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihy dro- 1H- 1,2,4-triazol- 1-y1)-7-fl uoro-4-sopropy1-2-(o-tolyl)i soquinolin- 1 (2H)-one, 2-(2-Chl oro-4-m ethyl pyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-4-(1-methyl cyclopropyl)i soquinol in- i(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-(2-hydroxypropan-2-ypisoquinolin- 1(2H)-one;
4-(Dimethylamino)-6-(4-ethyl -3 -(hydroxymethyl)-5-oxo-4,5-dihydro- 1H- 1,2,4-triazol-1 -y1)-2-(o-tolypi soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-7-fluoro-4-(prop- 1-en-2-yl)phthal azin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-7-methoxy-4-(prop- 1-en-2-yl)phthal azi n- 1 (2H)-one;
2-(5 -Chl oro-3 -m ethyl - 1H-pyrazol-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -di hydro- 11/-1,2,4-triazol- 1 -y1)-7-fluoro-4-isopropyli soqui nolin- 1(2H)-one;
2-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihy dro- 1H- 1,2,4-triazol- 1-y1)-3-fl uoro-8-(prop- 1-en-2-y1)-6-(o-toly1)- 1, 6-naphthyri din- 5(611)-one;
2-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fluoro-8-methy1-6-(o-toly1)pyri do[2, 3 -d]pyridazin-5(611)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fluoro-8-isopropy1-6-(o-toly1)pyrido12,3-d]pyridazin-5(611)-one;
6-(2-Chl oro-6-fluoropheny1)-2-(4-ethy1-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-tri azol- 1-y1)-3 -fluoro-8 -(prop- 1-en-2-y1)- 1,6-naphthyri din- 5(6H)-one;
6-(2-Chl oro-6-fluoropheny1)-2-(4-ethy1-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-tri azol- 1-y1)-3 -fluoro-8 sopropy1-1,6-naphthyridin-5(6H)-one;
(S)-2-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihydro- 111- 1,2,4-triazol- 1-y1)-3 -fluoro-6-(o-toly1)-8-(1, 1, 1 -trifluoropropan-2-y1)-1,6-naphthyridin-5 (611)-one;
(R)-2-(4-Ethyl-3 -(hydroxym ethyl)- 5 -oxo-4, 5-dihydro- 1H- 1,2,4-tri azol- 1-y1)-3 -fluoro-6-(o-toly1)-8-(1, 1, 1 -trifluoropropan-2-y1)-1,6-naphthyridin-5 (611)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(4-methylthiazol -5 -yl)i soquinolin-1(2H)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fluoro-8-i sopropy1-6-(o-toly1)- 1,6-naphthyridin-5(6H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-5-methylpheny1)-4-i sopropylisoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-5-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1(2H)-one;
2-(2-Chl oro-5-m ethyl pheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro- 1H-1,2,4-triazol- 1-y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro- 5-methoxypheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
2-(2-Chl oropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-(prop- 1-en-2-y1)-2-(o-tolypi soquinolin- 1 (2H)-one;
2-(2-Chloro-5-methoxypheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihy dro-1,2,4-triazol- 1-y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin- 1 (2H)-one;
racemi c-4-(sec-Buty1)-2-(2-chl oro-6-fluoropheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol- 1-y1)-7-fluoroi soquinolin- 1(2H)-one;
2-(3 -Chloro-6-methoxypyridin-2-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro- 1H-1,2,4-triazol- 1 -y1)-7-fluoro-4-i sopropyli soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(2-methoxy-4-m ethylpyri din-3 -yl)i soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoro-3 -methoxypheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, di hydro- 1H-1,2,4-triazol- 1 -y1)-7-fluoro-4-(prop-1-en-2-yl)isoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1,2,4-triazol- 1-y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(o-toly1)phthalazin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-7-fluoro-4-i sopropylphthalazin-1(2H)-one;
Racemic 6-(4-Ethyl-3-(hydroxymethyl)-5-oxo-4,5 -dihydro-1H- 1,2,4-triazol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)phthalazin-1 (2H)-one;
(S*)-6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)phthalazin-1 (2H)-one;
(R *)-6-(4-Ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro- 1H- 1,2,4-tri azol- 1 -y1)-'7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)phthalazin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hy droxymethyl)-5-oxo-4, 5 -dihydro-1,2,4-tri azol- 1-y1)-7-fluoro-4-( 1-methyl cycl opropyl)i soquinolin- i(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-methoxy-4-methylpyridin-3-y1)-4-(prop- 1-en-2-yl)isoquinolin- 1(2H)-one;
2-(5 -Chl oro-3 -m ethyl - 1H-pyrazol-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -di hydro- 1H-1,2,4-triazol- 1 -y1)-7-fluoro-4-(prop-1-en-2-yl)isoquinolin-1(2H)-one;
2-(3-Chloro-2-methoxy-5-methylpyridin-4-y1)-6-(4-ethy1-3 -(hydroxymethyl)- 5 -oxo-4, 5 -dihydro- 1H- 1,2,4-triazol- 1 -y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
2-(3-Chloro-2-methoxy-5-methylpyridin-4-y1)-6-(4-ethy1-3 -(hydroxymethyl)- 5 -oxo-4, 5-dihydro-1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin-1(21-1)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro- 5-methoxypheny1)-4-i sopropylisoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(4-fluoro-2-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one;
2-(2-Chloro-3-(2-hydroxyethoxy)pheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, di hydro- 1H-1,2,4-triazol- 1 -y1)-7-fluoro-4-(prop-1-en-2-yl)isoquinolin-1(2H)-one, 6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fl uoro-2-(2-fluoropheny1)-4-(prop- 1 -en-2-yl)i soquinolin-1 (2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(5-fluoro-2-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one;
2-(2, 5-Difluoropheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-i sopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-6-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one, 2-(2-Chloro-3-methoxypheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5-dihy dro-1, 2,4-triazol- 1-y1)- 7-fluoro-4-(prop- 1-en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(2-methoxy-3, 5 -dimethylpyridin-4-y1)-4-(prop- 1 -en-2-yl)isoquinolin- 1(2H)-one;
2-(2, 5-Difluoropheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-6-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(3 -fluoro-2-methylpheny1)-4-i sopropylisoquinolin- 1(2H)-one;
2-(2, 5-Dimethylpheny1)-6-(4-ethyl-3 -(hy droxymethyl)-5 -oxo-4,5 -dihy dro-1H- 1,2,4-triazol- 1 -y1)-7-fluoro-4-i sopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(4-fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoropheny1)-44 sopropyli soquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(2-methoxy-3,5-dimethylpyridin-4-y1)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-methy1-4-(prop- 1-en-2-y1)-2-(o-tolyl)i soquinolin- 1 (2H)-one;
2-(2-Chloro-6-fluoro-3 -methoxypheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, di hydro- 1H-1,2,4-tri azol- 1 -y1)-7-fluoro-44 sopropyli soquinolin- 1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(o-toly1)-4-(3 ,3,3-trifluoroprop-1-en-2-yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-2-(5 -fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-methoxypheny1)-4-(prop- 1 -en-2-yl)i soquinolin- 1(2H)-one;
2-(2-Chl oro-5-m ethylpyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol- 1-y1)-7-fluoro-4-(prop-1-en-2-yl)i soqui nolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(5-fluoro-2-methoxypyridin-4-y1)-4-(prop-1 -en-2-yl)i soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(3 -fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
2-(2, 5-Dimethylpheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soquinolin- 1(2H)-one;
Racemic-6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro- 1H- 1,2,4-tri azol- 1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-2-(2-ethylpheny1)-7-fluoro-44 sopropyli soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(2-methoxypyridin-3-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(5-fluoro-2-methoxypyridin-4-y1)-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chl oro-5-m ethylpyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihy dro-1H- 1,2,4-tri azol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one, 6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(2-(methyl-d3)phenypi soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(4-methylpyrimi din-5 -yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(2-methoxyphenypi soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(3 -fluoro-6-methoxypyridin-2-y1)-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(3-methylpyrazin-2-yl)i soquinolin- 1(2H)-one;
2-(2-C hl oro-5-m ethyl pyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one, 2-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-3-flu oro-6-(2-fluoro- 5-methylpheny1)-8-i sopropyl- 1, 6-naphthyridin- 5(611)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro 4-isopropy1-2-(4-methylpyridazin-3-yl)isoquinolin-1(2H)-one;
(S)-6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4, 5 -dihydro- 1H- 1,2,4-triazol- 1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2 -yl)isoquinolin-1(2H)-one;
(R)-6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro-1H-1,2,4-triazol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2 -yl)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropyl-2-(2-(trifluoromethyl)phenyl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(5-methylpyrimi din-4 -yl)isoquinolin-1(2H)-one;
2-(2-(Difluoromethyl)pheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1, 2,4-triazol- 1-y1)-7-fluoro-4 sopropylisoquinolin-1(2H)-one;
2-(3 -Chloro-2-methoxypyridin-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-di hydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoro-44 sopropyli soquinolin-1 (2H)-one;
2-Cy clohexy1-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro-1H-1,2,4-tri azol- 1-y1)-7-fl uoro-4-isopropylisoquinolin-1(2H)-one;
2-(3 -Chloro-6-methylpyridin-2-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-tri azol- 1-y1)-7-fluoro-4-i sopropyli soquinolin-1 (2H)-one, 2-Cy clopenty1-6-(4-ethy1-3 -(hy droxy methyl)-5 -oxo-4, 5 -dihy dro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-i sopropylisoquinolin-1(2H)-one, 2-(3 -Chloro-4-methoxypyridin-2-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-di hydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-((1R,2 S)-2-methylcyclohexyl)isoquinolin-1(2H)-one;
2-(1,3-Dimethoxypropan-2-y1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro-111-1, 2,4-triazol- 1-y1)-7-fluoro-4 sopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(2-methoxy-5 -methylpyridin-4-yl)i soquinolin-1 (2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-111-1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(( 1S,21?)-2-methylcyclohexypisoquinolin-1(2H)-one;
2-(Cyclopropylmethyl)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro-1H-1,2,4-triazol-1 -y1)-7-fluoro-4-i sopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-4-sopropy1-2-(1-methoxybutan-2-yl)i soquinolin- 1(2H)-one;
2-(2-Chloropheny1)-6-(4-ethyl-3 -(hy droxymethyl)-5-oxo-4, 5 -dihy dro-111-1,2,4-triazol-1 -y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropyl-2-(3-methylpyridin-2-y1)i soquinolin- 1(2H)-one;
Racemic 6-(4-Ethyl-3-(hy droxymethyl)-5-oxo-4,5 -dihydro-1H- 1,2,4-triazol-1 -y1)-7-fluoro-4-isopropy1-2-((ci s)-3 -methoxycycl opentyl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-241R*,2R*)-2-methylcyclohexyl)i soquinolin- 1 (2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-((1 S*,2 S*)-2-methy1cyc1ohexy1)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(pentan-3 -yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(( 1R*, 2R*)-2-methy1cyc1openty1)isoquino1in- 1 (2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-241 S*,2S*)-2-methylcyclopentyl)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2((1R*,2S*)-2-methylcyclopentyl)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-((1 S*,2R*)-2-methylcyclopentyl)isoquinolin- 1(2H)-one;
Racemic 6-(4-Ethyl-3-(hy droxymethyl)-5-oxo-4,5 -dihydro-1H- 1,2,4-triazol-1 -y1)-7-fluoro-4-isopropy1-2-((ci s)-3 -methoxycycl ohexyl)isoquinolin- 1(2H)-one;
2-(Bicycl o[2. 2.1 ]heptan- 1-y1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihy dro-/H-1,2,4-tri azol- 1-y1)-7-fluoro-4-isopropylisoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(2-methoxy-3 -m ethylpyri din-4-yl)isoquinolin- 1(2H)-one;
2-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-3-fluoro-8-i sopropy1-6-(2-methoxypheny1)- 1, 6-naphthyri din-5 (61J)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(3-methylisothiazol-4-ypisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(5-methylisothiazol-4-y1)isoquinolin-1(2H)-one;
2-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-3-flu oro-8-sopropy1-6-(2-(trifluoromethyl)pheny1)- 1, 6-naphthyri din-5 (61/)-one;
2-(3,6-Dimethylpyridin-2-y1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4, 5 -dihy dro-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
2-(2,5-Dimethylpyridin-4-y1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropyl-2-(4-methylpyridin-3-y1)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(3-methylpyridin-4-y1)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropyl-2-(2-methylpyridin-3-y1)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-IH-1,2,4-triazol-1-y1)-7-fluoro-2-(2-hydroxy-5-methylpyridin-4-y1)-4-isopropylisoquinolin-1(2H)-one;
6-(2-(Difluoromethyl)pheny1)-2-(4-ethyl-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-3-fluoro-8-isopropy1-1,6-naphthyridin-5(611)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(2-hydroxy-3-methylpyridin-4-y1)-4-isopropylisoquinolin-1(2H)-one; and 2-(4-Ethyl-3 -(hy droxym ethyl)-5 -oxo-4, 5 -di hy dro- 1H-1,2,4-triazol-1 -y1)-3 -fluoro-8 -isopropy1-6-(o-D3-toly1)-1,6-naphthyridin-5(6H)-one;
and, optionally, one or more of pharmaceutically acceptable salts, isotopes, N-oxides, solvates, and stereoisomers thereof.
103101 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) selected from the group consisting of:
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-(prop-1-en-2-y1)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-IH-1,2,4-triazol-1-y1)-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-phenylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-4-(prop-1-en-2-y1)isoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-IH-1, 2,4-triazol- 1-y1)-4-(3 ,3,3 -trifluoroprop-1-en-2-yl)isoquinolin-1 (2H)-one;
2-(2,6-Dichloropheny1)-6-(4-ethy1-3-(hy droxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1 -y1)-4-(1 -methylcycl opropyl)isoquinolin-1(2H)-one;
2-(2, 6-Di chl oropheny1)-6-(4-ethy1-3 -(hy droxymethyl)-5-oxo-4, 5 -dihydro-1H- 1,2,4-triazol-1 -y1)-4-(prop- 1-en-2-yl)i soquinolin-1 (2H)-one;
2-(2-Chloro-6-fluoropheny1)-4-cyclopropy1-6-(4-ethyl -3 -(hydroxymethyl)-5-oxo-4, 5 -dihydro- 1H-1,2,4-triazol- 1 -yl)i soquinolin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1,2,4-tri azol- 1-y1)-7-fluoro-4-i sopropyli soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-4-(prop- 1 -en-2-y1)-2-(2-(trifluoromethyl)phenyl)isoquinolin- 1(2H)-one;
2-(6-(4-Ethy1-3 -(hydroxymethyl)-5-oxo-4, 5 -dihydro- 1H- 1,2,4-triazol- 1-y1)-1 -oxo-4-(prop- 1-en-2-yl)i soquinolin-2(1H)-yl)benzonitrile;
2-(2-Chloropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-4-(prop- soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-4-(prop- 1 -en-2-y1)-2-(o-tolyl)i soquinolin-1(2H)-one;
2-(2-Chloropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-4-i sopropylphthal azin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-isopropylphthalazin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-4-i sopropylphthalazin-1 (2H)-one;
4-Ethyl-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihy dro- 1H-1,2,4-tri azol-1 -y1)-2-(3 -fluorophenyl)phthalazin-1(2H)-one;
4-Ethyl-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihy dro- 1H-1,2,4-tri azol-1 -y1)-2-(o-tolyl)phthalazin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(o-tolyl)i soquinolin- 1 (2H)-one;
2-(2-Chl oro-4-m ethyl pyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-4-(1-methyl cyclopropyl)i soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-2-(3 -fluoropheny1)-4-(2-hydroxypropan-2-yl)i soquinolin- 1(2H)-one;
4-(Dimethylamino)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro- 1H-1,2,4-triazol-1 -y1)-2-(o-tolyl)i soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4 -ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihy dro-1H-1, 2,4-tri azol- 1 -y1)-7-fluoro-4 -(prop-1-en-2 -yl)phthalazin-1(2H)-one;
2-(2 -Chloro-6-fluoropheny1)-6-(4 -ethy1-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro-1H-1, 2,4-tri azol- 1 -y1)-7-methoxy-4-(prop- 1-en-2-yl)phthal azin-1 (2H)-one;
2-(5-Chloro-3 -m ethyl - 1H-pyrazol-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -di hydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoro-44 sopropyli soquinolin-1 (2H)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fluoro-8-(prop- 1 -en-2-y1)-6-(o-toly1)- 1, 6-naphthyri din- 5(611)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-3-fluoro-8-methy1-6-(o-tolyl)pyri do[2, 3 -d]pyridazin-5 (614)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fluoro-8-i sopropy1-6-(o-tolyl)pyrido [2,3 -di pyridazin-5 (611)-one;
6-(2-Chloro-6-fluoropheny1)-2-(4 -ethyl-3 -(hy droxyrnethyl)-5 -oxo-4, 5 -dihydro-1H-1, 2,4-tri azol- 1 -y1)-3 -fluoro-8 -(prop-1-en-2 -y1)- 1,6-naphthyri din-5(614)-one;
6-(2-Chloro-6-fluoropheny1)-2-(4 -ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro-1H-1, 2,4-triazol-1-y1)-3-fluoro-8-i sopropy1-1,6-naphthyridin-5(6H)-one;
(S)-2-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4, 5 -dihydro-111-1,2,4-tri azol- 1-y1)-3 -fluoro-6-(o-toly1)-8-(1 , 1, 1 -tri fluoropropan-2 -y1)- 1,6-naphthyridin-5 (614)-one;
(R)-2-(4-Ethyl-3 -(hydroxym ethyl)- 5 -oxo-4, 5-dihydro-111-1,2,4-tri azol-1 -y1)-3 -fluoro-6-(o-toly1)-8-(1, 1, 1 -trifluoropropan-2 -y1)-1,6-naphthyridin-5(614)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(4-methylthiazol -5 -yl)isoquinolin-1(2H)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-114- 1,2,4-triazol-1-y1)-3-fluoro-8-sopropy1-6-(o-toly1)- 1, 6-naphthyri din- 5(611)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(2-fluoro- 5-methylpheny1)-4-i sopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-5-methylpheny1)-4-(prop-1-en-2-y1)isoquinolin-1(2H)-one;
2-(2-C hl oro-5-m ethyl pheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro-1H-1, 2,4-triazol-1-y1)-7-fluoro-4 -(prop-1-en-2 -yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-2-(2-fluoro- 5-methoxypheny1)-4-(prop-1 -en-2-yl)isoquinolin-1(2H)-one;
2-(2-Chloropheny1)-6-(4-ethyl-3 -(hy droxymethyl)-5-oxo-4, 5 -dihy dro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-(prop-1-en-2-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihy dro-1H- 1,2,4-triazol-1-y1)-7-fl uoro-4-(prop- 1-en-2-y1)-2-(o-tolyl)i soquinolin-1 (2H)-one, 2-(2-Chloro-5-methoxypheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4,5-dihy dro-1, 2,4-triazol- 1-y1)-7-fluoro-4 -(prop-1-en-2 -yl)isoquinolin-1(2H)-one;
racemi c-4-(sec-Buty1)-2-(2-chl oro-6-fluoropheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoroi soquinoli n-1 (2H)-one;
2-(3 -Chloro-6-methoxypyridin-2-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-di hydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(2-methoxy-4-m ethylpyri din-3 -yl)i soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoro-3-methoxypheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5 -di hydro- 1H-1,2,4-tri azol-1-y1)-7-fluoro-4-(prop-1-en-2-y1)1 soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4 -ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro-1H-1, 2,4-triazol- 1-y1)-7-fluoro-4 -(prop-1-en-2 -yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(o-tolyl)phthalazin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4 -ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihy dro-1H-1, 2,4-tri azol- 1-y1)-7-fluoro-4 sopropylphthalazin-1(2H)-one;
Racemic 6-(4-Ethyl-3-(hy droxymethyl)-5-oxo-4,5 -dihydro-1H-1,2,4 -triazol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)phthalazin-1 (2H)-one;
(S*)-6-(4-Ethy1-3-(hydroxymethyl)-5 -oxo-4, 5-dihydro-1H- 1, 2,4 -triazol-1 -y1)- 7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2 -yl)phthalazin-1(2H)-one;
(R *)-6-(4-Ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hydro- 1H-1,2,4-tri azol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)phthalazin-1 (2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4 -ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1, 2,4-tri azol- 1 -y1)-7-fluoro-4 -(1-methyl cycl opropyl)i soquinolin- 1(21-1)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(2-methoxy-4-methylpyridin-3 -y1)-4-(prop- 1-en-2-yl)i soquinolin-1(2H)-one;
2-(5-Chloro-3 -m ethyl - 1H-pyrazol-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -di hydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoro-4-(prop-1 -en-2-yl)i soquinolin-1(2H)-one;
2-(3 -Chloro-2-methoxy-5-methylpyridin-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)- 5 -oxo-4, 5 -dihydro-1H- 1,2,4-triazol-1 -y1)-7-fluoro-4-isopropyli soquinolin- 1(2H)-one;
2-(3 -Chloro-2-methoxy-5-methylpyridin-4-y1)-6-(4-ethyl-3 -(hy droxymethyl)- 5 -oxo-4, 5-dihydro-1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro- 5-methoxypheny1)-4-isopropylisoquinolin- 1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(4-fluoro-2-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one;
2-(2-Chloro-3-(2-hydroxyethoxy)pheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, di hydro- 1H-1,2,4-tri azol- 1 -y1)-7-fluoro-4-(prop-1-en-2-yl)i soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoropheny1)-4-(prop- 1 -en-2-yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(5-fluoro-2-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one;
2-(2, 5-Difluoropheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-i sopropyli soquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-6-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one;
2-(2-Chloro-3-methoxypheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro-1,2,4-triazol- 1-y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-methoxy-3,5-dimethylpyridin-4-y1)-4-(prop- 1 -en-2-yl)isoquinolin- 1(2H)-one;
2-(2, 5-Difluoropheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-6-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(3 -fluoro-2-methylpheny1)-4-isopropylisoquinolin- 1(2H)-one;
2-(2, 5-Dimethylpheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(4-fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoropheny1)-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-4-i sopropy1-2-(2-methoxy-3 , 5-dimethylpyridin-4-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-methyl-4-(prop- 1-en-2-y1)-2-(o-tolyl)i soquinolin- 1 (2H)-one, 2-(2-Chloro-6-fluoro-3 -methoxypheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, di hydro- 1H- 1,2,4-tri azol- 1 -y1)-7-fluoro-4-i sopropyli soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(o-toly1)-4-(3 ,3,3-trifluoroprop- 1-en-2-yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(5 -fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(2-methoxypheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1(2H)-one;
2-(2-Chl oro-5-m ethyl pyri din-3 -y1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5-dihy dro-1H- 1,2,4-tri azol- 1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soqui nolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(5 -fluoro-2-methoxypyri din-4-y1)-4-(prop- 1 -en-2-yl)i soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(3 -fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
2-(2, 5-Dimethylpheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soquinolin- 1(2H)-one;
Racemic-6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihy dro- 1 H- 1,2,4-tri azol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-2-(2-ethylpheny1)-7-fluoro-44 sopropyli soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(2-methoxypyridin-3-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(5 -fluoro-2-methoxypyridin-4-y1)-4-i sopropyli soquinolin- 1 (2H)-one;
2-(2-Chl oro-5-m ethyl pyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(2-(methyl-d3)phenypi soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-sopropy1-2-(4-methylpyrimi din-5 -yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-4-sopropy1-2-(2-methoxyphenyl)i soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihy dro- 1H- 1,2,4-triazol- 1-y1)-7-fl uoro-2-(3 -fluoro-6-methoxypyridin-2-y1)-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(3-methylpyrazin-2-y1)isoquinolin-1(2H)-one;
2-(2 -C hl oro-5-m ethyl pyri din-3 -y1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-tri azol-1-y1)-7-fluoro-4-1 sopropyli soquinolin-1(2H)-one;
2-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-3-fluoro-6-(2-fluoro-5-methylpheny1)-8-i sopropyl- 1,6-naphthyridin-5(6H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro i sopropy1-2-(4-methylpyridazin-3-yl)isoquinolin-1(2H)-one;
(S)-6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihydro- 1H-1,2,4-triazol- 1-y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2 -yl)isoquinolin-1(2H)-one;
(R)-6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro-1H-1,2,4-tri azol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2 -yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(2-(trifluoromethyl)phenyl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(5-methylpyrimi din-4 -yl)isoquinolin-1(2H)-one;
2-(2-(Difluoromethyl)pheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihy dro-11/-1, 2,4-triazol-1-y1)-7-fluoro-44 sopropylisoquinolin-1(2H)-one;
2-(3 -Chloro-2-methoxypyridin-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-di hydro- 111-1,2,4-tri azol- 1-y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
2-Cy cl ohexy1-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro-111-1,2,4-tri azol- 1-y1)-7-fluoro-44 sopropyli soquinolin-1(2H)-one;
2-(3 -Chl oro-6-m ethyl pyri din-2-y1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-111-1,2,4-tri azol-1-y1)-7-fluoro-4-1 sopropyli soquinolin-1(2H)-one;
2-Cy cl openty1-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihy dro- 1H- 1,2,4-tri azol- 1-y1)-7-fluoro-4-i sopropylisoquinolin-1(2H)-one;
2-(3 -Chloro-4-methoxypyridin-2-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-di hydro- 1H-1,2,4-tri azol-1-y1)-7-fluoro-44 sopropyli soquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-((1R,2 S)-2-methylcyclohexyl)isoquinolin-1(2H)-one;
2-(1,3-Dimethoxypropan-2-y1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro-1, 2,4-tri azol- 1-y1)-7-fluoro-4 sopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihy dro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(2-methoxy-5-methylpyridin-4-yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-241S,2R)-2-methylcyclohexyl)isoquinolin- 1(2H)-one;
2-(Cyclopropylmethyl)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro-1H-1,2,4-triazol-1 -y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-sopropy1-2-(1-methoxybutan-2-yl)i soquinolin- 1(2H)-one;
2-(2-Chl oropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(3 -methylpyridin-2-yl)i soquinolin- i(2H)-one;
Racemic 6-(4-Ethyl-3-(hy droxymethyl)-5-oxo-4, 5 -dihydro-1H- 1,2,4-triazol-1 -y1)-7-fluoro-4-i sopropy1-2-((ci s)-3 -methoxycycl opentyl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-sopropy1-241R*,2R*)-2-methylcyclohexyl)i soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-sopropy1-2-((1 S*,2 S*)-2-methylcyclohexyl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fl uoro-4-i sopropy1-2-(pentan-3 -y1)) soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-sopropy1-241R*, 2R*)-2-methy1cyc1openty1)isoquino1in- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-((1 S*,2S*)-2-methylcyclopentyl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-241R*,2S*)-2-methylcyclopentyl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-((1 S*,2R*)-2-methylcyclopentyl)isoquinolin- 1(2H)-one;
Racemic 6-(4-Ethyl-3-(hy droxymethyl)-5-oxo-4, 5 -dihydro-1H- 1,2,4-triazol-1 -y1)-'7-fluoro-4-1 sopropy1-2-((ci s)-3 -methoxycycl ohexyl)isoquinolin- 1(2H)-one;
2-(Bicycl o [2. 2.1 ]heptan- 1-y1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihy dro-/H-1, 2,4-triazol- 1-y1)-7-fluoro-44 sopropylisoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-4-sopropy1-2-(2-methoxy-3 -methylpyridin-4-yl)isoquinolin-1(2H)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fl uoro-8-i sopropyl- 6-(2-m ethoxypheny1)- 1, 6-naphthyri din-5 (611)-one, 6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol-1 -y1)- 7-fl u oro-4-i sopropyl- 2 -(3 -methyl i sothi azol-4 -yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1,2 , 4 -tri azol- 1 -y1)- 7-flu oro-4-sopropyl- 2 -(5-methyl i sothi azol-4 -yl)isoquinolin-1(2H)-one;
2 -(4-Ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol-1 -y1)-3-flu oro- 8 -sopropyl- 6-(2-(trifluorom ethy 1)pheny1)- 1, 6-n aphthyri di n-5 (611)-one;
2 -(3 , 6-Dim ethyl pyri din-2-y1)- 6 -(4-ethy1-3 -(hy droxym ethyl)- 5 -oxo-4, 5 -di hy dro- 1H-1, 2, 4 -tri azol- 1-y1)- 7-fluoro-4 sopropyli soquinoli n- 1(2H)-one;
2-(2, 5-Dim ethyl pyri din-4-y1)- 6 -(4-ethy1-3 -(hy droxym ethyl)- 5 -oxo-4, 5 -di hy dro- 1H-1, 2, 4 -tri azol- 1 -y1)- 7-fluoro-4 sopropyli soquinoli n- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol- 1 -y1)- 7-flu oro-4-i sopropyl- 2 -(4-methyl pyridin-3 -yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol- 1 -y1)- 7-flu oro-4-i sopropyl- 2 -(3 -methyl pyridin-4-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol- 1 -y1)- 7-flu oro-4-sopropyl- 2 -(2-methyl pyridin-3 -yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol-1 -y1)- 7-fl u oro-2-(2-hy droxy-5 -m ethyl pyri din-4-y1)-4-i sopropyli soquinolin- 1(2H)-one;
6-(2-(Difluoromethyl)pheny1)-2-(4-ethyl-3 -(hydroxymethyl)-5 -ox o-4, 5 -di hy dro- 111-1, 2, 4 -tri az ol- 1 -y1)-3 -fluoro-8 sopropyl- 1 ,6-nap hthyri din- 5 (611)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol- 1 -y1)- 7-flu oro-2-(2-hy droxy-3 -m ethyl pyri din-4-y1)-4-i sopropyli soquinolin- 1(2H)-one; and 2-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -triazol-1 -y1)-3 -fluoro-8 sopropy1-6-(o-D3-toly1)- 1, 6-naphthyridin-5 (611)-one;
and, optionally, one or more of pharmaceutically acceptable salts, isotopes, N-oxides, solvates, and stereoisomers thereof; or a compound selected from:
2 -(2-Chl oro- 6 -fluoroph eny1)-6-(4 -ethy1-3 -(hy droxym ethyl)-5 -oxo-4, 5 -dihy dro- 1H-1, 2, 4 -tri azol- 1 -yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol- 1 -y1)-2-(2-fluoro-4-nitropheny1)-4-iodoi soquinolin- 1(2H)-one;
2 -(2-Chl oro- 6 -fluoroph eny1)-7-(4 -ethy1-3 -(hy droxym ethyl)-5 -oxo-4, 5 -dihy dro- 1H-1, 2, 4 -tri az ol- 1 -y1)- 6-fl uoro-4 -(prop- 1 -en-2 -yl)phthal azin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-7-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-6-methoxy-4-(prop-1-en-2-y1)phthalazin-1(2H)-one, or a pharmaceutically acceptable salt, N-oxide, solvate, or stereoisomer thereof.
103111 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) selected from the group consisting of:
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(o-toly1)isoquinolin-1(2H)-one;
2-(2-C hl oro-4-m ethyl pyri din-3 -y1)-6-(4-ethyl-3 -(hydroxy m ethyl)-5-oxo-4, 5-di hy dro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1, 2,4-triazol-1-y1)-4-(1 -methyl cyclopropyl)i soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxyrnethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-(prop-1-en-2-y1)phthalazin-1(2H)-one;
2-(4-Ethyl-3 -(hy droxym ethyl)-5 -oxo-4, 5 -di hy dro-1H-1,2,4-tri azol-1 -y1)-3 -fluoro-8 -isopropy1-6-(o-toly1)-1,6-naphthyridin-5(6H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(o-toly1)phthalazin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylphthalazin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(2-(methyl-d3)phenypisoquinolin-1(2H)-one;
(R)-6-(4-Ethyl-3 -(hydroxym ethyl)-5-oxo-4, 5-di hy dro-1H-1,2,4-tri azol -1 -y1)-7-fluoro-2-(o-toly1)-4-(1,1, 1 -trifluoropropan-2-yl)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-IH-1,2,4-triazol-1-y1)-7-fluoro-isopropyl-2-(2-(trifluoromethyl)phenypisoquinolin-1(2H)-one; and 2-(2-(Difluoromethyl)pheny1)-6-(4-ethyl -3 -(hy droxym ethyl)-5 -oxo-4, 5 -di hy dro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
and, optionally, one or more of pharmaceutically acceptable salts, isotopes, N-oxides, solvates, and stereoisomers thereof.
103121 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) having the Formula (Za):
, R4,,N
(Za), wherein Y is CH or N;
RI is selected from the group consisting of. C1_6alkyl; C1_6alkyl substituted with OH, or OCH3; C2_6alkeny1; Ch6haloalkyl; Ci_6haloa1kyl substituted with OH, or OCH3;
C2_6haloalkenyl; N(CH3)2; C3_6cycloalkyl; C3_6cyc1oalkyl substituted with Ci_6alkyl; and phenyl;
HO
N
N
\.N
R2 is 0 R3 is selected from the group consisting of: H, halo, CH3 and OCH3;
R4 is selected from the group consisting of:
C1_6alky1; Ci_6alky1 substituted with one or two OCH3; C3_6cyc1oalkyl;
C3_6cycloalky1 substituted with CH3, or OCH3; CH2-C3_6cycloalkyl; and (R
Rd ;
(Rc N Re\ Re N
N N N
Rd I I , Rd N Rd N Rd N
N
[I , and and RG Rc S
Rc¨<\ IRg¨N
-"-^ Rd ¨^ Rd .
N Rd , and wherein each It is independently selected from the group consisting of: H; halo;
Ci_6alkyl, Ci-6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci_6haloa1kyl; Ci_6haloalky1 substituted with a member selected from the group consisting of: OH, and OCH3; NO2; OH; 0-CH2CH2OH; and OCi-6alkyl;
Rd is selected from the group consisting of: H; halo; C1_6alkyl; Ci_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3;
C1_6haloalkyl; Ci_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; CN; and OCi_6alkyl;
Rg is selected from the group consisting of: H; Ci_6alkyl; Ci_6a1kyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci-6haloalkyl; and Ci_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and n is 1, or 2;
or a pharmaceutically acceptable salt, solvate, stereoisomer, isotopic variant, or N-oxide thereof.
[0313] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) having the Formula (Zb):
:R2 N =*". ---N
"I[ R3 (Zb), wherein Y is CH or N:
RI is selected from the group consisting of: Ch6alkyl, C16haloalkyl and C2_6alkenyl;
HO
N
N
R2 is 0 =
R3 is selected from the group consisting of: 1-1, halo and OCH3;
R4 is selected from the group consisting of:
(Rc RN
(Rc Rc Rc Rc I , Rd N
Rd N Ru N R' ro " r -- µ-----",R d Rc Rg¨N
NRd, and Rd wherein RC is selected from the group consisting of: H, halo; C1_6alkyl, C1_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3;
C 1_6haloalkyl; C 1_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and NO2;
Rd is selected from the group consisting of: H; halo; Ci_6alkyl; Ci_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3;
C1_6haloalkyl; C1_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; CN; and OCi_6alkyl;
Rg is selected from the group consisting of: H; Ci_6alkyl; C16alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci-6haloalkyl; and C1_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and n is 1;
or a pharmaceutically acceptable salt, solvate, stereoisomer, isotopic variant, or N-oxide thereof.
[0314] Exemplary compounds of Formula (Z) useful in methods of the invention will now be described by reference to the illustrative synthetic schemes for their general preparation below and examples that follow. Artisans will recognize that, to obtain the various compounds herein, starting materials may be suitably selected so that the ultimately desired substituents will be carried through the reaction scheme with or without protection as appropriate to yield the desired product. Alternatively, it may be necessary or desirable to employ, in the place of the ultimately desired substituent, a suitable group that may be carried through the reaction scheme and replaced as appropriate with the desired substituent. Unless otherwise specified, the variables are as defined above in reference to Formula (Z). Reactions may be performed between the melting point and the reflux temperature of the solvent, and preferably between 0 C and the reflux temperature of the solvent. Reactions may be heated employing conventional heating or microwave heating. Reactions may also be conducted in sealed pressure vessels above the normal reflux temperature of the solvent.
[0315] All abbreviations used in the general schemes and examples for Formula (Z) are as defined in Table 1A. Variables are as defined in the scope or as specifically defined in the general Schemes.
Table lA ¨ Abbreviations Abbreviation Name A angstrom ACN or MeCN acetonitrile AcOH glacial acetic acid AcOK Potassium acetate AgBF4 Silver tetrafluoroborate AlMe3 Trimethylaluminium Ar Argon aq. aqueous AuC13 Gold(III) chloride BC13 Boron trichloride Bn or Bzl benzyl Boc tert-butyloxycarbonyl (Boc)20 Di-tert-butyl dicarbonate Catacxium A Pd G2 AT Chi oro [(di (1 -adam anty1)--butyl ph osphi ne)-2-(2-aminobiphenyl)]palladium(1) CdC12 Cadmium chloride Celite di atom a ceous earth conc. concentrated CO2 Carbon dioxide (C0C1)2 Oxalyl chloride Cul Copper(1) iodide Cu(OAc)2 copper(11) acetate Cy2NMe N,N-Dicyclohexylmethylamine Cs2CO3 Cesium carbonate DCC N,N'-dicyclohexyl-carbodiimide DCE dichloroethane DCM dichloromethane DIPEA or DIEA diisopropyl-ethyl amine DEAD Diethyl azodicarboxylate DEA Diethanolamine DHP 3,4-Dihydropyran DMA dimethylaniline DMAP 4-dimethylaminopyridine DME dimethoxyethane DMf N,N-dimethylformamide DMP
Dess¨Martin periodinane or 1,1,1-Tris(acetyloxy)-1,1-dihydro-1,2-benziodoxo1-3-(11/)-one DMSO dimethylsulfoxide Dppf or DPPF 1, l'-Bis(diphenylphosphino)ferrocene EDCI 1 -ethy1-3 -(3 -dimethylaminopropyl) carb odiimi de ES-API electrospray-atmospheric pressure ionization Abbreviation Name ESI el ectrospray ionization Et3N.3HF Triethylamine trihydrofluoride Et0Ac or EA ethyl acetate Et0H ethanol Et0Na sodium ethoxide EtMgBr Ethylmagnesium bromide GCMS gas chromatography-mass spectrometry h or hr(s) hour or hours H2 Hydrogen gas HC1 Hydrogen chloride HPLC high performance liquid chromatography HPA hypophosphorous acid H2 S 04 Sulfuric acid i-PrMgC1 Isopropylmagnesium chloride IPA Isopropylamine iPrOH Isopropyl alcohol or 2-propanol isovaleraldehyde 3-methylbutanal KT-11\41)S Potassium b i s(tri m ethyl si 1 yl) am i de KI Potassium iodide K20s04.2H20 Potassium osmate (VI) dihydrate K2CO3 Potassium carbonate K3PO4 Potassium phosphate LCMS or LC/MS Liquid chromatography¨mass spectrometry LiHMD S Lithium bis(trimethylsilyl)amide Me0H methanol MeMgBr methylmagnesium bromide Mg(C104)2 Magnesium perchlorate MgSO4 Magnesium sulfate MHz megahertz min minute or minutes MS mass spectrometry NaB H4 Sodium borohydride NaHMDS Sodium bi s(trimethylsilyl)ami de NaOH Sodium hydroxide Na0Et Sodium ethoxide NaHCO3 Sodium bicarbonate Na2CO3 Sodium carbonate NaI04 Sodium periodate NaNO2 Sodium nitrite Na2SO4 Sodium sulfate N2 Nitrogen gas Abbreviation Name NBS N-Bromosuccinimide NC S N-chlorosuccinimide NH2N112.H20 Hydrazine monohydrate NIS N-iodosuccinimide NH4C1 Ammonium chloride NH4HCO3 Ammonium bicarbonate NH3 H20 or NH4OH Ammonium hydroxide NMR nuclear magnetic resonance Allylchl oropalladi um dimer or Bi s(allyl)di chi orodipalladi um or [Pd(ally1)C1]2 Bis(allyl)dichloropalladium or Bis(allylchloropalladium) or Diallyldichlorodipalladium PdC12(PPh3)2 or Pd(PPh3)2C12 bis(triphenylphosphine)palladium(II) dichloride Pd(PPh3)4 tetrakis(triphenylphosphine)palladium Pd(0Ac)2 palladium (II) acetate P(tBu3)PdG2 or chi oroRtri -tert-butyl ph osph i n e)-2-(2-am i n ob i ph eny1)]
tBu3PPdG2 palladium(II) PE petrolum ether PPh3 triphenylphosphine ppm parts per million Pd(dppf)C12 CH2C12 1,1! -bi s(diphenylphosphino)ferrocene -palladium(II)di chl ori de or Pd(dppf)C12.DCM dichloromethane complex Pd/C Palladium on carbon PG Protecting group RP reverse-phase rt or RT room temperature Rt retention time RhCl(PPh3)3 or Rh(PPh3)3C1 Wilkinson's Catalyst or Chlorotris(triphenylphosphine)rhodium(I) Sec second or seconds SFC supercritical fluid chromatography 5i02 silica gel S0C12 Thionyl chloride 02 Oxygen gas TBAB tetrabutylammonium bromide or tetra-n-butylammonium bromide TBDPS tert-Butyldiphenylchlorosilane TBAF tetrabutylammonium fluoride TBHP tert-butyl hydroperoxide TBS tert-Butyldimethylsilyl TES triethylsilane TIPS triisopropylsilane TEA or Et3N triethylamine Abbreviation Name TFA trifluoroacetic acid THE tetrahydrofuran TiC14 Titanium tetrachloride TLC thin layer chromatography TF2NPh N-pheny lb i s(tri fluoromethan esufoni mi de) triflate trifluoromethanesulfonyl Tf20 Triflic anhydride or Trifluoromethanesulfonic anhydride TMS0iPr Is opropoxytri m ethyl silane (PTSA or pTs0H) or p-Toluenesulfonic acid tosylic acid PREPARATIVE EXAMPLES
[0316] Exemplary compounds of Formula (Z) useful in methods of the invention will now be described by reference to the illustrative synthetic schemes for their general preparation below and the specific examples to follow.
1.R3-NCO
0 NH2NH2+120 0 HNAN¨Ra Bn0j-LOEt H20 N_NH2 _____________________________________________________ Et0H
2. Cyclization .. 0 (II) PG
[0317] According to SCHEME 1, a 1,2,4-triazol-5(4H)-one compound of formula (II), where PG is Bn, is prepared from ethyl 2-(benzyloxy)acetate in three steps. In a first step 2-(benzyloxy)acetohydrazide is prepared by the reaction of ethyl 2-(benzyloxy)acetate with hydrazine hydrate, in a suitable solvent such as Et0H, and the like; at temperatures ranging from 70-85 C. Reaction of the hydrazide with an isocyanate of formula Ra-NCO, where Ra is C1_6alkyl, in a suitable solvent such as water, and the like; provides the corresponding semicarbazide. Subsequent cyclization of the semicarbazide with a suitable base such as NaOH, in a suitable solvent such as water, provides a compound of formula (II), where PG is Bn.
[0318] A compound of formula (II), where Ra is C1_6haloalkyl or C3_6cycloalkyl; may be prepared as previously described employing a suitably substituted compound of formula Ra-NCO, where Ra is Ci_6haloalkyl or C3_6cycloalkyl.
[0319] Protecting group exchange of a compound of formula (II), where PG is Bn to a compound of formula (II) where PG is TBDPS, is achieved in two steps employing established methodologies, such as those described in T. W. Greene and P. G. M. Wuts, "Protective Groups in Organic Synthesis,- 3 ed., John Wiley & Sons, 1999. In a first step, deprotection of benzyl group is achieved under hydrogenolytic conditions known to one skilled in the art provides the alcohol. For example, deprotection is achieved employing a palladium catalyst such Pd/C, and the like; under H2; in a suitable solvent such as Et0H, Me0H, Et0Ac, or a mixture thereof, preferably Et0H; with or without the presence HC1; for a period of 4 to 72 hrs. In a second step, protection of the corresponding alcohol as the silyl ether, is achieved with tert-butyldiphenylsily1 chloride, a suitable base such as imidazole, dimethylaminopyridine, pyridine, and the like; in a solvent such as DMF, DCM, and the like; at temperatures ranging from 0 C
to room temperature; affords a compound of formula (II) where PG is TBDP S.
HAL R1 Ri Br Br Halogenation HAL
I I Suzuki Coupling Coupling NI I
HN 3 -B(OH)2 HN,Ir-R3 R1 HN
R R3 R4-B(OH)2 -1( (XIV) (III) (IV) (V) [0320] According to SCHEME 2, a compound of formula (XIV), where R3 is H is treated with a halogenating reagent such as N-iodosuccinimide (NIS), and the like; in an aprotic solvent such as acetonitrile, and the like; under heating conditions, to afford the halogenated compound of formula (III), where HAL is iodide. A compound of formula R1-B(OH)2; is reacted under Suzuki coupling conditions known to one skilled in the art with a compound of formula (III), to provide a compound of formula (IV). For example, a compound of formula (III), where HAL
is iodide, is reacted a commercially available or synthetically accessible boronic acid (or boronic ester) such as R1-B(OH)2, where Rl is an optionally substituted C2_6alkenyl or aryl as defined herein with reference to Formula (Z); a palladium catalyst such as bi s(triphenylphosphine)pall adium(II) dichlori de, tetraki s(triphenylphosphine)pall adium, and the like; a suitable base such as potassium phosphate, Cs2CO3, and the like;
in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof; to provide a compound of formula compound (IV). A compound of formula (IV), where R3 is H, is reacted with a compound of formula R4-B(OH)2; under copper (11) mediated Chan-Lam coupling conditions known to one skilled in the art, to provide a compound of formula (V), where HAL is bromide, X is CH and R3 is H. For example, a compound of formula (IV) is reacted with a compound of formula R4-B(OH)2, where R4 is as defined herein with reference to Formula (Z); a catalyst such as copper(II) acetate, and the like; a base such as pyridine, NEt3, and the like;
in a suitable solvent such as DCM, ACN, dioxane, THF, and the like; to afford a compound of formula (V).
PG
0 j'Z'a "Cd N R1 -N 0_ Ri Ri HAL HN,N/)-----j PG
X X
NI (II) Deprotection R4 Coupling R4 R4 (V) (VI) (7) [0321] According to SCHEME 3, Ullmann-type aromatic amination reaction of compound of formula (V), where R1 is optionally substituted C2_6alkenyl, R3 is H, R4 is suitably substituted phenyl as described herein with reference to Formula (Z), and HAL is Br; with a commercially available or synthetically accessible nucleophilic compound of formula (II), where Ra is C1_ 6a1ky1; such as suitably protected triazolones, where PG is selected from:
benzyl, 4-methoxy benzyl, or an alkyl or aryl silane such as TBDPS, TBS, TES, or TIPS; in the presence of catalytic CuI and a diamine such as trans-1,2-diaminocyclohexane, and a base such as K3PO4, K2CO3, Cs2CO3, NaHCO3, triethylamine, and the like; in a suitable solvent such as 1,4-dioxane, DMSO, DMF, THF, ACN, and the like; provides a compound of formula (VI), where X is CH
and Y is CH.
[0322] A compound of formula (VI), where PG is Bn and R1 is C2_6alkenyl, is reacted under Simmons-Smith cyclopropanation reaction conditions known to one skilled in the art to provide a compound of formula (VI) where RI is C3_6cycloalkyl substituted with Ci_6alkyl. For example, a compound of formula (VI), where R1 is is reacted with diiodomethane; diethylzinc; in a suitable solvent such as toluene, and the like; at temperatures ranging from 0 C to room temperature; for a period of 3 to 26 h; to provide a compound of formula (VI), where Rl is cyclopropyl substituted with CH3.
[0323] Subsequent deprotection employing established methodologies, such as those described in T. W. Greene and P. G M. Wuts, "Protective Groups in Organic Synthesis," 3 ed., John Wiley & Sons, 1999), provides a compound of Formula (Z), where X and Y are CH.
For example, compound of formula (VI), where R3 is H, and PG is TBDPS, is deprotected employing conditions known to one skilled in the art, preferably with TBAF in a suitable solvent such as THF, and the like. In a preferred method, PG is TBDPS, and Ra is C1_6a1kyl.
Alternately, removal of a TBDPS protecting group is achieved employing triethylamine trihydrogen fluoride (Et3N=31-IF).
[0324] Removal of the Bn protecting group is achieved in the presence of hydrogen gas, in the presence of a catalyst such as Palladium on carbon (Pd/C). Removal of the protecting group Bn is also achieved employing TFA, at a temperature of about 80 C.
[0325] A compound of Formula (Z), where X is CH; Y is CH; R2, R3, R4 is each defined as described herein with reference to Formula (Z); and R4 is C2_6alkenyl, is reduced employing hydrogenation conditions known to one skilled in the art, for example, reaction with Pd/C or Wilkinson's Catalyst [RhCl(PPh3).3] under H2; in a suitable solvent such as Me0H, THF, Et0Ac, and the like; provides a compound of Formula (Z) where RI is C2_6alkyl.
HAL
00a R5 Reductive Br ') Br (V) Amination Cyclization NH
R4¨N H2 R4' DMAP/NEt3 R4' N
HAL
(VII) (VIII) (IX) 31( (Va) [0326] According to SCHEME 4, reductive amination of a compound of formula (VII), with oc, I3-unsaturated aldehyde such as 3-methyl-2-butenal, 3-methylpent-2-enal, and the like;
employing TiC14; and a base such as triethylamine; in an aprotic solvent such as dichloromethane (DCM), and the like; provides an enamine intermediate which is subsequently reduced employing a reducing agent such as Nal3ILI, and the like; to afford a compound of formula (VIII) where R5 is C1_4alkyl, R4 is as defined herein with reference to Formula (Z). A
compound of formula (VIII) is coupled with commercially available or synthetically accessible 4-bromo-2-iodobenzoyl chloride employing a base such as triethylamine and 4-dimethylaminopyridine (DMAP); in an anhydrous aprotic solvent such as dichloromethane (DCM), and the like; to afford a compound of formula (IX). Treatment of a compound of formula (IX), with palladium (II) acetate, tetrabutylammonium bromide, and potassium acetate under heating Heck reaction conditions, affords the intramolecular cyclized compounds of formula (V), wherein RI- is optionally substituted C2_6alkyl, R3 is H, X is CH, and HAL is Br;
and (Va) wherein R1 is optionally substituted C2_6alkenyl, R3 is H, X is CH2, and HAL is Br.
PG PG
PG
0 r /¨
ps ty N¨R3 N¨R.
,O. (j Hydrolysis I Ai Chlorination I =
N
R5 if R3'o - HO IV 'Rs CI
base, heating (X) (YI) (X1a) (XII) [0327] According to SCHEME 5, the reaction of a commercially available or synthetically accessible compound of formula (X), where HAL is F, R3 is F, and R5 is H or C1_4alkyl, with a commercially available or synthetically accessible nucleophilic compound of formula (II), where IV is C1_6alkyl, such as suitably protected triazolones, where PG is selected from: benzyl, 4-methoxy benzyl, or an alkyl or aryl silane such as TBDPS, TBS, TES, or TIPS;
in the presence of a base such as K3PO4, K2CO3, Cs2CO3, NaHCO3, triethylamine, and the like;
in a suitable solvent such as DMSO, DMF, THF, ACN, and the like; affords a compound of formula (XI).
In a preferred method, PG is Bn, and IV is Ci_6alkyl. The ester of formula (XI), when R5 is C1_ 4a1ky1, is hydrolyzed to its corresponding acid, under acidic or basic conditions. For example, the treatment of tert-butyl ester (R5 is tert-Bu) with TFA; or alternately, hydrolysis with a base like NaOH, in an aqueous solvent, affords a compound of formula (XIa), where R5 is H. A
compound of formula (Xla) is chlorinated, employing conditions known to one skilled in the art, to provide the acyl chloride of formula (XII). For example, a compound of formula (XIa) is heated in S0C12; or treated with oxalyl chloride in DCM
PG PG
PG
/¨O
N
f N_Ra ,NH I N¨Ra (VIII) 1 Cyclization X
Cl 0 0 Base R4 R3 (XII) (XIII) (VI) [0328] According to SCHEME 6, a compound of formula (XII), where R3 is H or F, PG is Bn, and Ra is C1-6alkyl; is reacted with a compound of formula (VIII), where R5 is Ci_4alkyl, employing a base such as a mixture of triethylamine (TEA) and 4-dimethylaminopyridine (DMAP); in an anhydrous aprotic solvent such as dichloromethane (DCM), and the like; to afford a compound of formula (XIII). A compound of formula (VI), where X is CH
and Y is CH, is obtained by treatment of a compound of formula (XIII), where RI is optionally substituted C1_6alkyl as described herein with reference to Formula (Z); with palladium (II) acetate, tetrabutylammonium bromide, and potassium acetate under heating Heck reaction conditions, that affords a mixture of intramolecular cyclized compounds, which is then separated to isolate an intermediate compound where R1 is C2_6alkyl, and R3 is H or F.
PG
PG
0 ,Ra _TO
1\1 FIN,/ NN¨
B
Halogenation [ I
Coupling 0 __________________________________ HN
IR3 HNI,--,1 R, 0 HN,r--,R3 (XIV) (XV) (XVI) [0329] According to SCHEME 7, Ullmann-type aromatic arnination reaction of a compound of formula (XIV), where R3 is H or F, with a compound of formula (II); such as suitably protected triazolones, where PG is selected from: benzyl, 4-methoxy benzyl, or an alkyl or aryl silane such as TBDPS, TBS, TES, or TIPS; according to methods previously described;
affords a compound of formula (XV). In a preferred method, PG is Bn, and IV is Ci_6alkyl. A compound of formula (XV) is treated with a halogenating reagent such as N-iodosuccinimide (NIS), and the like; in an aprotic solvent such as acetonitrile, and the like; under heating conditions; affords a halogenated compound of formula (XVI), where Y is CH and HAL is iodide.
R5'0 R' PG
0 0 =
R1 0, R1 PG FzI N
1 Br (XVIla) 1 Br NH2NH2 H20 X
Br (II) )1(1;111 P3 Coupling HN
R, 0 0"" I -k,= 0 (V) 0 (XVIII) (XVIIb) [0330] According to SCHEME 8, compounds of formula (XVIIa) and (XVIIb) are prepared from 5-bromoi sob enzofuran- 1 , 3 -di one in two steps. 5 -B rom oi sob enzofuran- 1,3 -di one is reacted with a commercially available or synthetically accessible suitably substituted alkyl Grignard reagent such as i-PrMgC1, EtMgBr, and the like; in the presence of CdC12; in aprotic solvent like THF, and the like; followed by subsequent treatment with an alkylating agent of formula R5-I, where R5 is C1_4alkyl (such as iodomethane or iodoethane); in the presence of base like K2CO3, Cs2CO3, and the like; in a aprotic solvent such as DMF, DMSO, and the like;
affords a mixture of regio-isomeric esters of formula (XVIIa) and (XVIIb), where Rl is an optionally substituted Ci_6alkyl. In a similar fashion, aryl Grignard reagents may be used to provide compounds of formula (XVIIa) and (VXIIb), where R1 is a suitably substituted phenyl.
The regio-isomers of formula (XVIIa) and (XVIIb) are not separated but are used directly and converted into the corresponding phthalazinone (mixture). For example, a mixture of formula (XVIIa) and formula (XVIIb) are treated with excess hydrazine; in a suitable solvent such as ethanol or methanol, at temperatures ranging from room temperature to 90 C, for a period of 6 to 20 hours. The desired phthalazinone compound of formula (V) can be readily separated from the other regio-isomer by precipitation, crystallization, or purified by flash chromatography. Ullmann-type aromatic amination reaction of a compound of formula (V), with a suitably protected triazolone of formula (II), where Ra is Ci_6a1ky1, and PG is selected from: benzyl, 4-methoxy benzyl, or an alkyl or aryl silane such as TBDPS, TBS, TES, or TIPS;
in the presence of catalytic CuI and a diamine such as trans-1,2-diaminocyclohexane, and a base such as K3PO4, K2CO3, Cs2CO3, NaHCO3, triethylamine, and the like; in a suitable solvent such as I,4-dioxane, DMSO, DMF, THE, ACN, and the like; affords a compound of formula (XVIII), where X is N.
[0331] A compound of formula (XVIII), where RI is C2_6a1keny1, is reacted under Simmons-Smith cyclopropanation reaction conditions known to one skilled in the art, to provide a compound of formula (XVIII) where RI is C3_6cyc10a1ky1 substituted with Ci_6alkyl. For example, a compound of formula (XVIII), where R1 is C2_6alkenyl, is reacted with diiodomethane; diethylzinc; in a suitable solvent such as toluene, and the like; at temperatures ranging from 0 C to room temperature; for a period of 24 to 26 h; to provide a compound of formula (XVIII), where RI is cyclopropyl substituted with CH3.
R PG
N
0 HN_N----j PG R1 R1 Ra 121 I HAL HAL (ii) 0 HAL sl\IHNH2> X I
n I I
rz, 0 o Couphng Rs-' R3 Coupling Rs- y 12' 11 R3 (X) (XIX) (V) (VI) [0332] According to SCHEME 9, a compound of formula (X), where HAL is Br, R3 is H, and R5 is CH3, is coupled in a palladium catalyzed carbonylation reaction with a commercially available or synthetically accessible aldehyde of formula RI-CHO, where RI is C1_6alkyl; to afford the corresponding ketone compound of formula (XIX), (similar transformation has been reported by Suchand et a1õ/. Org. Chem. 2016, 81, 6409-6423). For example, reaction of methyl 4-bromo-2-iodobenzoate with isobutylaldehye; in the presence of a palladium catalyst such as Pd(OAc)2; Ag2O; and an oxidizing agent such as aqueous solution of tert-butyl hydroperoxide (TBHP); at a temperature of about 120 C; for a period of 10-14 h; provided methyl 4-bromo-2-i sobutyrylbenzoate. A ketone compound of formula (XIX) is reacted with hydrazine le-NHNH2, where R4 is suitably substituted aryl such as 2-chloro-6-fluorophenylhydrazine; to afford a compound of formula (V), where X is N.
Ullmann-type aromatic amination reaction of a compound of formula (V) with a suitably protected triazolone (II) as previously described, affords a compound of formula (VI), where Y is CH, and R1 is selected from C1-6a1kyl.
[0333] A compound of formula (VI), where Y is CH, and R1 is phenyl and X is N, may be prepared in a similar fashion, employing methods previously describe by coupling methyl 4-bromo-2-iodobenzoate with a commercially available or synthetically accessible aldehyde of formula RI--CHO, where Rl is phenyl.
PG Suzuki Coupling PG
r /¨(5PG
R1-B(OH)2 HAL N¨Ra N¨R' 1. Suzuki (R1= alkenyl) Coupling I I 0 2. Oxidation I
.R3 0 R4-B(CH)2 HN, R4 R3 11 3. Grignard 0 0 (xviii) (VI) (xvi) HH(cH3)2. H20 Heat [0334] According to SCHEME 10, a compound of formula R'-B(OH)2; is reacted under Suzuki coupling conditions known to one skilled in the art, with a compound of formula (XVI), to provide a compound of formula (XVIII), where Xis CH. For example, a compound of formula (XVI), where Y is CH and HAL is iodide, is reacted a commercially available or synthetically accessible boronic acid (or boronic ester) such as R1-B(OH)2, where Rl is an optionally substituted C2_6alkenyl, C3_6cycloalkyl or aryl as defined herein with reference to Formula (Z);
a palladium catalyst such as bis(triphenylphosphine)palladium(II) dichloride, and the like; a suitable base such a potassium phosphate, Cs2CO3, and the like; in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof; to provide a compound of formula compound (XVIII), where X is CH. It has been noticed that during the coupling reaction as described above, loss of the iodide during the reaction conditions afforded a compound of formula compound (XVIII), where X is CH, and RI- is H. A compound of formula (XVIII), where X is CH or N, is reacted with a compound of formula R4-B(OH)2; under copper (II) mediated Chan-Lam coupling conditions known to one skilled in the art, or as previously described, to provide a compound of formula (VI), where X is CH or N, 11.1 is optionally substituted C2_6alkeny1, R3 is H or F, and R4 is a suitably substituted phenyl as described herein with reference to Formula (Z).
[0335] A compound of formula (XVIII), where R1 is N(CH3)2 is prepared from a compound of formula (XVI), where HAL is Br and PG is Bn. Reaction of a compound of formula (XVI) with an amine bs such as NH(CH3)2 in water, at a temperature of about 110 C, for a period of 96 hours h; affords a compound of formula (XVIII) where R1 is N(CH3)2, and IV is Ci_6alkyl. A
compound of Formula (Z), where R1 is N(CH3)2 is prepared according to methods described above.
[0336] A compound of formula (XVIII), where R1 is Ci_6alkyl substituted with OH, is prepared from a compound of formula (XVIII), where R1 is C2_6alkeny1, and PG is Bn in two steps. In a first step, reaction of a compound of formula (XVIII), where R1 is , under oxidizing conditions such as NaI04, and K20s04.2H20 or 0s04; in a suitable solvent such as THF/H20;
at temperatures ranging from 0 C to room temperature; for a period of 48 to 72 hours; affords a ketone intermediate compound. In a second step, reaction of the ketone intermediate compound with a Grignard reagent such as methylmagnesium bromide; in a suitable solvent such as diethyl ether; at temperatures ranging from 0 C to room temperature;
for a period of 3 to 30 hours; affords a compound of formula (XVIII), where le is C1_6alkyl substituted with OH.
0-1f ,F
NH2NH ¨R4 1-IN¨N
Base Hy Tf2 N
R4 R3 Base R4 (XX) (XXI) (XXII) [0337] According to SCHEME 11, 4,5-difluorophthalic anhydride is reacted with a hydrazine compound of formula R4-NHNH2, where R4 is a suitably substituted phenyl or heteroaryl such as (2-chloro-6-fluorophenyl)hydrazine hydrochloride; in acetic acid; at a temperature of about 125 C; for a period of about 1.5 h to afford a compound of formula (XX), where R3 is F.
Rearrangement of a compound of formula (XX) affords a ring expansion compound of formula (XXI), under basic conditions such as sodium ethoxide or sodium methoxide; in a protic solvent such as ethanol, methanol, and the like; at room temperature; for a period of about 1.5 h.
Derivation of a compound of formula (XXI), with a sulfonate-based leaving group such as trifluoromethanesulfonyl (triflate), is achieved by is by reaction with a triflating agent such as trifluoromethanesulfonic anhydride (Tf20), a base such as triethylamine (TEA), pyridine, and the like, in a suitable solvent such as DCM and the like, to provide a compound of formula (XXII). Milder triflating agents such as N-phenylbis(trifluoromethanesufonimide) (TF2NPh), a base such as TEA, DIEA, and the like, in a suitable solvent such as DCM, and the like; may be used.
gg PG
N"-Cd N "a )r,1 D
PG R4 '`
OTf Ri HN, (II) Suzuki Coupling x HAL
(VI) +
R3 R1-B(OH)2 R4 R4 Base (XXII) (V) X
,PG
0 .R' (Via) [0338] According to SCHEME 12, a compound of formula R1-B(OH)2; is reacted under Suzuki coupling conditions previously described, with a compound of formula (XXII), to provide a compound of formula (V), where X is N. For example, a compound of formula (XXII), is reacted a commercially available or synthetically accessible boronic acid (or boronic ester) such as R'-B(OH)2, where R" is C2_6alkenyl or C2_6haloalkenyl as defined herein with reference to Formula (Z); a palladium catalyst such as 1, l'-b i s(di phenyl ph osphi n o)ferrocene-palladium(II)dichloride or bis(triphenylphosphine)palladium(II) dichloride, and the like; a suitable base such a potassium phosphate, Cs2CO3, K2CO3, and the like; in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof; to provide a compound of formula compound (V). A compound of formula (V), where RI- is C2_6alkyl or C2_6haloa1kyl, is readily prepared by selective hydrogenation of a compound of formula (V), where It' is C2_6alkenyl or C2_6haloalkenyl. For example, reaction of a compound of formula (V), where It' is F
F , under hydrogenation conditions employing a catalyst such as Pd/C and the like, in a suitable solvent such as Et0Ac, and the like; under an atmosphere of hydrogen gas (20-45 psi) at room temperature; for a period of 4 to 24 hours; affords a compound of formula (V), , or F
where R1 is F F. The reaction of a compound of formula (V), with a suitably protected triazolone of formula (II), employing conditions previously described, affords a mixture of compounds of formula (VI) and (VIa) which can be separated before or after deprotection of the protecting group.
Rd Rd PG
PG
PG ' /¨ci R1 N--=-Cci F NO2 RI N=-A/¨C) N-R" RI
i N¨Rd (XXIII) Rd X"' All N.--1( Reduction Rd X
N -_.,.
irp, 0\ip o (IP o R3 HN --' R3 Y- Fe base I
02N.- IR' (XXV) (XVIII) Re (XXIV) PG
RI ' N1,----00 isii N-Rd Diazotization Rd Reduction l' Re (XXVI) [0339] According to SCHEME 13, N-arylation of a compound of formula (XVIII) is achieved by reaction of suitably substituted commercially available or synthetically accessible fluoro compound of formula (XXIII), where R' and Rd are as defined herein with reference to Formula (Z). A compound of formula (XVIII), where R1 is H, C2_6alkenyl , C2_6hal oal kenyl, C3-6cycl oalkyl, C3-6cycl alkyl substituted with C1-6a1ky1, and X is CH or N, is reacted under nucleophilic displacement reaction conditions, with a commercially available or synthetically accessible fluoro compound of formula (XXIII); in the presence of a base like K2CO3, Cs2CO3, and the like; in aprotic solvent such as DMF, DMSO, and the like; at temperatures ranging from 65 to 100 "V; to afford a compound of formula (XXIV).
[0340] Reduction of compound of formula (XXIV) is achieved employing zinc or iron and NH4C1; in a mixed solvent of methanol and water; to provide an amino compound of formula (XXV).
[0341] Di azotizati on of a compound in formula (XXV) with NaNO2; in an acidic aqueous solution or other nitrite reagents; in an organic solvent, such as Et0H, and the like; at a temperature of 0 C; and subsequent the reduction of diazo group with zinc at temperatures ranging from 0 to 85 C; or by treatment with H3P02; affords a compound of formula (XXVI), where R and Rd are as defined as described herein with reference to Formula (Z).
Rib Rla HN
N-Ra PG
RR' RtRIa N=Cd Br 0 a I HAL (XXV F N-R
I) .HAL (II) 1"0 " Gyclization PG
Base 0 R3 0 N
N-Re 0 (XXVIII) (XXIX) "
(X) PG
¨rd 0 (XXX) R
Cy2N Me (X la) Getecxiurn A Pd [0342] According to SCHEME 14, a compound of formula (X), where HAL is F, R5 is H and R3 is F, is reacted with a commercially available or synthetically accessible compound of formula (XXVII), where Ria and Rib are each independently H or Ci_4alky1, such as 1-bromo-3-methy1-2-butene; in the presence of a base such as K2CO3, Cs2CO3, and the like; in a suitable solvent such as DMSO, DIvIIF, THF, ACN, and the like; to afford an ester compound of formula (XXVIII), where R3 is F, and HAL is F. A compound of formula (XXVIII), where R1a and Rib are each independently selected from Ci_4haloalkyl or C3_6cycloalkyl may be made in a similar fashion. The reaction of an ester of formula (XXVIII) with a suitably protected triazolone compound of formula (11); in the presence of a base such as K3PO4, K2CO3, Cs2CO3, NaHCO3, triethylamine, and the like; in a suitable solvent such as 1,4-dioxane, DMSO, DMF, THF, ACN, and the like; affords a compound of formula (XXIX). In a preferred method, PG
is Bn, and Ra is Ci_6alkyl. A compound of formula (XXIX), where R3 is H or F, undergoes intramolecular cyclization under Heck reaction conditions, such as employing at catalyst such as chloroRtri-tert-butylphosphine)-2-(2-aminobi phenyl)] palladium (II) (P(tBu3)PdG2), N-cycl oh exyl -N-methyl-cyclohexanamine, in a suitable solvent such as toluene, and the like;
at a temperature of about 15 to 80 C; for a period of about 18 to 36 hours; to provide an isocoumarin compound of formula (XXX), where Y is CH and R1 is isopropyl, R3 is H or F, Ra and PG are defined as described above.
[0343] An isocoumarin compound of formula (XXX), where Ri is ¨ is prepared from a compound of formula (XIa) and methylbuta-1,2-dien-l-y1 acetate. Methylbuta-1,2-dien-l-y1 acetate is commercially available or prepared in two steps from 2-methyl-3-butyn-2-ol. Acetic anhydride is reacted with 2-methyl-3-butyn-2-ol, in the presence of a catalyst such as Mg(C104)2; in a suitable solvent such as DCM, and the like; to afford 2-methylbut-3-yn-2-y1 acetate. 2-Methylbut-3-yn-2-y1 acetate is reacted with a catalytic amount of a Lewis acid such as AgBF4, AgC104, PtC12, and the like; to provide 3-methylbuta-1,2-dien-1-y1 acetate. 3-Methylbuta-1,2-dien-1-y1 acetate is coupled with a compound of formula (XIa), where IV is H, employing intermolecular cyclization under Heck reaction conditions as previously described, such as employing at catalyst such as Catacxium A Pd G2, and Cy2NMe palladium (II) acetate, phase transfer reagent like tetrabutylammonium bromide, and a base like potassium acetate, in a suitable solvent such as DMF, and the like; at a temperature of 70 to 90 C;
for a period of 10 to 16 hours; to provide the isocoumarin compound of formula (XXX), where Y is CH and le is [0344] A compound of formula (XXX), where Y is CH and is -- is selectively reduced under hydrogenation conditions employing at catalyst such as Wilkinson's Catalyst [RhCl(PPh3)3] and the like, in a suitable solvent such as THF, and the like;
at room temperature, provide an isocoumarin compound of formula (XXX), where It1 is isopropyl.
0\
OEt Wittig Reaction Reduction Oxidation [0345] According to SCHEME 15, 2-butanone is converted to ethyl 3-methylpent-2-enoate employing Wittig reaction conditions known to one skilled in the art. For example, 2-butanone is reacted with a triphenyl phosphonium ylide such as (carbethoxymethylene) triphenylphosphorane, with or without an additive such as benzoic acid, LiC1, and sodium dodecyl sulfate (SDS), and the like, in a suitable solvent such as toluene, at temperatures ranging from rt to the reflux temperature of the solvent, for a period of 12-24 h. Ethyl 3-methylpent-2-enoate is reduced to 3-methylpent-2-en-1-ol employing a suitable reducing agent such as DIBAL-H, in a suitable solvent such as toluene, and the like, at temperatures ranging from -78 C to room temperature. 3 -Methylpent-2-en-l-ol is oxidized to 3-methylpent-2-enal employing oxidation conditions known to one skilled in the art, for example, DMP (Dess-Martin periodinane), S03-pyridine, Swern conditions RCOC1)2, DMSO, Et3IN], PCC, and the like, in a solvent such as Et0Ac, DMSO, DCM, and the like, at temperatures ranging from about -78 C to room temperature (about 23 C). In a preferred method, 3-methylpent-2-en-1-ol is oxidized to 3-methylpent-2-enal with Dess-Martin periodinane, in DCM, at 25 C for a period of 1-4 h.
PG
d R1 N%----C
Ri N ------ 1 N¨Ra 1 N¨Ra R4¨N H2 I , I , (VII) __________________________________________________ ..-Oy----.õ-_,----- R3 0 Lewis acid R4-N-TIR 03 (XXX) (XXXI) 103461 According to SCHEME 16, an isocoumarin of compound of formula (XXX), where Y
is CH, is reacted with a commercially available or synthetically accessible amine compound of formula R4-NH2, where R4 is as defined herein with reference to Formula (Z); a Lewis acid such as like AlMe3, A1C13, and the like; in a suitable aprotic solvent such as DCM, toluene, and the like; to provide a compound of formula (XXXI), where Y is CH, and le, R3, R4 and IV are defined as described herein with reference to Formula (Z).
PG
1. sea, j/ ________ N 0_ A
N---=1\
.- i F HN,N----/ PG \ i N¨Ra R
'ClYR3 X 0 3 __________________ base, heating 0 HO = 0 (X) 0 (XXXII!) (XXXIV) PG PG
0 0' N --,----C R1 N N¨Ra 1 iK,_, Lewis acid NI N-,\_c Cycliz ...e¨Raation i ..- õ 0 0 Rearrangement `-' R3 (XXXV) (XXX) 103471 An isocoumarin compound of formula (XXX) may be prepared according to SCHEME
17. 4,5-Difluoro-2-iodobenzoyl chloride is prepared from a compound of formula (X), where HAL is F, R5 is H and R3 is F, employing conditions known to one skilled in the art such as oxalyl chloride or thionyl chloride, in the presence of a catalytic amount of DMF, in a suitable solvent such as an aprotic non-polar solvent such as dichloromethane (DCM), tetrahydrofuran (THF), acetonitrile (ACN), toluene, and the like, at a temperatures ranging from 0 C to room temperature to form 4,5-difluoro-2-iodobenzoyl chloride. 4,5-Difluoro-2-iodobenzoyl chloride may be reacted with commercially available or synthetically accessible 2-methylbut-3-yn-2-ol, in the presence of a base such as triethylamine and DMAP; in a suitable solvent such as DCM, and the like, to afford an ester compound of formula (XXXIII). A compound of formula (XXXIII) may be reacted with a compound of formula (II), employing methods as previously described to afford a compound of formula (XXXIV). Treatment of a compound of formula (XXXIV) with a catalytic amount of a Lewis acid such as AgC104, PtC12, and the like; may afford the rearranged compound of formula (XXXV). A compound of formula (XXXV), where R3 is H or F, may undergo an intramolecular cyclization under Heck reaction conditions, such as employing a catalyst such as palladium (II) acetate, a phase transfer reagent like tetrabutylammonium bromide, and a base like potassium acetate, in a suitable solvent such as DMF, and the like; at a temperature of 70 to 90 C; for a period of 1 to 3 hours; to provide an isocoumarin compound of formula (XXX), where Y is CH.
PG
o N=C6 ci y rj N--F PG
HN PG
,N HALNJ 0 IN=4,, R- Coupling \(j 0 R5 (XXXIX) EtO15-0 0 (Xa) Suzuki R5 Coupling Or PG (XL) N-IR' N-Ac (XI) 103481 According to SCHEME 18, a compound of formula (Xa), where HAL is Cl, R5 is CH(CH3)2, and R3 is F, is commercially available or synthetically accessible according to methods as described in Chen, et al, US Patent Publication No. US2016-0176869.
Reaction of a compound of formula (Xa) with a commercially available or synthetically accessible nucleophilic compound of formula (II), where PG is benzyl, and Re is C1_6alkyl; in the presence of a base such as K2CO3, Cs2CO3, NaHCO3, triethyl amine, and the like; in a suitable solvent such as dimethylsulfoxide (DMSO), DMF, THE', ACN, and the like; affords a compound of formula (XXXIX), where Y is N. A compound of formula (XXXIX) or formula (XI), where R3 is F, and R5 is Ci_4alkyl; is reacted a commercially available 1-ethoxyethene-2-boronic acid pinacol ester, a palladium catalyst such as bis(triphenylphosphine)palladium(II) dichloride, 1,11-bis(diphenylphosphino)ferrocene-palladium(II)dichloride and the like; a suitable base such as Cs2CO3, and the like; in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof; employing conventional or microwave heating; to provide a compound of formula (XL), where Y is N or CH.
PG ci PG PG
] N-R
R4-NH2 Et0, Y=--AcOH N=id .
Et0,,,,-1/.., ,N-_,\ (VII) Y L1N-Ra I 0 Al(CH3)3 , H ,,,Y.,..N.INI-Ra or TFA
1 r 1 zØ.1.R3 0 Heating N --,_õ-, 0 R`I-NR3 (XL) (XLI) (XLII) PG PG
ci d HAL N=-/
R1 N=-/¨
I NR' \1 1 1-s " X Th--1 Halogenation l', N ...., \, R1-B(OH)2 N1 R
-1 ,-- -1 ---. ' -1 N, -. 0 Suzuki Coupling rj , I 0 R4- R3 ---,-..,----.. 3 R4- Tr R
o o (xvi) (vi) [0349] According to SCHEME 19, a compound of formula R4-NH2, where R4 is as defined herein with reference to Formula (7); is reacted with trimethyl aluminum; in a suitable solvent such as dichloromethane, toluene, or a mixture thereof; the resulting solution is combined with a compound of formula (XL), where Y is CH or N; to provide a compound of formula (XLI).
A compound of formula (XLI), where Y is CH or N, is treated with acetic acid or trifluoroacetic acid under heating conditions between 50 C to 90 C, to provide a compound of formula (XLII).
A compound of formula (XLII) is halogenated employing N-bromosuccinimide in anhydrous dimethylformamide at room temperature, to provide a compound of formula (XVI), where HAL
is Br. A compound of formula R1-B(OH)2; is reacted under Suzuki coupling conditions known to one skilled in the art, or as previously described with a compound of formula (XVI), to provide a compound of formula (VI), where R1 is an optionally substituted C2_6alkenyl, C2-6ha1oa1keny1, or aryl as defined herein with reference to Formula (Z). A
compound of formula (VI), where R1 is an optionally substituted C2_6alkenyl or C2_6haloalkenyl is reacted under hydrogenation conditions using Wilkinson catalyst ((PPh3)3RhC1) to provide a compound of formula (VI), where R1 is C2_6alkyl or C2_6haloalkyl.
PG
PG PG
N=Cd 1. R4-NH2 i N-Ro N=--Cd RI N=id I N-Ra ________ 1 y ij N¨Ra mi ,_ 1 CI -)1-_, N -1 2. AcOH -- 1r --'----1R3 [Pd(ally1)C1]2, DPPF
- r'i"
0 0 (VI) (xxxix, (xxx) [0350] According to SCHEME 20, 3-methylbutanal is reacted with a compound of formula (XXXIX), where Y is N and R5 is CH(CH3)2, with a palladium catalyst such as allylpalladium(II) chloride dimer, and the like; a ligand such as 1,1'-bis(diphenylphosphino)ferrocene (dppf), and the like; a suitable base such as Cs2CO3, and the like; in the presence of water scavenger such as molecular sieve (4A); in a suitable solvent such as dioxane thereof; to provide a compound of formula compound (X)0C), where Rl is isopropyl.
A compound of formula R4-NH2, where R4 is as defined herein with reference to Formula (Z);
is reacted with trimethyl aluminum; in a suitable solvent such as dichloromethane, toluene, or a mixture thereof; the resulting solution is combined with a compound of formula (XXX), followed by subsequent treatment with acetic acid under heating temperature of 80-100 C for a period of time ranging from 5 to 24 hours; to provide a compound of formula (VI); where X
is CH, Y is N, R1 is isopropyl, R3 is F.
PG
N----f 6 NI -Re I õ,,r.N -....,\(\
/-01:'G
,¨ CPG
N=--- N ----X
R5 II (i)-5<-o (XI) \I
PG "-----õ,z, B-0 \ ...:7..--õ,_,,õYõ,,,,N --_, K20s04. 0)'12 -or R5 N,--id Suzuki -R o Naio 3 R5 ,fly-^-..õ---R3 Coupling 1 N-Re 0 0 CI _,, (XLIII) (XLIV) (XXXIX) po PG
R1 N\ R1 R1 N=CO
1. 121-MgBr .. 0 1 --' A\ o NI-I2NH-R4 o --- 3 2. Dess-Martin Fzcz' 1.1"-----------R 0 (XLV) (VI) I1. Stille Coupling 2. Hydrolysis PG
N=C6 I N-CI ...,y,õN,..4 0 `.... 0 F
(XXXIX) 103511 According to SCHEME 21, A compound of formula (XXXIX) or formula (XI), where R3 is F, and R5 is CI-alkyl; is reacted a commercially available vinylboronic acid pinacol ester;
a palladium catalyst such as bis(triphenylphosphine)palladium(II) dichloride, or 1,1-bis(diphenylphosphino)ferrocene-palladium(II)dichloride dichloromethane complex, and the like, a suitable base such as Cs2CO3, and the like, in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof; to provide a compound of formula compound (XLIII), where Y
is N or CH. The vinyl group in a compound of formula (XLIII) is selectively converted into an aldehyde group of formula (XLIV) employing potassium osmate (VI) dihydrate/
sodium periodate, or ozonolysis, and the like. A compound of formula (XLIV) is reacted with a commercially available or synthetically accessible suitably substituted alkyl Grignard reagent such as i-PrMgC1, and the like; in aprotic solvent like THF, and the like;
followed by subsequent treatment with an oxidizing reagent such as Dess-Martin reagent, or Swern oxidation conditions, and the like; to afford a ketone compound of formula (XLV).
[0352] A compound of formula (XLV) is prepared from a compound of formula (XXXIX) in two steps. A compound of formula (XXXIX), where R3 is F, and R5 is Ch4alkyl;
is reacted a commercially available tributy1(1-ethoxyvinyl)tin; a palladium catalyst such as bis(triphenylphosphine)pall adium(II) di chl oride, 1, 1Lb i s(diphenylphosphino)ferrocene-palladium(II)dichl oride and the like; in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof Subsequent acidic hydrolysis employing conditions such as treatment with aqueous HC1 solution at room temperature affords a compound of formula (XLV), where X is N, Y is N or CH, RI is methyl.
[0353] A commercially or synthetically available hydrazine R4-NHNH2, where R4 is as defined herein with reference to Formula (Z), such as 2-chloro-6-fluorophenylhydrazine, o-tolylhydrazine; is condensed with a compound of formula (XLV); in the presence of a base such as potassium carbonate, and the like; under the heating conditions such as 70-120 C; in a suitable solvent such as toluene, or a mixture thereof; afford a compound of formula (VI), where X is N, Y is CH or N, and R4 is as defined herein with reference to Formula (Z).
PG
GC) HN N Re 0 ,R 0, tr N N 0_ PG ,0 PG R4-NH2 Br, (II) PG Br HO T.J.r, , F
[Pd(elly1)CIL DPPF CLIf AcOH -8- Base No molecular 0 0 (XLVI) Sieve (XLVII) (VI) [0354] According to SCHEME 22, the reaction of methyl 2-bromo-4,5-difluorobenzoate with a suitably protected triazolone compound of formula (II); in the presence of a base such as K3PO4, K2CO3, Cs2CO3, NaHCO3, triethylamine, and the like; in a suitable solvent such as 1,4-dioxane, DMSO, DMF, TifF, ACN, and the like; affords a compound of formula (XLVI). In a preferred method, PG is Bn, and R" is C1_6alkyl (as previously described in Scheme 14). 3-Methylbutanal is reacted with a compound of formula (XLVI), with a palladium catalyst such as allylpalladium(II) chloride dimer, and the like, a ligand such as 1,1'-bis(diphenylphosphino)ferrocene (dppf), and the like; a suitable base such as Cs2CO3, and the like; in the absence of water scavenger such as molecular sieve (4A); in a suitable solvent such as dioxane thereof; to provide a compound of formula compound (XLVII). A
compound of formula le-NH2, where R4 is as defined herein with reference to Formula (Z);
is reacted with trimethyl aluminum; in a suitable solvent such as dichloromethane, dichloroethane, toluene, or a mixture thereof; the resulting solution is combined with a compound of formula (XLVII), followed by subsequent treatment with acetic acid under heating temperature of 80-100 C for a period of time ranging from 5 to 24 hours; to provide a compound of formula (VI); where X
is CH, Y is CH, R1 is isopropyl, R3 is F. In certain cases, a compound of formula R4-NH2 such as o-toluidine and the like; is directly condensed with a compound of formula compound (XLVII) in acetic acid under heating temperature of 80-100 'V for a period of time ranging from 10 to 24 hours; to provide a compound of formula (VI); where X, Y, R3 are defined above.
PG PG
PG
N=C N==c N=id C I N N¨Ra N¨Ra N ¨Ra 1.Sonogoshira AuCll 2. TBAF MeCN 0 (XXXIX) (XLVI I I) (XLI X) PG
/¨
N=Cd N
1. R PG 4-NH2 N¨Ra R1 (VII) X 1 . Halogenation X
2. AcOH (j2. Coupling NI
(L) (VI) [0355] According to SCHEME 23, a compound of formula (XXXIX), where R5 is Ci_4alkyl, Y
is N, and R3 is F, is subjected to a Sonogashira coupling reaction with a silyl protected alkyne, such as trimethyl silyl acetyl ene, a palladium catalyst such as palladium(11)bis(triphenylphosphine) dichloride and the like; a copper catalyst such as copper iodide and the like; with a suitable base, such as triethylamine; in a suitable solvent such as ACN, toluene, and the like. Deprotection reaction employing TBAF in a suitable solvent such as THF, and the like; at room temperature affords a compound of formula (XLVIII). A
compound of formula (XLIX) is obtained using a gold catalyst, preferably AuC13 in a suitable solvent mixture, such as MeCN. Similar transformation by AuC13-catalyzed cyclization has been described by Marchal, E. et al in Tetrahedron 2007, 63, 9979-9990. A
compound of formula R4-NH2, where R4 is as defined herein with reference to Formula (Z);
is reacted with trimethylaluminum; in a suitable solvent such as dichloromethane, dichloroethane, toluene, or a mixture thereof; the resulting solution is combined with a compound of formula (XLIX), followed by subsequent treatment with acetic acid under heating temperature of 80-100 C for a period of time ranging from 5 to 24 hours; to provide a compound of formula (L). Employing NBS in a suitable solvent, preferably DMF, at room temperature followed by cross coupling using conditions known to one skilled in the art, preferably a palladium catalyst such as palladium(II)bis(triphenylphosphine) dichloride, a base such as Cs2CO3, Na2CO3, and the like;
in a solvent mixture composed of 1,4-dioxane and water; at a temperature of 100 C provides a compound of formula (VI), where X is CH, Y is N, R3 is F, and 111, Ra and PG
are defined as previously described.
PG
Ri N ¨id Ri _y N¨Ra Deprotection , R2 x rj I
(VI) (z) 103561 According to SCHEME 24, a compound of formula (VI), where PG is Bn, is deprotected employing conditions known to one skilled in the art, preferably in neat TFA
in a sealed tube, at a temperature of about 60 to 90 C; or employing BC13, at a temperature of about -78 C, in a suitable solvent such as in DCM; or treatment with hydrogen gas, in the presence of a catalyst such as Palladium on carbon (Pd/C), affords a compound of Formula (Z).
103571 In a similar fashion, N-arylation and in-situ TBDPS deprotection of a compound of formula (XVIII), where R1 is 1 and PG is TBDPS, and Xis N; is achieved employing conditions known to one skilled in the art or as previously described, to afford a compound of Formula (Z).
103581 A compound of Formula (Z), where R3 is F is reacted in a nucleophilic aromatic substitution reaction to provide a compound of Formula (Z), where R3 is OCH3.
For example, reaction of a compound of Formula (Z), where R3 is F, with a suitable base such as NaOH, and the like; in a suitable solvent such as Me0H, and the like; to provide a compound of Formula (Z) where Y is CH and R3 is OCH3.
[0359] Compounds of Formula (Z) may be converted to their corresponding salts using methods known to one of ordinary skill in the art. For example, an amine of Formula (Z) is treated with trifluoroacetic acid, HC1, or citric acid in a solvent such as Et20, CH2C12, THF, Me0H, chloroform, or isopropanol to provide the corresponding salt form.
Alternately, trifluoroacetic acid or formic acid salts are obtained as a result of reverse phase HPLC
purification conditions. Crystalline forms of pharmaceutically acceptable salts of compounds of Formula (Z) may be obtained in crystalline form by recrystallization from polar solvents (including mixtures of polar solvents and aqueous mixtures of polar solvents) or from non-polar solvents (including mixtures of non-polar solvents).
[0360] Where the compounds according to this invention have at least one chiral center, they may accordingly exist as enantiomers. Where the compounds possess two or more chiral centers, they may additionally exist as diastereomers. It is to be understood that all such isomers and mixtures thereof are encompassed within the scope of the present invention.
[0361] Compounds prepared according to the schemes described above may be obtained as single forms, such as single enantiomers, by form-specific synthesis, or by resolution.
Compounds prepared according to the schemes above may alternately be obtained as mixtures of various forms, such as racemic (1:1) or non-racemic (not 1:1) mixtures.
Where racemic and non-racemic mixtures of enantiomers are obtained, single enantiomers may be isolated using conventional separation methods known to one of ordinary skill in the art, such as chiral chromatography, recrystallization, diastereomeric salt formation, derivatization into diastereomeric adducts, biotransformation, or enzymatic transformation. Where regioisomeric or diastereomeric mixtures are obtained, as applicable, single isomers may be separated using conventional methods such as chromatography or crystallization.
[0362] The following specific examples are provided to further illustrate compounds of Formula (Z) and various preferred embodiments.
EXAMPLES
[0363] In obtaining the compounds of Formula (Z) described in the examples below and the corresponding analytical data, the following experimental and analytical protocols were followed unless otherwise indicated.
[0364] Unless otherwise stated, reaction mixtures were magnetically stirred at room temperature (rt) under a nitrogen atmosphere. Where solutions were "dried,"
they were generally dried over a drying agent such as Na2SO4 or MgSO4. Where mixtures, solutions, and extracts were "concentrated", they were typically concentrated on a rotary evaporator under reduced pressure.
[0365] Normal-phase silica gel chromatography (FCC) was performed on silica gel (SiO2) using prepacked cartridges.
[0366] Preparative reverse-phase high performance liquid chromatography (RP
HPLC) was performed on either:
METHOD A. A Gilson GX-281 semi-prep-HPLC with Phenomenex Synergi C18(10 ttm, 150 x 25mm), or Boston Green ODS C18 (51.tm, 150 x 30mm), and mobile phase of 5-99%
ACN in water (with 0.225%FA) over 10 min and then hold at 100% ACN for 2 min, at a flow rate of 25 mL/min; or METHOD B. A Gilson GX-281 semi-prep-HPLC with Phenomenex Synergi C18(10p.m, 150 x 25mm) , or Boston Green ODS C18 (4tm, 150 x 30mm), and mobile phase of 5-99%
ACN in water(0.1%TFA) over 10 min and then hold at 100% ACN for 2 min, at a flow rate of 25 mL/min; or METHOD C. A Gilson GX-281 semi-prep-IIPLC with Phenomenex Synergi C18(10ttm, 150 x 25mm), or Boston Green ODS C18 (51.tm, 150 x 30mm), and mobile phase of 5-99%
ACN in water(0.05%HC1) over 10 min and then hold at 100% ACN for 2 min, at a flow rate of 25 mL/min; or METHOD D. a Gilson GX-281 semi-prep-HPLC with Phenomenex Gemini C18 (10[Im, 150 x 25mm), AD(10m, 250mm x 30mm), or Waters XBridge C18 column (51.tm, 150 x 30mm), mobile phase of 0-99% ACN in water (with 0.05% ammonia hydroxide v/v) over 10 min and then hold at 100% ACN for 2 min, at a flow rate of 25 mL/min; or METHOD E. a Gilson GX-281 semi-prep-HPLC with Phenomenex Gemini C18 (lOttm, 150 x 25mm), or Waters )(Bridge C18 column (51,tm, 150 x 30mm), mobile phase of 5-99%
ACN in water(lOmM NH4HCO3) over 10 min and then hold at 100% ACN for 2 min, at a flow rate of 25 mL/min.
[0367] Preparative supercritical fluid high performance liquid chromatography (SFC) was performed either on a Thar 80 Prep-SFC system, or Waters 80Q Prep-SFC system from Waters.
The ABPR was set to 100bar to keep the CO2 in SF conditions, and the flow rate may verify according to the compound characteristics, with a flow rate ranging from 50g/min to 70g/min.
The column temperature was ambient temperature.
[0368] Mass spectra (MS) were obtained on a SHIMADZU LCMS-2020 MSD or Agilent 1200\G6110A MSD using electrospray ionization (ESI) in positive mode unless otherwise indicated. Calculated (calcd.) mass corresponds to the exact mass.
[0369] Nuclear magnetic resonance (NMR) spectra were obtained on Bruker model spectrometers. Definitions for multiplicity are as follows: s = singlet, d =
doublet, t= triplet, q = quartet, dd = doublet of doublets, ddd = doublet of doublet of doublets, td = triplet of doublets, dt = doublet of triplets, spt = septet, quin = quintet, m = multiplet, br =
broad. It will be understood that for compounds comprising an exchangeable proton, said proton may or may not be visible on an NMR spectrum depending on the choice of solvent used for running the NMR spectrum and the concentration of the compound in the solution.
[0370] Chemical names were generated using ChemDraw Ultra 12.0, ChemDraw Ultra 14.0 (CambridgeSoft Corp., Cambridge, MA) or ACD/Name Version 10.01 (Advanced Chemistry).
Compounds designated as R* or S* are enantiopure compounds where the absolute configuration was not determined.
Intermediate 1: 3 -((B enzy loxy)methyl)-4-ethyl- 1H-1,2,4-tri azol-5(4H)-one.
Bn0 N
N
HN-_1 [0371] Step A. 2-(Benzyloxy)acetohydrazide.
103721 To a solution of ethyl 2-(benzyloxy)acetate (55 g, 283.17 mmol) in Et0H
(500 mL) was added NH2NH2-1-120 (28.3 g, 566 mmol, 27.5 mL). The reaction mixture was heated at 78 C
for 6 h. The reaction mixture was concentrated under reduced pressure to afford the title product (52 g, crude) as a colorless oil, which was used directly in the next step without further purification.
[0373] Step B. 3 -((B enzyl oxy)m ethyl)-4-ethy1-1H-1, 2,4-triazol -5(4H)-one.
[0374] To a solution of 2-(benzyloxy)acetohydrazide (52 g, 288 mmol) in H20 (500 mL) was added dropwise isocyanatoethane (25.1 g, 346 mmol, 27.9 mL) at 0 C. After the addition was complete, the mixture was stirred at 25 C for 12 hr. To the mixture was added H20 (20 mL), and an aqueous solution (120 mL) of NaOH (57.7 g, 1.44 mol). The mixture was stirred at 95 C for 12 hr. The reaction mixture was cooled to rt, then quenched with HC1 (12 M) at 0 C
and adjusted to "pH" 6. The solid was filtered and dried under reduced pressure to afford the title compound as a white solid (61 g, 91% yield). 1-1-1NIMR (400 MHz, CDC13) ö ¨9.23 - 9.09 (m, 1H),-7.41 - 7.31 (m, 5H),-4.58 -4.53 (m, 2H),-4.45 - 4.42 (m, 2H),-3.82 -3.75 (m, 2H),-1.33 - 1.29 (m, 3H) ppm.
Intermediate 2: 5-(((tert-Butyldiphenylsilypoxy)methyl)-4-ethyl-2,4-dihydro-3H-1,2,4-triazol-3 -one.
TBDPSO
N
I N
HN
103751 Step A. 4-Ethyl-5-(hydroxymethyl)-2,4-dihydro-3H-1,2,4-triazol-3-one.
103761 To a solution of 5-[(benzyloxy)methyl]-4-methyl-2,4-dihydro-3H-1,2,4-triazol-3-one (8 g, 34.3 mmol, 1.0 eq.) in methanol (200 mL) was added Pd/C (2 g). The resulting mixture was maintained under hydrogen and stirred at rt for 6 h. Then the resulting mixture was filtered and the filtrate was concentrated to afford the crude product 4-ethy1-5-(hydroxym ethyl)-2,4-dihydro-3H-1,2,4-triazol-3-one as a white solid (4.3 g, 88 % yield). 1H NMR
(400 MHz, DMSO-d6) 6 11.52 (s, 1H), 5.55 (t, J= 5.50 Hz, 1H), 4.32 (d, J = 5.50 Hz, 2H), 3.64 (q, J =
6.97 Hz, 2H), 1.18 (t, J= 6.97 Hz, 3H) ppm.
103771 Step B. 5-(((tert-Butyldiphenylsilypoxy)methyl)-4-ethyl-2,4-dihydro-3H-1,2,4-triazol-3 -one .
103781 To a solution of 4-ethyl-5-(hydroxymethyl)-2,4-dihydro-3H-1,2,4-triazol-3-one (3 g, 21 mmol, 1.0 eq.) in DCM (30 mL) was added tert-butylchlorodiphenylsilane (6.5 mL, 25 mmol, 1.2 eq.) and pyridine (1.86 mL, 23 mmol, 1.1 eq.). The resulting mixture was stirred at rt overnight. The reaction mixture was quenched with water (100 mL). The resulting mixture was extracted with DCM (3 x 100 mL). The organic layers were combined, dried over anhydrous sodium sulfate, filtered and concentrated. The residue was purified by silica gel chromatography (SiO2, 50-80% ethyl acetate / petroleum ether) to afford 5-(((tert-butyldiphenylsilyl)oxy)methyl)-4-ethyl-2,4-dihydro-3H-1,2,4-triazol-3-one as a white solid (4.9 g, 61 % yield). LCMS (ES-API): mass calcd. for C211-127N302Si, 381.2; m/z found, 382.2 [M-41]'. 1H NMR (400 MHz, CDC13) 6 9.98 (s, 1H), 7.61-7.72 (m, 4H), 7.32-7.54 (m, 6H), 4.54 (s, 2H), 3.84 (q, J = 7.34 Hz, 2H), 1.33 (t, J= 7.34 Hz, 311), 1.07 (s, 9H) ppm.
Intermediate 3: 5-((B enzyl oxy)m ethyl)-4-ethy1-2-(7-fluoro- 1- oxo-4-(prop-l-cn-2-y1)- 1H-i sochromen-6-y1)-2,4-dihydro-3H-1.2,4-tri azol-3- one.
Bn0 N
N
0, o if [0379] Step A. tert-Butyl 4,5-difluoro-2-iodobenzoate.
[0380] 4,5-Difluoro-2-iodobenzoic acid (3 g, 11 mmol) was dissolved in TI-IF
(30 mL), then di-tert-butyl dicarbonate (4.6 g, 21 mmol) was added followed by DMAP (645 mg, 5.3 mmol).
The reaction mixture was stirred under nitrogen at 50 C overnight, then cooled down to room temperature. The solvent was evaporated under reduced pressure. The residue was diluted with Et0Ac then washed with brine. The organic layer was separated, dried with Na2SO4, filtered, and concentrated. The residue was purified by silica column chromatography (gradient elution:
0 - 5% Et0Ac in petroleum ether) to give the title compound as a yellow oil (2.9 g, yield: 79%).
1H NMR (400 MHz, CDC13) 6 7.77 (dd, J= 10.2, 7.9 Hz, 1 H), 7.63 (dd, J= 10.2, 7.9 Hz, 1 H), 1.62 (s, 911) ppm; 19F NMR (376 'VLF-1z, CDC13) 6 -131.55 - -131.13 (m, 1 F), -136.97 - -136.65 (m, 1 F) ppm.
[0381] Step B. tert-Butyl 4-(3 -((b enzyl oxy)m ethyl)-4-ethy1-5 -ox o-4,5 -di hy dro-11-1-1,2, 4-tri azol-1-y1)-5 -fluoro-2-i odob enzoate.
[0382] A mixture of tert-butyl 4,5-difluoro-2-iodobenzoate (3.2 g, 9.4 mmol), ((b enzyl oxy)m ethyl)-4-ethy1-1H-1 ,2,4-tri azol-5(4H)-one (Intermediate 1, 2.6 g, 11.2 mmol) and Cs2CO3 (6.1 g, 18.7 mmol) in anhydrous DMF (30 mL) was stirred under nitrogen at 75 C
for 1 h, then cooled to room temperature. The mixture was filtered through a pad of Celite , and the pad was washed with Et0Ac. The filtrate was combined, washed with brine, and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 -40% Et0Ac in petroleum ether) to give the title compound as a colorless amorphous solid (5 g, yield: 96%). ESI-MS: mass calcd. for C23H25FIN304, 553.1; m/z found, 554.1 [M+Hr 1H
NMR (400 MHz, CDC13) 6 8.16 (d, J= 7.1 Hz, 1 H), 7.62 (d, J= 10.8 Hz, 1 H), 7.29 - 7.45 (m, 5 H), 4.61 (s, 2 H), 4.50 (s, 2 H), 3.84 (q, J= 7.2 Hz, 2 H), 1.63 (s, 9 H), 1.35 (t, J= 7.2 Hz, 3 H) ppm; 19F NMR (376 MHz, CDC13) 6 -119.09 (dd, J= 10.6, 7.0 Hz, 1 F) ppm.
[0383] Step C. 4-(3-((B enzyloxy)methyl)-4-ethy1-5 -oxo-4,5 -dihydro-1H-1, 2,4-triazol-1 -y1)-5-fluoro-2-iodobenzoic acid.
[0384] To a solution of tert-butyl 4-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoate (5 g, 9 mmol) in DCM (50 mL) was slowly added TFA (10 mL). The reaction mixture was stirred at room temperature overnight.
The reaction mixture was concentrated under vacuum. The obtained residue was triturated with petroleum ether at room temperature for 30 min. The mixture was filtered and the solid was rinsed with petroleum ether. The precipitate was collected and dried in yam() to give the title compound as a white solid (4.1 g, yield: 91%). ESI-MS: mass calcd. for C19H17FIN304, 497.0; m/z found, 498.0 [M-h_El] .1H NMR (400 MHz, DMSO-d6) 6 8.16 (d, J= 7.3 Hz, 1 H), 7.78 (d, J
= 11.0 Hz, 1 H), 7.28 - 7.43 (m, 5 H), 4.60 (s, 2 H), 4.57 (s, 2 H), 3.74 (q, .1 = 7.2 Hz, 2 H), 1.23 (t, J= 7.2 Hz, 3 H) ppm; 19F NMR (376 MHz, DMSO-d6) 6 -119.91 (s, 1 F) ppm.
[0385] Step D. 5-((Benzyl oxy)m ethyl )-4-ethy1-2-(7-fluoro-1-oxo-4-(prop-1 -en -2-y1)-1H-isochromen-6-y1)-2,4-dihydro-3H-1,2,4-triazol-3-one.
[0386] To a mixture of 3-methylbuta-1,2-dien-1-y1 acetate (Intermediate 12, 280 mg, 2.2 mmol), 4-(3 -((b enzyl oxy)methyl)-4-ethy1-5 -oxo-4,5-dihydro-1H-1, 2,4-tri azol-1 -y1)-5-fluoro-2-i odobenzoi c acid (1.1 g, 2.2 mmol) and Cy2N1Me (867 mg, 4.4 mmol) in DMF
(7 mL) was added Catacxium A Pd G2 (74.2 mg, 0.11 mmol) under nitrogen. The reaction mixture was stirred under nitrogen at 90 'V for overnight. The mixture was then cooled to room temperature, diluted with Et0Ac and washed with brine. The organic layer was separated and the aqueous layer was combined and extracted with Et0Ac. The combined organic layer was dried over Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 - 80% Et0Ac in petroleum ether) to give the title compound as yellow solid (240 mg, yield: 25%). ESI-MS: mass calcd. for C24H22FN304, 435.2; m/z 436.2 [M-41]+.1H
NMR (400 MHz, CDC13) 6 8.15 (d, J = 10.5 Hz, 1 H), 7.86 (d, J = 6.8 Hz, 1 H), 7.30 - 7.45 (m, 5 H), 7.19 (s, 1 H), 5.37 -5.39 (m, 1 H), 5.18 (s, 1 H), 4.62 (s, 2 H), 4.53 (s, 2 H), 3.87 (q, J = 7.1 Hz, 2H), 2.11 (s, 3 H), 1.37 (t, J= 7.2 Hz, 3 H) ppm.
Intermediate 4: 5-((Benzyloxy)methyl)-4-ethy1-2-(7-fluoro-4-isopropyl-1-oxo-1H-isochromen-6-y1)-2,4-dihydro-3H-1,2,4-triazol-3-one.
Bn0 N
I N
N,Af Method I:
[0387] Step A. 3-Methylbut-2-en- 1-yl 4,5-difluoro-2-iodobenzoate.
[0388] To the mixture of 4,5-difluoro-2-iodobenzoic acid (1.4 g, 4.9 mmol) and Cs2CO3 (4.8 g, 14.8 mmol) in anhydrous DMF (20 mL) was added 1-bromo-3-methyl-2-butene (1.5 g, 9.9 mmol). The reaction mixture was stirred at room temperature for 18 h. The mixture was diluted with water, and the mixture was extracted with DCM and Et0Ac. The combined organic extract was dried over Na2SO4, filtered and concentrated. The residue was purified by flash chromatography (SiO2, gradient elution: 10-20% Et0Ac in heptane) to give the desired product as a colorless oil (1.6 g, yield: 92%). II-INMR (400 MHz, CDC13) 6 7.80 (dd, J
=7 .58, 9.54 Hz, 1H), 7.73 (dd, .1 = 7.83, 10.76 Hz, 1H), 5.42-5.52 (m, 1H), 4.82 (d, .1 = 7.34 Hz, 2H), 1.80 (s, 3H), 1.78(s, 3H) ppm.
[0389] Step B. 3 -Methylbut-2 -en-1 -y1 4-(3 -((b enzyloxy)m ethyl)-4-ethy1-5 -oxo-4, 5-di hy dro-1H-1,2,4-triazol-1-y1)-5-fluoro-24 odobenzoate.
[0390] To a mixture of 3-methylbut-2-en- 1 -y1 4,5-difluoro-2-iodobenzoate (1.6 g, 4.5 mmol), 3-((benzyloxy)methyl)-4-ethyl-1H-1,2,4-triazol-5(4H)-one (Intermediate 1, 2.1 g, 9.1 mmol) in anhydrous DMF (25 mL) was added Cs2CO3 (2.9 g, 9.1 mmol). The reaction mixture was heated under nitrogen at 85 C for 1 h, then cooled to room temperature. The mixture was diluted with water, and the mixture was extracted with DCM and Et0Ac. The combined organic extract was dried over Na2SO4, filtered and concentrated. The residue was purified by flash chromatography (SiO2, gradient elution: 20-50% Et0Ac in heptane) to give the title compound as a white solid (2.4 g, yield: 93%). LCMS (ES-API): mass calcd. for C24H25FIN304, 565.1;
m/z found, 566.2 [M-41]". NMR (400 MHz, CDC13) 6 8.21 (d, J = 6.85 Hz, 1H), 7.73 (d, J
= 11.25 Hz, 1H), 7.29-7.44 (m, 5H), 5.41-5.53 (m, 1H), 4.84 (d, J= 7.34 Hz, 2H), 4.60 (s, 2H), 4.50 (s, 2H), 3.84 (q, J = 7.22 Hz, 2H), 1.80 (s, 3H), 1.78 (d, J= 0.98 Hz, 3H), 1.34 (t, J = 7.22 Hz, 3H) ppm.
[0391] Step C. 5-((Benzyloxy)methyl)-4-ethy1-2-(7-fluoro-44 sopropy1-1-oxo-1H-i sochrom en-6-y1)-2,4-di hy dro-3H-1,2,4-tri azol-3 -one.
[0392] To a mixture of 3 -methylbut-2-en-l-y1 4-(3 -((b enzyloxy)methyl)-4-ethy1-5 -oxo-4, 5 -dihydro-1H-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoate (4 g, 6.86 mmol, 1 eq) in toluene (200 mL) was added (tBu3P)PdG2 (351 mg, 0.69 mmol, 0.1 eq), N-cyclohexyl-N-methyl-cyclohexanamine (1.60 mL, 7.54 mmol, 1.1 eq) respectively. The reaction mixture was degassed with nitrogen for three times, and then heated under nitrogen atmosphere at 80 C for 18 h. LCMS analysis showed -18% of starting material remained. The mixture was cooled to 15 C, and additional N-cyclohexyl-N-methyl- cyclohexanamine (0.72 mL, 3.43 mmol, 0.5 eq) and tBu3PPdG2 (176 mg, 0.34 mmol, 0.05 eq) were added. The reaction mixture was degassed with nitrogen, and then heated under nitrogen atmosphere at 80 C for 16 h. The mixture was concentrated under reduced pressure, then diluted with H20 (200 mL), and extracted with Et0Ac (150 mL x 3). The combined organic layers were washed with brine (100 mL
x 2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The residue was purified by flash chromatography (SiO2, Petroleum ether/Ethyl acetate=5/1 to 3/1) to give the title compound as a yellow oil (1.1 g, yield: 35%). ESI-MS: mass calcd. for C24H24FN304, 437.2;
m/z found, 438.5 [M+H]. 1H NMR (400 MHz, CDC13) 6 8.16(d, J= 6.6 Hz, 1H), 7.96 (d, J
= 6.6 Hz, 1H), 7.42 -7.34 (m, 5H), 7.13 (s, 1H), 4.63 (s, 2H), 4.54 (s, 2H), 3.88 (dd, I= 7.2, 14.4 Hz, 2H), 3.13- 3.06(m, 1H), 1.38 ( tõI= 7.2 Hz, 3H), 1.32 (dõI = 6.8 Hz, 6H) ppm.
Method II:
103931 To a mixture of 5-((benzyloxy)methyl)-4-ethy1-2-(7-fluoro-1-oxo-4-(prop-1-en-2-y1)-1H-isochromen-6-y1)-2,4-dihydro-3H-1,2,4-triazol-3-one (Intermediate 3, 5.9 g, 13.5 mmol) in THF (100 mL) at room temperature was added Wilkinson's Catalyst [RhCl(PP103]
(3.8 g, 4.1 mmol). The mixture was degassed and purged with hydrogen gas. The reaction mixture was stirred under an atmosphere of hydrogen (15 Psi) at room temperature for 12 h.
The mixture was concentrated. The residue was purified by silica column chromatography (elution: 0 -25%
Et0Ac in petroleum ether) to give the title compound as a yellow solid (1.5 g, yield: 77%). ESI-MS: mass calcd. for C24H24FN304, 437.2; m/z found 438.2 [M-FH]+. 1H NMR (400 MHz, DMSO-d6) 6 8.10 (d, J= 10.5 Hz, 1 H), 8.01 (d, J= 7.0 Hz, 1 H), 7.46 (s, 1 H), 7.26 - 7.42 (m, H), 4.61 (s, 2 H), 4.59 (s, 2 H), 3.77 (q, J= 7.3 Hz, 2 1-1), 3.08 (dt, J=
13.4, 6.8 Hz, 1 H), 1.22 - 1.28 (m, 911) ppm; 19F NMR (376 MHz, DMSO-d6) 6 -118.29 (br s, 1 F) ppm.
Intermediate 5: 4-(3-((Benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoyl chloride.
Bn0 IN
[0394] Step A. tert-Butyl 4,5-difluoro-2-iodobenzoate.
[0395] 4,5-Difluoro-2-iodobenzoic acid (3 g, 11 mmol) was dissolved in THE (30 mL), then di-tert-butyl dicarbonate (4.6 g, 21 mmol) was added followed by DMAP (645 mg, 5.3 mmol).
The reaction mixture was stirred under nitrogen at 50 C overnight, then cooled down to room temperature. The solvent was evaporated under reduced pressure. The residue was diluted with Et0Ac then washed with brine. The organic layer was separated, dried with Na2SO4, filtered, and concentrated. The residue was purified by silica column chromatography (gradient elution:
0 - 5% Et0Ac in petroleum ether) to give the title compound as a yellow oil (2.9 g, yield: 79%).
1H NMR (400 MHz, CDC13) 6 7.77 (dd, J = 10.2, 7.9 Hz, 1 H), 7.63 (dd, J =
100101 In some embodiments, the present invention is directed to methods for treating a subject who has been diagnosed with a hematopoietic disorder, the methods comprising administering to the subject a therapeutically effective amount of a menin-MLL inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof; a therapeutically effective amount of venetoclax, or a pharmaceutically acceptable salt or solvate thereof; and a therapeutically effective amount of azacitidine or a pharmaceutically acceptable salt or solvate thereof; wherein the venetoclax, or a pharmaceutically acceptable salt or solvate thereof, is administered to the subject prior to, simultaneous with, or after the administration of the menin-MLL inhibitor; and wherein the azacitidine, or a pharmaceutically acceptable salt or solvate thereof, is administered to the subject prior to, simultaneous with, or after the administration of the menin-MLL
inhibitor.
100111 In embodiments, the menin-MLL inhibitor of Formula (1) is:
X
X
n3(X )n4 n1( )n2 Ri a (I) Yu Rib 1011 and the tautomers and the stereoisomeric forms thereof, wherein xa R
xb Rla represents -C(=0)- xNR aRxb; Het; or NR
Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety;
wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalkyl and C1_4alkyl;
IV and IVb are each independently selected from the group consisting of hydrogen, Ci-4alkyl and C3_6cycloalkyl;
Rib represents F or Cl;
Y' represents -CR5aR5b-, -0- or R2 is selected from the group consisting of hydrogen, halo, CI-alkyl, -0-Ci-4alkyl, and -NR7aR7b;
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
Xl represents CH, and X2 represents N;
R4 represents isopropyl;
R5a, R5b, R5c, R7a, and km, are each independently selected from the group consisting of hydrogen, C1_4a1ky1 and C3_6cycloalkyl;
R3 represents -C3_6alkyl_NR8aR8b, -c _6 al kyl -C (=0)-NR9aR9b, -C _6 al kyl-OH, or 6alkyl-NR11-C(=0)-0-Ch4alky1-0-C(=0)-Ci_4a1ky1; wherein each of the CI-alkyl or C16alky1 moieties in the R3 definitions independently of each other may be substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C14alkyl;
Rsa and leb are each independently selected from the group consisting of hydrogen; C1-6alkyl; -C(=0)-Ci_4alky1; -C(=0)-0-C3_4alky1; -C(=0)-NR12aRl2b; and C3_6a1kyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S (=0)2-C 3_4alkyl, -0-C 3_4a1ky1, -C(=0)-NR10aRlOb, and _NRioc_c(=o)_c 1_ 4alkyl; and R9a, R9b, Rtoa, Riob, Rioc, R12a, and R' are each independently selected from the group consisting of hydrogen and C3_6alky1;
and the pharmaceutically acceptable salts and the solvates thereof.
[0012] In particular embodiments, the menin-NILL inhibitor of Formula (I) is (R)-N-ethyl--fluoro-N-i sopropy1-245-(2-(64(2-methoxyethyl)(methypamino)-2-methylhexan-3 -y1)-2, 6-diazaspiro [3 .4] octan-6-y1)- 1, 2,4-tri azin-6 -yl)oxy)b enzami de besylate salt (benzenesulfonate salt):
/N \-0/
rNR-re-j besylate salt and solvates thereof.
[0013] A skilled person will understand that the 'and solvates thereof' refer to the besylate salt of (R)-N-ethyl-5 -fluoro-N-i sopropy1-2-((5 -(2-(6-((2-m ethoxy ethyl)(m ethyl)ami no)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3 .4]octan-6-y1)-1 ,2,4-tri azin-6-yl)oxy)b enzami de.
[0014] In particular embodiments, the menin-MLL inhibitor of Formula (I) is (R)-N-ethyl--fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide besylate salt or hydrates thereof.
[0015] In particular embodiments, the menin-MLL inhibitor of Formula (I) is (R)-N-ethyl-5 -fluoro-N-i sop ropy1-2-((5 -(2-(6-((2-m ethoxy ethyl)(m ethyl)ami no)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt or solvates thereof.
[0016] In particular embodiments, the menin-MLL inhibitor of Formula (I) is (R)-N-ethyl-5 -fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt or hydrates thereof.
[0017] In particular the present invention is directed to (R)-N-ethy1-5-fluoro-N-isopropyl-2-45 -(2-(6-((2-methoxyethyl)(m ethyl)amino)-2-m ethylhexan-3 -y1)-2,6-diazaspiro[3 .4] octan-6-y1)4,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt 0.5-2.0 equivalents hydrate.
[0018] In particular the present invention is directed to (R)-N-ethy1-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3 . octan-6-y1)4,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt 2.0 equivalents hydrate.
[0019] In particular embodiments, the menin-MLL inhibitor of Formula (I) is a crystalline form A of (R)-N-ethyl -5-fl uoro-N-i sopropy1-2-((5-(2-(6-42-m ethoxyethyl )(m ethyl ami n o)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3 . 4-]octan-6-y1)-1,2,4-tri azin-6-yl)oxy)b enzami de bis-besylate salt hydrate.
[0020] In particular embodiments, the menin-MLL inhibitor of Formula (I) is a crystalline form A of (R)-N-ethyl-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3 4]octan-6-y1)-1,2,4-tri azin-6-yl)oxy)b enzami de bis-besylate salt 0.5-2.0 equivalents hydrate.
[0021] More in particular the present invention is directed to a crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-245-(2-(6-((2-methoxyethyl)(methyl)amino)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3 .4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt 2.0 equivalents hydrate.
[0022] Additional embodiments, features, and advantages of the invention will be apparent from the following detailed description and through practice of the invention.
BRIEF DESCRIPTION OF THE DRAWINGS
[0023] FIG. 1 is an X-ray powder diffraction (XRPD) pattern of Compound A4: a crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2 -m ethyl hexan-3 -y1)-2, 6 -di azaspiro [3 .4] octan-6 -y1)-1,2, 4 -tri azi n-6 -yl)oxy)b enzami de bis-besylate salt hydrate.
[0024] FIG. 2 depicts a comparison of tumor volumes as a function of time for the control group and for the treatment groups treated with a regimen comprising various amounts of Compound A3.
[0025] FIG. 3 depicts a comparison of tumor percent survival as a function of time (e.g., Kaplan-Meier survival curves) for the control group and for the treatment groups treated with a regimen comprising various amounts of Compound A3.
[0026] FIG. 4A depicts a comparison of percent survival as a function of time of mice bearing established OCI-AML3 tumors following treatment with vehicle, monotherapy with either venetoclax, azacitidine or Compound Al, the doublet combination of either venetoclax and azacitidine, or Compound Al and venetoclax, or the triplet combination of Compound Al, venetoclax and azacitidine.
[0027] FIG. 4B depicts a comparison of percent survival as a function of time of mice bearing established MOLM-13 tumors following treatment with vehicle, monotherapy with either venetoclax, azacitidine or Compound Al, the doublet combination of either venetoclax and azacitidine, or Compound Al and venetoclax, or the triplet combination of Compound Al, venetoclax and azacitidine.
[0028] FIG. 5A is a contour plot for maxR which illustrates the effect of Compound A3 in combination with venetoclax on proliferation of MOT ,M- I 3 cells in vitro [0029] FIG. 5B is a contour plot for maxR which illustrates the effect of Compound A3 in combination with azacitidine and venetoclax on proliferation of MOLM-13 cells in vitro.
[0030] FIG. 6A is a contour plot for maxR which illustrates the effect of Compound A4 in combination with decitabine on proliferation of MOLM-13 cells in vitro.
[0031] FIG. 6B is a contour plot for maxR which illustrates the effect of Compound A4 in combination with decitabine and venetoclax on proliferation of MOLM-13 cells in vitro.
[0032] FIG. 7A is a contour plot for maxR which illustrates the effect of Compound A4 in combination with decitabine on proliferation of OCI-AML3 cells in vitro.
[0033] FIG. 7B is a contour plot for maxR which illustrates the effect of Compound A4 in combination with decitabine and venetoclax on proliferation of OCI-AML3 cells in vitro.
DESCRIPTION OF THE INVENTION
[0034] The term 'halo' or 'halogen' as used herein represents fluoro, chloro, bromo and iodo.
[0035] The prefix (where x and y are integers) as used herein refers to the number of carbon atoms in a given group. Thus, a Ci_6alkyl group contains from 1 to 6 carbon atoms, and so on.
[0036] The term `C1_4alkyr as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 1 to 4 carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, s-butyl, t-butyl and the like.
[0037] Similar, the term 'C1_6alkyl' as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 1 to 6 carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, s-butyl, t-butyl, n-pentyl, n-hexyl and the like [0038] The term C3_6cycloalkyr as used herein as a group or part of a group defines a saturated, cyclic hydrocarbon radical having from 3 to 6 carbon atoms, such as cyclopropyl, cyclobutyl, cyclopentyl and cyclohexyl.
[0039] It will be clear for the skilled person that S(=0)2 or SO2 represents a sulfonyl moiety.
[0040] It will be clear for the skilled person that CO or C(=0) represents a carbonyl moiety.
[0041] It will be clear for the skilled person that a group such as -CRR-represents R R
[0042] ¨C¨
. An example of such a group is -CR5aR5b-.
[0043] It will be clear for the skilled person that a group such as -NR-represents -N-. An example of such a group is -N12-10044] Non-limiting examples of monocyclic 5-or 6-membered aromatic rings containing one, two or three nitrogen atoms and optionally a carbonyl moiety', include, but are not limited to pyrazolyl, imidazolyl, pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl, triazinyl or 1,2-dihydro-2-oxo-4-pyridinyl.
[0045] The skilled person will understand that a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and a carbonyl moiety includes, but is not limited to H
,and [0046] When any variable occurs mole than one time in any constituent, each definition is independent.
[0047] When any variable occurs more than one time in any formula (e.g., Formula (I)), each definition is independent.
[0048] In general, whenever the term 'substituted' is used in the present invention, it is meant, unless otherwise indicated or clear from the context, to indicate that one or more hydrogens, in particular from 1 to 4 hydrogens, more in particular from 1 to 3 hydrogens, preferably 1 or 2 hydrogens, more preferably 1 hydrogen, on the atom or radical indicated in the expression using 'substituted' are replaced with a selection from the indicated group, provided that the normal valency is not exceeded, and that the substitution results in a chemically stable compound, i.e., a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture (isolation after a reaction e g , purification by silica gel chromatography) In a particular embodiment, when the number of sub stituents is not explicitly specified, the number of substituents is one [0049] Combinations of substituents and/or variables are permissible only if such combinations result in chemically stable compounds. 'Stable compound' is in this context meant to indicate a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture (isolation after a reaction e.g., purification by silica gel chromatography).
[0050] The skilled person will understand that the term 'optionally substituted' means that the atom or radical indicated in the expression using 'optionally substituted' may or may not be substituted (this means substituted or unsubstituted respectively).
[0051] When two or more substituents are present on a moiety they may, where possible and unless otherwise indicated or clear from the context, replace hydrogens on the same atom or they may replace hydrogen atoms on different atoms in the moiety.
[0052] Within the context of this invention 'saturated' means 'fully saturated', if not otherwise specified.
[0053] Unless otherwise specified or clear from the context, aromatic rings groups, can be attached to the remainder of the molecule of Formula (1) through any available ring carbon atom (C-linked) or nitrogen atom (N-linked).
[0054] Unless otherwise specified or clear from the context, aromatic rings groups, may optionally be substituted, where possible, on carbon and/or nitrogen atoms according to the embodiments.
[0055] The term "comprising" as used herein, encompasses the terms "consisting of" and "consisting essentially of." All embodiments described herein using the term "comprising" are also applicable for embodiments of the invention wherein the term "comprising"
is limited to "consisting of." Likewise, all embodiments described herein using the term"
comprising" are also applicable for embodiments of the invention wherein the term "comprising"
is limited to "consisting essentially of."
[0056] The term "subject" as used herein, refers to an animal, preferably a mammal (e.g., cat, dog, primate or human), more preferably a human, who is or has been the object of treatment, observation or experiment [0057] The term "therapeutically effective amount" as used herein, means that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human that is being sought by a researcher, veterinarian, medicinal doctor or other clinician, which includes alleviation or reversal of the symptoms of the disease or disorder being treated.
[0058] The term "composition" is intended to encompass a product including the specified ingredients in the specified amounts, as well as any product which results, directly or indirectly, from combinations of the specified ingredients in the specified amounts.
[0059] The terms "treatment" and "treating," as used herein, are intended to refer to all processes wherein there may be a slowing, interrupting, arresting or stopping of the progression of a disorder, or amelioration of one or more symptoms thereof, but does not necessarily indicate a total elimination of all symptoms [0060] As used herein, any chemical formula with bonds shown only as solid lines and not as solid wedged or hashed wedged bonds, or otherwise indicated as having a particular configuration (e.g., R, S) around one or more atoms, contemplates each possible stereoisomer, or mixture of two or more stereoisomers.
[0061] Hereinbefore and hereinafter, the term "compound(s) of Formula (I)" is meant to include the tautomers thereof and the stereoisomeric forms thereof.
[0062] Hereinbefore and hereinafter, the term "compound(s) of Formula (Z)" is meant to include the tautomers thereof and the stereoisomeric forms thereof.
[0063] The terms "stereoisomers", "stereoisomeric forms" or "stereochemically isomeric forms"
hereinbefore or hereinafter are used interchangeably.
[0064] The invention includes all stereoisomers of the compounds of the invention either as a pure stereoisomer or as a mixture of two or more stereoisomers.
[0065] Enantiomers are stereoisomers that are non-superimposable mirror images of each other.
A 1:1 mixture of a pair of enantiomers is a racemate or racemic mixture.
[0066] Atropisomers (or atropoisomers) are stereoisomers which have a particular spatial configuration, resulting from a restricted rotation about a single bond, due to large steric hindrance. All atropisomeric forms of the compounds of Formula (I) are intended to be included within the scope of the present invention.
[0067] Diastereomers (or diastereoisomers) are stereoisomers that are not enantiomers, i.e., they are not related as mirror images. If a compound contains a double bond, the substituents may be in the E or the Z configuration.
[0068] Substituents on bivalent cyclic saturated or partially saturated radicals may have either the cis- or trans-configuration; for example, if a compound contains a disubstituted cycloalkyl group, the substituents may be in the cis or trans configuration.
[0069] Therefore, the invention includes enantiomers, atropisomers, diastereomers, racemates, E isomers, Z isomers, cis isomers, trans isomers and mixtures thereof, whenever chemically possible.
[0070] The meaning of all those terms, i.e., enantiomers, atropisomers, diastereomers, racemates, E isomers, Z isomers, cis isomers, trans isomers and mixtures thereof are known to the skilled person.
[0071] The absolute configuration is specified according to the Cahn-Ingold-Prelog system.
The configuration at an asymmetric atom is specified by either R or S.
Resolved stereoisomers whose absolute configuration is not known can be designated by (+) or (-) depending on the direction in which they rotate plane polarized light. For instance, resolved enantiomers whose absolute configuration is not known can be designated by (+) or (-) depending on the direction in which they rotate plane polarized light.
[0072] When a specific stereoisomer is identified, this means that said stereoisomer is substantially free, i.e., associated with less than 50%, preferably less than 20%, more preferably less than 10%, even more preferably less than 5%, in particular less than 2%
and most preferably less than 1%, of the other stereoisomers. Thus, when a compound of Formula (I) is for instance specified as (R), this means that the compound is substantially free of the (S) isomer;
when a compound of Formula (I) is for instance specified as E, this means that the compound is substantially free of the Z isomer; when a compound of Formula (I) is for instance specified as cis, this means that the compound is substantially free of the trans isomer.
[0073] Some of the compounds according to Formula (I) may also exist in their tautomeric form. Such forms in so far as they may exist, although not explicitly indicated in the above Formula (I) are intended to be included within the scope of the present invention. It follows that a single compound may exist in both stereoisomeric and tautomeric form.
[0074] Pharmaceutically acceptable salts include acid addition salts and base addition salts.
Such salts may be formed by conventional means, for example by reaction of a free acid or a free base form with one or more equivalents of an appropriate base or acid, optionally in a solvent, or in a medium in which the salt is insoluble, followed by removal of said solvent, or said medium, using standard techniques (e.g., in vacno, by freeze-drying or by filtration) Salts may also be prepared by exchanging a counter-ion of a compound of the invention in the form of a salt with another counter-ion, for example using a suitable ion exchange resin.
[0075] The pharmaceutically acceptable salts as mentioned hereinabove or hereinafter are meant to comprise the therapeutically active non-toxic acid and base salt forms which the compounds of Formula (I) and solvates thereof, are able to form [0076] Appropriate acids comprise, for example, inorganic acids such as hydrohalic acids, e.g., hydrochloric or hydrobromic acid, sulfuric, nitric, phosphoric and the like acids; or organic acids such as, for example, acetic, propanoic, hydroxyacetic, lactic, pyruvic, oxalic (i.e., ethanedioic), malonic, succinic (i.e., butanedioic acid), maleic, fumaric, malic, tartaric, citric, methanesulfonic, ethanesulfonic, benzenesulfonic, p-toluenesulfonic, cyclamic, salicylic, p-aminosalicylic, pamoic and the like acids. Conversely said salt forms can be converted by treatment with an appropriate base into the free base form.
[0077] The compounds of Formula (I) and solvates thereof containing an acidic proton may also be converted into their non-toxic metal or amine salt forms by treatment with appropriate organic and inorganic bases.
[0078] Appropriate base salt forms comprise, for example, the ammonium salts, the alkali and earth alkaline metal salts, e.g., the lithium, sodium, potassium, cesium, magnesium, calcium salts and the like, salts with organic bases, e.g., primary, secondary and tertiary aliphatic and aromatic amines such as methylamine, ethylamine, propylamine, isopropylamine, the four butylamine isomers, dimethylamine, diethylamine, diethanolamine, dipropylamine, diisopropylamine, di-n-butylamine, pyrrolidine, piperidine, morpholine, trimethylamine, triethylamine, tripropylamine, quinuclidine, pyridine, quinoline and isoquinoline; the benzathine, N-methyl-D-glucamine, hydrabamine salts, and salts with amino acids such as, for example, arginine, lysine and the like. Conversely the salt form can be converted by treatment with acid into the free acid form.
[0079] The term "prodrug" includes any compound that, following oral or parenteral administration, in particular oral administration, is metabolised in vivo to a (more) active form in an experimentally-detectable amount, and within a predetermined time (e.g., within a dosing interval of between 0.5 and 24 hours, or e.g., within a dosing interval of between 6 and 24 hours (i.e., once to four times daily)). For the avoidance of doubt, the term "parenteral" administration includes all forms of administration other than oral administration, in particular intravenous (IV), intramuscular (IM), and subcutaneous (SC) injection.
[0080] Prodrugs may be prepared by modifying functional groups present on a compound in such a way that the modifications are cleaved in vivo when such prodrug is administered to a mammalian subject. The modifications typically are achieved by synthesizing the parent compound with a prodrug substituent. In general, prodrugs include compounds wherein a hydroxyl, amino, sulfhydryl, carboxy or carbonyl group is bonded to any group that may be cleaved in vivo to regenerate the free hydroxyl, amino, sulfhydryl, carboxy or carbonyl group, respectively.
[0081] Examples of prodrugs include, but are not limited to, esters and carbamates of hydroxy functional groups, esters groups of carboxyl functional groups, N-acyl derivatives and N-Mannich bases. General information on prodrugs may be found e.g., in Bundegaard, H. "Design of Prodrugs" p. 1-92, Elesevier, New York-Oxford (1985).
[0082] The term solvate comprises the solvent addition forms as well as the salts thereof, which the compounds of Formula (I) are able to form. Examples of such solvent addition forms are e.g., hydrates, alcoholates and the like.
[0083] The compounds of the invention as prepared in the processes described below may be synthesized in the form of mixtures of enantiomers, in particular racemic mixtures of enantiomers, that can be separated from one another following art-known resolution procedures.
A manner of separating the enantiomeric forms of the compounds of Formula (I), and pharmaceutically acceptable salts, and solvates thereof, involves liquid chromatography using a chiral stationary phase. Said pure stereochemically isomeric forms may also be derived from the corresponding pure stereochemically isomeric forms of the appropriate starting materials, provided that the reaction occurs stereospecifically. Preferably if a specific stereoisomer is desired, said compound would be synthesized by stereospecific methods of preparation. These methods will advantageously employ enantiomerically pure starting materials.
[0084] The term "enantiomerically pure" as used herein means that the product contains at least 80% by weight of one enantiomer and 20% by weight or less of the other enantiomer. Preferably the product contains at least 90% by weight of one enantiomer and 10% by weight or less of the other enantiomer. In the most preferred embodiment the term "enantiomerically pure"
means that the composition contains at least 99% by weight of one enantiomer and 1% or less of the other enantiomer.
[0085] The present invention also embraces isotopically-labeled compounds which are identical to those recited herein, but for the fact that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature (or the most abundant one found in nature).
[0086] All isotopes and isotopic mixtures of any particular atom or element as specified herein are contemplated within the scope of the invention, either naturally occurring or synthetically produced, either with natural abundance or in an isotopically enriched form.
Exemplary isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine, chlorine and iodine, such as 2H, 3H, 13c, 14c, 13N, 150, 170, 180, 32P, 33p, 35s, 18F, 36c1, 1221, 1231, 1251, 131-, 1 75Br, 76Br, 77Br and 82Br.
Preferably, the isotope is selected from the group of 2H, 3H, 11( 13C and "F.
Preferably, the isotope is selected from the group of 2H, 3H, 11C and 18F. More preferably, the isotope is 2H, 3H
or 13C. More preferably, the isotope is 2H or 'C. More preferably, the isotope is 2H. In particular, deuterated compounds and 13C-enriched compounds are intended to be included within the scope of the present invention. In particular, deuterated compounds are intended to be included within the scope of the present invention.
[0087] Certain isotopically-labeled compounds (e.g., those labeled with 3H and NC) may be useful for example in substrate tissue distribution assays. Tritiated (3H) and carbon-14 (mC) isotopes are useful for their ease of preparation and detectability. Further, substitution with heavier isotopes such as deuterium (i.e., 2H) may afford certain therapeutic advantages resulting from greater metabolic stability (e.g., increased in vivo half-life or reduced dosage requirements) and hence may be preferred in some circumstances. Positron emitting isotopes such as 150, 13N, "C and "F are useful for positron emission tomography (PET) studies. PET
imaging in cancer finds utility in helping locate and identify tumors, stage the disease and determine suitable treatment. Human cancer cells overexpress many receptors or proteins that are potential disease-specific molecular targets. Radiolabelled tracers that bind with high affinity and specificity to such receptors or proteins on tumor cells have great potential for diagnostic imaging and targeted radionuclide therapy (Charron, Carlie L. et al.
Tetrahedron Lett. 2016, 57(37), 4119-4127). Additionally, target-specific PET radiotracers may be used as biomarkers to examine and evaluate pathology, by for example, measuring target expression and treatment response (Austin R. etal. Cancer Letters (2016), doi: 10.1016/j .canlet.2016.05.008).
[0088] Solid oral dosage forms such as, tablets or capsules, containing one or more compounds described herein may be administered in at least one dosage form at a time, as appropriate. It is also possible to administer the compounds in sustained release formulations.
[0089] Additional oral forms in which the compounds described herein may be administered include elixirs, solutions, syrups, and suspensions; each optionally containing flavoring agents and coloring agents.
[0090] Alternatively, one or more compounds described herein can be administered by inhalation (intratracheal or intranasal) or in the form of a suppository or pessary, or they may be applied topically in the form of a lotion, solution, cream, ointment or dusting powder. For example, they can be incorporated into a cream comprising, consisting of, and/or consisting essentially of an aqueous emulsion of polyethylene glycols or liquid paraffin.
They can also be incorporated, at a concentration of between about 1 % and about 10 % by weight of the cream, into an ointment comprising, consisting of, and/or consisting essentially of a wax or soft paraffin base together with any stabilizers and preservatives as may be required. An alternative means of administration includes transdermal administration by using a skin or transdermal patch.
[0091] The pharmaceutical compositions used in the methods of the present invention (as well as the compounds alone) can also be injected parenterally, for example, intracavernosally, intravenously, intramuscularly, subcutaneously, intradermally, or intrathecally. In this case, the compositions will also include at least one of a suitable carrier, a suitable excipient, and a suitable diluent.
[0092] For parenteral administration, the pharmaceutical compositions of the present invention are best used in the form of a sterile aqueous solution that may contain other substances, for example, enough salts and monosaccharides to make the solution isotonic with blood.
[0093] For buccal or sublingual administration, the pharmaceutical compositions of the present invention may be administered in the form of tablets or lozenges, which can be formulated in a conventional manner.
[0094] By way of further example, pharmaceutical compositions containing a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, and a BCL-2 inhibitor and optionally, at least one other antineoplastic agent as an active ingredient can be prepared by mixing the compound(s) with a pharmaceutically acceptable carrier, a pharmaceutically acceptable diluent, and/or a pharmaceutically acceptable excipient according to conventional pharmaceutical compounding techniques. The carrier, excipient, and diluent may take a wide variety of forms depending upon the desired route of administration (e.g., oral, parenteral, etc.).
Thus, for liquid oral preparations such as, suspensions, syrups, elixirs and solutions, suitable carriers, excipients and diluents include water, glycols, oils, alcohols, flavoring agents, preservatives, stabilizers, coloring agents and the like; for solid oral preparations such as, powders, capsules, and tablets, suitable carriers, excipients and diluents include starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like. Solid oral preparations also may be optionally coated with substances such as, sugars, or be enterically coated so as to modulate the major site of absorption and disintegration. For parenteral administration, the carrier, excipient and diluent will usually include sterile water, and other ingredients may be added to increase solubility and preservation of the composition. Injectable suspensions or solutions may also be prepared utilizing aqueous carriers along with appropriate additives such as, solubilizers and preservatives.
[0095] According to particular embodiments, methods using a therapeutically effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, and a BCL-2 inhibitor and optionally, at least one other antineoplastic agent, may comprise a dose range from about 0.1 mg to about 3000 mg, or any particular amount or range therein, in particular from about 1 mg to about 1000 mg, or any particular amount or range therein, of active ingredient in a regimen of about 1 to about (4x) per day for an average (70 kg) human;
although, it is apparent to one skilled in the art that the therapeutically effective amount for a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, and a BCL-2 inhibitor and optionally, at least one other antineoplastic agent, will vary as will the diseases, syndromes, conditions, and disorders being treated.
[0096] An embodiment of the present invention is directed to methods of using pharmaceutical compositions for oral administration, comprising a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof in an amount of from about 1 mg to about 500 mg. Advantageously, a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof may be administered in a single daily dose, or the total daily dosage may be administered in divided doses of two, three and (4x) daily.
[0097] Optimal dosages of a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof to be administered may be readily determined and will vary with the particular compound used, the mode of administration, the strength of the preparation, and the advancement of the hematopoietic disorder. In addition, factors associated with the particular subject being treated, including subject gender, age, weight, diet and time of administration, will result in the need to adjust the dose to achieve an appropriate therapeutic level and desired therapeutic effect. The above dosages are thus exemplary of the average case.
There can be, of course, individual instances wherein higher or lower dosage ranges are merited, and such are within the scope of this invention.
[0098] Compounds of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof may be administered in any of the foregoing compositions and dosage regimens or by means of those compositions and dosage regimens established in the art whenever use of a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered to a subject in need thereof [0099] An embodiment of the present invention is directed to methods of using pharmaceutical compositions for intravenous or subcutaneous administration, comprising a BCL-2 inhibitor in an amount of from about 1 mg to about 500 mg. Advantageously, the BCL-2 inhibitor may be administered in a single daily dose, or the total daily dosage may be administered in divided doses of two, three and (4x) daily.
[0100] Optimal dosages of the BCL-2 inhibitor to be administered may be readily determined and will vary with the particular compound used, the mode of administration, the strength of the preparation, and the advancement of the disease, syndrome, condition or disorder. In addition, factors associated with the particular subject being treated, including subject gender, age, weight, diet and time of administration, will result in the need to adjust the dose to achieve an appropriate therapeutic level and desired therapeutic effect. The above dosages are thus exemplary of the average case. There can be, of course, individual instances wherein higher or lower dosage ranges are merited, and such are within the scope of this invention.
[0101] The BCL-2 inhibitor may be administered in any of the foregoing compositions and dosage regimens or by means of those compositions and dosage regimens established in the art whenever use of a BCL-2 inhibitor is administered to a subject in need thereof.
[0102] As used herein, the term "menin-MLL inhibitor" refers to an inhibitor of the protein-protein interaction between menin and mixed-lineage leukemia 1 (MLL1) (also known as histone-lysine N-methyltransferase 2A (KMT2A) protein in the scientific field (UniProt Accession # Q03164)) which inhibits or reduces menin-MLL 1 activity. Menin-MLL
inhibitors described herein are disclosed in PCT/CN2020/137266 (which published as WO
on June 24, 2021), which is incorporated by reference herein in its entirety, and which also discloses corresponding synthetic schemes and analytical characterizations.
[0103] As used herein, the term "BCL-2 inhibitor" refers to an agent that inhibits or reduces BCL-2 activity.
[0104] As used herein, the term "antineoplastic agent" refers to any agent that treats cancer.
[0105] As used herein, the term "hypomethylating agent" refers to an agent that inhibits or reduces DNA methylation.
[0106] As used herein, the term "kinase inhibitor" refers to an agent that inhibits or reduce the activity of at least one kinase (e.g., tyrosine and/or serine kinases such as fms-like receptor tyrosine kinase-3 (FLT3), Bruton tyrosine kinase (BTK), an Abelson tyrosine kinase 1 (ABL), an Aurora serine/tyrosine kinase).
[0107] As used herein, the term "FLT-3 inhibitor" refers to tyrosine kinase inhibitors (TKI) classified into first and next generation inhibitors based on their potency and specificity for fms-like receptor tyrosine kinase-3 (FLT3) and their associated downstream targets.
[0108] As used herein, the term "CD20 inhibitor" refers to any agent that reduces activity of CD20.
[0109] As used herein, the term "isocitrate dehydrogenase (1DH) inhibitor"
refers to any agent that interferes with the conversion of isocitrate to a-ketoglutarate (a-KG) in the tricarboxylic acid (TCA) cycle [0110] As used herein, the term "immunomodulatory antineoplastic agent" refers to any agent that enhances antitumor immune cell activity.
[0111] As used herein, the term "programmed cell death protein 1 (PD-1) inhibitor" refers to any agent that inhibits or reduces PD-1 activity.
[0112] As used herein, the term "dihydroorotate dehydrogenase (DHODH) inhibitor" refers to any agent that inhibits or reduces dihydroorotate dehydrogenase activity.
[0113] As used herein, unless otherwise noted, the term "affect" or "affected"
(when referring to a disease, disorder, or medical condition that is affected by the inhibition or alteration of menin-MLL activity) includes a reduction in the frequency and/or severity of one or more symptoms or manifestations of said hematopoietic disorder; and/or includes the prevention of the development of one or more symptoms or manifestations of said hematopoietic disorder or the development of the hematopoietic disorder.
[0114] As used herein, the term "hematopoietic disorder" refers to any disorder associated with the production of the cellular components of blood and blood plasma, including but not limited to blood cancers.
[0115] According to an embodiment, the invention provides combinations as described herein.
[0116] According to an embodiment, the invention provides combinations as described herein for use as a medicament.
[0117] According to an embodiment, the invention provides combinations as described herein for the manufacture of a medicament.
[0118] According to an embodiment, the invention provides combinations as described herein for the manufacture of a medicament for the treatment or prevention of any one of the disease conditions mentioned herein.
[0119] According to an embodiment, the invention provides combinations as described herein for use in the prevention or treatment, in particular treatment, of diseases as described herein.
[0120] According to an embodiment, the invention provides combinations as described herein for use in the prevention or treatment, in particular treatment, of a hematopoietic disorder, including but not limited to blood cancers, including but not limited to lymphomas, myelomas and leukemias.
[0121] According to an embodiment, the invention provides combinations as described herein for use in the prevention or treatment, in particular treatment, of a hematopoietic disorder.
[0122] According to an embodiment, the hematopoietic disorder is selected from, but not limited to, lymphomas, myelomas, myelodysplasia and leukemias.
[0123] According to an embodiment, the hematopoietic disorder is a lymphoma selected from Hodgkin's disease lymphomas and Non-Hodgkin's lymphomas.
[0124] According to an embodiment, the lymphoma is a Non-Hodgkin's disease that is Burkitt's lymphoma, anaplastic large cell lymphoma, splenic marginal zone lymphoma, hepatosplenic T-cell lymphoma or angioimmunoblastic T-cell lymphoma (AILT).
[0125] According to an embodiment, the hematopoietic disorder is a myeloma.
According to an embodiment, the hematopoietic disorder is a multiple myeloma, Waldenstrom macroglobulinemia or plasmacytoma.
[0126] According to an embodiment the hematopoietic disorder is a myelodysplasia including, but not limited to, myelodysplastic syndrome (MDS).
[0127] According to an embodiment, the hematopoietic disorder is a leukemia.
[0128] According to an embodiment, the hematopoietic disorder is a leukemia selected from acute leukemias and chronic leukemias. According to an embodiment, the leukemia is an acute leukemia. According to an embodiment, the leukemia is chronic leukemia.
[0129] According to an embodiment, the hematopoietic disorder is a myeloid leukemia, myelogeneous leukemia, lymphoblastic leukemia, or lymphocytic leukemia, According to an embodiment, the hematopoietic disorder is a leukemia selected from, but not limited to, acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), small lymphocytic leukemia (SLL), acute myeloid leukemia (AML), chronic idiopathic myelofibrosis (MF), chronic myelogenous leukemia (CML), T-cell prolymphocytic leukemia (T-PLL), B-cell prolymphocytic leukemia (B-PLL), chronic neutrophilic leukemia (CNL), Hairy cell leukemia lg (HCL), T-cell large granular lymphocyte leukemia (T-LGL) and aggressive NK-cell leukemia.
According to an embodiment, the AML is acute megakaryoblastic leukemia (AMKL).
[0130] According to an embodiment, the leukemia is MDS, CLL, SLL, ALL or AML.
According to an embodiment, the leukemia is CLL, SLL or AML. According to an embodiment, the leukemia is CLL or SLL. In some embodiments, the CLL or SLL is a CD20 expressing cancer. According to an embodiment, the leukemia is ALL or AML. According to an embodiment, the leukemia is ALL. According to an embodiment, the leukemia is AML.
According to an embodiment, the hematopoietic disorder is Waldenstrom macroglobulinemia.
[0131] According to an embodiment, the hematopoietic disorder is a MILL-rearranged leukemia, MILL-partial tandem duplication (PTD) leukemia, MILL amplified leukemia, MILL-positive leukemia, or leukemia exhibiting elevated HOX/MEIS1 gene expression signatures.
[0132] According to an embodiment, the leukemia is a MILL-rearranged leukemia &/or a nucleophosmin 1 (NPM1)-mutated leukemia.According to an embodiment, the hematopoietic disorder is a MILL-rearranged leukemia.
[0133] According to an embodiment, the hematopoietic disorder is a nucleophosmin 1 (NPM1)-mutated leukemia (e.g., NPM1c).
[0134] According to an embodiment, the invention provides methods for treatment of a hematopoietic disorder that is myelodysplastic syndrome (MDS), a myeloproliferative neoplasm (MPN), acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), a small lymphocytic lymphoma (SLL) or chronic lymphocytic leukemia (CLL), comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, and a BCL-2 inhibitor, and optionally, at least one other antineoplastic agent.
[0135] According to an embodiment, the hematopoietic disorder is myelodysplastic syndrome (MDS) or a myeloproliferative neoplasm (MPN).
[0136] According to an embodiment, the hematopoietic disorder is acute lymphocytic leukemia (ALL).
[0137] According to an embodiment, the hematopoietic disorder is acute myeloid leukemia (AML).
[0138] According to an embodiment, the hematopoietic disorder is a small lymphocytic lymphoma (SLL) or chronic lymphocytic leukemia (CLL).
[0139] According to an embodiment, the hematopoietic disorder is a SLL or CLL
where SLL
or CLL is a CD20-expressing cancer.
[0140] According to an embodiment, the hematopoietic disorder is myelodysplastic syndrome (MDS).
[0141] According to an embodiment, the hematopoietic disorder is a my eloproliferative neoplasm (1VIPN).
[0142] According to an embodiment, the hematopoietic disorder is a NPM1-mutated leukemia with a FLT3 mutation.
[0143] According to an embodiment, the hematopoietic disorder is a FLT3-dependent leukemia.
[0144] According to an embodiment, the hematopoietic disorder is a MEF2G-dependent leukemia.
[0145] According to an embodiment, the hematopoietic disorder harbours one or more MLL1 (KMT2A) gene rearrangements or alterations (e.g., duplications or amplification) and/or NPM1 mutations.
[0146] According to an embodiment, the hematopoietic disorder harbours (i) one or more MLL1 (KMT2A) gene rearrangements or alterations (e.g., duplications or amplification) and/or NPM1 mutations plus (ii) a FLT3 mutation.
[0147] According to an embodiment, the hematopoietic disorder is an MLL-rearranged leukemia.
[0148] According to an embodiment, the hematopoietic disorder is acute myeloid leukemia (AML).
[0149] According to an embodiment, the hematopoietic disorder is a small lymphocytic lymphoma (SLL).
[0150] According to an embodiment, the hematopoietic disorder is a chronic lymphocytic leukemia (CLL).
[0151] According to an embodiment, the hematopoietic disorder is an acute leukemia, chronic leukemia, myeloid leukemia, myelogeneous leukemia, lymphoblastic leukemia, lymphocytic leukemia, acute myelogeneous leukemia (AML), chronic myelogenous leukemia (CIVIL), acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), T cell prolymphocytic leukemias (T-PLL), large granular lymphocytic leukemia, Hairy cell leukemia (HCL), MLL-rearranged leukemia, MLL-PTD leukemia, MLL amplified leukemia, MLL-positive leukemia, or leukemia exhibiting elevated IIOXIMEISI gene expression signatures.
[0152] According to an embodiment, the hematopoietic disorder is AML, in particular nucleophosmin (NPM1)-mutated AML (i.e., NPM1" AML), more in particular abstract NPM I -mutated AML.
[0153] According to an embodiment, the hematopoietic disorder is a IVILL-rearranged leukemia, in particular MLL-rearranged AML or ALL.
[0154] According to an embodiment, the hematopoietic disorder includes a MLL gene alteration, in particular the hematopoietic disorder is AML or ALL
with MLL gene alteration(s). In certain embodiments, the MLL gene alteration is a duplication.
In certain embodiments the MLL gene alteration is an amplification.
[0155] According to an embodiment, the hematopoietic disorder includes a NPM1 gene mutation and/or MILLI (also known as KiVIT2A) gene mutation.
[0156] According to an embodiment, MLL1 gene mutations include, but are not limited to, 1VILL1 gene rearrangements, duplications or amplification.
[0157] According to an embodiment, the hematopoietic disorder is a mixed-lineage leukemia (MIL), MLL-related leukemia, MLL-associated leukemia, MILL-positive leukemia, MILL-induced leukemia, leukemia associated with a MLL, acute leukemia, chronic leukemia, myelodysplastic syndrome (MD S), or myeloproliferative neoplasms (MPN).
[0158] All embodiments described herein for methods for treating a hematopoietic disorder, are also applicable for use in treating said hematopoietic disorder.
[0159] All embodiments described herein for use in treating a hematopoietic disorder, are also applicable for methods for treating said hematopoietic disorder.
[0160] All embodiments described herein for methods for treating a hematopoietic disorder, are also applicable for use in a method for treating said hematopoietic disorder.
[0161] All embodiments described herein for use in a method for treating a hematopoietic disorder, are also applicable for methods for treating said hematopoietic disorder.
[0162] In an embodiment, the present invention relates to a novel combination comprising:
= a therapeutically effective amount of a menin-MLL inhibitor of Formula (I), or a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt or a solvate thereof;
= a therapeutically effective amount of a BCL-2 inhibitor; and = optionally, a therapeutically effective amount of at least one other antineoplastic agent.
[0163] According to an embodiment, compounds of Foimula (I) are menin-MLL
inhibitors having the structure:
X
n3( ) )n4 n1( ('>)n2 1 a (I) Ribyu and the tautomers and the stereoisomeric forms thereof, wherein xa xb R" represents -C(=0)-NR ax Rxb, Het, or NR R
Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety;
wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalky1 and C1_4alkyl;
R' and WI' are each independently selected from the group consisting of hydrogen, Ci-4alkyl and C3_6cycloalkyl;
Rib represents F or Cl;
Y' represents -CR5aR5b-, -0- or R2 is selected from the group consisting of hydrogen, halo, Ch4alkyl, -0-Ci_4alkyl, and -NR7aR7b;
U represents N or CH, nl, n2, n3 and n4 are each independently selected from 1 and 2;
Xl represents CH, and X2 represents N;
R4 represents isopropyl, Rsa, R5b, R5C, R7a, and WI', are each independently selected from the group consisting of hydrogen, Ci¨talkyl and C3_6eycloalkyl, R3 represents -CI -6 alkyl-NR"R8b, -C1-6 alkyl-C (=0)-NR9aR9b, -C 1- 6 alkyl-OH, or -C1-6a1ky1-NR11-C(=0)-0-Ci_4a1kyl-O-C(=0)-Ci_4alkyl; wherein each of the Ci4alkyl or Ci_6alky1 moieties in the R3 definitions independently of each other may be substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo, -OH, and -0-Ci_4alky1;
R'a and R" are each independently selected from the group consisting of hydrogen; Ci-6alkyl, -C(=0)-0-Ci_4alkyl, _c(=0)_NRI2aRi2b, and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -s(=0)2-C3_4alkyl, -0-C3_4a1ky1, -C(=0)-NR10aRlOb, and _N-Rioc_c(=o)_c 1_ 4a1ky1; and R9a, R9b, R10a, R1013, R10c, R12a, and R12b are each independently selected from the group consisting of hydrogen and C 1-6 alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0164] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein xa xb Rla represents -C(=0)-NWa Rxb; Het; or N R R
Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety;
wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalky1 and C1_4alkyl;
R' and Wb are each independently selected from the group consisting of hydrogen, Ci-4alkyl and C3_6cycloalky1;
Rib represents F or Cl;
Y1 represents -CR5aR5b-, -0- or -NR5e-;
R2 is selected from the group consisting of hydrogen, halo, C3_4alkyl, -0-C3_4alkyl, and -NR7aR7b;
U represents N or CH;
n 1, n2, n3 and n4 are each independently selected from 1 and 2;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R5a, R5b, R5e, R7a, and R7b, are each independently selected from the group consisting of hydrogen, Ci_4alkyl and C3_6cycloalkyl;
R3 represents -Ch6alkyl-NR'R8b, -Ci_6alkyl-C(=0)-N1eaR9b, -Ci_6alkyl-OH, or -Ci-6alkyl-NR11-C(=0)-0 -C 1_4alkyl-O-C(=0)-C 3_4alkyl wherein each of the Ci_4alkyl or C3_6alkyl moieties in the R3 definitions independently of each other may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo or -0-C1_4alkyl;
R a and leb are each independently selected from the group consisting of hydrogen, Ci-6alkyl; -C(=0)-C1_4alky1; -C(=0)-0-C1_4alkyl; -C(=0)-NR12aRl2b; and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-C1_4alkyl, -0-C1_4alkyl, and -C(=0)-NRiOaRlOb; and R9a, R9b, Rioa, R10b, R12a, and R12b are each independently selected from the group consisting of hydrogen and Ci_6alky1;
and the pharmaceutically acceptable salts and the solvates thereof.
[0165] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein xa xb Itla represents -C(=0)-NRxa Rxb; Het; or N R R
=
Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety;
wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalky1 and C1_4alkyl;
R' and Wb are each independently selected from the group consisting of hydrogen, Ci--talkyl and C3_6cycloalkyl;
Rib represents F or Cl;
Y1 represents -CR5aR5b-, -0- or -NR5e-;
R2 is selected from the group consisting of hydrogen, halo, C1_4alkyl, -0-C1_4alkyl, and -NR7aR7b;
U represents N or CH;
n 1, n2, n3 and n4 are each independently selected from 1 and 2;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R5a, R5b, R5e, R7a, and R7b, are each independently selected from the group consisting of hydrogen, Ci_4alkyl and C3_6cycloalkyl;
R3 represents -C1_6alkyl-NR'le1); wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, OH, and -0-C1_4alkyl;
R' and R'b are each independently selected from the group consisting of hydrogen; C1-6a1ky1; and C3_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci_4alkyl, -C(=0)- 1NR OaR1 013, and -NR"c-C(=0)-Ci_4a1kyl; and R10a, R10b, R1 Oc are each independently selected from the group consisting of hydrogen and C1_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0166] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein xa x b R1a represents -C(=0)-NR ax Rxb; Het; or N R R
Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety;
wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalky1 and C3_4alkyl;
R' and It'th are each independently selected from the group consisting of hydrogen, Ci-4alkyl and C3_6cycloalkyl;
Rib represents F or Cl;
Y1 represents -CR5aR5b-, -0- or -NR5c-;
R2 is selected from the group consisting of hydrogen, halo, C1_4alkyl, -0-C1_4a1ky1, and -NR7aR7b;
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R5a, R5b, R5c, R7a, and R7b, are each independently selected from the group consisting of hydrogen, Ci_4alkyl and C3_6cycloalkyl;
R3 represents -Ci -6alkyl-NR8aR8b; wherein the Ci_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C1_4alkyl;
R8 and R8b are each independently selected from the group consisting of hydrogen; Ci_ 6alkyl; and C3_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-C3_4alkyl, -0-C3_4alkyl, and -C(=0)-NRiOaRl0b, and R'0a and leth are each independently selected from the group consisting of hydrogen and Ci_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
101671 According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rla represents -C(=0)-NR"Wb or Het;
Het represents a 6-membered monocyclic aromatic ring containing two nitrogen atoms;
wherein said 6-membered monocyclic aromatic ring is substituted with one C3_6cycloalkyl;
R' and Wb represent C1_4a1kyl;
Rib represents F;
Y1 represents -0-;
R2 represents hydrogen;
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2, X' represents CH, and X2 represents N, R4 represents isopropyl;
R3 represents -C1-6alkyl-NR8aR8b, -C1-6alkyl-C(=0)-NR9aR9b, -C 1- 6alkyl-OH, or -Ci-6alkyl-NR11-C(=0)-0-C1_4alkyl-O-C(=0)-C1_4a1 kyl ;
wherein each of the CI-alkyl or Ch6alkyl moieties in the R3 definitions independently of each other may be substituted with one, two or three substituents each independently selected from the group consisting of -OH and -0-C1_4a1kyl;
R" and R" are each independently selected from the group consisting of hydrogen; Ci-6alkyl; -C(=0)-Ci_4a1ky1; -C(=0)-0-C1_4a1ky1; _c (=co_NR12aR12b; and C1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -s(=0)2-C1_4alkyl, -C(=0)-NR10aRlOb, and -NR1 c-C(=0)-C,_ 4a1ky1; and R9a, R9b, R10a, R10b, R10c, Rn, R12a, and R12b are each independently selected from the group consisting of hydrogen and C1_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0168] According to an embodiment, compounds of Formula q) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rla represents -C(=0)-NR"Rth or Het, Het represents a 6-membered monocyclic aromatic ring containing two nitrogen atoms, wherein said 6-membered monocyclic aromatic ring is substituted with one C3_6cycloalkyl;
R' and 1Vb represent C1_4a1kyl, Rib represents F;
Yl represents -0-;
R2 represents hydrogen;
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
Xl represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -Ci_6alkyl-NR8aR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of -OH and -0-Ci_4alky1;
Rsa and leb are each independently selected from the group consisting of hydrogen; Ci 6alkyl; and Ci_6a1kyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci4a1kyl, -C(=0)-NR1 OaR1 and -NR1cc-C(=0)-Ci_4a1ky1; and R10a, R10b, and Rthc are each independently selected from the group consisting of hydrogen and Ci_6alkyl, and the pharmaceutically acceptable salts and the solvates thereof.
101691 According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rh a represents -C(=0)- xNR aRxb;
R' and 1Vb represent C1_4a1kyl;
Rib represents F;
Yl represents -0-;
R2 represents hydrogen;
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
X' represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -C1-6 alkyl-NR'R'; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of -OH and -0-Ci_4alky1, R8a and Itsb are each independently selected from the group consisting of hydrogen, Ci 6a1ky1; and Ci_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyan , halo, -S(-0)2-Ci_4alkyl, -0-C1_4alkyl, -C(-0)-NR10aRlOb, and _NRi0e-C(=0)-Ci4alkyl; and R10a, R10b, and R' are each independently selected from the group consisting of hydrogen and Ci_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0170] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R' represents -C(=0)-NR"Wb or Het;
Het represents pyrimidinyl substituted with one C3-6cycloalkyl;
It and Itxb represent Ci_4a1kyl;
Rib represents F;
Y1 represents -0-;
R2 represents hydrogen;
U represents N, nl, n2, n3 and n4 are each independently selected from 1 and 2, X1 represents CH, and X2 represents N, R4 represents isopropyl;
R3 represents -Ci_6alkyl-NR8aR8b, wherein the C1_6alkyl moiety in the R3 definition may be substituted with one -OH;
R8a- and Rsb are each independently selected from the group consisting of hydrogen; CI-6alkyl; and C1_6alkyl substituted with one or two substituents each independently selected from the group consisting of halo, -0-C1_4a1ky1, and -NR"-C(=0)-C1_4alkyl; and R10a, R10b, and R1 ' are each independently selected from the group consisting of hydrogen and C1_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0171] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R' represents -C(=0)-NRxaRxb or Het;
Het represents pyrimidinyl substituted with one C3_6cycloalkyl;
It' and It'd' represent C14a1kyl;
Rib represents F;
Y1 represents -0-, R2 represents hydrogen;
U represents N;
n2 is 2, nl, n3 and n4 are I;
X3 represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -C1_6alkyl-NleaR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one -OH;
R8a- and leb are each independently selected from the group consisting of hydrogen; Ci-6alkyl; and Ci_6alkyl substituted with one or two substituents each independently selected from the group consisting of halo, -0-0 _aalkyl, and -NR1 c-C(=0)-0-talkyl; and R10a, R10b, and R1 ' are each independently selected from the group consisting of hydrogen and Ci_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0172] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R1a represents -C(=0)-NR"R", R' and R' represent Ci-talkyl, Rib represents F, Y3 represents -0-;
R2 represents hydrogen;
U represents N;
n2 is 2, nl, n3 and n4 are 1;
X3 represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -C1_6alkyl-NR8aR8b;
R8a- and R8b are each independently selected from the group consisting of hydrogen; CI-6alkyl; and C16alkyl substituted with one or two substituents each independently selected from the group consisting of halo, -0-CI_4alkyl, and -NR"c-C(=0)-CI_4alkyl; and Riod, Riob, and Rme are each independently selected from the group consisting of hydrogen and C1-6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0173] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R" represents -C(=0)-NR ax Rxb;
R' and It represent C1_4a1kyl, Rib represents F;
Y1 represents -0-;
R2 represents hydrogen;
U represents N;
n2 is 2, nl, n3 and n4 are I;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -CH2-CH2-CH2-NR8aR81);
R8a- and R8b are each independently selected from the group consisting of hydrogen; CI
-(alkyl; and C16alkyl substituted with one or two substituents each independently selected from the group consisting of halo, -0-C1_4alky1, and -NR1 c-C(=0)-Ci_4alkyl; and R10", R10', and Itme are each independently selected from the group consisting of hydrogen and Ci_6alkyl, and the pharmaceutically acceptable salts and the solvates thereof.
101741 According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R' represents -C(=0)-NR ax Rxb;
R.' and It' represent C1_4a1kyl;
Rib represents F;
Y1 represents -0-;
R2 represents hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from I and 2;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -Ci_6alkyl-NR8aR8b;
R8a and R8b are each independently selected from the group consisting of hydrogen; C
6a1ky1; and Ch6a1kyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-C1-4alkyl, -0-Ci4alkyl, and -C(=0)-NR10aRlOb, and Rioa and Rmb are each independently selected from the group consisting of hydrogen and Ci_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0175] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rla represents -C(=0)- amtx Rxb;
R' and It'd' represent Ci_4a1kyl;
Rib represents F;
Yl represents -0-;
R2 represents hydrogen;
U represents N;
n I, n2, n3 and n4 are each independently selected from 1 and 2;
Xl represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -CH2-CH2-CH24\asaRsb;
R8a and leb are each independently selected from the group consisting of hydrogen, Ci-6alkyl, and Ci_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-C1-4alkyl, -0-C1_4alkyl, and -C(=0)-NR10aRlOb, and RI" and Rlob are each independently selected from the group consisting of hydrogen and Ci_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0176] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein ¨ la tc represents -C(=0)- aNRx Rxb;
R' and Itxb represent hydrogen or Ci_4alkyl;
Rib tc represents F;
Yl represents -0-;
R2 represents hydrogen;
U represents N;
n I, n2, n3 and n4 are each independently selected from 1 and 2;
X' represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -CH2-CH2-CH2-Nlealt";
R8a and Itsb are each independently selected from the group consisting of hydrogen, Ci-6a1ky1, and Ci_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(-0)2-Ci-4alkyl, -0-C14alkyl, and -C(-0)-NR10aRlOb, and RWa and R1' are each independently selected from the group consisting of hydrogen and Ci_oalkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0177] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R' represents -C(=0)-NR"Wb;
R' and Wb represent hydrogen or C1_4a1ky1;
Rib represents F;
Y3 represents -0-;
R2 represents hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from 1 and 2, X' represents CH, and X2 represents N, R4 represents isopropyl, R3 represents -CH2-CH2-CH2-NR8aR"; and R8a and R" are each independently selected from the group consisting of hydrogen, Ci-6alkyl; and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH and -0-Ci_4alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0178] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Ria represents -C(=0)- aNRx Rxb;
R' and Wb represent Ci_aalkyl;
lb I( represents F;
Y3 represents -0-, R2 represents hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from 1 and 2, X' represents CH, and X2 represents N, R4 represents isopropyl, R3 represents -C1_6alkyl-NR"R", and R' and R81' are each independently selected from the group consisting of Ci_6alkyl; and C1_6alkyl substituted with one -0-C1_4alkyl, and the pharmaceutically acceptable salts and the solvates thereof.
[0179] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rla represents -C(=0)- aNw wb;
R' and It'th represent Ci¨talkyl;
Rib represents F;
Yl represents -0-;
R2 represents hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
Xl represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -CH2-CH2-CH2-NR'R"; and RS a and le are each independently selected from the group consisting of C1_6alkyl, and C1_6alkyl substituted with one -0-Ci_4alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0180] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein Rla represents -C(=0)-N-RxaRxh; or Het;
Het represents a 6-membered monocyclic aromatic ring containing two nitrogen atoms;
wherein said 6-membered monocyclic aromatic ring is optionally substituted with one C3-6cycloalkyl;
Rxa- and WI' represent Ci_4alkyl;
-=-= lb lc represents F;
Yl represents -0-;
R2 is hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
X' represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -C1-6alkyl-NleaRsb, -C1-6alkyl-C(=0)-NR9aR9b, -Ci_6alkyl-OH, or -6alkyl-Nlel-C(=0)-0-C1_4alkyl-O-C(=0)-C1_4alkyl, R'a and R" are each independently selected from the group consisting of hydrogen; Ci-6alkyl, -C(=0)-0-Ci4alkyl, _c(=0)_NRI2aRi 2h, and C1_6a1kyl substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo, -S(=0)2-Ci_4alkyl, and -0-C1_4alkyl; and R9a, R9b, R12a, and R' are each independently selected from the group consisting of hydrogen and C1_6alkyl;
and the pharmaceutically acceptable salts and the solvates thereof.
[0181] According to an embodiment, compounds of Formula (I) are as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein R1a represents -C(=0)- aNRx Rxb;
It and Itxb represent Ci_4alkyl;
Rib represents F;
Y1 represents -0-;
R2 is hydrogen;
U represents N;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
X1 represents CH, and X2 represents N;
R4 represents isopropyl;
R3 represents -Ci_6alkyl-NR8aR", -Ci_6alkyl-C(=0)-NR94R9b, or -Ci_6alkyl-OH;
R a and R" are each independently selected from the group consisting of hydrogen; Ci-6alkyl; -C(=0)-C 1_4a1ky1; -C(=0)-0-C1_4alkyl; -C(=0)-NR12aRl2b; and C 1-6 alkyl substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo, -S(=0)2-Ci_4alkyl, and -0-Ci_4alky1; and R9a, R9b, Rua., and R12b are each independently selected from the group consisting of hydrogen and Ci_oalkyl;
and the pharmaceutically acceptable salts and the solvates thereof [0182] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Rib represents F.
[0183] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R2 represents hydrogen.
[0184] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein n1 is 1, n2 is 2, n3 is 1, and n4 is 1.
[0185] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Yi represents -0-.
[0186] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Yi represents -0-; and U
represents N.
[0187] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Yi represents -0-; U
represents N; Rib represents F; and R2 represents hydrogen.
[0188] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het represents NN
[0189] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het represents a monocyclic 5- or 6-membered aromatic ring containing one or two nitrogen atoms, wherein said monocyclic 5- or 6-membered aromatic ring is substituted with one C3_6cycloalkyl.
[0190] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het represents a monocyclic 5- or 6-membered aromatic ring containing one or two nitrogen atoms, wherein said monocyclic 5- or 6-membered aromatic ring is substituted with one C3_6cycloalkyl, and Rib represents F.
[0191] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het represents a monocyclic 6-membered aromatic ring containing one or two nitrogen atoms; wherein said monocyclic 6-membered aromatic ring is substituted with one C3_6cycloalkyl.
[0192] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het represents a monocyclic 6-membered aromatic ring containing one or two nitrogen atoms; and wherein said monocyclic 6-membered aromatic ring is substituted with one C3_6cycloalkyl; and Rib represents F.
[0193] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NleaR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C1_4alkyl.
[0194] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1_6alkyl-NleaR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl [0195] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alky1-NleaR8b.
[0196] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NR8aR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo and -0-Ci_4alky1; R8a. and R8b are each independently selected from the group consisting of hydrogen;
Ci_6alkyl; and Ci-6alkyl substituted with one, two or three substituents each independently selected from the _c(=0)_NRio _1( 10b group consisting of -OH, cyano, halo, -S(=0)2-C1_4alkyl, , and -NR1 c-C(=0)-C1 _4a1ky1 [0197] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1_6alkyl-NR8aR8b; wherein the Ci_6alkyl moiety in the R3 definition may be substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8a and R81' are each independently selected from the group consisting of hydrogen; Ci_6alkyl;
and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci4alkyl, _c(=0)_NRioaRiob, and -Nit' 'c-C(=0)-C 1_4alkyl [0198] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NR8aR8b; wherein the Ci_oalkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C
i_4alkyl; lea and Ieb are each independently selected from the group consisting of hydrogen;
Ci_6alkyl; and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-Ci_4alkyl, -0-Ci_4alkyl, and -C(=0)-ONR1 aRlOb.
[0199] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NR8aR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C
i_4alkyl; R8a and It' are each independently selected from the group consisting of hydrogen, C1_6alkyl, and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-C1_4alkyl, -0-C 1_4alkyl, _c(=c)_NR10aRlOb, and -NRI c-C(=0)-C1_4alkyl.
[0200] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-INVaR8b; wherein the C1_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8 a and R8b are each independently selected from the group consisting of hydrogen; C1_6alkyl;
and Ci_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-Ci_4alkyl, -0-C1_4alkyl, and -C(=0)- ONR1 aRlOb.
[0201] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NR8aR8b; wherein the Ci_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8a. and R81' are each independently selected from the group consisting of hydrogen; Ci_6alkyl;
and Ci_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(-0)2-C1_4alkyl, -C(-0)-ONR1 aRl0b, and -NR1'e-C(=0)-C t-talkyl [0202] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR5b; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-Ci_4alkyl.
[0203] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR"; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-Ci_4alkyl.
[0204] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR"; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-Ci_4alky1, lea and R" are each independently selected from the group consisting of hydrogen, C
i_6alkyl, and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-C1_4alkyl, -C(=0)-NR 01 aR1013, and _NR' LA 0)-C
[0205] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR"; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8a and R" are each independently selected from the group consisting of hydrogen; C1_6alkyl;
and C1_6alkyl substituted with one, two or three sub stituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-CI_4alkyl, -C(=0)-NR10aR101), and -NR1 c-C(=0)-C hztalkyl [0206] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R1 represents -C2_6alkyl-NR8aR"; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C14alkyl, It, and WI' are each independently selected from the group consisting of hydrogen; C1_6a1kyl;
and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-Ci_4alkyl, -0-C1_4alkyl, and -C(=0)- ONR1 aRlOb.
[0207] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR8b; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C
i_4alkyl; R8a and R8b are each independently selected from the group consisting of hydrogen;
Ci_6alkyl; and Ci-6alkyl substituted with one, two or three substituents each independently selected from the =
group consisting of cyano, halo, -S(=0)2-C1_4alkyl, -0-C1_4alkyl, and _c(0)_NRioaRtob.
[0208] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1_6alky1-NRsaR8b;
R8a and leb are each independently selected from the group consisting of C1_6alkyl, and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ct-4alkyl, -0-Ci4alkyl, and _c(=0)_NRioaRtob.
[0209] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NR8aR8b; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8 a and R8b are each independently selected from the group consisting of hydrogen; C1_6alkyl;
and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(=0)2-C1_4alkyl, -0-C1_4alkyl, -C(=0)-ONR1 aR1013, and -NRmc-C(=0)-C _aalkyl [0210] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C2_6alkyl-NleaR8b; wherein the C2_6alkyl moiety in the R3 definition may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo and -0-C1_4alkyl; lea and R8b are each independently selected from the group consisting of hydrogen;
Ci_6alkyl; and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -S(-0)2-C1_4alkyl, -0-C1_4alkyl, _c(=c)_NR10aRlOb, and -NR1'e-C(=0)-C t-talkyl [0211] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl-NR8aR";
R8 a and R8b are each independently selected from the group consisting of C1_6alkyl; and Ci-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci-4alkyl, -C(=0)-NR'a-=-=_1( 10b , and -NR1 c-C(=0)-Calkyl [0212] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -Ci_6alkyl_NR8aR8b; Rsa represents C1_6alkyl; and R" represents C1_6alkyl substituted with one -0-C
i_Ltalkyl.
[0213] In an embodiment, the present invention relates to methods of using the compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1_6alkyl-NR8aR8b, -Ci_6alkyl-C(=0)-NR9aR9b, -C1_6alkyl-OH, or -Ci_6alkyl-NR11-C(=0)-0-C1_4alkyl-O-C(=0)-CiAalkyl, wherein each of the Ci-talkyl or Ci_6alkyl moieties in the R3 definitions independently of each other may be substituted with one, two or three sub stituents each independently selected from the group consisting of cyano, halo or -0-Ci4alkyl [0214] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1_6alkyl-NR8aR8b, -C1-6alkyl-C(=0)-NR9aR9b, or -C1_6alkyl _NR i-C(=0)-0-C 1_4alkyl -0 -C(=0)-C
; wherein each of the C1_4alkyl or Ci_6alkyl moieties in the R3 definitions independently of each other may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl.
[0215] In an embodiment, the present invention includes compounds of Formula (1) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -CH2-CH2-CH2-NR8aR8b.
[0216] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R3 represents -C1-12-0-12-NR8aR8b R a represents methyl, and R" represents -CH2-CH2-0CH3.
[0217] In an embodiment, the present invention includes compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein C1_6alkyl in the R3 definition -Ci_6alkyl-NR8aR8b s =
I limited to ¨CH2-CH2-CH2-.
[0218] In an embodiment, the present invention includes compounds of Formula (I) or the pharmaceutically acceptable salts or the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (Ia) or Formula (Ib):
x n3( ) )n4 n3( ) )n4 n1( )n2 n1( )n2 R1' R1 a N
R5' U U
N'N halo Rib halo Rib (Ia) or (Ib), wherein R' Rib, R3, R4, R5a, R5b, X2, nl, n2, n3, n4 and halo are as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0219] In an embodiment, the compounds of Formula (1), or the pharmaceutically acceptable salts or the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, are restricted to compounds of Formula (Ia), or the pharmaceutically acceptable salts or the solvates thereof. In an embodiment, the compounds of Formula (I), or the pharmaceutically acceptable salts or the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, are restricted to compounds of Formula (Ib), or the pharmaceutically acceptable salts or the solvates thereof.
[0220] In an embodiment, the present invention includes compounds of Formula (I), or the pharmaceutically acceptable salts or the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (I-y):
cR3 , (1-Y) fl(1 N'N
wherein R3 is as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0221] In Formula (I-y) n1 is 1, n2 is 2, n3 is 1, and n4 is 1.
[0222] In a particular embodiment, the compound of Formula (I) is Compound A:
0 \
N¨N
Compound A
or a pharmaceutically acceptable salt or solvate thereof.
[0223] In a particular embodiment, the compound of Formula (I) is Compound Al:
x H20 N (x : 2-3) N¨N
Compound Al.
[0224] In a particular embodiment, the compound of Formula (I) is Compound A2:
0 \
N¨N
Compound A2.
[0225] In a particular embodiment, the compound of Formula (I) is Compound A3:
0 co N- N
oxalate salt Compound A3.
[0226] In a particular embodiment, the compound of Formula (1) is Compound A4-a.
N is __________________________________________ / __ 0 \ _____________________________________________________ /
N
I
N -N besylate salt Compound A4-a or a solvate thereof.
[0227] In a particular embodiment, the menin-MLL inhibitor of Formula (I) is (R)-N-ethyl--fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide besylate salt or a hydrate thereof.
[0228] In a particular embodiment, the menin-MLL inhibitor of Formula (I) is (R)-N-ethyl-5 -fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt or a solvate thereof.
[0229] In a particular embodiment, the menin-MLL inhibitor of Formula (I) is (R)-N-ethy1-5-fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt (Compound A4-b) or a hydrate thereof.
[0230] In a particular embodiment, the menin-MLL inhibitor of Formula (I) is Compound A4:
crystalline form A of (R)-N-ethy1-5 -flu oro-N-i sopropyl-2-((5 -(2-(6-((2-methoxyethyl)(m ethyl)amino)-2-m ethylhexan-3 -y1)-2,6-diazaspiro[3 .4] octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate.
[0231] In a particular embodiment, the menin-MLL inhibitor of Formula (I) is a crystalline form A of (R)-N-ethyl-5 -fl uoro-N-i sopropy1-2-((5 -(2-(6-((2-m ethoxy ethyl)(m ethyl)ami no)-2-m ethyl hexan-3 -y1)-2,6-diazaspiro[3 .4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt 0.5-2.0 equivalents hydrate.
[0232] In an embodiment, the present invention relates to a subgroup of Formula (I) as defined in the general reaction schemes.
[0233] In an embodiment the compound of Formula (I) is selected from the group consisting of any of the exemplified compounds, tautomers and stereoisomeric forms thereof, and the free bases, any pharmaceutically acceptable salts, and the solvates thereof.
[0234] In some embodiments, provided is a pharmaceutical composition comprising a pharmaceutically acceptable carrier, and as active ingredient a therapeutically effective amount of a combination as described in any of the other embodiments.
[0235] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and optionally, at least one other antineoplastic agent.
[0236] According to embodiments, the menin-MLL inhibitor is a compound of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof.
[0237] According to particular embodiments, the menin-MLL inhibitor is Compound A or a pharmaceutically acceptable salt or solvate thereof.
[0238] According to particular embodiments, the menin-MLL inhibitor is Compound Al.
[0239] According to particular embodiments, the menin-MLL inhibitor is Compound A2.
[0240] According to particular embodiments, the menin-MLL inhibitor is Compound A3.
[0241] According to particular embodiments, the menin-MLL inhibitor is Compound A4-a or a solvate thereof.
[0242] According to particular embodiments, the menin-MLL inhibitor is Compound A4-b or a hydrate thereof.
[0243] According to particular embodiments, the menin-MLL inhibitor is Compound A4.
[0244] In particular embodiments, the menin-MLL inhibitor may have improved metabolic stability properties.
[0245] In particular embodiments, the menin-MLL inhibitor may have extended in vivo half-life (T1/2).
[0246] In particular embodiments, the menin-MLL inhibitor may have improved oral bioavailability.
[0247] In particular embodiments, the menin-MLL inhibitor may reduce tumor growth e.g., tumors harbouring MILL (KMT2A) gene rearrangements/alterations and/or NPM1 mutations.
[0248] In particular embodiments, the menin-MLL inhibitor may have improved PD
properties in vivo during a prolonged period of time, e.g. inhibition of target gene expression such as IVLEIS1 and upregulation of differentiation marker over a period of at least 16 hours.
[0249] In particular embodiments, the menin-MLL inhibitor may have an improved safety profile (e.g., reduced hERG inhibition; improved cardiovascular safety).
[0250] In particular embodiments, the menin-MLL inhibitor may be suitable for Q.D. dosing (once daily).
[0251] According to embodiments, the BCL-2 inhibitor is selected from obatoclax, HA14-1, navitoclax, ABT-737, TW-37, AT 1 0 1, sabutoclax, gamgogic acid and venetoclax, or pharmaceutically acceptable salts or solvates thereof.
[0252] According to particular embodiments, the BCL-2 inhibitor is venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0253] According to embodiments, at least one other antineoplastic agent is a hypomethylating agent, a DNA intercalating agent, a pyrimidine analog, a purine analog, a kinase inhibitor, a CD20 inhibitor, an 1DH inhibitor, immunomodulatory antineoplastic agent or a DHODH
inhibitor.
[0254] According to embodiments, at least one other antineoplastic agent is a hypomethylating agent, a DNA intercalating agent, a pyrimidine analog, a purine analog, a kinase inhibitor, a CD20 inhibitor, an isocitrate dehydrogenase (IDH) inhibitor.
[0255] According to embodiments, the hypomethylating agent includes, but is not limited to, azacitidine, decitabine, or pharmaceutically acceptable salts or solvates thereof.
[0256] According to embodiments, the DNA intercalating agent includes, but is not limited to, an anthracycline (e.g., daunorubicin, doxorubicin, idarubicin).
[0257] According to embodiments, the DNA intercalating agent is daunorubicin.
[0258] According to embodiments, the DNA intercalating agent is doxorubicin.
[0259] According to embodiments, the DNA intercalating agent is idarubicin.
[0260] According to embodiments, the pyrimidine analog includes, but is not limited to, cytarabine (ARA-C).
[0261] According to embodiments, the purine analog is fiudarabine.
[0262] According to embodiments, the kinase inhibitor is a FLT-3 inhibitor, a BTK inhibitor, an ABL inhibitor, an Aurora inhibitor or a multi-kinase inhibitor of two or more kinase inhibitors thereof [0263] According to embodiments, the kinase inhibitor is a multi-kinase inhibitor of FLT-3 inhibitor, ABL inhibitor, and Aurora inhibitor. According to embodiments, such multi-kinase inhibitor includes, but is not limited to KW-2449.
[0264] According to embodiments, the kinase inhibitor is a tyrosine kinase inhibitor.
[0265] According to embodiments, the tyrosine kinase inhibitor is a FLT-3 inhibitor or a BTK
inhibitor.
[0266] According to embodiments, the FLT3 inhibitor includes, but is not limited to, sorafenib, sunitinib, midostaurin (PKC412), lestaurtinib (CEP-701), tandutinib (MLN518), quizartinib (AC220), gilteritinib (ASP2215), and KW-2449.
[0267] According to embodiments, the BTK inhibitor includes, but is not limited to, ibrutinib.
[0268] According to embodiments, the CD20 inhibitor includes, but is not limited to, an anti-CD20 antibody (e.g., obinutuzumab (GA101)).
[0269] According to embodiments, the 1DH inhibitor includes, but is not limited to, ivosidenib and enasidenib.
[0270] According to embodiments, the isocitrate dehydrogenase-1 inhibitor includes, but is not limited to, ivosidenib.
[0271] According to embodiments, the isocitrate dehydrogenase-2 inhibitor includes, but is not limited to, enasidenib.
[0272] According to embodiments, the immunomodulatory antineoplastic agent includes, but is not limited to, PD-1 inhibitors (e.g., nivolumab, atezolizumab and pembrolizumab), thalidomide, lenalidomide, pomalidomide, Bacillus Calmette¨Guerin (BCG) and levami sole.
[0273] According to embodiments, the PD-1 inhibitor includes, but is not limited to, nivolumab, atezolizumab and pembrolizumab.
[0274] According to embodiments, the DHODH inhibitor includes, but is not limited to, a compound having the structure of Formula (Z):
R.1 XT( (Z), wherein Xis CH or N;
Y is CH or N;
R1 is selected from the group consisting of: Ci_6alky1; Ci_6alkyl substituted with OH, or OCH3; C2_6alkenyl; Ci_6haloa1kyl; Ci_6ha1oalkyl substituted with OH, or OCH3;
6haloalkenyl; N(CH3)2; C3_6cyc1oalkyl; C3_6cycloalkyl substituted with Ci_6alkyl; and phenyl, Rb NK
N ¨Ra R2 is 0 wherein Rd is selected from the group consisting of: Ci_6alkyl, C1_6haloalkyl, and C3_6cycloalkyl;
Rb is Ci_6a1kyl or Ci_6alkyl substituted with a member selected from the group consisting of:
OH, halo, CN, OCi_6alkyl, OCi_6haloalkyl and 0C3_6cycloalkyl;
R3 is selected from the group consisting of: H, halo, CH3 and OCH3;
R4 is selected from the group consisting of:
= C1_6alkyl; Ci_6alkyl substituted with one or two OCH3; C3-6cycloalkyl; C3-6cycloalkyl substituted with CH3, or OCH3; CH2-C3_6cycloalkyl; and (ReL_ = - Rd (RG
IRc< N Re\ Rc [1 N
I I
= Rd, N Rd NRd,N N
and and Rc Rc Rc¨<\I R9 ¨N
= NRd N Rd and µN---". Rd wherein each RC is independently selected from the group consisting of: H; halo;
C1_6alkyl; C1_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci_6haloalkyl; Ci_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; NO2; OH; 0-CH2CH2OH; and OCi_6a1kyl;
Rd is selected from the group consisting of: H; halo; Ci_6alkyl; Ci_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3;
C1_6haloalkyl; C1_6haloa1kyl substituted with a member selected from the group consisting of: OH, and OCH3; CN; and OCi_6alkyl;
Rg is selected from the group consisting of: H; Ci_6alkyl; Ci_6alkyl substituted with a member selected from the group consisting of. OH, OCH3, SCH3, and OCF3, Ci-6haloalkyl; and Ci_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and n is 1, or 2;
or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof;
or a compound selected from HO
N-' - \
r F-HC
N
N. \
.N
F HO
I N
N
ci [rya rIO
_,õ
N
or a pharmaceutically acceptable salt, N-oxide, solvate, or stereoisomer thereof [0275] According to embodiments, the DHODH inhibitor includes, but is not limited to, a compound having the structure of Formula (Z):
X i R2 N
Fcr (Z), wherein Xis CH or N;
Y is CH or N;
R1 is selected from the group consisting of: Ci_6alkyl; Ci_6alkyl substituted with OH, or OCH3; C2_6alkenyl; Ci_6haloalkyl; Ci_6haloalkyl substituted with OH, or OCH3;
6haloalkenyl; N(CH3)2; C3_6cyc1oalkyl; C3_6cycloalkyl substituted with C1_6alkyl; and phenyl;
Rb N
N ¨1Ra ,k \I
R2 is 0 ; wherein Ra is selected from the group consisting of: C1_6alkyl, C1_6haloalkyl, and C3_6cycloalky1;
Rb is C1_6alkyl or C1_6a1kyl substituted with a member selected from the group consisting of:
OH, halo, CN, OC1_6alkyl, 0C1_6haloalkyl and 0C3_6cycloa1kyl;
R3 is selected from the group consisting of: H, halo, CH3 and OCH3;
R4 is selected from the group consisting of:
= C1_6alkyl; C1_6alky1 substituted with one or two OCH3; C3-6cycloalkyl; C3-6cycloalkyl substituted with CH3, or OCH3; CH2-C3_6cycloalkyl; and =
(Rc = Rd =
(Rc IRc< N Rcv__ Rc N I
N
= Rd, Rd, N Rd N Rd, N N N
N
and and Rc Rc S
Rc¨<, IRg¨N
= A s ; - N Rd , and N Rd wherein each It' is independently selected from the group consisting of. H, halo, C1_6alkyl, C1_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; C1_6haloalkyl; C1_6ha1oa1ky1 substituted with a member selected from the group consisting of: OH, and OCH3; NO2; OH; 0-CH2CH2OH; and 0C1_6a1kyl;
Rd is selected from the group consisting of: H; halo; Ci_6alkyl; C1_6alkyl substituted with a member selected from the group consisting of. OH, OCH3, SCH3, and OCF3;
C1_6haloalkyl; C1_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; CN; and OCi_6alkyl;
Rg is selected from the group consisting of: H; Ci_oalkyl; Ci_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci-6haloalkyl; and Ci_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and n is 1, or 2;
or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0276] In the context of Formula (Z), the following definitions apply:
[0277] The term ''alkenyl" includes unsaturated aliphatic groups analogous in length and possible substitution to the alkyls described above, but that contain at least one double bond.
For example, the term "alkenyl" includes straight-chain alkenyl groups (e.g., ethenyl, propenyl, butenyl, pentenyl, hexenyl, heptenyl, octenyl, nonenyl, decenyl, etc.). The term alkenyl further includes alkenyl groups which include oxygen, nitrogen, sulfur or phosphorous atoms replacing one or more carbons of the hydrocarbon backbone. In certain embodiments, a straight chain or branched chain alkenyl group has 6 or fewer carbon atoms in its backbone (e.g., C2-6 for straight chain, C3-6 for branched chain).
[0278] The term "haloalkyl" refers to a straight- or branched-chain alkyl group having from 1 to 6 carbon atoms in the chain optionally substituting hydrogens with halogens. The term "CI-6 haloalkyl" as used here refers to a straight- or branched-chain alkyl group having from 1 to 6 carbon atoms in the chain, optionally substituting hydrogens with halogens.
The term "Ci-4 haloalkyl" as used here refers to a straight- or branched-chain alkyl group having from 1 to 4 carbon atoms in the chain, optionally substituting hydrogens with halogens.
Examples of "haloalkyl" groups include trifluoromethyl (CF3), difluoromethyl (CF2H), monofluoromethyl (CH2F), pentafluoroethyl (CF2CF3), tetrafluoroethyl (CHFCF3), monofluoroethyl (CH2CH2F), trifluoroethyl (CH2CF3), tetrafluorotrifluoromethylethyl (CF(CF3)2), and groups that in light of the ordinary skill in the art and the teachings provided herein would be considered equivalent to any one of the foregoing examples.
[0279] The term ''haloalkenyl" includes unsaturated aliphatic groups analogous in length and possible substitution to the alkyls described above, but that contain at least one double bond and having from 1 to 6 carbon atoms in the chain optionally substituting hydrogens with halogens.
[0280] The term "aryl" refers to a monocyclic, aromatic carbocycle (ring structure having ring atoms that are all carbon) having 6 atoms per ring. (Carbon atoms in the aryl groups are sp2 hybridized.) [0281] The term "heteroaryl" refers to a monocyclic or fused bicyclic heterocycle (ring structure having ring atoms selected from carbon atoms and up to four heteroatoms selected from nitrogen, oxygen, and sulfur) having from 3 to 9 ring atoms per heterocycle. Illustrative examples of heteroaryl groups include the following entities, in the form of properly bonded moieties:
,S
N
\ ¨ / N
I ' I I
t N , , and [0282] Those skilled in the art will recognize that the species listed or illustrated above are not exhaustive, and that additional species within the scope of these defined terms may also be selected.
[0283] The term "variable point of attachment" means that a group is allowed to be attached at more than one alternative position in a structure. The attachment will always replace a hydrogen atom on one of the ring atoms. In other words, all permutations of bonding are represented by the single diagram, as shown in the illustrations below.
N
r R N N )zz_, represent y- , Or [0284] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein X is CH.
[0285] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein X is N.
[0286] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein Y is CH.
[0287] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein Y is N.
[0288] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein Rl is C1_4alkyl; C1_4alkyl substituted with OH, or OCH3;
C2_4a1keny1; Ci_4ha1oa1ky1;
C1_4haloalkyl substituted with OH, or OCH3; C2_4haloalkenyl; N(CH3)2;
cyclopropyl;
cyclopropyl substituted with Ci_zialkyl; or phenyl.
[0289] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein RI is CH3, CH2CH3, / 0 _______ F, \N _____________ F
, Or F
[0290] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula F
,or -L4 (Z) wherein R1 is [0291] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein Rb I N¨Re N
wherein Rb is Ci_4a1kyl substituted with OH, halo, CN, OC1_4a1kyl, OCi4haloalkyl or 0C3_6cycloalkyl; and Ra is Ci-talkyl, Ci-thaloalkyl, or C3_6cyc1oalky1.
[0292] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula HO
N
) N
N
(Z) wherein R2 is 0 [0293] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R3 is H.
[0294] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R3 is F.
[0295] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R3 is CH3.
[0296] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R3 is OCH3.
[0297] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R4 is CD\sµ 0 , or [0298] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein (Rc R4 is Rd ;wherein each RC is independently selected from the group consisting of: H; halo;
C1_4alkyl, CI
-alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci_4haloalkyl; C1_4haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and NO2;
Rd is selected from the group consisting of: H; halo; Ci_zialkyl; Ci_zialkyl substituted with OH, OCH3, SCH3, or OCF3; Ci_4haloalkyl; Ci-ihaloalkyl substituted with OH, or OCH3;
or OCI-4alkyl; CN; and OCI-6alkyl; and n is 1, or 2.
[0299] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein (Rc R4 is Rd ;
each Rc is independently selected from the group consisting of: H, halo, Ci_4a1kyl, Ci_4haloalkyl, NO2, 0-CH2CH2OH, and OCi4alkyl;
Rd is selected from the group consisting of: H, halo, C1_4alkyl, CN, and OCi_6alkyl; and f/ is 1, or 2.
[0300] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R4 is F ' CI ' DQFO
0 ' CI
F CI , CI F
oI
oI F
0:
, CI , F ' CI ' CI , CI , CI , or .- --- , HO
103011 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula CI
(Z) wherein le is or F=
103021 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein c Rc,<Nµ, Rc .. (R
\ _ Rc N `z, N ''--I
U.. --- ---. --i--..
R4 is -'"---7-'Rd I.L.-C"'-'-' Rd N ',,,d N R-d , , , N N-N
II '-N .-- ft,,,,,, .
, or wherein each Re is independently selected from the group consisting of: H; halo;
Ci_4alkyl; Ci_alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci_4haloalkyl; Ci_4haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and Rd is selected from the group consisting of:
halo;
C1_4alky1; C1-4alkyl substituted with OH, OCH3, SCH3, or OCF3; Ci_4haloalkyl;
Ci-4haloalkyl substituted with OH, or OCH3; or 0C1_4alkyl; CN; and 0C1_6alky1.
103031 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein IR
(F2' Rc><N...,,,µ, IR\
n N
_, I ,---`-'.---"- ------N -1 ,õ-r21 I _, I. ..--, II ------_------------ d N'------''Rd N''¨' Rd 1\( -- ''- N ---9- N -- ---R4 is ..'",---;----.."-Rd - R
, , , NN
or ----%---- ; wherein each RC is independently selected from the group consisting of: H, halo, C1_4a1kyl, Ci_4haloalkyl, OC1_4a1ky1, and OH;
Rd is selected from the group consisting of: halo, Ci-talkyl, and CI-alkyl;
and ri is 1, or 2.
103041 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein R4 is I
, -(21 CI
N[
NK NNO' NC I
I , oI
N , N ,N N ,N N
CI CI
HO N CN NN
I I
N, N , , or HO
.
103051 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula c NI)/ 5' (Z) wherein R4 is \-103061 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein Re Rc RC I R9¨N
R4 is NRd, N Rd , orRd , wherein Re is H; halo; Ci_4alkyl; Ci_4alkyl substituted with OH, OCH3, SCH3, or OCF3;
Cl_4haloalkyl; C1_4haloa1kyl substituted with OH, or OCH3; or CI-alkyl;
Rd is halo; CI-alkyl; Ci-talkyl substituted with OH, OCH3, SCH3, or OCF3; Ci-thaloalkyl;
or C1_4haloalky1 substituted with OH, or OCH3; and Rg is H; Ci_4alkyl; Ci_4alkyl substituted with OH, OCH3, SCH3, or OCF3;
Ci_4haloalkyl; or C1_4haloalkyl substituted with OH, or OCH3.
103071 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) wherein S
F2c¨I Rg¨N
R4 is N Rd , N Rd , or snr"---'-- a =
R , wherein Re is H or halo;
Rd is C1_4alkyl; and Rg is H.
103081 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula CI
S
N I
HN, \S"-, , µ1\1-- , or N =
(Z) wherein R4 is N
103091 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) selected from the group consisting of:
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-(prop-1-en-2-y1)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-phenylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1, 2,4-tri azol -1-y1)-4-(prop-1-en-2-yl)i soquinol in-1(21-1)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1, 2,4-triazol-1-y1)-4-(3,3,3 -trifluoroprop-1-en-2-yl)isoquinolin-1(2H)-one, 2-(2,6-Dichloropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-4-(1-methylcy el opropyl)isoquinolin-1(2H)-one, 2-(2,6-Dichloropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-4-(prop-1-en-2-yl)isoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-4-cyclopropy1-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4,5-di hydro-1H-1,2,4-tri azol-1-yl)i soquinolin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-44 sopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxym ethyl)-5 -oxo-4,5-di hy dro-1H- 1,2,4-triazol-1-y1)-4-(prop- 1-en-2-y1)-2-(2-(trifluoromethyl)phenyl)isoquinolin- 1(2H)-one;
2-(6-(4-Ethy1-3 -(hydroxymethyl)-5-oxo-4, 5 -dihydro- 1H- 1,2,4-tri azol - 1 -y1)- 1 -oxo-4-(prop- 1-en-2-yl)i soquinolin-2(1H)-yl)benzonitrile;
2-(2-Chloropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-4-(prop- 1-en-2-yl)i soquinolin-1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-4-(prop- 1 -en-2-y1)-2-(o-tolyl)i soquinolin-1(2H)-one;
2-(2-Chloropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol- 1 -y1)-4-i sopropylphthal azin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-44 sopropylphthal azin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-4-i sopropylphthalazin- 1 (2H)-one;
4-Ethyl-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihy dro- 1H- 1,2,4-tri azol-1 -y1)-2-(3 -fluorophenyl)phthalazin-1(2H)-one;
4-Ethyl-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihy dro- 1H- 1,2,4-tri azol-1 -y1)-2-(o-tolyl)phthalazin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihy dro- 1H- 1,2,4-triazol- 1-y1)-7-fl uoro-4-sopropy1-2-(o-tolyl)i soquinolin- 1 (2H)-one, 2-(2-Chl oro-4-m ethyl pyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-4-(1-methyl cyclopropyl)i soquinol in- i(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-(2-hydroxypropan-2-ypisoquinolin- 1(2H)-one;
4-(Dimethylamino)-6-(4-ethyl -3 -(hydroxymethyl)-5-oxo-4,5-dihydro- 1H- 1,2,4-triazol-1 -y1)-2-(o-tolypi soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-7-fluoro-4-(prop- 1-en-2-yl)phthal azin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-7-methoxy-4-(prop- 1-en-2-yl)phthal azi n- 1 (2H)-one;
2-(5 -Chl oro-3 -m ethyl - 1H-pyrazol-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -di hydro- 11/-1,2,4-triazol- 1 -y1)-7-fluoro-4-isopropyli soqui nolin- 1(2H)-one;
2-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihy dro- 1H- 1,2,4-triazol- 1-y1)-3-fl uoro-8-(prop- 1-en-2-y1)-6-(o-toly1)- 1, 6-naphthyri din- 5(611)-one;
2-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fluoro-8-methy1-6-(o-toly1)pyri do[2, 3 -d]pyridazin-5(611)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fluoro-8-isopropy1-6-(o-toly1)pyrido12,3-d]pyridazin-5(611)-one;
6-(2-Chl oro-6-fluoropheny1)-2-(4-ethy1-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-tri azol- 1-y1)-3 -fluoro-8 -(prop- 1-en-2-y1)- 1,6-naphthyri din- 5(6H)-one;
6-(2-Chl oro-6-fluoropheny1)-2-(4-ethy1-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-tri azol- 1-y1)-3 -fluoro-8 sopropy1-1,6-naphthyridin-5(6H)-one;
(S)-2-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihydro- 111- 1,2,4-triazol- 1-y1)-3 -fluoro-6-(o-toly1)-8-(1, 1, 1 -trifluoropropan-2-y1)-1,6-naphthyridin-5 (611)-one;
(R)-2-(4-Ethyl-3 -(hydroxym ethyl)- 5 -oxo-4, 5-dihydro- 1H- 1,2,4-tri azol- 1-y1)-3 -fluoro-6-(o-toly1)-8-(1, 1, 1 -trifluoropropan-2-y1)-1,6-naphthyridin-5 (611)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(4-methylthiazol -5 -yl)i soquinolin-1(2H)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fluoro-8-i sopropy1-6-(o-toly1)- 1,6-naphthyridin-5(6H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-5-methylpheny1)-4-i sopropylisoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-5-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1(2H)-one;
2-(2-Chl oro-5-m ethyl pheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro- 1H-1,2,4-triazol- 1-y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro- 5-methoxypheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
2-(2-Chl oropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-(prop- 1-en-2-y1)-2-(o-tolypi soquinolin- 1 (2H)-one;
2-(2-Chloro-5-methoxypheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihy dro-1,2,4-triazol- 1-y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin- 1 (2H)-one;
racemi c-4-(sec-Buty1)-2-(2-chl oro-6-fluoropheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol- 1-y1)-7-fluoroi soquinolin- 1(2H)-one;
2-(3 -Chloro-6-methoxypyridin-2-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro- 1H-1,2,4-triazol- 1 -y1)-7-fluoro-4-i sopropyli soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(2-methoxy-4-m ethylpyri din-3 -yl)i soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoro-3 -methoxypheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, di hydro- 1H-1,2,4-triazol- 1 -y1)-7-fluoro-4-(prop-1-en-2-yl)isoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1,2,4-triazol- 1-y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(o-toly1)phthalazin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-7-fluoro-4-i sopropylphthalazin-1(2H)-one;
Racemic 6-(4-Ethyl-3-(hydroxymethyl)-5-oxo-4,5 -dihydro-1H- 1,2,4-triazol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)phthalazin-1 (2H)-one;
(S*)-6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)phthalazin-1 (2H)-one;
(R *)-6-(4-Ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro- 1H- 1,2,4-tri azol- 1 -y1)-'7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)phthalazin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hy droxymethyl)-5-oxo-4, 5 -dihydro-1,2,4-tri azol- 1-y1)-7-fluoro-4-( 1-methyl cycl opropyl)i soquinolin- i(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-methoxy-4-methylpyridin-3-y1)-4-(prop- 1-en-2-yl)isoquinolin- 1(2H)-one;
2-(5 -Chl oro-3 -m ethyl - 1H-pyrazol-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -di hydro- 1H-1,2,4-triazol- 1 -y1)-7-fluoro-4-(prop-1-en-2-yl)isoquinolin-1(2H)-one;
2-(3-Chloro-2-methoxy-5-methylpyridin-4-y1)-6-(4-ethy1-3 -(hydroxymethyl)- 5 -oxo-4, 5 -dihydro- 1H- 1,2,4-triazol- 1 -y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
2-(3-Chloro-2-methoxy-5-methylpyridin-4-y1)-6-(4-ethy1-3 -(hydroxymethyl)- 5 -oxo-4, 5-dihydro-1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin-1(21-1)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro- 5-methoxypheny1)-4-i sopropylisoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(4-fluoro-2-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one;
2-(2-Chloro-3-(2-hydroxyethoxy)pheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, di hydro- 1H-1,2,4-triazol- 1 -y1)-7-fluoro-4-(prop-1-en-2-yl)isoquinolin-1(2H)-one, 6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fl uoro-2-(2-fluoropheny1)-4-(prop- 1 -en-2-yl)i soquinolin-1 (2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(5-fluoro-2-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one;
2-(2, 5-Difluoropheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-i sopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-6-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one, 2-(2-Chloro-3-methoxypheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5-dihy dro-1, 2,4-triazol- 1-y1)- 7-fluoro-4-(prop- 1-en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(2-methoxy-3, 5 -dimethylpyridin-4-y1)-4-(prop- 1 -en-2-yl)isoquinolin- 1(2H)-one;
2-(2, 5-Difluoropheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-6-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(3 -fluoro-2-methylpheny1)-4-i sopropylisoquinolin- 1(2H)-one;
2-(2, 5-Dimethylpheny1)-6-(4-ethyl-3 -(hy droxymethyl)-5 -oxo-4,5 -dihy dro-1H- 1,2,4-triazol- 1 -y1)-7-fluoro-4-i sopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(4-fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoropheny1)-44 sopropyli soquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(2-methoxy-3,5-dimethylpyridin-4-y1)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-methy1-4-(prop- 1-en-2-y1)-2-(o-tolyl)i soquinolin- 1 (2H)-one;
2-(2-Chloro-6-fluoro-3 -methoxypheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, di hydro- 1H-1,2,4-tri azol- 1 -y1)-7-fluoro-44 sopropyli soquinolin- 1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(o-toly1)-4-(3 ,3,3-trifluoroprop-1-en-2-yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-2-(5 -fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-methoxypheny1)-4-(prop- 1 -en-2-yl)i soquinolin- 1(2H)-one;
2-(2-Chl oro-5-m ethylpyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol- 1-y1)-7-fluoro-4-(prop-1-en-2-yl)i soqui nolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(5-fluoro-2-methoxypyridin-4-y1)-4-(prop-1 -en-2-yl)i soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(3 -fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
2-(2, 5-Dimethylpheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soquinolin- 1(2H)-one;
Racemic-6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro- 1H- 1,2,4-tri azol- 1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-2-(2-ethylpheny1)-7-fluoro-44 sopropyli soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(2-methoxypyridin-3-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(5-fluoro-2-methoxypyridin-4-y1)-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chl oro-5-m ethylpyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihy dro-1H- 1,2,4-tri azol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one, 6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(2-(methyl-d3)phenypi soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(4-methylpyrimi din-5 -yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(2-methoxyphenypi soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(3 -fluoro-6-methoxypyridin-2-y1)-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(3-methylpyrazin-2-yl)i soquinolin- 1(2H)-one;
2-(2-C hl oro-5-m ethyl pyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one, 2-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-3-flu oro-6-(2-fluoro- 5-methylpheny1)-8-i sopropyl- 1, 6-naphthyridin- 5(611)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro 4-isopropy1-2-(4-methylpyridazin-3-yl)isoquinolin-1(2H)-one;
(S)-6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4, 5 -dihydro- 1H- 1,2,4-triazol- 1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2 -yl)isoquinolin-1(2H)-one;
(R)-6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro-1H-1,2,4-triazol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2 -yl)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropyl-2-(2-(trifluoromethyl)phenyl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(5-methylpyrimi din-4 -yl)isoquinolin-1(2H)-one;
2-(2-(Difluoromethyl)pheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1, 2,4-triazol- 1-y1)-7-fluoro-4 sopropylisoquinolin-1(2H)-one;
2-(3 -Chloro-2-methoxypyridin-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-di hydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoro-44 sopropyli soquinolin-1 (2H)-one;
2-Cy clohexy1-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro-1H-1,2,4-tri azol- 1-y1)-7-fl uoro-4-isopropylisoquinolin-1(2H)-one;
2-(3 -Chloro-6-methylpyridin-2-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-tri azol- 1-y1)-7-fluoro-4-i sopropyli soquinolin-1 (2H)-one, 2-Cy clopenty1-6-(4-ethy1-3 -(hy droxy methyl)-5 -oxo-4, 5 -dihy dro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-i sopropylisoquinolin-1(2H)-one, 2-(3 -Chloro-4-methoxypyridin-2-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-di hydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-((1R,2 S)-2-methylcyclohexyl)isoquinolin-1(2H)-one;
2-(1,3-Dimethoxypropan-2-y1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro-111-1, 2,4-triazol- 1-y1)-7-fluoro-4 sopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(2-methoxy-5 -methylpyridin-4-yl)i soquinolin-1 (2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-111-1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(( 1S,21?)-2-methylcyclohexypisoquinolin-1(2H)-one;
2-(Cyclopropylmethyl)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro-1H-1,2,4-triazol-1 -y1)-7-fluoro-4-i sopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-4-sopropy1-2-(1-methoxybutan-2-yl)i soquinolin- 1(2H)-one;
2-(2-Chloropheny1)-6-(4-ethyl-3 -(hy droxymethyl)-5-oxo-4, 5 -dihy dro-111-1,2,4-triazol-1 -y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropyl-2-(3-methylpyridin-2-y1)i soquinolin- 1(2H)-one;
Racemic 6-(4-Ethyl-3-(hy droxymethyl)-5-oxo-4,5 -dihydro-1H- 1,2,4-triazol-1 -y1)-7-fluoro-4-isopropy1-2-((ci s)-3 -methoxycycl opentyl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-241R*,2R*)-2-methylcyclohexyl)i soquinolin- 1 (2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-((1 S*,2 S*)-2-methy1cyc1ohexy1)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(pentan-3 -yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(( 1R*, 2R*)-2-methy1cyc1openty1)isoquino1in- 1 (2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-241 S*,2S*)-2-methylcyclopentyl)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2((1R*,2S*)-2-methylcyclopentyl)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-((1 S*,2R*)-2-methylcyclopentyl)isoquinolin- 1(2H)-one;
Racemic 6-(4-Ethyl-3-(hy droxymethyl)-5-oxo-4,5 -dihydro-1H- 1,2,4-triazol-1 -y1)-7-fluoro-4-isopropy1-2-((ci s)-3 -methoxycycl ohexyl)isoquinolin- 1(2H)-one;
2-(Bicycl o[2. 2.1 ]heptan- 1-y1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihy dro-/H-1,2,4-tri azol- 1-y1)-7-fluoro-4-isopropylisoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(2-methoxy-3 -m ethylpyri din-4-yl)isoquinolin- 1(2H)-one;
2-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-3-fluoro-8-i sopropy1-6-(2-methoxypheny1)- 1, 6-naphthyri din-5 (61J)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(3-methylisothiazol-4-ypisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(5-methylisothiazol-4-y1)isoquinolin-1(2H)-one;
2-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-3-flu oro-8-sopropy1-6-(2-(trifluoromethyl)pheny1)- 1, 6-naphthyri din-5 (61/)-one;
2-(3,6-Dimethylpyridin-2-y1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4, 5 -dihy dro-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
2-(2,5-Dimethylpyridin-4-y1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropyl-2-(4-methylpyridin-3-y1)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(3-methylpyridin-4-y1)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropyl-2-(2-methylpyridin-3-y1)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-IH-1,2,4-triazol-1-y1)-7-fluoro-2-(2-hydroxy-5-methylpyridin-4-y1)-4-isopropylisoquinolin-1(2H)-one;
6-(2-(Difluoromethyl)pheny1)-2-(4-ethyl-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-3-fluoro-8-isopropy1-1,6-naphthyridin-5(611)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(2-hydroxy-3-methylpyridin-4-y1)-4-isopropylisoquinolin-1(2H)-one; and 2-(4-Ethyl-3 -(hy droxym ethyl)-5 -oxo-4, 5 -di hy dro- 1H-1,2,4-triazol-1 -y1)-3 -fluoro-8 -isopropy1-6-(o-D3-toly1)-1,6-naphthyridin-5(6H)-one;
and, optionally, one or more of pharmaceutically acceptable salts, isotopes, N-oxides, solvates, and stereoisomers thereof.
103101 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) selected from the group consisting of:
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-(prop-1-en-2-y1)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-IH-1,2,4-triazol-1-y1)-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-phenylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-4-(prop-1-en-2-y1)isoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-IH-1, 2,4-triazol- 1-y1)-4-(3 ,3,3 -trifluoroprop-1-en-2-yl)isoquinolin-1 (2H)-one;
2-(2,6-Dichloropheny1)-6-(4-ethy1-3-(hy droxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1 -y1)-4-(1 -methylcycl opropyl)isoquinolin-1(2H)-one;
2-(2, 6-Di chl oropheny1)-6-(4-ethy1-3 -(hy droxymethyl)-5-oxo-4, 5 -dihydro-1H- 1,2,4-triazol-1 -y1)-4-(prop- 1-en-2-yl)i soquinolin-1 (2H)-one;
2-(2-Chloro-6-fluoropheny1)-4-cyclopropy1-6-(4-ethyl -3 -(hydroxymethyl)-5-oxo-4, 5 -dihydro- 1H-1,2,4-triazol- 1 -yl)i soquinolin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1,2,4-tri azol- 1-y1)-7-fluoro-4-i sopropyli soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-4-(prop- 1 -en-2-y1)-2-(2-(trifluoromethyl)phenyl)isoquinolin- 1(2H)-one;
2-(6-(4-Ethy1-3 -(hydroxymethyl)-5-oxo-4, 5 -dihydro- 1H- 1,2,4-triazol- 1-y1)-1 -oxo-4-(prop- 1-en-2-yl)i soquinolin-2(1H)-yl)benzonitrile;
2-(2-Chloropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-4-(prop- soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-4-(prop- 1 -en-2-y1)-2-(o-tolyl)i soquinolin-1(2H)-one;
2-(2-Chloropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-4-i sopropylphthal azin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-2-(3-fluoropheny1)-4-isopropylphthalazin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-4-i sopropylphthalazin-1 (2H)-one;
4-Ethyl-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihy dro- 1H-1,2,4-tri azol-1 -y1)-2-(3 -fluorophenyl)phthalazin-1(2H)-one;
4-Ethyl-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihy dro- 1H-1,2,4-tri azol-1 -y1)-2-(o-tolyl)phthalazin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(o-tolyl)i soquinolin- 1 (2H)-one;
2-(2-Chl oro-4-m ethyl pyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethyl-3-(hydroxymethyl)-5-oxo-4, 5 -dihydro-1, 2,4-tri azol- 1-y1)-4-(1-methyl cyclopropyl)i soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-2-(3 -fluoropheny1)-4-(2-hydroxypropan-2-yl)i soquinolin- 1(2H)-one;
4-(Dimethylamino)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro- 1H-1,2,4-triazol-1 -y1)-2-(o-tolyl)i soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4 -ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihy dro-1H-1, 2,4-tri azol- 1 -y1)-7-fluoro-4 -(prop-1-en-2 -yl)phthalazin-1(2H)-one;
2-(2 -Chloro-6-fluoropheny1)-6-(4 -ethy1-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro-1H-1, 2,4-tri azol- 1 -y1)-7-methoxy-4-(prop- 1-en-2-yl)phthal azin-1 (2H)-one;
2-(5-Chloro-3 -m ethyl - 1H-pyrazol-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -di hydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoro-44 sopropyli soquinolin-1 (2H)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fluoro-8-(prop- 1 -en-2-y1)-6-(o-toly1)- 1, 6-naphthyri din- 5(611)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-3-fluoro-8-methy1-6-(o-tolyl)pyri do[2, 3 -d]pyridazin-5 (614)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fluoro-8-i sopropy1-6-(o-tolyl)pyrido [2,3 -di pyridazin-5 (611)-one;
6-(2-Chloro-6-fluoropheny1)-2-(4 -ethyl-3 -(hy droxyrnethyl)-5 -oxo-4, 5 -dihydro-1H-1, 2,4-tri azol- 1 -y1)-3 -fluoro-8 -(prop-1-en-2 -y1)- 1,6-naphthyri din-5(614)-one;
6-(2-Chloro-6-fluoropheny1)-2-(4 -ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro-1H-1, 2,4-triazol-1-y1)-3-fluoro-8-i sopropy1-1,6-naphthyridin-5(6H)-one;
(S)-2-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4, 5 -dihydro-111-1,2,4-tri azol- 1-y1)-3 -fluoro-6-(o-toly1)-8-(1 , 1, 1 -tri fluoropropan-2 -y1)- 1,6-naphthyridin-5 (614)-one;
(R)-2-(4-Ethyl-3 -(hydroxym ethyl)- 5 -oxo-4, 5-dihydro-111-1,2,4-tri azol-1 -y1)-3 -fluoro-6-(o-toly1)-8-(1, 1, 1 -trifluoropropan-2 -y1)-1,6-naphthyridin-5(614)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(4-methylthiazol -5 -yl)isoquinolin-1(2H)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-114- 1,2,4-triazol-1-y1)-3-fluoro-8-sopropy1-6-(o-toly1)- 1, 6-naphthyri din- 5(611)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(2-fluoro- 5-methylpheny1)-4-i sopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-5-methylpheny1)-4-(prop-1-en-2-y1)isoquinolin-1(2H)-one;
2-(2-C hl oro-5-m ethyl pheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro-1H-1, 2,4-triazol-1-y1)-7-fluoro-4 -(prop-1-en-2 -yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-2-(2-fluoro- 5-methoxypheny1)-4-(prop-1 -en-2-yl)isoquinolin-1(2H)-one;
2-(2-Chloropheny1)-6-(4-ethyl-3 -(hy droxymethyl)-5-oxo-4, 5 -dihy dro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-(prop-1-en-2-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihy dro-1H- 1,2,4-triazol-1-y1)-7-fl uoro-4-(prop- 1-en-2-y1)-2-(o-tolyl)i soquinolin-1 (2H)-one, 2-(2-Chloro-5-methoxypheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4,5-dihy dro-1, 2,4-triazol- 1-y1)-7-fluoro-4 -(prop-1-en-2 -yl)isoquinolin-1(2H)-one;
racemi c-4-(sec-Buty1)-2-(2-chl oro-6-fluoropheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoroi soquinoli n-1 (2H)-one;
2-(3 -Chloro-6-methoxypyridin-2-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-di hydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(2-methoxy-4-m ethylpyri din-3 -yl)i soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoro-3-methoxypheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5 -di hydro- 1H-1,2,4-tri azol-1-y1)-7-fluoro-4-(prop-1-en-2-y1)1 soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4 -ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro-1H-1, 2,4-triazol- 1-y1)-7-fluoro-4 -(prop-1-en-2 -yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(o-tolyl)phthalazin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4 -ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihy dro-1H-1, 2,4-tri azol- 1-y1)-7-fluoro-4 sopropylphthalazin-1(2H)-one;
Racemic 6-(4-Ethyl-3-(hy droxymethyl)-5-oxo-4,5 -dihydro-1H-1,2,4 -triazol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)phthalazin-1 (2H)-one;
(S*)-6-(4-Ethy1-3-(hydroxymethyl)-5 -oxo-4, 5-dihydro-1H- 1, 2,4 -triazol-1 -y1)- 7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2 -yl)phthalazin-1(2H)-one;
(R *)-6-(4-Ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hydro- 1H-1,2,4-tri azol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)phthalazin-1 (2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4 -ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1, 2,4-tri azol- 1 -y1)-7-fluoro-4 -(1-methyl cycl opropyl)i soquinolin- 1(21-1)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(2-methoxy-4-methylpyridin-3 -y1)-4-(prop- 1-en-2-yl)i soquinolin-1(2H)-one;
2-(5-Chloro-3 -m ethyl - 1H-pyrazol-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -di hydro- 1H-1,2,4-tri azol- 1-y1)-7-fluoro-4-(prop-1 -en-2-yl)i soquinolin-1(2H)-one;
2-(3 -Chloro-2-methoxy-5-methylpyridin-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)- 5 -oxo-4, 5 -dihydro-1H- 1,2,4-triazol-1 -y1)-7-fluoro-4-isopropyli soquinolin- 1(2H)-one;
2-(3 -Chloro-2-methoxy-5-methylpyridin-4-y1)-6-(4-ethyl-3 -(hy droxymethyl)- 5 -oxo-4, 5-dihydro-1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro- 5-methoxypheny1)-4-isopropylisoquinolin- 1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(4-fluoro-2-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one;
2-(2-Chloro-3-(2-hydroxyethoxy)pheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, di hydro- 1H-1,2,4-tri azol- 1 -y1)-7-fluoro-4-(prop-1-en-2-yl)i soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoropheny1)-4-(prop- 1 -en-2-yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(5-fluoro-2-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one;
2-(2, 5-Difluoropheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-i sopropyli soquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-6-methylpheny1)-44 sopropylisoquinolin- 1(2H)-one;
2-(2-Chloro-3-methoxypheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro-1,2,4-triazol- 1-y1)-7-fluoro-4-(prop- 1-en-2-yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-methoxy-3,5-dimethylpyridin-4-y1)-4-(prop- 1 -en-2-yl)isoquinolin- 1(2H)-one;
2-(2, 5-Difluoropheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoro-6-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(3 -fluoro-2-methylpheny1)-4-isopropylisoquinolin- 1(2H)-one;
2-(2, 5-Dimethylpheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(4-fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-2-(2-fluoropheny1)-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-4-i sopropy1-2-(2-methoxy-3 , 5-dimethylpyridin-4-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-methyl-4-(prop- 1-en-2-y1)-2-(o-tolyl)i soquinolin- 1 (2H)-one, 2-(2-Chloro-6-fluoro-3 -methoxypheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, di hydro- 1H- 1,2,4-tri azol- 1 -y1)-7-fluoro-4-i sopropyli soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(o-toly1)-4-(3 ,3,3-trifluoroprop- 1-en-2-yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(5 -fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(2-methoxypheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1(2H)-one;
2-(2-Chl oro-5-m ethyl pyri din-3 -y1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4, 5-dihy dro-1H- 1,2,4-tri azol- 1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soqui nolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(5 -fluoro-2-methoxypyri din-4-y1)-4-(prop- 1 -en-2-yl)i soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-7-fluoro-2-(3 -fluoro-2-methylpheny1)-4-(prop- 1 -en-2-yl)isoquinolin- 1 (2H)-one;
2-(2, 5-Dimethylpheny1)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-(prop- 1-en-2-yl)i soquinolin- 1(2H)-one;
Racemic-6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihy dro- 1 H- 1,2,4-tri azol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2-yl)isoquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-2-(2-ethylpheny1)-7-fluoro-44 sopropyli soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(2-methoxypyridin-3-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-2-(5 -fluoro-2-methoxypyridin-4-y1)-4-i sopropyli soquinolin- 1 (2H)-one;
2-(2-Chl oro-5-m ethyl pyri din-3 -y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol- 1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(2-(methyl-d3)phenypi soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-sopropy1-2-(4-methylpyrimi din-5 -yl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-4-sopropy1-2-(2-methoxyphenyl)i soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihy dro- 1H- 1,2,4-triazol- 1-y1)-7-fl uoro-2-(3 -fluoro-6-methoxypyridin-2-y1)-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(3-methylpyrazin-2-y1)isoquinolin-1(2H)-one;
2-(2 -C hl oro-5-m ethyl pyri din-3 -y1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-tri azol-1-y1)-7-fluoro-4-1 sopropyli soquinolin-1(2H)-one;
2-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-3-fluoro-6-(2-fluoro-5-methylpheny1)-8-i sopropyl- 1,6-naphthyridin-5(6H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro i sopropy1-2-(4-methylpyridazin-3-yl)isoquinolin-1(2H)-one;
(S)-6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4, 5 -dihydro- 1H-1,2,4-triazol- 1-y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2 -yl)isoquinolin-1(2H)-one;
(R)-6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-dihydro-1H-1,2,4-tri azol-1 -y1)-7-fluoro-2-(o-toly1)-4-(1, 1, 1 -trifluoropropan-2 -yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(2-(trifluoromethyl)phenyl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-i sopropy1-2-(5-methylpyrimi din-4 -yl)isoquinolin-1(2H)-one;
2-(2-(Difluoromethyl)pheny1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihy dro-11/-1, 2,4-triazol-1-y1)-7-fluoro-44 sopropylisoquinolin-1(2H)-one;
2-(3 -Chloro-2-methoxypyridin-4-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-di hydro- 111-1,2,4-tri azol- 1-y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
2-Cy cl ohexy1-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro-111-1,2,4-tri azol- 1-y1)-7-fluoro-44 sopropyli soquinolin-1(2H)-one;
2-(3 -Chl oro-6-m ethyl pyri din-2-y1)-6-(4-ethy1-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-111-1,2,4-tri azol-1-y1)-7-fluoro-4-1 sopropyli soquinolin-1(2H)-one;
2-Cy cl openty1-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihy dro- 1H- 1,2,4-tri azol- 1-y1)-7-fluoro-4-i sopropylisoquinolin-1(2H)-one;
2-(3 -Chloro-4-methoxypyridin-2-y1)-6-(4-ethyl-3 -(hydroxymethyl)-5-oxo-4, 5-di hydro- 1H-1,2,4-tri azol-1-y1)-7-fluoro-44 sopropyli soquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-((1R,2 S)-2-methylcyclohexyl)isoquinolin-1(2H)-one;
2-(1,3-Dimethoxypropan-2-y1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4,5 -dihydro-1, 2,4-tri azol- 1-y1)-7-fluoro-4 sopropylisoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihy dro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(2-methoxy-5-methylpyridin-4-yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-241S,2R)-2-methylcyclohexyl)isoquinolin- 1(2H)-one;
2-(Cyclopropylmethyl)-6-(4-ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro-1H-1,2,4-triazol-1 -y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-sopropy1-2-(1-methoxybutan-2-yl)i soquinolin- 1(2H)-one;
2-(2-Chl oropheny1)-6-(4-ethyl -3 -(hydroxymethyl)-5 -oxo-4, 5 -dihydro- 1H-1,2,4-triazol-1 -y1)-7-fluoro-4-isopropyli soquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-(3 -methylpyridin-2-yl)i soquinolin- i(2H)-one;
Racemic 6-(4-Ethyl-3-(hy droxymethyl)-5-oxo-4, 5 -dihydro-1H- 1,2,4-triazol-1 -y1)-7-fluoro-4-i sopropy1-2-((ci s)-3 -methoxycycl opentyl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-sopropy1-241R*,2R*)-2-methylcyclohexyl)i soquinolin- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-sopropy1-2-((1 S*,2 S*)-2-methylcyclohexyl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fl uoro-4-i sopropy1-2-(pentan-3 -y1)) soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-sopropy1-241R*, 2R*)-2-methy1cyc1openty1)isoquino1in- 1 (2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-((1 S*,2S*)-2-methylcyclopentyl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-241R*,2S*)-2-methylcyclopentyl)isoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-fluoro-4-i sopropy1-2-((1 S*,2R*)-2-methylcyclopentyl)isoquinolin- 1(2H)-one;
Racemic 6-(4-Ethyl-3-(hy droxymethyl)-5-oxo-4, 5 -dihydro-1H- 1,2,4-triazol-1 -y1)-'7-fluoro-4-1 sopropy1-2-((ci s)-3 -methoxycycl ohexyl)isoquinolin- 1(2H)-one;
2-(Bicycl o [2. 2.1 ]heptan- 1-y1)-6-(4-ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -dihy dro-/H-1, 2,4-triazol- 1-y1)-7-fluoro-44 sopropylisoquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4,5-dihydro- 1H- 1,2,4-triazol- 1-y1)-7-flu oro-4-sopropy1-2-(2-methoxy-3 -methylpyridin-4-yl)isoquinolin-1(2H)-one;
2-(4-Ethyl-3 -(hydroxymethyl)-5-oxo-4,5-dihydro-1H- 1,2,4-triazol-1-y1)-3-fl uoro-8-i sopropyl- 6-(2-m ethoxypheny1)- 1, 6-naphthyri din-5 (611)-one, 6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol-1 -y1)- 7-fl u oro-4-i sopropyl- 2 -(3 -methyl i sothi azol-4 -yl)isoquinolin-1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1,2 , 4 -tri azol- 1 -y1)- 7-flu oro-4-sopropyl- 2 -(5-methyl i sothi azol-4 -yl)isoquinolin-1(2H)-one;
2 -(4-Ethy1-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol-1 -y1)-3-flu oro- 8 -sopropyl- 6-(2-(trifluorom ethy 1)pheny1)- 1, 6-n aphthyri di n-5 (611)-one;
2 -(3 , 6-Dim ethyl pyri din-2-y1)- 6 -(4-ethy1-3 -(hy droxym ethyl)- 5 -oxo-4, 5 -di hy dro- 1H-1, 2, 4 -tri azol- 1-y1)- 7-fluoro-4 sopropyli soquinoli n- 1(2H)-one;
2-(2, 5-Dim ethyl pyri din-4-y1)- 6 -(4-ethy1-3 -(hy droxym ethyl)- 5 -oxo-4, 5 -di hy dro- 1H-1, 2, 4 -tri azol- 1 -y1)- 7-fluoro-4 sopropyli soquinoli n- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol- 1 -y1)- 7-flu oro-4-i sopropyl- 2 -(4-methyl pyridin-3 -yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol- 1 -y1)- 7-flu oro-4-i sopropyl- 2 -(3 -methyl pyridin-4-yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol- 1 -y1)- 7-flu oro-4-sopropyl- 2 -(2-methyl pyridin-3 -yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hy droxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol-1 -y1)- 7-fl u oro-2-(2-hy droxy-5 -m ethyl pyri din-4-y1)-4-i sopropyli soquinolin- 1(2H)-one;
6-(2-(Difluoromethyl)pheny1)-2-(4-ethyl-3 -(hydroxymethyl)-5 -ox o-4, 5 -di hy dro- 111-1, 2, 4 -tri az ol- 1 -y1)-3 -fluoro-8 sopropyl- 1 ,6-nap hthyri din- 5 (611)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol- 1 -y1)- 7-flu oro-2-(2-hy droxy-3 -m ethyl pyri din-4-y1)-4-i sopropyli soquinolin- 1(2H)-one; and 2-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -triazol-1 -y1)-3 -fluoro-8 sopropy1-6-(o-D3-toly1)- 1, 6-naphthyridin-5 (611)-one;
and, optionally, one or more of pharmaceutically acceptable salts, isotopes, N-oxides, solvates, and stereoisomers thereof; or a compound selected from:
2 -(2-Chl oro- 6 -fluoroph eny1)-6-(4 -ethy1-3 -(hy droxym ethyl)-5 -oxo-4, 5 -dihy dro- 1H-1, 2, 4 -tri azol- 1 -yl)i soquinolin- 1(2H)-one;
6-(4-Ethyl-3 -(hydroxymethyl)-5 -oxo-4, 5 -di hy dro- 1H- 1, 2, 4 -tri azol- 1 -y1)-2-(2-fluoro-4-nitropheny1)-4-iodoi soquinolin- 1(2H)-one;
2 -(2-Chl oro- 6 -fluoroph eny1)-7-(4 -ethy1-3 -(hy droxym ethyl)-5 -oxo-4, 5 -dihy dro- 1H-1, 2, 4 -tri az ol- 1 -y1)- 6-fl uoro-4 -(prop- 1 -en-2 -yl)phthal azin- 1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-7-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-6-methoxy-4-(prop-1-en-2-y1)phthalazin-1(2H)-one, or a pharmaceutically acceptable salt, N-oxide, solvate, or stereoisomer thereof.
103111 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) selected from the group consisting of:
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(o-toly1)isoquinolin-1(2H)-one;
2-(2-C hl oro-4-m ethyl pyri din-3 -y1)-6-(4-ethyl-3 -(hydroxy m ethyl)-5-oxo-4, 5-di hy dro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1, 2,4-triazol-1-y1)-4-(1 -methyl cyclopropyl)i soquinolin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxyrnethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-(prop-1-en-2-y1)phthalazin-1(2H)-one;
2-(4-Ethyl-3 -(hy droxym ethyl)-5 -oxo-4, 5 -di hy dro-1H-1,2,4-tri azol-1 -y1)-3 -fluoro-8 -isopropy1-6-(o-toly1)-1,6-naphthyridin-5(6H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(o-toly1)phthalazin-1(2H)-one;
2-(2-Chloro-6-fluoropheny1)-6-(4-ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylphthalazin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-isopropy1-2-(2-(methyl-d3)phenypisoquinolin-1(2H)-one;
(R)-6-(4-Ethyl-3 -(hydroxym ethyl)-5-oxo-4, 5-di hy dro-1H-1,2,4-tri azol -1 -y1)-7-fluoro-2-(o-toly1)-4-(1,1, 1 -trifluoropropan-2-yl)isoquinolin-1(2H)-one;
6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-IH-1,2,4-triazol-1-y1)-7-fluoro-isopropyl-2-(2-(trifluoromethyl)phenypisoquinolin-1(2H)-one; and 2-(2-(Difluoromethyl)pheny1)-6-(4-ethyl -3 -(hy droxym ethyl)-5 -oxo-4, 5 -di hy dro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropylisoquinolin-1(2H)-one;
and, optionally, one or more of pharmaceutically acceptable salts, isotopes, N-oxides, solvates, and stereoisomers thereof.
103121 In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) having the Formula (Za):
, R4,,N
(Za), wherein Y is CH or N;
RI is selected from the group consisting of. C1_6alkyl; C1_6alkyl substituted with OH, or OCH3; C2_6alkeny1; Ch6haloalkyl; Ci_6haloa1kyl substituted with OH, or OCH3;
C2_6haloalkenyl; N(CH3)2; C3_6cycloalkyl; C3_6cyc1oalkyl substituted with Ci_6alkyl; and phenyl;
HO
N
N
\.N
R2 is 0 R3 is selected from the group consisting of: H, halo, CH3 and OCH3;
R4 is selected from the group consisting of:
C1_6alky1; Ci_6alky1 substituted with one or two OCH3; C3_6cyc1oalkyl;
C3_6cycloalky1 substituted with CH3, or OCH3; CH2-C3_6cycloalkyl; and (R
Rd ;
(Rc N Re\ Re N
N N N
Rd I I , Rd N Rd N Rd N
N
[I , and and RG Rc S
Rc¨<\ IRg¨N
-"-^ Rd ¨^ Rd .
N Rd , and wherein each It is independently selected from the group consisting of: H; halo;
Ci_6alkyl, Ci-6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci_6haloa1kyl; Ci_6haloalky1 substituted with a member selected from the group consisting of: OH, and OCH3; NO2; OH; 0-CH2CH2OH; and OCi-6alkyl;
Rd is selected from the group consisting of: H; halo; C1_6alkyl; Ci_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3;
C1_6haloalkyl; Ci_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; CN; and OCi_6alkyl;
Rg is selected from the group consisting of: H; Ci_6alkyl; Ci_6a1kyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci-6haloalkyl; and Ci_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and n is 1, or 2;
or a pharmaceutically acceptable salt, solvate, stereoisomer, isotopic variant, or N-oxide thereof.
[0313] In an embodiment of the invention, the DHODH inhibitor is a compound of Formula (Z) having the Formula (Zb):
:R2 N =*". ---N
"I[ R3 (Zb), wherein Y is CH or N:
RI is selected from the group consisting of: Ch6alkyl, C16haloalkyl and C2_6alkenyl;
HO
N
N
R2 is 0 =
R3 is selected from the group consisting of: 1-1, halo and OCH3;
R4 is selected from the group consisting of:
(Rc RN
(Rc Rc Rc Rc I , Rd N
Rd N Ru N R' ro " r -- µ-----",R d Rc Rg¨N
NRd, and Rd wherein RC is selected from the group consisting of: H, halo; C1_6alkyl, C1_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3;
C 1_6haloalkyl; C 1_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and NO2;
Rd is selected from the group consisting of: H; halo; Ci_6alkyl; Ci_6alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3;
C1_6haloalkyl; C1_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; CN; and OCi_6alkyl;
Rg is selected from the group consisting of: H; Ci_6alkyl; C16alkyl substituted with a member selected from the group consisting of: OH, OCH3, SCH3, and OCF3; Ci-6haloalkyl; and C1_6haloalkyl substituted with a member selected from the group consisting of: OH, and OCH3; and n is 1;
or a pharmaceutically acceptable salt, solvate, stereoisomer, isotopic variant, or N-oxide thereof.
[0314] Exemplary compounds of Formula (Z) useful in methods of the invention will now be described by reference to the illustrative synthetic schemes for their general preparation below and examples that follow. Artisans will recognize that, to obtain the various compounds herein, starting materials may be suitably selected so that the ultimately desired substituents will be carried through the reaction scheme with or without protection as appropriate to yield the desired product. Alternatively, it may be necessary or desirable to employ, in the place of the ultimately desired substituent, a suitable group that may be carried through the reaction scheme and replaced as appropriate with the desired substituent. Unless otherwise specified, the variables are as defined above in reference to Formula (Z). Reactions may be performed between the melting point and the reflux temperature of the solvent, and preferably between 0 C and the reflux temperature of the solvent. Reactions may be heated employing conventional heating or microwave heating. Reactions may also be conducted in sealed pressure vessels above the normal reflux temperature of the solvent.
[0315] All abbreviations used in the general schemes and examples for Formula (Z) are as defined in Table 1A. Variables are as defined in the scope or as specifically defined in the general Schemes.
Table lA ¨ Abbreviations Abbreviation Name A angstrom ACN or MeCN acetonitrile AcOH glacial acetic acid AcOK Potassium acetate AgBF4 Silver tetrafluoroborate AlMe3 Trimethylaluminium Ar Argon aq. aqueous AuC13 Gold(III) chloride BC13 Boron trichloride Bn or Bzl benzyl Boc tert-butyloxycarbonyl (Boc)20 Di-tert-butyl dicarbonate Catacxium A Pd G2 AT Chi oro [(di (1 -adam anty1)--butyl ph osphi ne)-2-(2-aminobiphenyl)]palladium(1) CdC12 Cadmium chloride Celite di atom a ceous earth conc. concentrated CO2 Carbon dioxide (C0C1)2 Oxalyl chloride Cul Copper(1) iodide Cu(OAc)2 copper(11) acetate Cy2NMe N,N-Dicyclohexylmethylamine Cs2CO3 Cesium carbonate DCC N,N'-dicyclohexyl-carbodiimide DCE dichloroethane DCM dichloromethane DIPEA or DIEA diisopropyl-ethyl amine DEAD Diethyl azodicarboxylate DEA Diethanolamine DHP 3,4-Dihydropyran DMA dimethylaniline DMAP 4-dimethylaminopyridine DME dimethoxyethane DMf N,N-dimethylformamide DMP
Dess¨Martin periodinane or 1,1,1-Tris(acetyloxy)-1,1-dihydro-1,2-benziodoxo1-3-(11/)-one DMSO dimethylsulfoxide Dppf or DPPF 1, l'-Bis(diphenylphosphino)ferrocene EDCI 1 -ethy1-3 -(3 -dimethylaminopropyl) carb odiimi de ES-API electrospray-atmospheric pressure ionization Abbreviation Name ESI el ectrospray ionization Et3N.3HF Triethylamine trihydrofluoride Et0Ac or EA ethyl acetate Et0H ethanol Et0Na sodium ethoxide EtMgBr Ethylmagnesium bromide GCMS gas chromatography-mass spectrometry h or hr(s) hour or hours H2 Hydrogen gas HC1 Hydrogen chloride HPLC high performance liquid chromatography HPA hypophosphorous acid H2 S 04 Sulfuric acid i-PrMgC1 Isopropylmagnesium chloride IPA Isopropylamine iPrOH Isopropyl alcohol or 2-propanol isovaleraldehyde 3-methylbutanal KT-11\41)S Potassium b i s(tri m ethyl si 1 yl) am i de KI Potassium iodide K20s04.2H20 Potassium osmate (VI) dihydrate K2CO3 Potassium carbonate K3PO4 Potassium phosphate LCMS or LC/MS Liquid chromatography¨mass spectrometry LiHMD S Lithium bis(trimethylsilyl)amide Me0H methanol MeMgBr methylmagnesium bromide Mg(C104)2 Magnesium perchlorate MgSO4 Magnesium sulfate MHz megahertz min minute or minutes MS mass spectrometry NaB H4 Sodium borohydride NaHMDS Sodium bi s(trimethylsilyl)ami de NaOH Sodium hydroxide Na0Et Sodium ethoxide NaHCO3 Sodium bicarbonate Na2CO3 Sodium carbonate NaI04 Sodium periodate NaNO2 Sodium nitrite Na2SO4 Sodium sulfate N2 Nitrogen gas Abbreviation Name NBS N-Bromosuccinimide NC S N-chlorosuccinimide NH2N112.H20 Hydrazine monohydrate NIS N-iodosuccinimide NH4C1 Ammonium chloride NH4HCO3 Ammonium bicarbonate NH3 H20 or NH4OH Ammonium hydroxide NMR nuclear magnetic resonance Allylchl oropalladi um dimer or Bi s(allyl)di chi orodipalladi um or [Pd(ally1)C1]2 Bis(allyl)dichloropalladium or Bis(allylchloropalladium) or Diallyldichlorodipalladium PdC12(PPh3)2 or Pd(PPh3)2C12 bis(triphenylphosphine)palladium(II) dichloride Pd(PPh3)4 tetrakis(triphenylphosphine)palladium Pd(0Ac)2 palladium (II) acetate P(tBu3)PdG2 or chi oroRtri -tert-butyl ph osph i n e)-2-(2-am i n ob i ph eny1)]
tBu3PPdG2 palladium(II) PE petrolum ether PPh3 triphenylphosphine ppm parts per million Pd(dppf)C12 CH2C12 1,1! -bi s(diphenylphosphino)ferrocene -palladium(II)di chl ori de or Pd(dppf)C12.DCM dichloromethane complex Pd/C Palladium on carbon PG Protecting group RP reverse-phase rt or RT room temperature Rt retention time RhCl(PPh3)3 or Rh(PPh3)3C1 Wilkinson's Catalyst or Chlorotris(triphenylphosphine)rhodium(I) Sec second or seconds SFC supercritical fluid chromatography 5i02 silica gel S0C12 Thionyl chloride 02 Oxygen gas TBAB tetrabutylammonium bromide or tetra-n-butylammonium bromide TBDPS tert-Butyldiphenylchlorosilane TBAF tetrabutylammonium fluoride TBHP tert-butyl hydroperoxide TBS tert-Butyldimethylsilyl TES triethylsilane TIPS triisopropylsilane TEA or Et3N triethylamine Abbreviation Name TFA trifluoroacetic acid THE tetrahydrofuran TiC14 Titanium tetrachloride TLC thin layer chromatography TF2NPh N-pheny lb i s(tri fluoromethan esufoni mi de) triflate trifluoromethanesulfonyl Tf20 Triflic anhydride or Trifluoromethanesulfonic anhydride TMS0iPr Is opropoxytri m ethyl silane (PTSA or pTs0H) or p-Toluenesulfonic acid tosylic acid PREPARATIVE EXAMPLES
[0316] Exemplary compounds of Formula (Z) useful in methods of the invention will now be described by reference to the illustrative synthetic schemes for their general preparation below and the specific examples to follow.
1.R3-NCO
0 NH2NH2+120 0 HNAN¨Ra Bn0j-LOEt H20 N_NH2 _____________________________________________________ Et0H
2. Cyclization .. 0 (II) PG
[0317] According to SCHEME 1, a 1,2,4-triazol-5(4H)-one compound of formula (II), where PG is Bn, is prepared from ethyl 2-(benzyloxy)acetate in three steps. In a first step 2-(benzyloxy)acetohydrazide is prepared by the reaction of ethyl 2-(benzyloxy)acetate with hydrazine hydrate, in a suitable solvent such as Et0H, and the like; at temperatures ranging from 70-85 C. Reaction of the hydrazide with an isocyanate of formula Ra-NCO, where Ra is C1_6alkyl, in a suitable solvent such as water, and the like; provides the corresponding semicarbazide. Subsequent cyclization of the semicarbazide with a suitable base such as NaOH, in a suitable solvent such as water, provides a compound of formula (II), where PG is Bn.
[0318] A compound of formula (II), where Ra is C1_6haloalkyl or C3_6cycloalkyl; may be prepared as previously described employing a suitably substituted compound of formula Ra-NCO, where Ra is Ci_6haloalkyl or C3_6cycloalkyl.
[0319] Protecting group exchange of a compound of formula (II), where PG is Bn to a compound of formula (II) where PG is TBDPS, is achieved in two steps employing established methodologies, such as those described in T. W. Greene and P. G. M. Wuts, "Protective Groups in Organic Synthesis,- 3 ed., John Wiley & Sons, 1999. In a first step, deprotection of benzyl group is achieved under hydrogenolytic conditions known to one skilled in the art provides the alcohol. For example, deprotection is achieved employing a palladium catalyst such Pd/C, and the like; under H2; in a suitable solvent such as Et0H, Me0H, Et0Ac, or a mixture thereof, preferably Et0H; with or without the presence HC1; for a period of 4 to 72 hrs. In a second step, protection of the corresponding alcohol as the silyl ether, is achieved with tert-butyldiphenylsily1 chloride, a suitable base such as imidazole, dimethylaminopyridine, pyridine, and the like; in a solvent such as DMF, DCM, and the like; at temperatures ranging from 0 C
to room temperature; affords a compound of formula (II) where PG is TBDP S.
HAL R1 Ri Br Br Halogenation HAL
I I Suzuki Coupling Coupling NI I
HN 3 -B(OH)2 HN,Ir-R3 R1 HN
R R3 R4-B(OH)2 -1( (XIV) (III) (IV) (V) [0320] According to SCHEME 2, a compound of formula (XIV), where R3 is H is treated with a halogenating reagent such as N-iodosuccinimide (NIS), and the like; in an aprotic solvent such as acetonitrile, and the like; under heating conditions, to afford the halogenated compound of formula (III), where HAL is iodide. A compound of formula R1-B(OH)2; is reacted under Suzuki coupling conditions known to one skilled in the art with a compound of formula (III), to provide a compound of formula (IV). For example, a compound of formula (III), where HAL
is iodide, is reacted a commercially available or synthetically accessible boronic acid (or boronic ester) such as R1-B(OH)2, where Rl is an optionally substituted C2_6alkenyl or aryl as defined herein with reference to Formula (Z); a palladium catalyst such as bi s(triphenylphosphine)pall adium(II) dichlori de, tetraki s(triphenylphosphine)pall adium, and the like; a suitable base such as potassium phosphate, Cs2CO3, and the like;
in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof; to provide a compound of formula compound (IV). A compound of formula (IV), where R3 is H, is reacted with a compound of formula R4-B(OH)2; under copper (11) mediated Chan-Lam coupling conditions known to one skilled in the art, to provide a compound of formula (V), where HAL is bromide, X is CH and R3 is H. For example, a compound of formula (IV) is reacted with a compound of formula R4-B(OH)2, where R4 is as defined herein with reference to Formula (Z); a catalyst such as copper(II) acetate, and the like; a base such as pyridine, NEt3, and the like;
in a suitable solvent such as DCM, ACN, dioxane, THF, and the like; to afford a compound of formula (V).
PG
0 j'Z'a "Cd N R1 -N 0_ Ri Ri HAL HN,N/)-----j PG
X X
NI (II) Deprotection R4 Coupling R4 R4 (V) (VI) (7) [0321] According to SCHEME 3, Ullmann-type aromatic amination reaction of compound of formula (V), where R1 is optionally substituted C2_6alkenyl, R3 is H, R4 is suitably substituted phenyl as described herein with reference to Formula (Z), and HAL is Br; with a commercially available or synthetically accessible nucleophilic compound of formula (II), where Ra is C1_ 6a1ky1; such as suitably protected triazolones, where PG is selected from:
benzyl, 4-methoxy benzyl, or an alkyl or aryl silane such as TBDPS, TBS, TES, or TIPS; in the presence of catalytic CuI and a diamine such as trans-1,2-diaminocyclohexane, and a base such as K3PO4, K2CO3, Cs2CO3, NaHCO3, triethylamine, and the like; in a suitable solvent such as 1,4-dioxane, DMSO, DMF, THF, ACN, and the like; provides a compound of formula (VI), where X is CH
and Y is CH.
[0322] A compound of formula (VI), where PG is Bn and R1 is C2_6alkenyl, is reacted under Simmons-Smith cyclopropanation reaction conditions known to one skilled in the art to provide a compound of formula (VI) where RI is C3_6cycloalkyl substituted with Ci_6alkyl. For example, a compound of formula (VI), where R1 is is reacted with diiodomethane; diethylzinc; in a suitable solvent such as toluene, and the like; at temperatures ranging from 0 C to room temperature; for a period of 3 to 26 h; to provide a compound of formula (VI), where Rl is cyclopropyl substituted with CH3.
[0323] Subsequent deprotection employing established methodologies, such as those described in T. W. Greene and P. G M. Wuts, "Protective Groups in Organic Synthesis," 3 ed., John Wiley & Sons, 1999), provides a compound of Formula (Z), where X and Y are CH.
For example, compound of formula (VI), where R3 is H, and PG is TBDPS, is deprotected employing conditions known to one skilled in the art, preferably with TBAF in a suitable solvent such as THF, and the like. In a preferred method, PG is TBDPS, and Ra is C1_6a1kyl.
Alternately, removal of a TBDPS protecting group is achieved employing triethylamine trihydrogen fluoride (Et3N=31-IF).
[0324] Removal of the Bn protecting group is achieved in the presence of hydrogen gas, in the presence of a catalyst such as Palladium on carbon (Pd/C). Removal of the protecting group Bn is also achieved employing TFA, at a temperature of about 80 C.
[0325] A compound of Formula (Z), where X is CH; Y is CH; R2, R3, R4 is each defined as described herein with reference to Formula (Z); and R4 is C2_6alkenyl, is reduced employing hydrogenation conditions known to one skilled in the art, for example, reaction with Pd/C or Wilkinson's Catalyst [RhCl(PPh3).3] under H2; in a suitable solvent such as Me0H, THF, Et0Ac, and the like; provides a compound of Formula (Z) where RI is C2_6alkyl.
HAL
00a R5 Reductive Br ') Br (V) Amination Cyclization NH
R4¨N H2 R4' DMAP/NEt3 R4' N
HAL
(VII) (VIII) (IX) 31( (Va) [0326] According to SCHEME 4, reductive amination of a compound of formula (VII), with oc, I3-unsaturated aldehyde such as 3-methyl-2-butenal, 3-methylpent-2-enal, and the like;
employing TiC14; and a base such as triethylamine; in an aprotic solvent such as dichloromethane (DCM), and the like; provides an enamine intermediate which is subsequently reduced employing a reducing agent such as Nal3ILI, and the like; to afford a compound of formula (VIII) where R5 is C1_4alkyl, R4 is as defined herein with reference to Formula (Z). A
compound of formula (VIII) is coupled with commercially available or synthetically accessible 4-bromo-2-iodobenzoyl chloride employing a base such as triethylamine and 4-dimethylaminopyridine (DMAP); in an anhydrous aprotic solvent such as dichloromethane (DCM), and the like; to afford a compound of formula (IX). Treatment of a compound of formula (IX), with palladium (II) acetate, tetrabutylammonium bromide, and potassium acetate under heating Heck reaction conditions, affords the intramolecular cyclized compounds of formula (V), wherein RI- is optionally substituted C2_6alkyl, R3 is H, X is CH, and HAL is Br;
and (Va) wherein R1 is optionally substituted C2_6alkenyl, R3 is H, X is CH2, and HAL is Br.
PG PG
PG
0 r /¨
ps ty N¨R3 N¨R.
,O. (j Hydrolysis I Ai Chlorination I =
N
R5 if R3'o - HO IV 'Rs CI
base, heating (X) (YI) (X1a) (XII) [0327] According to SCHEME 5, the reaction of a commercially available or synthetically accessible compound of formula (X), where HAL is F, R3 is F, and R5 is H or C1_4alkyl, with a commercially available or synthetically accessible nucleophilic compound of formula (II), where IV is C1_6alkyl, such as suitably protected triazolones, where PG is selected from: benzyl, 4-methoxy benzyl, or an alkyl or aryl silane such as TBDPS, TBS, TES, or TIPS;
in the presence of a base such as K3PO4, K2CO3, Cs2CO3, NaHCO3, triethylamine, and the like;
in a suitable solvent such as DMSO, DMF, THF, ACN, and the like; affords a compound of formula (XI).
In a preferred method, PG is Bn, and IV is Ci_6alkyl. The ester of formula (XI), when R5 is C1_ 4a1ky1, is hydrolyzed to its corresponding acid, under acidic or basic conditions. For example, the treatment of tert-butyl ester (R5 is tert-Bu) with TFA; or alternately, hydrolysis with a base like NaOH, in an aqueous solvent, affords a compound of formula (XIa), where R5 is H. A
compound of formula (Xla) is chlorinated, employing conditions known to one skilled in the art, to provide the acyl chloride of formula (XII). For example, a compound of formula (XIa) is heated in S0C12; or treated with oxalyl chloride in DCM
PG PG
PG
/¨O
N
f N_Ra ,NH I N¨Ra (VIII) 1 Cyclization X
Cl 0 0 Base R4 R3 (XII) (XIII) (VI) [0328] According to SCHEME 6, a compound of formula (XII), where R3 is H or F, PG is Bn, and Ra is C1-6alkyl; is reacted with a compound of formula (VIII), where R5 is Ci_4alkyl, employing a base such as a mixture of triethylamine (TEA) and 4-dimethylaminopyridine (DMAP); in an anhydrous aprotic solvent such as dichloromethane (DCM), and the like; to afford a compound of formula (XIII). A compound of formula (VI), where X is CH
and Y is CH, is obtained by treatment of a compound of formula (XIII), where RI is optionally substituted C1_6alkyl as described herein with reference to Formula (Z); with palladium (II) acetate, tetrabutylammonium bromide, and potassium acetate under heating Heck reaction conditions, that affords a mixture of intramolecular cyclized compounds, which is then separated to isolate an intermediate compound where R1 is C2_6alkyl, and R3 is H or F.
PG
PG
0 ,Ra _TO
1\1 FIN,/ NN¨
B
Halogenation [ I
Coupling 0 __________________________________ HN
IR3 HNI,--,1 R, 0 HN,r--,R3 (XIV) (XV) (XVI) [0329] According to SCHEME 7, Ullmann-type aromatic arnination reaction of a compound of formula (XIV), where R3 is H or F, with a compound of formula (II); such as suitably protected triazolones, where PG is selected from: benzyl, 4-methoxy benzyl, or an alkyl or aryl silane such as TBDPS, TBS, TES, or TIPS; according to methods previously described;
affords a compound of formula (XV). In a preferred method, PG is Bn, and IV is Ci_6alkyl. A compound of formula (XV) is treated with a halogenating reagent such as N-iodosuccinimide (NIS), and the like; in an aprotic solvent such as acetonitrile, and the like; under heating conditions; affords a halogenated compound of formula (XVI), where Y is CH and HAL is iodide.
R5'0 R' PG
0 0 =
R1 0, R1 PG FzI N
1 Br (XVIla) 1 Br NH2NH2 H20 X
Br (II) )1(1;111 P3 Coupling HN
R, 0 0"" I -k,= 0 (V) 0 (XVIII) (XVIIb) [0330] According to SCHEME 8, compounds of formula (XVIIa) and (XVIIb) are prepared from 5-bromoi sob enzofuran- 1 , 3 -di one in two steps. 5 -B rom oi sob enzofuran- 1,3 -di one is reacted with a commercially available or synthetically accessible suitably substituted alkyl Grignard reagent such as i-PrMgC1, EtMgBr, and the like; in the presence of CdC12; in aprotic solvent like THF, and the like; followed by subsequent treatment with an alkylating agent of formula R5-I, where R5 is C1_4alkyl (such as iodomethane or iodoethane); in the presence of base like K2CO3, Cs2CO3, and the like; in a aprotic solvent such as DMF, DMSO, and the like;
affords a mixture of regio-isomeric esters of formula (XVIIa) and (XVIIb), where Rl is an optionally substituted Ci_6alkyl. In a similar fashion, aryl Grignard reagents may be used to provide compounds of formula (XVIIa) and (VXIIb), where R1 is a suitably substituted phenyl.
The regio-isomers of formula (XVIIa) and (XVIIb) are not separated but are used directly and converted into the corresponding phthalazinone (mixture). For example, a mixture of formula (XVIIa) and formula (XVIIb) are treated with excess hydrazine; in a suitable solvent such as ethanol or methanol, at temperatures ranging from room temperature to 90 C, for a period of 6 to 20 hours. The desired phthalazinone compound of formula (V) can be readily separated from the other regio-isomer by precipitation, crystallization, or purified by flash chromatography. Ullmann-type aromatic amination reaction of a compound of formula (V), with a suitably protected triazolone of formula (II), where Ra is Ci_6a1ky1, and PG is selected from: benzyl, 4-methoxy benzyl, or an alkyl or aryl silane such as TBDPS, TBS, TES, or TIPS;
in the presence of catalytic CuI and a diamine such as trans-1,2-diaminocyclohexane, and a base such as K3PO4, K2CO3, Cs2CO3, NaHCO3, triethylamine, and the like; in a suitable solvent such as I,4-dioxane, DMSO, DMF, THE, ACN, and the like; affords a compound of formula (XVIII), where X is N.
[0331] A compound of formula (XVIII), where RI is C2_6a1keny1, is reacted under Simmons-Smith cyclopropanation reaction conditions known to one skilled in the art, to provide a compound of formula (XVIII) where RI is C3_6cyc10a1ky1 substituted with Ci_6alkyl. For example, a compound of formula (XVIII), where R1 is C2_6alkenyl, is reacted with diiodomethane; diethylzinc; in a suitable solvent such as toluene, and the like; at temperatures ranging from 0 C to room temperature; for a period of 24 to 26 h; to provide a compound of formula (XVIII), where RI is cyclopropyl substituted with CH3.
R PG
N
0 HN_N----j PG R1 R1 Ra 121 I HAL HAL (ii) 0 HAL sl\IHNH2> X I
n I I
rz, 0 o Couphng Rs-' R3 Coupling Rs- y 12' 11 R3 (X) (XIX) (V) (VI) [0332] According to SCHEME 9, a compound of formula (X), where HAL is Br, R3 is H, and R5 is CH3, is coupled in a palladium catalyzed carbonylation reaction with a commercially available or synthetically accessible aldehyde of formula RI-CHO, where RI is C1_6alkyl; to afford the corresponding ketone compound of formula (XIX), (similar transformation has been reported by Suchand et a1õ/. Org. Chem. 2016, 81, 6409-6423). For example, reaction of methyl 4-bromo-2-iodobenzoate with isobutylaldehye; in the presence of a palladium catalyst such as Pd(OAc)2; Ag2O; and an oxidizing agent such as aqueous solution of tert-butyl hydroperoxide (TBHP); at a temperature of about 120 C; for a period of 10-14 h; provided methyl 4-bromo-2-i sobutyrylbenzoate. A ketone compound of formula (XIX) is reacted with hydrazine le-NHNH2, where R4 is suitably substituted aryl such as 2-chloro-6-fluorophenylhydrazine; to afford a compound of formula (V), where X is N.
Ullmann-type aromatic amination reaction of a compound of formula (V) with a suitably protected triazolone (II) as previously described, affords a compound of formula (VI), where Y is CH, and R1 is selected from C1-6a1kyl.
[0333] A compound of formula (VI), where Y is CH, and R1 is phenyl and X is N, may be prepared in a similar fashion, employing methods previously describe by coupling methyl 4-bromo-2-iodobenzoate with a commercially available or synthetically accessible aldehyde of formula RI--CHO, where Rl is phenyl.
PG Suzuki Coupling PG
r /¨(5PG
R1-B(OH)2 HAL N¨Ra N¨R' 1. Suzuki (R1= alkenyl) Coupling I I 0 2. Oxidation I
.R3 0 R4-B(CH)2 HN, R4 R3 11 3. Grignard 0 0 (xviii) (VI) (xvi) HH(cH3)2. H20 Heat [0334] According to SCHEME 10, a compound of formula R'-B(OH)2; is reacted under Suzuki coupling conditions known to one skilled in the art, with a compound of formula (XVI), to provide a compound of formula (XVIII), where Xis CH. For example, a compound of formula (XVI), where Y is CH and HAL is iodide, is reacted a commercially available or synthetically accessible boronic acid (or boronic ester) such as R1-B(OH)2, where Rl is an optionally substituted C2_6alkenyl, C3_6cycloalkyl or aryl as defined herein with reference to Formula (Z);
a palladium catalyst such as bis(triphenylphosphine)palladium(II) dichloride, and the like; a suitable base such a potassium phosphate, Cs2CO3, and the like; in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof; to provide a compound of formula compound (XVIII), where X is CH. It has been noticed that during the coupling reaction as described above, loss of the iodide during the reaction conditions afforded a compound of formula compound (XVIII), where X is CH, and RI- is H. A compound of formula (XVIII), where X is CH or N, is reacted with a compound of formula R4-B(OH)2; under copper (II) mediated Chan-Lam coupling conditions known to one skilled in the art, or as previously described, to provide a compound of formula (VI), where X is CH or N, 11.1 is optionally substituted C2_6alkeny1, R3 is H or F, and R4 is a suitably substituted phenyl as described herein with reference to Formula (Z).
[0335] A compound of formula (XVIII), where R1 is N(CH3)2 is prepared from a compound of formula (XVI), where HAL is Br and PG is Bn. Reaction of a compound of formula (XVI) with an amine bs such as NH(CH3)2 in water, at a temperature of about 110 C, for a period of 96 hours h; affords a compound of formula (XVIII) where R1 is N(CH3)2, and IV is Ci_6alkyl. A
compound of Formula (Z), where R1 is N(CH3)2 is prepared according to methods described above.
[0336] A compound of formula (XVIII), where R1 is Ci_6alkyl substituted with OH, is prepared from a compound of formula (XVIII), where R1 is C2_6alkeny1, and PG is Bn in two steps. In a first step, reaction of a compound of formula (XVIII), where R1 is , under oxidizing conditions such as NaI04, and K20s04.2H20 or 0s04; in a suitable solvent such as THF/H20;
at temperatures ranging from 0 C to room temperature; for a period of 48 to 72 hours; affords a ketone intermediate compound. In a second step, reaction of the ketone intermediate compound with a Grignard reagent such as methylmagnesium bromide; in a suitable solvent such as diethyl ether; at temperatures ranging from 0 C to room temperature;
for a period of 3 to 30 hours; affords a compound of formula (XVIII), where le is C1_6alkyl substituted with OH.
0-1f ,F
NH2NH ¨R4 1-IN¨N
Base Hy Tf2 N
R4 R3 Base R4 (XX) (XXI) (XXII) [0337] According to SCHEME 11, 4,5-difluorophthalic anhydride is reacted with a hydrazine compound of formula R4-NHNH2, where R4 is a suitably substituted phenyl or heteroaryl such as (2-chloro-6-fluorophenyl)hydrazine hydrochloride; in acetic acid; at a temperature of about 125 C; for a period of about 1.5 h to afford a compound of formula (XX), where R3 is F.
Rearrangement of a compound of formula (XX) affords a ring expansion compound of formula (XXI), under basic conditions such as sodium ethoxide or sodium methoxide; in a protic solvent such as ethanol, methanol, and the like; at room temperature; for a period of about 1.5 h.
Derivation of a compound of formula (XXI), with a sulfonate-based leaving group such as trifluoromethanesulfonyl (triflate), is achieved by is by reaction with a triflating agent such as trifluoromethanesulfonic anhydride (Tf20), a base such as triethylamine (TEA), pyridine, and the like, in a suitable solvent such as DCM and the like, to provide a compound of formula (XXII). Milder triflating agents such as N-phenylbis(trifluoromethanesufonimide) (TF2NPh), a base such as TEA, DIEA, and the like, in a suitable solvent such as DCM, and the like; may be used.
gg PG
N"-Cd N "a )r,1 D
PG R4 '`
OTf Ri HN, (II) Suzuki Coupling x HAL
(VI) +
R3 R1-B(OH)2 R4 R4 Base (XXII) (V) X
,PG
0 .R' (Via) [0338] According to SCHEME 12, a compound of formula R1-B(OH)2; is reacted under Suzuki coupling conditions previously described, with a compound of formula (XXII), to provide a compound of formula (V), where X is N. For example, a compound of formula (XXII), is reacted a commercially available or synthetically accessible boronic acid (or boronic ester) such as R'-B(OH)2, where R" is C2_6alkenyl or C2_6haloalkenyl as defined herein with reference to Formula (Z); a palladium catalyst such as 1, l'-b i s(di phenyl ph osphi n o)ferrocene-palladium(II)dichloride or bis(triphenylphosphine)palladium(II) dichloride, and the like; a suitable base such a potassium phosphate, Cs2CO3, K2CO3, and the like; in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof; to provide a compound of formula compound (V). A compound of formula (V), where RI- is C2_6alkyl or C2_6haloa1kyl, is readily prepared by selective hydrogenation of a compound of formula (V), where It' is C2_6alkenyl or C2_6haloalkenyl. For example, reaction of a compound of formula (V), where It' is F
F , under hydrogenation conditions employing a catalyst such as Pd/C and the like, in a suitable solvent such as Et0Ac, and the like; under an atmosphere of hydrogen gas (20-45 psi) at room temperature; for a period of 4 to 24 hours; affords a compound of formula (V), , or F
where R1 is F F. The reaction of a compound of formula (V), with a suitably protected triazolone of formula (II), employing conditions previously described, affords a mixture of compounds of formula (VI) and (VIa) which can be separated before or after deprotection of the protecting group.
Rd Rd PG
PG
PG ' /¨ci R1 N--=-Cci F NO2 RI N=-A/¨C) N-R" RI
i N¨Rd (XXIII) Rd X"' All N.--1( Reduction Rd X
N -_.,.
irp, 0\ip o (IP o R3 HN --' R3 Y- Fe base I
02N.- IR' (XXV) (XVIII) Re (XXIV) PG
RI ' N1,----00 isii N-Rd Diazotization Rd Reduction l' Re (XXVI) [0339] According to SCHEME 13, N-arylation of a compound of formula (XVIII) is achieved by reaction of suitably substituted commercially available or synthetically accessible fluoro compound of formula (XXIII), where R' and Rd are as defined herein with reference to Formula (Z). A compound of formula (XVIII), where R1 is H, C2_6alkenyl , C2_6hal oal kenyl, C3-6cycl oalkyl, C3-6cycl alkyl substituted with C1-6a1ky1, and X is CH or N, is reacted under nucleophilic displacement reaction conditions, with a commercially available or synthetically accessible fluoro compound of formula (XXIII); in the presence of a base like K2CO3, Cs2CO3, and the like; in aprotic solvent such as DMF, DMSO, and the like; at temperatures ranging from 65 to 100 "V; to afford a compound of formula (XXIV).
[0340] Reduction of compound of formula (XXIV) is achieved employing zinc or iron and NH4C1; in a mixed solvent of methanol and water; to provide an amino compound of formula (XXV).
[0341] Di azotizati on of a compound in formula (XXV) with NaNO2; in an acidic aqueous solution or other nitrite reagents; in an organic solvent, such as Et0H, and the like; at a temperature of 0 C; and subsequent the reduction of diazo group with zinc at temperatures ranging from 0 to 85 C; or by treatment with H3P02; affords a compound of formula (XXVI), where R and Rd are as defined as described herein with reference to Formula (Z).
Rib Rla HN
N-Ra PG
RR' RtRIa N=Cd Br 0 a I HAL (XXV F N-R
I) .HAL (II) 1"0 " Gyclization PG
Base 0 R3 0 N
N-Re 0 (XXVIII) (XXIX) "
(X) PG
¨rd 0 (XXX) R
Cy2N Me (X la) Getecxiurn A Pd [0342] According to SCHEME 14, a compound of formula (X), where HAL is F, R5 is H and R3 is F, is reacted with a commercially available or synthetically accessible compound of formula (XXVII), where Ria and Rib are each independently H or Ci_4alky1, such as 1-bromo-3-methy1-2-butene; in the presence of a base such as K2CO3, Cs2CO3, and the like; in a suitable solvent such as DMSO, DIvIIF, THF, ACN, and the like; to afford an ester compound of formula (XXVIII), where R3 is F, and HAL is F. A compound of formula (XXVIII), where R1a and Rib are each independently selected from Ci_4haloalkyl or C3_6cycloalkyl may be made in a similar fashion. The reaction of an ester of formula (XXVIII) with a suitably protected triazolone compound of formula (11); in the presence of a base such as K3PO4, K2CO3, Cs2CO3, NaHCO3, triethylamine, and the like; in a suitable solvent such as 1,4-dioxane, DMSO, DMF, THF, ACN, and the like; affords a compound of formula (XXIX). In a preferred method, PG
is Bn, and Ra is Ci_6alkyl. A compound of formula (XXIX), where R3 is H or F, undergoes intramolecular cyclization under Heck reaction conditions, such as employing at catalyst such as chloroRtri-tert-butylphosphine)-2-(2-aminobi phenyl)] palladium (II) (P(tBu3)PdG2), N-cycl oh exyl -N-methyl-cyclohexanamine, in a suitable solvent such as toluene, and the like;
at a temperature of about 15 to 80 C; for a period of about 18 to 36 hours; to provide an isocoumarin compound of formula (XXX), where Y is CH and R1 is isopropyl, R3 is H or F, Ra and PG are defined as described above.
[0343] An isocoumarin compound of formula (XXX), where Ri is ¨ is prepared from a compound of formula (XIa) and methylbuta-1,2-dien-l-y1 acetate. Methylbuta-1,2-dien-l-y1 acetate is commercially available or prepared in two steps from 2-methyl-3-butyn-2-ol. Acetic anhydride is reacted with 2-methyl-3-butyn-2-ol, in the presence of a catalyst such as Mg(C104)2; in a suitable solvent such as DCM, and the like; to afford 2-methylbut-3-yn-2-y1 acetate. 2-Methylbut-3-yn-2-y1 acetate is reacted with a catalytic amount of a Lewis acid such as AgBF4, AgC104, PtC12, and the like; to provide 3-methylbuta-1,2-dien-1-y1 acetate. 3-Methylbuta-1,2-dien-1-y1 acetate is coupled with a compound of formula (XIa), where IV is H, employing intermolecular cyclization under Heck reaction conditions as previously described, such as employing at catalyst such as Catacxium A Pd G2, and Cy2NMe palladium (II) acetate, phase transfer reagent like tetrabutylammonium bromide, and a base like potassium acetate, in a suitable solvent such as DMF, and the like; at a temperature of 70 to 90 C;
for a period of 10 to 16 hours; to provide the isocoumarin compound of formula (XXX), where Y is CH and le is [0344] A compound of formula (XXX), where Y is CH and is -- is selectively reduced under hydrogenation conditions employing at catalyst such as Wilkinson's Catalyst [RhCl(PPh3)3] and the like, in a suitable solvent such as THF, and the like;
at room temperature, provide an isocoumarin compound of formula (XXX), where It1 is isopropyl.
0\
OEt Wittig Reaction Reduction Oxidation [0345] According to SCHEME 15, 2-butanone is converted to ethyl 3-methylpent-2-enoate employing Wittig reaction conditions known to one skilled in the art. For example, 2-butanone is reacted with a triphenyl phosphonium ylide such as (carbethoxymethylene) triphenylphosphorane, with or without an additive such as benzoic acid, LiC1, and sodium dodecyl sulfate (SDS), and the like, in a suitable solvent such as toluene, at temperatures ranging from rt to the reflux temperature of the solvent, for a period of 12-24 h. Ethyl 3-methylpent-2-enoate is reduced to 3-methylpent-2-en-1-ol employing a suitable reducing agent such as DIBAL-H, in a suitable solvent such as toluene, and the like, at temperatures ranging from -78 C to room temperature. 3 -Methylpent-2-en-l-ol is oxidized to 3-methylpent-2-enal employing oxidation conditions known to one skilled in the art, for example, DMP (Dess-Martin periodinane), S03-pyridine, Swern conditions RCOC1)2, DMSO, Et3IN], PCC, and the like, in a solvent such as Et0Ac, DMSO, DCM, and the like, at temperatures ranging from about -78 C to room temperature (about 23 C). In a preferred method, 3-methylpent-2-en-1-ol is oxidized to 3-methylpent-2-enal with Dess-Martin periodinane, in DCM, at 25 C for a period of 1-4 h.
PG
d R1 N%----C
Ri N ------ 1 N¨Ra 1 N¨Ra R4¨N H2 I , I , (VII) __________________________________________________ ..-Oy----.õ-_,----- R3 0 Lewis acid R4-N-TIR 03 (XXX) (XXXI) 103461 According to SCHEME 16, an isocoumarin of compound of formula (XXX), where Y
is CH, is reacted with a commercially available or synthetically accessible amine compound of formula R4-NH2, where R4 is as defined herein with reference to Formula (Z); a Lewis acid such as like AlMe3, A1C13, and the like; in a suitable aprotic solvent such as DCM, toluene, and the like; to provide a compound of formula (XXXI), where Y is CH, and le, R3, R4 and IV are defined as described herein with reference to Formula (Z).
PG
1. sea, j/ ________ N 0_ A
N---=1\
.- i F HN,N----/ PG \ i N¨Ra R
'ClYR3 X 0 3 __________________ base, heating 0 HO = 0 (X) 0 (XXXII!) (XXXIV) PG PG
0 0' N --,----C R1 N N¨Ra 1 iK,_, Lewis acid NI N-,\_c Cycliz ...e¨Raation i ..- õ 0 0 Rearrangement `-' R3 (XXXV) (XXX) 103471 An isocoumarin compound of formula (XXX) may be prepared according to SCHEME
17. 4,5-Difluoro-2-iodobenzoyl chloride is prepared from a compound of formula (X), where HAL is F, R5 is H and R3 is F, employing conditions known to one skilled in the art such as oxalyl chloride or thionyl chloride, in the presence of a catalytic amount of DMF, in a suitable solvent such as an aprotic non-polar solvent such as dichloromethane (DCM), tetrahydrofuran (THF), acetonitrile (ACN), toluene, and the like, at a temperatures ranging from 0 C to room temperature to form 4,5-difluoro-2-iodobenzoyl chloride. 4,5-Difluoro-2-iodobenzoyl chloride may be reacted with commercially available or synthetically accessible 2-methylbut-3-yn-2-ol, in the presence of a base such as triethylamine and DMAP; in a suitable solvent such as DCM, and the like, to afford an ester compound of formula (XXXIII). A compound of formula (XXXIII) may be reacted with a compound of formula (II), employing methods as previously described to afford a compound of formula (XXXIV). Treatment of a compound of formula (XXXIV) with a catalytic amount of a Lewis acid such as AgC104, PtC12, and the like; may afford the rearranged compound of formula (XXXV). A compound of formula (XXXV), where R3 is H or F, may undergo an intramolecular cyclization under Heck reaction conditions, such as employing a catalyst such as palladium (II) acetate, a phase transfer reagent like tetrabutylammonium bromide, and a base like potassium acetate, in a suitable solvent such as DMF, and the like; at a temperature of 70 to 90 C; for a period of 1 to 3 hours; to provide an isocoumarin compound of formula (XXX), where Y is CH.
PG
o N=C6 ci y rj N--F PG
HN PG
,N HALNJ 0 IN=4,, R- Coupling \(j 0 R5 (XXXIX) EtO15-0 0 (Xa) Suzuki R5 Coupling Or PG (XL) N-IR' N-Ac (XI) 103481 According to SCHEME 18, a compound of formula (Xa), where HAL is Cl, R5 is CH(CH3)2, and R3 is F, is commercially available or synthetically accessible according to methods as described in Chen, et al, US Patent Publication No. US2016-0176869.
Reaction of a compound of formula (Xa) with a commercially available or synthetically accessible nucleophilic compound of formula (II), where PG is benzyl, and Re is C1_6alkyl; in the presence of a base such as K2CO3, Cs2CO3, NaHCO3, triethyl amine, and the like; in a suitable solvent such as dimethylsulfoxide (DMSO), DMF, THE', ACN, and the like; affords a compound of formula (XXXIX), where Y is N. A compound of formula (XXXIX) or formula (XI), where R3 is F, and R5 is Ci_4alkyl; is reacted a commercially available 1-ethoxyethene-2-boronic acid pinacol ester, a palladium catalyst such as bis(triphenylphosphine)palladium(II) dichloride, 1,11-bis(diphenylphosphino)ferrocene-palladium(II)dichloride and the like; a suitable base such as Cs2CO3, and the like; in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof; employing conventional or microwave heating; to provide a compound of formula (XL), where Y is N or CH.
PG ci PG PG
] N-R
R4-NH2 Et0, Y=--AcOH N=id .
Et0,,,,-1/.., ,N-_,\ (VII) Y L1N-Ra I 0 Al(CH3)3 , H ,,,Y.,..N.INI-Ra or TFA
1 r 1 zØ.1.R3 0 Heating N --,_õ-, 0 R`I-NR3 (XL) (XLI) (XLII) PG PG
ci d HAL N=-/
R1 N=-/¨
I NR' \1 1 1-s " X Th--1 Halogenation l', N ...., \, R1-B(OH)2 N1 R
-1 ,-- -1 ---. ' -1 N, -. 0 Suzuki Coupling rj , I 0 R4- R3 ---,-..,----.. 3 R4- Tr R
o o (xvi) (vi) [0349] According to SCHEME 19, a compound of formula R4-NH2, where R4 is as defined herein with reference to Formula (7); is reacted with trimethyl aluminum; in a suitable solvent such as dichloromethane, toluene, or a mixture thereof; the resulting solution is combined with a compound of formula (XL), where Y is CH or N; to provide a compound of formula (XLI).
A compound of formula (XLI), where Y is CH or N, is treated with acetic acid or trifluoroacetic acid under heating conditions between 50 C to 90 C, to provide a compound of formula (XLII).
A compound of formula (XLII) is halogenated employing N-bromosuccinimide in anhydrous dimethylformamide at room temperature, to provide a compound of formula (XVI), where HAL
is Br. A compound of formula R1-B(OH)2; is reacted under Suzuki coupling conditions known to one skilled in the art, or as previously described with a compound of formula (XVI), to provide a compound of formula (VI), where R1 is an optionally substituted C2_6alkenyl, C2-6ha1oa1keny1, or aryl as defined herein with reference to Formula (Z). A
compound of formula (VI), where R1 is an optionally substituted C2_6alkenyl or C2_6haloalkenyl is reacted under hydrogenation conditions using Wilkinson catalyst ((PPh3)3RhC1) to provide a compound of formula (VI), where R1 is C2_6alkyl or C2_6haloalkyl.
PG
PG PG
N=Cd 1. R4-NH2 i N-Ro N=--Cd RI N=id I N-Ra ________ 1 y ij N¨Ra mi ,_ 1 CI -)1-_, N -1 2. AcOH -- 1r --'----1R3 [Pd(ally1)C1]2, DPPF
- r'i"
0 0 (VI) (xxxix, (xxx) [0350] According to SCHEME 20, 3-methylbutanal is reacted with a compound of formula (XXXIX), where Y is N and R5 is CH(CH3)2, with a palladium catalyst such as allylpalladium(II) chloride dimer, and the like; a ligand such as 1,1'-bis(diphenylphosphino)ferrocene (dppf), and the like; a suitable base such as Cs2CO3, and the like; in the presence of water scavenger such as molecular sieve (4A); in a suitable solvent such as dioxane thereof; to provide a compound of formula compound (X)0C), where Rl is isopropyl.
A compound of formula R4-NH2, where R4 is as defined herein with reference to Formula (Z);
is reacted with trimethyl aluminum; in a suitable solvent such as dichloromethane, toluene, or a mixture thereof; the resulting solution is combined with a compound of formula (XXX), followed by subsequent treatment with acetic acid under heating temperature of 80-100 C for a period of time ranging from 5 to 24 hours; to provide a compound of formula (VI); where X
is CH, Y is N, R1 is isopropyl, R3 is F.
PG
N----f 6 NI -Re I õ,,r.N -....,\(\
/-01:'G
,¨ CPG
N=--- N ----X
R5 II (i)-5<-o (XI) \I
PG "-----õ,z, B-0 \ ...:7..--õ,_,,õYõ,,,,N --_, K20s04. 0)'12 -or R5 N,--id Suzuki -R o Naio 3 R5 ,fly-^-..õ---R3 Coupling 1 N-Re 0 0 CI _,, (XLIII) (XLIV) (XXXIX) po PG
R1 N\ R1 R1 N=CO
1. 121-MgBr .. 0 1 --' A\ o NI-I2NH-R4 o --- 3 2. Dess-Martin Fzcz' 1.1"-----------R 0 (XLV) (VI) I1. Stille Coupling 2. Hydrolysis PG
N=C6 I N-CI ...,y,õN,..4 0 `.... 0 F
(XXXIX) 103511 According to SCHEME 21, A compound of formula (XXXIX) or formula (XI), where R3 is F, and R5 is CI-alkyl; is reacted a commercially available vinylboronic acid pinacol ester;
a palladium catalyst such as bis(triphenylphosphine)palladium(II) dichloride, or 1,1-bis(diphenylphosphino)ferrocene-palladium(II)dichloride dichloromethane complex, and the like, a suitable base such as Cs2CO3, and the like, in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof; to provide a compound of formula compound (XLIII), where Y
is N or CH. The vinyl group in a compound of formula (XLIII) is selectively converted into an aldehyde group of formula (XLIV) employing potassium osmate (VI) dihydrate/
sodium periodate, or ozonolysis, and the like. A compound of formula (XLIV) is reacted with a commercially available or synthetically accessible suitably substituted alkyl Grignard reagent such as i-PrMgC1, and the like; in aprotic solvent like THF, and the like;
followed by subsequent treatment with an oxidizing reagent such as Dess-Martin reagent, or Swern oxidation conditions, and the like; to afford a ketone compound of formula (XLV).
[0352] A compound of formula (XLV) is prepared from a compound of formula (XXXIX) in two steps. A compound of formula (XXXIX), where R3 is F, and R5 is Ch4alkyl;
is reacted a commercially available tributy1(1-ethoxyvinyl)tin; a palladium catalyst such as bis(triphenylphosphine)pall adium(II) di chl oride, 1, 1Lb i s(diphenylphosphino)ferrocene-palladium(II)dichl oride and the like; in a suitable solvent such as dioxane, water, ethanol, or a mixture thereof Subsequent acidic hydrolysis employing conditions such as treatment with aqueous HC1 solution at room temperature affords a compound of formula (XLV), where X is N, Y is N or CH, RI is methyl.
[0353] A commercially or synthetically available hydrazine R4-NHNH2, where R4 is as defined herein with reference to Formula (Z), such as 2-chloro-6-fluorophenylhydrazine, o-tolylhydrazine; is condensed with a compound of formula (XLV); in the presence of a base such as potassium carbonate, and the like; under the heating conditions such as 70-120 C; in a suitable solvent such as toluene, or a mixture thereof; afford a compound of formula (VI), where X is N, Y is CH or N, and R4 is as defined herein with reference to Formula (Z).
PG
GC) HN N Re 0 ,R 0, tr N N 0_ PG ,0 PG R4-NH2 Br, (II) PG Br HO T.J.r, , F
[Pd(elly1)CIL DPPF CLIf AcOH -8- Base No molecular 0 0 (XLVI) Sieve (XLVII) (VI) [0354] According to SCHEME 22, the reaction of methyl 2-bromo-4,5-difluorobenzoate with a suitably protected triazolone compound of formula (II); in the presence of a base such as K3PO4, K2CO3, Cs2CO3, NaHCO3, triethylamine, and the like; in a suitable solvent such as 1,4-dioxane, DMSO, DMF, TifF, ACN, and the like; affords a compound of formula (XLVI). In a preferred method, PG is Bn, and R" is C1_6alkyl (as previously described in Scheme 14). 3-Methylbutanal is reacted with a compound of formula (XLVI), with a palladium catalyst such as allylpalladium(II) chloride dimer, and the like, a ligand such as 1,1'-bis(diphenylphosphino)ferrocene (dppf), and the like; a suitable base such as Cs2CO3, and the like; in the absence of water scavenger such as molecular sieve (4A); in a suitable solvent such as dioxane thereof; to provide a compound of formula compound (XLVII). A
compound of formula le-NH2, where R4 is as defined herein with reference to Formula (Z);
is reacted with trimethyl aluminum; in a suitable solvent such as dichloromethane, dichloroethane, toluene, or a mixture thereof; the resulting solution is combined with a compound of formula (XLVII), followed by subsequent treatment with acetic acid under heating temperature of 80-100 C for a period of time ranging from 5 to 24 hours; to provide a compound of formula (VI); where X
is CH, Y is CH, R1 is isopropyl, R3 is F. In certain cases, a compound of formula R4-NH2 such as o-toluidine and the like; is directly condensed with a compound of formula compound (XLVII) in acetic acid under heating temperature of 80-100 'V for a period of time ranging from 10 to 24 hours; to provide a compound of formula (VI); where X, Y, R3 are defined above.
PG PG
PG
N=C N==c N=id C I N N¨Ra N¨Ra N ¨Ra 1.Sonogoshira AuCll 2. TBAF MeCN 0 (XXXIX) (XLVI I I) (XLI X) PG
/¨
N=Cd N
1. R PG 4-NH2 N¨Ra R1 (VII) X 1 . Halogenation X
2. AcOH (j2. Coupling NI
(L) (VI) [0355] According to SCHEME 23, a compound of formula (XXXIX), where R5 is Ci_4alkyl, Y
is N, and R3 is F, is subjected to a Sonogashira coupling reaction with a silyl protected alkyne, such as trimethyl silyl acetyl ene, a palladium catalyst such as palladium(11)bis(triphenylphosphine) dichloride and the like; a copper catalyst such as copper iodide and the like; with a suitable base, such as triethylamine; in a suitable solvent such as ACN, toluene, and the like. Deprotection reaction employing TBAF in a suitable solvent such as THF, and the like; at room temperature affords a compound of formula (XLVIII). A
compound of formula (XLIX) is obtained using a gold catalyst, preferably AuC13 in a suitable solvent mixture, such as MeCN. Similar transformation by AuC13-catalyzed cyclization has been described by Marchal, E. et al in Tetrahedron 2007, 63, 9979-9990. A
compound of formula R4-NH2, where R4 is as defined herein with reference to Formula (Z);
is reacted with trimethylaluminum; in a suitable solvent such as dichloromethane, dichloroethane, toluene, or a mixture thereof; the resulting solution is combined with a compound of formula (XLIX), followed by subsequent treatment with acetic acid under heating temperature of 80-100 C for a period of time ranging from 5 to 24 hours; to provide a compound of formula (L). Employing NBS in a suitable solvent, preferably DMF, at room temperature followed by cross coupling using conditions known to one skilled in the art, preferably a palladium catalyst such as palladium(II)bis(triphenylphosphine) dichloride, a base such as Cs2CO3, Na2CO3, and the like;
in a solvent mixture composed of 1,4-dioxane and water; at a temperature of 100 C provides a compound of formula (VI), where X is CH, Y is N, R3 is F, and 111, Ra and PG
are defined as previously described.
PG
Ri N ¨id Ri _y N¨Ra Deprotection , R2 x rj I
(VI) (z) 103561 According to SCHEME 24, a compound of formula (VI), where PG is Bn, is deprotected employing conditions known to one skilled in the art, preferably in neat TFA
in a sealed tube, at a temperature of about 60 to 90 C; or employing BC13, at a temperature of about -78 C, in a suitable solvent such as in DCM; or treatment with hydrogen gas, in the presence of a catalyst such as Palladium on carbon (Pd/C), affords a compound of Formula (Z).
103571 In a similar fashion, N-arylation and in-situ TBDPS deprotection of a compound of formula (XVIII), where R1 is 1 and PG is TBDPS, and Xis N; is achieved employing conditions known to one skilled in the art or as previously described, to afford a compound of Formula (Z).
103581 A compound of Formula (Z), where R3 is F is reacted in a nucleophilic aromatic substitution reaction to provide a compound of Formula (Z), where R3 is OCH3.
For example, reaction of a compound of Formula (Z), where R3 is F, with a suitable base such as NaOH, and the like; in a suitable solvent such as Me0H, and the like; to provide a compound of Formula (Z) where Y is CH and R3 is OCH3.
[0359] Compounds of Formula (Z) may be converted to their corresponding salts using methods known to one of ordinary skill in the art. For example, an amine of Formula (Z) is treated with trifluoroacetic acid, HC1, or citric acid in a solvent such as Et20, CH2C12, THF, Me0H, chloroform, or isopropanol to provide the corresponding salt form.
Alternately, trifluoroacetic acid or formic acid salts are obtained as a result of reverse phase HPLC
purification conditions. Crystalline forms of pharmaceutically acceptable salts of compounds of Formula (Z) may be obtained in crystalline form by recrystallization from polar solvents (including mixtures of polar solvents and aqueous mixtures of polar solvents) or from non-polar solvents (including mixtures of non-polar solvents).
[0360] Where the compounds according to this invention have at least one chiral center, they may accordingly exist as enantiomers. Where the compounds possess two or more chiral centers, they may additionally exist as diastereomers. It is to be understood that all such isomers and mixtures thereof are encompassed within the scope of the present invention.
[0361] Compounds prepared according to the schemes described above may be obtained as single forms, such as single enantiomers, by form-specific synthesis, or by resolution.
Compounds prepared according to the schemes above may alternately be obtained as mixtures of various forms, such as racemic (1:1) or non-racemic (not 1:1) mixtures.
Where racemic and non-racemic mixtures of enantiomers are obtained, single enantiomers may be isolated using conventional separation methods known to one of ordinary skill in the art, such as chiral chromatography, recrystallization, diastereomeric salt formation, derivatization into diastereomeric adducts, biotransformation, or enzymatic transformation. Where regioisomeric or diastereomeric mixtures are obtained, as applicable, single isomers may be separated using conventional methods such as chromatography or crystallization.
[0362] The following specific examples are provided to further illustrate compounds of Formula (Z) and various preferred embodiments.
EXAMPLES
[0363] In obtaining the compounds of Formula (Z) described in the examples below and the corresponding analytical data, the following experimental and analytical protocols were followed unless otherwise indicated.
[0364] Unless otherwise stated, reaction mixtures were magnetically stirred at room temperature (rt) under a nitrogen atmosphere. Where solutions were "dried,"
they were generally dried over a drying agent such as Na2SO4 or MgSO4. Where mixtures, solutions, and extracts were "concentrated", they were typically concentrated on a rotary evaporator under reduced pressure.
[0365] Normal-phase silica gel chromatography (FCC) was performed on silica gel (SiO2) using prepacked cartridges.
[0366] Preparative reverse-phase high performance liquid chromatography (RP
HPLC) was performed on either:
METHOD A. A Gilson GX-281 semi-prep-HPLC with Phenomenex Synergi C18(10 ttm, 150 x 25mm), or Boston Green ODS C18 (51.tm, 150 x 30mm), and mobile phase of 5-99%
ACN in water (with 0.225%FA) over 10 min and then hold at 100% ACN for 2 min, at a flow rate of 25 mL/min; or METHOD B. A Gilson GX-281 semi-prep-HPLC with Phenomenex Synergi C18(10p.m, 150 x 25mm) , or Boston Green ODS C18 (4tm, 150 x 30mm), and mobile phase of 5-99%
ACN in water(0.1%TFA) over 10 min and then hold at 100% ACN for 2 min, at a flow rate of 25 mL/min; or METHOD C. A Gilson GX-281 semi-prep-IIPLC with Phenomenex Synergi C18(10ttm, 150 x 25mm), or Boston Green ODS C18 (51.tm, 150 x 30mm), and mobile phase of 5-99%
ACN in water(0.05%HC1) over 10 min and then hold at 100% ACN for 2 min, at a flow rate of 25 mL/min; or METHOD D. a Gilson GX-281 semi-prep-HPLC with Phenomenex Gemini C18 (10[Im, 150 x 25mm), AD(10m, 250mm x 30mm), or Waters XBridge C18 column (51.tm, 150 x 30mm), mobile phase of 0-99% ACN in water (with 0.05% ammonia hydroxide v/v) over 10 min and then hold at 100% ACN for 2 min, at a flow rate of 25 mL/min; or METHOD E. a Gilson GX-281 semi-prep-HPLC with Phenomenex Gemini C18 (lOttm, 150 x 25mm), or Waters )(Bridge C18 column (51,tm, 150 x 30mm), mobile phase of 5-99%
ACN in water(lOmM NH4HCO3) over 10 min and then hold at 100% ACN for 2 min, at a flow rate of 25 mL/min.
[0367] Preparative supercritical fluid high performance liquid chromatography (SFC) was performed either on a Thar 80 Prep-SFC system, or Waters 80Q Prep-SFC system from Waters.
The ABPR was set to 100bar to keep the CO2 in SF conditions, and the flow rate may verify according to the compound characteristics, with a flow rate ranging from 50g/min to 70g/min.
The column temperature was ambient temperature.
[0368] Mass spectra (MS) were obtained on a SHIMADZU LCMS-2020 MSD or Agilent 1200\G6110A MSD using electrospray ionization (ESI) in positive mode unless otherwise indicated. Calculated (calcd.) mass corresponds to the exact mass.
[0369] Nuclear magnetic resonance (NMR) spectra were obtained on Bruker model spectrometers. Definitions for multiplicity are as follows: s = singlet, d =
doublet, t= triplet, q = quartet, dd = doublet of doublets, ddd = doublet of doublet of doublets, td = triplet of doublets, dt = doublet of triplets, spt = septet, quin = quintet, m = multiplet, br =
broad. It will be understood that for compounds comprising an exchangeable proton, said proton may or may not be visible on an NMR spectrum depending on the choice of solvent used for running the NMR spectrum and the concentration of the compound in the solution.
[0370] Chemical names were generated using ChemDraw Ultra 12.0, ChemDraw Ultra 14.0 (CambridgeSoft Corp., Cambridge, MA) or ACD/Name Version 10.01 (Advanced Chemistry).
Compounds designated as R* or S* are enantiopure compounds where the absolute configuration was not determined.
Intermediate 1: 3 -((B enzy loxy)methyl)-4-ethyl- 1H-1,2,4-tri azol-5(4H)-one.
Bn0 N
N
HN-_1 [0371] Step A. 2-(Benzyloxy)acetohydrazide.
103721 To a solution of ethyl 2-(benzyloxy)acetate (55 g, 283.17 mmol) in Et0H
(500 mL) was added NH2NH2-1-120 (28.3 g, 566 mmol, 27.5 mL). The reaction mixture was heated at 78 C
for 6 h. The reaction mixture was concentrated under reduced pressure to afford the title product (52 g, crude) as a colorless oil, which was used directly in the next step without further purification.
[0373] Step B. 3 -((B enzyl oxy)m ethyl)-4-ethy1-1H-1, 2,4-triazol -5(4H)-one.
[0374] To a solution of 2-(benzyloxy)acetohydrazide (52 g, 288 mmol) in H20 (500 mL) was added dropwise isocyanatoethane (25.1 g, 346 mmol, 27.9 mL) at 0 C. After the addition was complete, the mixture was stirred at 25 C for 12 hr. To the mixture was added H20 (20 mL), and an aqueous solution (120 mL) of NaOH (57.7 g, 1.44 mol). The mixture was stirred at 95 C for 12 hr. The reaction mixture was cooled to rt, then quenched with HC1 (12 M) at 0 C
and adjusted to "pH" 6. The solid was filtered and dried under reduced pressure to afford the title compound as a white solid (61 g, 91% yield). 1-1-1NIMR (400 MHz, CDC13) ö ¨9.23 - 9.09 (m, 1H),-7.41 - 7.31 (m, 5H),-4.58 -4.53 (m, 2H),-4.45 - 4.42 (m, 2H),-3.82 -3.75 (m, 2H),-1.33 - 1.29 (m, 3H) ppm.
Intermediate 2: 5-(((tert-Butyldiphenylsilypoxy)methyl)-4-ethyl-2,4-dihydro-3H-1,2,4-triazol-3 -one.
TBDPSO
N
I N
HN
103751 Step A. 4-Ethyl-5-(hydroxymethyl)-2,4-dihydro-3H-1,2,4-triazol-3-one.
103761 To a solution of 5-[(benzyloxy)methyl]-4-methyl-2,4-dihydro-3H-1,2,4-triazol-3-one (8 g, 34.3 mmol, 1.0 eq.) in methanol (200 mL) was added Pd/C (2 g). The resulting mixture was maintained under hydrogen and stirred at rt for 6 h. Then the resulting mixture was filtered and the filtrate was concentrated to afford the crude product 4-ethy1-5-(hydroxym ethyl)-2,4-dihydro-3H-1,2,4-triazol-3-one as a white solid (4.3 g, 88 % yield). 1H NMR
(400 MHz, DMSO-d6) 6 11.52 (s, 1H), 5.55 (t, J= 5.50 Hz, 1H), 4.32 (d, J = 5.50 Hz, 2H), 3.64 (q, J =
6.97 Hz, 2H), 1.18 (t, J= 6.97 Hz, 3H) ppm.
103771 Step B. 5-(((tert-Butyldiphenylsilypoxy)methyl)-4-ethyl-2,4-dihydro-3H-1,2,4-triazol-3 -one .
103781 To a solution of 4-ethyl-5-(hydroxymethyl)-2,4-dihydro-3H-1,2,4-triazol-3-one (3 g, 21 mmol, 1.0 eq.) in DCM (30 mL) was added tert-butylchlorodiphenylsilane (6.5 mL, 25 mmol, 1.2 eq.) and pyridine (1.86 mL, 23 mmol, 1.1 eq.). The resulting mixture was stirred at rt overnight. The reaction mixture was quenched with water (100 mL). The resulting mixture was extracted with DCM (3 x 100 mL). The organic layers were combined, dried over anhydrous sodium sulfate, filtered and concentrated. The residue was purified by silica gel chromatography (SiO2, 50-80% ethyl acetate / petroleum ether) to afford 5-(((tert-butyldiphenylsilyl)oxy)methyl)-4-ethyl-2,4-dihydro-3H-1,2,4-triazol-3-one as a white solid (4.9 g, 61 % yield). LCMS (ES-API): mass calcd. for C211-127N302Si, 381.2; m/z found, 382.2 [M-41]'. 1H NMR (400 MHz, CDC13) 6 9.98 (s, 1H), 7.61-7.72 (m, 4H), 7.32-7.54 (m, 6H), 4.54 (s, 2H), 3.84 (q, J = 7.34 Hz, 2H), 1.33 (t, J= 7.34 Hz, 311), 1.07 (s, 9H) ppm.
Intermediate 3: 5-((B enzyl oxy)m ethyl)-4-ethy1-2-(7-fluoro- 1- oxo-4-(prop-l-cn-2-y1)- 1H-i sochromen-6-y1)-2,4-dihydro-3H-1.2,4-tri azol-3- one.
Bn0 N
N
0, o if [0379] Step A. tert-Butyl 4,5-difluoro-2-iodobenzoate.
[0380] 4,5-Difluoro-2-iodobenzoic acid (3 g, 11 mmol) was dissolved in TI-IF
(30 mL), then di-tert-butyl dicarbonate (4.6 g, 21 mmol) was added followed by DMAP (645 mg, 5.3 mmol).
The reaction mixture was stirred under nitrogen at 50 C overnight, then cooled down to room temperature. The solvent was evaporated under reduced pressure. The residue was diluted with Et0Ac then washed with brine. The organic layer was separated, dried with Na2SO4, filtered, and concentrated. The residue was purified by silica column chromatography (gradient elution:
0 - 5% Et0Ac in petroleum ether) to give the title compound as a yellow oil (2.9 g, yield: 79%).
1H NMR (400 MHz, CDC13) 6 7.77 (dd, J= 10.2, 7.9 Hz, 1 H), 7.63 (dd, J= 10.2, 7.9 Hz, 1 H), 1.62 (s, 911) ppm; 19F NMR (376 'VLF-1z, CDC13) 6 -131.55 - -131.13 (m, 1 F), -136.97 - -136.65 (m, 1 F) ppm.
[0381] Step B. tert-Butyl 4-(3 -((b enzyl oxy)m ethyl)-4-ethy1-5 -ox o-4,5 -di hy dro-11-1-1,2, 4-tri azol-1-y1)-5 -fluoro-2-i odob enzoate.
[0382] A mixture of tert-butyl 4,5-difluoro-2-iodobenzoate (3.2 g, 9.4 mmol), ((b enzyl oxy)m ethyl)-4-ethy1-1H-1 ,2,4-tri azol-5(4H)-one (Intermediate 1, 2.6 g, 11.2 mmol) and Cs2CO3 (6.1 g, 18.7 mmol) in anhydrous DMF (30 mL) was stirred under nitrogen at 75 C
for 1 h, then cooled to room temperature. The mixture was filtered through a pad of Celite , and the pad was washed with Et0Ac. The filtrate was combined, washed with brine, and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 -40% Et0Ac in petroleum ether) to give the title compound as a colorless amorphous solid (5 g, yield: 96%). ESI-MS: mass calcd. for C23H25FIN304, 553.1; m/z found, 554.1 [M+Hr 1H
NMR (400 MHz, CDC13) 6 8.16 (d, J= 7.1 Hz, 1 H), 7.62 (d, J= 10.8 Hz, 1 H), 7.29 - 7.45 (m, 5 H), 4.61 (s, 2 H), 4.50 (s, 2 H), 3.84 (q, J= 7.2 Hz, 2 H), 1.63 (s, 9 H), 1.35 (t, J= 7.2 Hz, 3 H) ppm; 19F NMR (376 MHz, CDC13) 6 -119.09 (dd, J= 10.6, 7.0 Hz, 1 F) ppm.
[0383] Step C. 4-(3-((B enzyloxy)methyl)-4-ethy1-5 -oxo-4,5 -dihydro-1H-1, 2,4-triazol-1 -y1)-5-fluoro-2-iodobenzoic acid.
[0384] To a solution of tert-butyl 4-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoate (5 g, 9 mmol) in DCM (50 mL) was slowly added TFA (10 mL). The reaction mixture was stirred at room temperature overnight.
The reaction mixture was concentrated under vacuum. The obtained residue was triturated with petroleum ether at room temperature for 30 min. The mixture was filtered and the solid was rinsed with petroleum ether. The precipitate was collected and dried in yam() to give the title compound as a white solid (4.1 g, yield: 91%). ESI-MS: mass calcd. for C19H17FIN304, 497.0; m/z found, 498.0 [M-h_El] .1H NMR (400 MHz, DMSO-d6) 6 8.16 (d, J= 7.3 Hz, 1 H), 7.78 (d, J
= 11.0 Hz, 1 H), 7.28 - 7.43 (m, 5 H), 4.60 (s, 2 H), 4.57 (s, 2 H), 3.74 (q, .1 = 7.2 Hz, 2 H), 1.23 (t, J= 7.2 Hz, 3 H) ppm; 19F NMR (376 MHz, DMSO-d6) 6 -119.91 (s, 1 F) ppm.
[0385] Step D. 5-((Benzyl oxy)m ethyl )-4-ethy1-2-(7-fluoro-1-oxo-4-(prop-1 -en -2-y1)-1H-isochromen-6-y1)-2,4-dihydro-3H-1,2,4-triazol-3-one.
[0386] To a mixture of 3-methylbuta-1,2-dien-1-y1 acetate (Intermediate 12, 280 mg, 2.2 mmol), 4-(3 -((b enzyl oxy)methyl)-4-ethy1-5 -oxo-4,5-dihydro-1H-1, 2,4-tri azol-1 -y1)-5-fluoro-2-i odobenzoi c acid (1.1 g, 2.2 mmol) and Cy2N1Me (867 mg, 4.4 mmol) in DMF
(7 mL) was added Catacxium A Pd G2 (74.2 mg, 0.11 mmol) under nitrogen. The reaction mixture was stirred under nitrogen at 90 'V for overnight. The mixture was then cooled to room temperature, diluted with Et0Ac and washed with brine. The organic layer was separated and the aqueous layer was combined and extracted with Et0Ac. The combined organic layer was dried over Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 - 80% Et0Ac in petroleum ether) to give the title compound as yellow solid (240 mg, yield: 25%). ESI-MS: mass calcd. for C24H22FN304, 435.2; m/z 436.2 [M-41]+.1H
NMR (400 MHz, CDC13) 6 8.15 (d, J = 10.5 Hz, 1 H), 7.86 (d, J = 6.8 Hz, 1 H), 7.30 - 7.45 (m, 5 H), 7.19 (s, 1 H), 5.37 -5.39 (m, 1 H), 5.18 (s, 1 H), 4.62 (s, 2 H), 4.53 (s, 2 H), 3.87 (q, J = 7.1 Hz, 2H), 2.11 (s, 3 H), 1.37 (t, J= 7.2 Hz, 3 H) ppm.
Intermediate 4: 5-((Benzyloxy)methyl)-4-ethy1-2-(7-fluoro-4-isopropyl-1-oxo-1H-isochromen-6-y1)-2,4-dihydro-3H-1,2,4-triazol-3-one.
Bn0 N
I N
N,Af Method I:
[0387] Step A. 3-Methylbut-2-en- 1-yl 4,5-difluoro-2-iodobenzoate.
[0388] To the mixture of 4,5-difluoro-2-iodobenzoic acid (1.4 g, 4.9 mmol) and Cs2CO3 (4.8 g, 14.8 mmol) in anhydrous DMF (20 mL) was added 1-bromo-3-methyl-2-butene (1.5 g, 9.9 mmol). The reaction mixture was stirred at room temperature for 18 h. The mixture was diluted with water, and the mixture was extracted with DCM and Et0Ac. The combined organic extract was dried over Na2SO4, filtered and concentrated. The residue was purified by flash chromatography (SiO2, gradient elution: 10-20% Et0Ac in heptane) to give the desired product as a colorless oil (1.6 g, yield: 92%). II-INMR (400 MHz, CDC13) 6 7.80 (dd, J
=7 .58, 9.54 Hz, 1H), 7.73 (dd, .1 = 7.83, 10.76 Hz, 1H), 5.42-5.52 (m, 1H), 4.82 (d, .1 = 7.34 Hz, 2H), 1.80 (s, 3H), 1.78(s, 3H) ppm.
[0389] Step B. 3 -Methylbut-2 -en-1 -y1 4-(3 -((b enzyloxy)m ethyl)-4-ethy1-5 -oxo-4, 5-di hy dro-1H-1,2,4-triazol-1-y1)-5-fluoro-24 odobenzoate.
[0390] To a mixture of 3-methylbut-2-en- 1 -y1 4,5-difluoro-2-iodobenzoate (1.6 g, 4.5 mmol), 3-((benzyloxy)methyl)-4-ethyl-1H-1,2,4-triazol-5(4H)-one (Intermediate 1, 2.1 g, 9.1 mmol) in anhydrous DMF (25 mL) was added Cs2CO3 (2.9 g, 9.1 mmol). The reaction mixture was heated under nitrogen at 85 C for 1 h, then cooled to room temperature. The mixture was diluted with water, and the mixture was extracted with DCM and Et0Ac. The combined organic extract was dried over Na2SO4, filtered and concentrated. The residue was purified by flash chromatography (SiO2, gradient elution: 20-50% Et0Ac in heptane) to give the title compound as a white solid (2.4 g, yield: 93%). LCMS (ES-API): mass calcd. for C24H25FIN304, 565.1;
m/z found, 566.2 [M-41]". NMR (400 MHz, CDC13) 6 8.21 (d, J = 6.85 Hz, 1H), 7.73 (d, J
= 11.25 Hz, 1H), 7.29-7.44 (m, 5H), 5.41-5.53 (m, 1H), 4.84 (d, J= 7.34 Hz, 2H), 4.60 (s, 2H), 4.50 (s, 2H), 3.84 (q, J = 7.22 Hz, 2H), 1.80 (s, 3H), 1.78 (d, J= 0.98 Hz, 3H), 1.34 (t, J = 7.22 Hz, 3H) ppm.
[0391] Step C. 5-((Benzyloxy)methyl)-4-ethy1-2-(7-fluoro-44 sopropy1-1-oxo-1H-i sochrom en-6-y1)-2,4-di hy dro-3H-1,2,4-tri azol-3 -one.
[0392] To a mixture of 3 -methylbut-2-en-l-y1 4-(3 -((b enzyloxy)methyl)-4-ethy1-5 -oxo-4, 5 -dihydro-1H-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoate (4 g, 6.86 mmol, 1 eq) in toluene (200 mL) was added (tBu3P)PdG2 (351 mg, 0.69 mmol, 0.1 eq), N-cyclohexyl-N-methyl-cyclohexanamine (1.60 mL, 7.54 mmol, 1.1 eq) respectively. The reaction mixture was degassed with nitrogen for three times, and then heated under nitrogen atmosphere at 80 C for 18 h. LCMS analysis showed -18% of starting material remained. The mixture was cooled to 15 C, and additional N-cyclohexyl-N-methyl- cyclohexanamine (0.72 mL, 3.43 mmol, 0.5 eq) and tBu3PPdG2 (176 mg, 0.34 mmol, 0.05 eq) were added. The reaction mixture was degassed with nitrogen, and then heated under nitrogen atmosphere at 80 C for 16 h. The mixture was concentrated under reduced pressure, then diluted with H20 (200 mL), and extracted with Et0Ac (150 mL x 3). The combined organic layers were washed with brine (100 mL
x 2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The residue was purified by flash chromatography (SiO2, Petroleum ether/Ethyl acetate=5/1 to 3/1) to give the title compound as a yellow oil (1.1 g, yield: 35%). ESI-MS: mass calcd. for C24H24FN304, 437.2;
m/z found, 438.5 [M+H]. 1H NMR (400 MHz, CDC13) 6 8.16(d, J= 6.6 Hz, 1H), 7.96 (d, J
= 6.6 Hz, 1H), 7.42 -7.34 (m, 5H), 7.13 (s, 1H), 4.63 (s, 2H), 4.54 (s, 2H), 3.88 (dd, I= 7.2, 14.4 Hz, 2H), 3.13- 3.06(m, 1H), 1.38 ( tõI= 7.2 Hz, 3H), 1.32 (dõI = 6.8 Hz, 6H) ppm.
Method II:
103931 To a mixture of 5-((benzyloxy)methyl)-4-ethy1-2-(7-fluoro-1-oxo-4-(prop-1-en-2-y1)-1H-isochromen-6-y1)-2,4-dihydro-3H-1,2,4-triazol-3-one (Intermediate 3, 5.9 g, 13.5 mmol) in THF (100 mL) at room temperature was added Wilkinson's Catalyst [RhCl(PP103]
(3.8 g, 4.1 mmol). The mixture was degassed and purged with hydrogen gas. The reaction mixture was stirred under an atmosphere of hydrogen (15 Psi) at room temperature for 12 h.
The mixture was concentrated. The residue was purified by silica column chromatography (elution: 0 -25%
Et0Ac in petroleum ether) to give the title compound as a yellow solid (1.5 g, yield: 77%). ESI-MS: mass calcd. for C24H24FN304, 437.2; m/z found 438.2 [M-FH]+. 1H NMR (400 MHz, DMSO-d6) 6 8.10 (d, J= 10.5 Hz, 1 H), 8.01 (d, J= 7.0 Hz, 1 H), 7.46 (s, 1 H), 7.26 - 7.42 (m, H), 4.61 (s, 2 H), 4.59 (s, 2 H), 3.77 (q, J= 7.3 Hz, 2 1-1), 3.08 (dt, J=
13.4, 6.8 Hz, 1 H), 1.22 - 1.28 (m, 911) ppm; 19F NMR (376 MHz, DMSO-d6) 6 -118.29 (br s, 1 F) ppm.
Intermediate 5: 4-(3-((Benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoyl chloride.
Bn0 IN
[0394] Step A. tert-Butyl 4,5-difluoro-2-iodobenzoate.
[0395] 4,5-Difluoro-2-iodobenzoic acid (3 g, 11 mmol) was dissolved in THE (30 mL), then di-tert-butyl dicarbonate (4.6 g, 21 mmol) was added followed by DMAP (645 mg, 5.3 mmol).
The reaction mixture was stirred under nitrogen at 50 C overnight, then cooled down to room temperature. The solvent was evaporated under reduced pressure. The residue was diluted with Et0Ac then washed with brine. The organic layer was separated, dried with Na2SO4, filtered, and concentrated. The residue was purified by silica column chromatography (gradient elution:
0 - 5% Et0Ac in petroleum ether) to give the title compound as a yellow oil (2.9 g, yield: 79%).
1H NMR (400 MHz, CDC13) 6 7.77 (dd, J = 10.2, 7.9 Hz, 1 H), 7.63 (dd, J =
10.2, 7.9 Hz, 1 H), 1.62 (s, 911) ppm; 19F NMIR (376 MHz, CDC13) 6 -131.55 - -131.13 (m, 1 F), -136.97 - -136.65 (m, 1 F) ppm.
[0396] Step B. tell-Butyl 4-(3 -((b enzyloxy )m ethyl)-4-ethy1-5 -ox o-4,5 -di hy dro-11-1-1,2, 4-tri azol-1-y1)-5 -fluoro-2-iodob enzoate.
[0397] A mixture of tert-butyl 4,5-di fluoro-2-i odobenzoate (3.2 g, 9.4 mmol), 3-((benzyloxy)methyl)-4-ethy1-1H-1,2,4-triazol-5(4H)-one (Intermediate 1, 2.6 g,
[0396] Step B. tell-Butyl 4-(3 -((b enzyloxy )m ethyl)-4-ethy1-5 -ox o-4,5 -di hy dro-11-1-1,2, 4-tri azol-1-y1)-5 -fluoro-2-iodob enzoate.
[0397] A mixture of tert-butyl 4,5-di fluoro-2-i odobenzoate (3.2 g, 9.4 mmol), 3-((benzyloxy)methyl)-4-ethy1-1H-1,2,4-triazol-5(4H)-one (Intermediate 1, 2.6 g,
11.2 mmol) and Cs2CO3 (6.1 g, 18.7 mmol) in anhydrous DMF (30 mL) was stirred under nitrogen at 75 C
for 1 h, then cooled to room temperature. The mixture was filtered through a pad of Celite , and the pad was washed with Et0Ac. The filtrate was combined, washed with brine, and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 -40% Et0Ac in petroleum ether) to give the title compound as a colorless amorphous solid (5 g, yield: 96%). ESI-MS: mass calcd. for C23H25FIN304, 553.1; m/z found, 554.1 [M+H]t 1H
NMR (400 MHz, CDC13) 6 8.16 (d, J = 7.1 Hz, 1 H), 7.62 (d, J = 10.8 Hz, 1 H), 7.29 - 7.45 (m, 5 H), 4.61 (s, 2 H), 4.50 (s, 2 H), 3.84 (q, J= 7.2 Hz, 211), 1.63 (s, 9H), 1.35 (t, J = 7.2 Hz, 3 H) ppm; 19F NMR (376 MHz, CDC13) 6 -119.09 (dd, J= 10.6, 7.0 Hz, 1 F) ppm.
[0398] Step C. 4-(34(Benzyloxy)methyl)-4-ethyl-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoic acid.
[0399] To a solution of tert-butyl 4-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-111-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoate (5 g, 9 mmol) in DCM (50 mL) was slowly added TFA (10 mL). The reaction mixture was stirred at room temperature overnight.
The reaction mixture was concentrated under vacuum. The obtained residue was triturated with petroleum ether at room temperature for 30 min. The mixture was filtered and the solid was rinsed with petroleum ether. The precipitate was collected and dried in vacuo to give the title compound as a white solid (4.1 g, yield: 91%). ESI-MS: mass calcd. for C191117FIN304, 497.0; m/z found, 498.0 [M Hr.1H NMR (400 MHz, DMSO-d6) 6 8.16 (d, J= 7.3 Hz, 111), 7.78 (d, J =
11.0 Hz, 1 H), 7.28 - 7.43 (m, 5 H), 4.60 (s, 2 H), 4.57 (s, 2 H), 3.74 (q, J= 7.2 Hz, 2 H), 1.23 (t, J
= 7.2 Hz, 3 H) ppm; 19F NMR (376 MHz, DMSO-d6) 6 -119.91 (s, 1 F) ppm.
[0400] Step D. 4-(34(Benzyloxy)methyl)-4-ethyl-5-oxo-4,5-dihydro-1H-1.,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoyl chloride.
[0401] A solution of 4-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoic acid (3.5 g, 7 mmol) in SOC12 (14 mL) was heated at reflux for 15 min. The reaction mixture was cooled to room temperature and concentrated. To the residue was added anhydrous toluene, then the mixture was evaporated to give the crude product as a yellow gum (3.6 g), which was directly used for the next step without further purification.
Intermediate 6: 2-Chloro-6-fluoro-N-(3-methylpent-2-en-1-yl)aniline.
CI
[0402] Step A. Ethyl 3-methylpent-2-enoate.
[0403] To a solution of 2-butanone (52 g, 717.6 mmol) and (carbethoxymethylene) triphenylphosphorane (50 g, 143.5 mmol) in toluene (65 mL) was added benzoic acid (3.5 g, 28.7 mmol). The reaction mixture was heated at reflux for 16 h. The mixture was diluted with petroleum ether and filtered through a short pad of silica gel. The silica gel was washed with hexane. The filtrate was concentrated under reduced pressure at 0-2 C. The residue was purified by silica column chromatography (elution: 0 - 10% Et0Ac in petroleum ether) to give the title compound as a colorless liquid (23.3 g crude). 1-fl NMR (400 MHz, CDC13) 6 5.58 -5.69 (m, 1 H), 4.13 (qd, J= 7.1, 4.9 Hz, 2 H), 2.62 (q, J= 7.5 Hz, 1 H), 2.09 -2.20 (m, 3 H), 1.86 (d, J= 1.2 Hz, 1 H), 1.24- 1.28 (m, 3 H), 1.01 - 1.09 (m, 3 H) ppm.
[0404] Step B. 3-Methylpent-2-en-1 -ol.
[0405] To a toluene solution (1 M) of DIBAL-H (118 mL, 118 mmol) at -78 C was added a toluene solution (40 mL) of ethyl 3-methylpent-2-enoate (20 g crude) dropwise under nitrogen.
The reaction mixture was stirred at -78 'V for 2 h. The mixture was warmed to room temperature and slowly poured into saturated aqueous potassium sodium tartrate solution at 0 C. The mixture was stirred for 2 h and filtered through a short pad of Celite . The pad was washed with DC1V1/Et0Ac (v/v, 3/1), and the filtrate was extracted with DCM.
The organic extract was separated, dried over Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (elution: 0 - 100% DCM in petroleum ether, then 0 - 30%
Et0Ac in DCM) to give the title compound as a colorless liquid (7 g, yield of two steps: 57%).
1I-1 NM:ft (400 MiElz, CDC13) 6 5.35- 5.46(m, 1 H), 4.11 - 4.21 (m, 2 H), 2.02 - 2.13 (m, 2 H), 1.67- 1.76 (m, 311), 0.98 - 1.06 (m, 3 H) ppm.
[0406] Step C. 3-Methylpent-2-enal.
[0407] To a solution of 3-methylpent-2-en-1-ol (2 g, 20.0 mmol) in DCM (20 mL) was added Dess-martin periodinane (10 g, 24.0 mmol). The reaction mixture was stirred at room temperature for 1 h. The mixture was filtered through a short pad of Centel.
The pad was washed with DCM. The combined filtrate was washed with saturated aqueous NaHCO3 solution.
The organic layer was separated, dried over Na2SO4, filtered and concentrated under reduced pressure at 0 - 2 'C. The crude was purified by silica column chromatography (elution: DCM) to give the title compound as a colorless liquid (1.5 g, yield: 77%). 1H NMR
(400 MHz, CDC13) 6 9.91 - 10.04 (m, 1 H), 5.78 - 5.90 (m, 1 H), 2.58 (q, J= 7.6 Hz, 1 H), 2.23 (d, J= 7.3 Hz, 1 H), 2.16 (s, 2 H), 1.96 (dõI = 1.1 Hz, 1 H), 1.16 (tõI = 7.6 Hz, 1 H), 1.09 (tõI = 7.4 Hz, 2 H) PPm -[0408] Step D. N-(2-Chloro-6-fluoropheny1)-3-methylpent-2-en-1-imine.
[0409] To a mixture of 2-chloro-6-fluoroaniline (1.2 g, 8.2 mmol) and 3-methylpent-2-enal (0.97 g, 9.9 mmol) in DCM (18 mL) under nitrogen at 0 C was added triethylamine (4.6 mL, 33 mmol), followed by the addition of a DCM solution (1 M) of TiC14 (5 mL, 5 mmol) dropwise.
The resulting mixture was stirred at 0 C for 1 h, then warmed to room temperature and stirred for 4 h. The mixture was poured into saturated aqueous NH4C1 solution. The mixture became cloudy and filtered through a pad of Celite . The pad was washed with Et0Ac.
The combined filtrate was diluted with DCM and water. The organic layer was separated, and aqueous layer was extracted with DCM. The combined organic layers were washed with brine, dried over Na2SO4, filtered and concentrated. The residue product was purified by silica gel column chromatography (gradient elution: 0 - 5% DCM in petroleum ether) to give the title compound as a pale yellow oil (1.3 g, yield: 70%).
[0410] Step E. 2-Chl oro-6-fluoro-N -(3 -methylp ent-2 -en-1 -yl)aniline.
[0411] To a solution of N-(2-chloro-6-fluoropheny1)-3 -methyl pent-2-en-1 -imine (1.3 g, 5.76 mmol) in Me0H (20 mL) was added NaBH4 (218 mg, 5.8 mmol), and after 1 h, another batch of NaBH4 (218 mg, 5.8 mmol) was added. A total of NaBH4 (1.1 g, 29 mmol) was added. The reaction mixture was stirred at room temperature overnight. The mixture was concentrated, and then diluted with water and extracted with Et0Ac. The organic layer was separated, washed with brine, dried over Na2SO4, filtered and concentrated. The residue was purified by combi flash column chromatography over silica gel (eluent: 0 - 5% DCM in petroleum ether) to give the title compound as a yellow oil (430 mg, yield: 33%). 1H NM:1Z (400 MHz, CDC13) 6 6.95 -7.02 (m, 1 H), 6.84 (ddd, J = 12.2, 8.3, 1.3 Hz, 1 H), 6.52 - 6.63 (m, 1 H), 5.17 -5.28 (m, 1 H), 3.85 (d, J= 5.6 Hz, 2 H), 3.73 (s, 1 H), 1.91 -2.07 (m, 2 H), 1.58 - 1.68 (m, 3 H), 0.89 - 0.96 (m, 3 H).
Intermediate 7: 5-Chloro-3-methy1-1-(tetrahydro-2H-pyran-2-y1)-1H-pyrazol-4-amine.
THP
[0412] Step A. 5-Chloro-3-methy1-4-nitro-1-(tetrahydro-2H-pyran-2-y1)-1H-pyrazole.
[0413] To a solution of 3-methyl-4-nitropyrazole (2 g, 15.7 mmol) in Et0Ac (20 mL) was added DHP (2 g, 23.6 mmol) and Ts0H.H20 (150 mg, 0.79 mmol) at room temperature. The mixture was stirred at room temperature for overnight. Et3N (0.4 mL) was added and the mixture was washed with brine. Then the organic layer was separated, dried over anhydrous Na2SO4, filtered and concentrated. The residue was dissolved in THE (45 mL) and the temperature was lowered to -78 C. A THF (1 M) solution of LiHMDS (10.6 mL, 13.8 mmol) was added to the mixture under nitrogen. After 45 minutes at -78 C, the solution of hexachloroethane (8.9 g, 37.8 mmol) in THE (20 mL) was added dropwise. The reaction mixture was warmed to room temperature and stirred for overnight. The mixture was poured into saturated aqueous NTI4C1 solution and extracted with Et0Ac. The organic phase was separated, washed with brine, dried over anhydrous Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 -40% Et0Ac in petroleum ether) to give the title compound as white solid (1.8 g, yield:
58%). 1H NAAR (400 MHz, CDC13) 6 5.52 (dd, J = 10.0, 2.7 Hz, 1 H), 4.07 - 4.15 (m, 1 H), 3.70 (td, J = 11.3, 2.8 Hz, 1 H), 2.57 (s, 3 H), 2.37 - 2.47 (m, 1 H), 2.11 -2.19 (m, 1 H), 1.86- 1.90 (m, 1 H), 1.72 -1.75 (m, 1 H), 1.64 (d, J= 2.0 Hz, 1 H), 1.53 (d, J= 6.6 Hz, 1 H) ppm.
[0414] Step B. 5 -C hl oro-3 -methyl-1 -(tetrahy dro-2H-pyran-2-y1)-1H-pyrazol-4-ami ne.
[0415] To a mixture of 5 -chl oro-3 -methyl -4-nitro-1 -(tetrahy dro-2H-pyran-2-y1)-1H-pyrazol e (100 mg, 0.4 mmol) in Me0H/THF/H20 (v/v/v, 1/1/1, 3 mL) was added iron powder (114 mg, 2.0 mmol) and NH4C1 (109 mg, 2.0 mmol). The mixture was stirred at 70 "V for 1.5 h. The mixture was cooled to room temperature and filtered through a pad of Celite.
The pad was washed with Et0Ac. The combined filtrate was washed with saturated aqueous NaHCO3 solution. The organic layer was separated, and the aqueous layer was extracted with Et0Ac.
The combined organic extract was washed with brine, dried over anhydrous Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution:
0 - 50% Et0Ac in petroleum ether) to give the title compound as a yellow oil (70 mg, yield:
79%). ESI-MS: mass calcd. for C9H14C1N30, 215.1; m/z found, 216.1 [M+H].
Intermediate 8: 3 -(2-((tert-Butyl diphenyl silyl)oxy)ethoxy)-2-chloroaniline.
Sc' TBDPS
[0416] Step A. tert-Butyl (2-(2-chl oro-3 -nitrophenoxy) eth oxy)diphenyl silane .
[0417] To a mixture of 2-chloro-3-nitrophenol (200 mg, 1.2 mmol), 2-((tert-butyldiphenylsilyl)oxy)ethan-1 -ol (554 mg, 1.8 mmol) and PPh3 (453 mg, 1.7 mmol) in TT-IF
(10 mL) was added DEAD (281 mg, 161 mmol) at 0 C under nitrogen. The mixture was warmed to room temperature and stirred at room temperature for 12 h. Saturated aqueous NH4C1 solution was added, and the mixture was extracted with Et0Ac. The organic was separated, washed with brine, dried over anhydrous Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 -10% Et0Ac in petroleum ether) to give the title compound as a yellow oil (240 mg, yield:
46%). 1H NAIR (400 MHz, CDC13) 6 7.72 (dd, J = 7.8, 1.5 Hz, 4 H), 7.35 - 7.49 (m, 7 H), 7.30 (t, J = 8.2 Hz, 1 H), 7.12 (dd, J= 8.3, 1.2 Hz, 1 H), 4.20 - 4.25 (m, 2 H), 4.06 (t, J= 4.9 Hz, 2 H), 1.06 (s, 9 H) ppm.
[0418] Step B. 3-(2-((tert-Butyldiphenylsilyl)oxy)ethoxy)-2-chloroaniline.
[0419] To a mixture of tert-buty1(2-(2-chloro-3-nitrophenoxy)ethoxy)diphenylsilane (220 mg, 0.5 mmol), NH4C1 (258 mg, 4.8 mmol) in THE (3 mL), Me0H (3 mL) and H20 (3 mL) was added iron powder (269 mg, 4.8 mmol). The reaction mixture was stirred at 70 C for 2 h. The mixture was cooled to room temperature, diluted with Et0Ac, and filtered through a pad of Celite . The Celite was washed with Et0Ac. The combined filtrate was washed with brine, dried over Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 - 11% Et0Ac in petroleum ether) to give the title compound as a yellow solid (192 mg, yield: 92%). ESI-MS: mass calcd. for C24H28C1NO2Si, 425.2; m/z found, 426.1[M+H]t 1H NMR (400 MHz, CDC13) 6 7.75 (dd, J= 7.9, 1.6 Hz, 4H), 7.35 - 7.48 (m, 6H), 6.97 (t, J= 8.1 Hz, 1 H), 6.42 (dd, J = 8.2, 1.1 Hz, 1 H), 6.33 (dd, J = 8.2, 1.1 Hz, 1 H), 4.13 - 4.17 (m, 2H), 4.07 - 4.13 (m, 2 H), 4.01 -4.06 (m, 2 H), 1.06 (s, 9 H) ppm.
Intermediate 9: 5-((B enzyloxy)m ethyl)-4-ethy1-2-(7-m ethyl -1 -oxo-4-(prop-1-en-2-y1)-1H-i sochromen-6-y1)-2,4-dihydro-3H-1,2,4-tri azol -3- one.
Bn0 0,1f [0420] Step A. tert-Butyl 2-bromo-4-fluoro-5-methylbenzoate.
[0421] To a solution of 2-bromo-4-fluoro-5-methylbenzoic acid (1 g, 4.3 mmol) in TI-IF (10 mL) was added (Boc)20 (1.9 g, 8.6 mmol), followed by the addition of DMAP (262 mg, 2.1 mmol). The reaction mixture turned orange and was stirred under nitrogen at 50 C for overnight. The mixture was cooled to room temperature, diluted with Et0Ac, and then washed with brine. The organic layer was separated, dried over Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (elution: 0 - 3% Et0Ac in petroleum ether) to give the title compound as colorless oil (900 mg, yield: 72%). 1H
NMIt (400 MHz, CDC13) 6 7.57 (d, J= 8.1 Hz, 1 H), 7.24 (d, J= 4.6 Hz, 1 H), 2.22 (d, J= 1.5 Hz, 3 H), 1.58 (s, 9 H) ppm.
[0422] Step B. tert-Butyl 4-(3 -((b en zyl oxy)m ethyl)-4-ethyl-5 -ox o-4,5 -di hydro-1H-1,2, 4-tri azol-1-y1)-2 -bromo-5-methylbenzoate.
[0423] A mixture of tert-butyl 2-bromo-4-fluoro-5-methylbenzoate. (750 mg, 2.6 mmol), 5-((benzyloxy)methyl)-4-ethy1-2,4-dihydro-3H-1,2,4-triazol-3-one (800 mg, 3.4 mmol) and Cs2CO3 (1.7 g, 5.2 mmol) in DMF (8 mL) was stirred at 90 C for 16 h. The reaction was quenched by the addition of aqueous saturated N1H4C1 solution. The mixture was extracted with Et0Ac. The organic layer was separated, washed with brine, dried over Na2SO4, filtered and concentrated. The residue was purified by combi-flash chromatography (SiO2, eluent: 0 - 22%
Et0Ac in petroleum ether) to give the title compound as colorless gum (1 g, yield: 71%). ESI-MS: mass calcd. for C24H28BrN304, 501.1; m/z found, 502.1 [M+H]t 1H NAIR (400 MHz, CDC13) 6 7.64 (d, J= 6.1 Hz, 2 H), 7.33 - 7.43 (m, 5 H), 4.61 (s, 2 H), 4.50 (s, 2 H), 3.85 (qõI
= 7.3 Hz, 2 H), 2.31 (s, 3 H), 1.62 (s, 9 H), 1.36 (t, J= 7.2 Hz, 3 H) ppm.
[0424] Step C. 4-(34(Benzyloxy)methyl)-4-ethyl-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-bromo-5-methylbenzoic acid.
[0425] To a mixture of tert-butyl 4-(3 -((b enzyl oxy)methyl)-4-ethy1-5 -oxo-4, 5 -di hy dro-1H-1,2,4-triazol-1-y1)-2-bromo-5-methylbenzoate (500 mg, 0.90 mmol) in DCM (5 mL) was added TFA (1 mL). The mixture was stirred at room temperature for 12 h. The mixture was concentrated. The residue was dissolved with DCM, and petroleum ether was added slowly.
The mixture was stirred at room temperature for 30 min. The mixture was filtered, and the precipitate was rinsed with petroleum ether. The solid was collected and dried in vacuo to give the title compound as a white solid (360 mg, yield: 86%). ESI-MS: mass calcd.
for C201-120BrN304, 445.1; m/z found, 446.0 [M+H] . 1H NMR (400 MHz, DMSO-d6) 6 7.77 (s, 1 H), 7.70 (s, 1 H), 7.29 -7.41 (m, 5 H), 4.59 (s, 2 H), 4.56 (s, 2 H), 3.74 (q, J= 7.0 Hz, 2 H), 2.24 (s, 3 H), 1.23 (t, J= 7.2 Hz, 3 H) ppm.
[0426] Step D. 5 -((B enzyl oxy)methyl)-4-ethy1-2 -(7-methyl- 1 -oxo-4-(prop-1 -en-2-y1)-1H-isochromen-6-y1)-2,4-dihydro-3H-1,2,4-triazol-3-one.
[0427] To a mixture of 4-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-triazol--y1)-2-bromo-5-methylbenzoi c acid (560 mg, 1.26 mmol), 3-methyl buta-1,2-di en-l-yl acetate (Intermediate 12, 1.58 g, 12.5 mmol), AcOK (369 mg, 3.76 mmol) and TBAB (809 mg, 2.51 mmol) in DMF (3.9 mL) under nitrogen was added Pd(OAc)2 (141 mg, 0.63 mmol).
The reaction mixture was stirred under nitrogen at 90 C for overnight. The mixture was cooled to room temperature, diluted with Et0Ac, and washed with brine. The organic layer was separated, and the aqueous layer was extracted with Et0Ac. The combined organic layers were combined, dried over Na2SO4, filtered, and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 - 70% Et0Ac in petroleum ether) to give the title compound as a yellow solid (410 mg, yield: 73%). ESI-MS: mass calcd. for C25H25N304, 431.2;
m/z found, 432.1 [M+H] . 1H NIVIR (400 MHz, CDC13) 6 8.28 (s, 1 H), 7.59 (s, 1 H), 7.31 -7.46 (m, 5 H), 7.17 (s, 1 H), 5.30 - 5.37 (m, 1 H), 5.15 (s, 1 H), 4.63 (s, 2 H), 4.52 (s, 2 H), 3.87 (q, 1=7.1 Hz, 2 H), 2.46 (s, 3 H), 2.10 (s, 3 IT), 1.38 (t, = 7.2 Hz, 31-1) ppm.
Intermediate 10: Isopropyl 6-(3 -((benzyloxy)methyl)-4-ethyl-5-oxo-4, 5-dihy dro-1H-1, 2,4-tri azol-1-y1)-2-chl oro-5 -fl uoroni coti nate.
/--OBn CI N
reA
\r0 [0428] Step A. 2,6-Dichloro-5-fluoronicotinoyl chloride.
[0429] To a solution of 2,6-dichloro-5-fluoronicotinic acid (20 g, 95 mmol) in THF (200 mL) was added (C0C1)2 (12.7 g, 10.0 mmol) and DMF (69.6 mg, 0.952 mmol) at 0 C
dropwise.
The mixture was stirred at 0 C for 30 min, then warmed to 25 C, and stirred for 1 h. The reaction mixture was concentrated under reduced pressure to afford desired product (21.7 g, crude) as a colorless oil, which was used without further purification.
[0430] Step B. Isopropyl 2,6-dichloro-5-fluoronicotinate.
[0431] To a mixture of propan-2-ol (8.56 g, 142 mmol, 10.9 mL) and pyridine (9.02 g, 114 mmol) in THF (200 mL) was added a solution of 2,6-dichloro-5-fluoronicotinoyl chloride (21.7 g, 96.0 mmol) in THF (50 mL) at 0 C. The mixture was stirred at 25 C for 1 h. The mixture was poured into water (300 mL). The aqueous phase was extracted with ethyl acetate (300 mL).
The combined organic phase was dried with anhydrous Na2SO4, filtered and concentrated. The residue was purified by column chromatography (SiO2, Petroleum ether/Ethyl acetate=1/1 to 10:1) to afford the title compound (21 g, 86.82% yield). MS (ESI): mass calcd.
for C9H8C12FN02, 250.1; m/z found, 252.0 [M+H]+. 1H NMR (400 MHz, CDC13) 6 7.97 -7.95 (d, J= 7.2 Hz, 1H), 5.32 - 5.25 (m, 1H), 1.58 - 1.39 (in, 6H) ppm.
[0432] Step C. Isopropyl 6-(3-((benzyloxy)methyl)-4-ethyl-5-oxo-4,5-dihydro-1H-1,2,4-tri azol-1-y0-2 -chloro-5 -fl uoroni cotinate.
[0433] To a mixture of isopropyl 2,6-dichloro-5-fluoronicotinate (4 g, 15.87 mmol) in DMSO
(40 mL) was added 3-((benzyloxy)methyl)-4-ethyl-1H-1,2,4- triazol-5(4H)-one (3.89 g, 16.66 mmol) and K2CO3 (3.29 g, 23.80 mmol). The mixture was stirred at 80 C for 3 hr. LCMS
showed the starting material was consumed and desired mass was detected. The mixture was diluted with H20 (30 mL) and extracted with Et0Ac (50 mL x 3). The combined organic layers were washed with brine (100 mL), dried over Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, Petroleum ether/Ethyl acetate=1/0 to 1:1) to afford the title compound (5.7g, 79.86% yield). MS
(ESI): mass calcd.
for C21H22C1FN404, 448.1; m/z found, 449.2 [M+H]+. 1H NMR (400 MHz, CDC13) 6 8.10 (d, J= 8.8 Hz, 1H), 7.43 - 7.31 (m, 5H), 5.30 (td, J= 6.3, 12.5 Hz, 1H), 4.61 (s, 2H), 4.54 (s, 2H), 3.85 (q, J= 7.2 Hz, 2H), 1.41 (d, J= 6.2 Hz, 6H), 1.37 - 1.31 (m, 3H) ppm.
Intermediate 11: 5-((B enzyl oxy)m ethyl)-4-ethy1-2-(7-fluoro-3 -hy droxy-4-i sopropy1-1-oxoi sochrom an-6-y1)-2,4- di hy dro-3H-1,2,4-tri azol-3 -one.
Fy N N OH
Bn0 [0434] Step A. Methyl 4-(3-((benzyl oxy)methyl)-4-ethyl -5-oxo-4, 5-di hydro-1H-1,2,4-tri azol -1-y1)-2-bromo-5-fluorobenzoate.
[0435] To a flask charged with methyl 2-bromo-4,5-difluorobenzoate (100.0 g, 398 mmol), 5-((b enzyl oxy)m ethyl)-4-ethy1-2,4-dihy dro-3H-1,2,4-tri azol-3 -one (Intermediate 1, 113.5 g, 508 mmol) and K2CO3 (100.0 g, 724 mmol) was added anhydrous DNIF (1000 mL). The reaction mixture was heated under nitrogen at 50 C for 16 h, and then additional 5-((benzyloxy)methyl)-4-ethy1-2,4-dihydro-3H-1,2,4-triazol-3-one (11 g, 51 mmol) was added.
The reaction mixture continued to be stirred at 50 C. The mixture was cooled to room temperature and stirred for 10 min. Water (1000 mL) was added dropwise, and the mixture was stirred at room temperature for 2 h. The precipitate was collected by filtration and dried to give the crude product (190 g). The product was stirred in DMF (500 mL) for 30 min, then water (500 mL) was added. The mixture was stirred for 2 h. The precipitate was collected by filtration and dried to give the title compound (180 g, yield: 90%). 1H NMR (300 MHz, CDC13) 6 7.95 (d, J= 6.7 Hz, 1H), 7.73 (d, J= 10.7 Hz, 1H), 7.44-7.27 (m, 5 H), 4.60 (s, 2 H), 4.50 (s, 2 H), 3.95 (s, 3H), 3.84 (q, .1 = 7.2 Hz, 2 H), 1.34 (t, .1 = 7.2 Hz, 3 H) ppm.
[0436] Step B. 5 -((B enzyl oxy)methyl)-4-ethy1-2-(7-fluoro-3 -hydroxy -4-i sopropy1-1-oxoi sochrom an-6 -y1)-2,4-di hy dro-3H-1, 2,4-tri azol-3 -one.
[0437] To a mixture of methyl 4-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-bromo-5-fluorobenzoate (30 g, 65.9 mmol), Xantphos (4.02 g, 6.6 mmol), [Pd(ally1)C1]2 (1.38 g, 3.77 mmol), Cs2CO3 (42.6 g, 130 mmol) in dimethylacetamide (300 mL) was added 3-methylbutanal (41.4 mL, 386 mmol) slowly. The reaction mixture was heated under nitrogen at 80 C for 22 h. The mixture was filtered and quenched with aqueous NU1IC1 solution until "pH" turned 7-8. The mixture was extracted with ethyl acetate (2000 mL x2). The combined organic extract was concentrated. The residue was purified by column chromatography (SiO2, gradient elution: 1-33% ethyl acetate in petroleum ether) to give the title compound as an oil (61.7 g, yield: 56%). 111 NMIR (300 1V111z, CDC13) 6 7.93 (d, J = 10.4 Hz, 1H), 7.55 (d, J= 6.7 Hz, 1H), 7.44-7.28 (m, 5H), 5.92 (s, 1H), 4.61 (s, 2H), 4.51 (s, 2H), 4.37 (br s, 1H), 3.85 (q, J = 7.2 Hz, 2H), 2.80 (d, J= 7.1 Hz, 1H), 1.92 (spt, J= 6.8 Hz, 1H), 1.35 (t, J= 7.2 Hz, 3H), 1.05 (d, J= 6.8 Hz, 3H), 0.93 (d, 1= 6.8 Hz, 3H) ppm.
Intermediate 12: 3 -Methylbuta-1,2-di en-1 -y1 acetate.
[0438] Step A. 2-Methylbut-3-yn-2-y1 acetate.
[0439] To a mixture of Mg(C104)2 (796 mg, 3.6 mmol) in acetic anhydride (38 g, 371 mmol) at 0 C was added 2-methyl-3-butyn-2-ol (30 g, 357 mmol) dropwise. The reaction mixture was stirred at 0 'V for 10 min, then warmed to room temperature and stirred for overnight. The reaction mixture was diluted with DCM, then washed with aqueous saturated NaHCO3 solution and aqueous saturated Na2CO3 solution. The organic layer was separated, dried over Na2SO4, filtered and concentrated at 0 C. The residue was purified by silica column chromatography (elution: DCM) to give the title compound as pale yellow oil (35.8 g, yield:
80%). 1H NMR
(400 MHz, CDC13) 5 2.54 (s, 1 H), 2.03 (s, 3 H), 1.67 (s, 6 H) ppm.
[0440] Step B. 3-Methylbuta-1,2-dien-1 -y1 acetate.
[0441] To a solution of 2-methylbut-3-yn-2-y1 acetate (2.5 g, 20 mmol) in DCM
(20 mL) was added AgBF4 (117 mg, 0.6 mmol) under nitrogen. The resulting colorless solution was stirred under nitrogen at 35 C for 2 h until the mixture turned into a black solution. The mixture was washed with aqueous ammonia (10%). The organic layer was separated, and the aqueous layer was extracted with DCM. The combined organic layer was dried over Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 ¨
3% Et0Ac in petroleum ether) to give the title compound as yellow oil (650 mg, yield: 26%).
1H NMR (400 MHz, CDC13) 5 7.20 (dt, J= 4.1, 2.0 Hz, 1 H), 2.11 (s, 3 H), 1.81 (d, J= 2.0 Hz, 6 H) ppm.
Example 22 of PCT/IB2020/053601 (which published as WO 2020/212897 on October 22, 2020) discloses 6-(4-Ethyl-3-(hydroxym ethyl)-5-oxo-4,5-di hydro- 1H-1,2,4-tri azol -1-y1)-7-fluoro-4-isopropy1-2-(o-tolyl)isoquinolin-1(2H)-one (Compound 22).
HO
1tII
Ns-2 N
[0442] Step A. 6-(3-((Benzyloxy)methyl)-4-ethyl-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropyl-2-(o-tolypisoquinolin-1(2H)-one.
[0443] To a mixture of 5-((benzyloxy)methyl)-4-ethy1-2-(7-fluoro-3-hydroxy-4-isopropyl-1-oxoisochroman-6-y1)-2,4-dihydro-3H-1,2,4-triazol-3-one (Intermediate 11, 56 g, 123 mmol) in AcOH (160 mL) was added o-toluidine (14.8 g, 138 mmol). The reaction mixture was heated at 80 C for 16 h. The mixture was concentrated, and then the -pH- was adjusted to 7-8 with aqueous NaHCO3 solution. The mixture was extracted with ethyl acetate (160 mL
x2). The combined organic extract was concentrated. The residue was purified by flash chromatography (SiO2, 0-20% Ethyl acetate in DCM) to give the title compound as an oil (32.5 g, yield: 50%).
MS (ESI): mass calcd. for C311-131FN403, 526.2; m/z found, 527.4 [M-F1-1] .
NMR (300 MHz, CDC13) 6 8.33 (d, J = 10.9 Hz, 1H), 8.07 (d, J = 6.8 Hz, 1H), 7.44-7.27 (m, 9H), 6.84 (s, 1H), 4.64 (s, 2H), 4.55 (s, 2H), 3.89 (q, J= 7.2 Hz, 2H), 3.23 (spt, J= 6.8 Hz, 1H), 2.16 (s, 3H), 1.39 (t, J= 7.2 Hz, 3H), 1.31 (dd, J= 6.8, 2.1 Hz, 6H) ppm.
[0444] Step B. 6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(o-toly1)isoquinolin-1(2H)-one.
[0445] To a stirred solution of 6-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-tri azol sopropy1-2-(o-tol yl)i soquinolin-1(2H)-one (26. 5 g, 50.3 mmol) in DCM (230 mL) at -78 C was added a DCM solution (1 M) of BC13 (290 mL, 290 mL) under nitrogen. The reaction mixture was stirred at 15 C for 0.5 h. The reaction was quenched by Me0H (100 mL) at -78 C to -20 C. The mixture was partitioned between water and DCM. The organic layer was separated, and the aqueous layer was extracted with DCM (110 mL x 2). The combined organic extract was washed with brine (30 mLx2), dried with anhydrous Na2SO4, filtered, and concentrated to give a crude product (27.5 g). The product was triturated with methyl ethyl ketone (82 mL) and heptane (290 mL) to give a pure product (17.5 g), which was re-crystallized in ethanol and water to give the title compound as a white solid (16 g, yield:
73%). MS (ESI): mass caled. for C24H25FN403, 436.2; m/z found, 437.2 [M+Hr 11-INMR (400 MHz, CDC13) 6 8.33 (d, J = 11.2, 1 H), 8.08 (d, 1= 6.8, 1 7.39-7.33 (m, 3 H), 7.28 (s, 1 H), 6.85 (s, 1 H), 4.69 (br s, 2 H), 3.94 (q, J= 7.11 Hz, 2 H), 3.27 (td, J=
13.66, 6.82 Hz, 1 H), 2.32 (br s, 1 H), 2.17 (s, 3 H), 1.45 (t, J = 7.11 Hz, 3 H), 1.32 (dd, J =
6.82, 1.83 Hz, 6 H) ppm.
[0446] It is noted that compounds of Formula (Z) described herein are described in PCT/IB2020/053601 (which published as WO 2020/212897 on October 22, 2020), which is incorporated by reference herein, in its entirety for all purposes.
[0447] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent.
[0448] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a hypomethylating agent.
[0449] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a hypomethylating agent.
[0450] According to embodiments, the hypomethylating agent is azacitidine, decitabine, or pharmaceutically acceptable salts or solvates thereof.
[0451] According to particular embodiments, the hypomethylating agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0452] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof and a BCL-2 inhibitor.
[0453] In some embodiments, provided is a combination therapy consisting of a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof and a BCL-2 inhibitor.
[0454] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0455] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0456] In some embodiments, provided is a combination therapy comprising Compound Al and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0457] In some embodiments, provided is a combination therapy comprising Compound A2 and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0458] In some embodiments, provided is a combination therapy comprising Compound A3 and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0459] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0460] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0461] In some embodiments, provided is a combination therapy comprising Compound A4 and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0462] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0463] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof, and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0464] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof [0465] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof [0466] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0467] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0468] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0469] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0470] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0471] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0472] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof, and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0473] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0474] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0475] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0476] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0477] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0478] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0479] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0480] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0481] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0482] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0483] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof [0484] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof [0485] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0486] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0487] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0488] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0489] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DNA intercalating agent.
[0490] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DNA intercalating agent [0491] According to embodiments, the DNA intercalating agent is an anthracycline.
[0492] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an anthracycline.
[0493] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an anthracycline.
[0494] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0495] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0496] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0497] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0498] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0499] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0500] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0501] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a pyrimidine analog [0502] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a pyrimidine analog.
[0503] According to embodiments, the pyrimidine analog is cytarabine.
[0504] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is cytarabine.
[0505] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is cytarabine [0506] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0507] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0508] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0509] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0510] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0511] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0512] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine [0513] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a purine analog.
[0514] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a purine analog.
[0515] According to embodiments, the purine analog is fludarabine.
[0516] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is fludarabine [0517] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is fludarabine [0518] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0519] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0520] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0521] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0522] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0523] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0524] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0525] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an IDH inhibitor.
[0526] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an isocitrate dehydrogenase-1 inhibitor (e.g., ivosidenib) [0527] According to embodiments, the IDH inhibitor is ivosidenib.
[0528] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ivosidenib [0529] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ivosidenib.
[0530] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0531] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0532] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0533] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib [0534] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0535] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0536] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0537] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an isocitrate dehydrogenase-2 inhibitor (e.g., enasidenib).
[0538] According to embodiments, the 1DH inhibitor is enasidenib.
[0539] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is enasidenib.
[0540] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is enasidenib.
[0541] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib [0542] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib.
[0543] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib.
[0544] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib.
[0545] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib [0546] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib.
[0547] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib.
[0548] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an immunomodulatory antineoplastic agent.
[0549] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an immunomodulatory antineoplastic agent which is a PD-1 inhibitor.
[0550] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an immunomodulatory antineoplastic agent.
[0551] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an immunomodulatory antineoplastic agent which is a PD-1 inhibitor.
[0552] According to embodiments, the immunomodulatory antineoplastic agent is nivolumab, atezolizumab, pembrolizumab, thalidomide, lenalidomide, pomalidomide, Bacillus Calmette¨
Guerin (BCG) or levamisole.
[0553] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is nivolumab.
[0554] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is nivolumab.
[0555] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab.
[0556] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab.
[0557] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab.
[0558] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab [0559] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab.
[0560] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab.
[0561] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab [0562] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is atezolizumab.
[0563] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is atezolizumab [0564] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0565] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0566] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0567] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0568] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0569] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab [0570] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0571] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is pembrolizumab.
[0572] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is pembrolizumab.
[0573] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0574] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0575] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0576] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0577] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0578] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab [0579] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0580] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is thalidomide.
[0581] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is thalidomide.
[0582] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide [0583] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0584] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0585] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0586] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0587] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0588] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0589] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is lenalidomide.
[0590] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is lenalidomide.
[0591] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0592] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0593] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0594] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0595] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0596] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0597] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0598] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is pomalidomide.
[0599] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is pomalidomide.
[0600] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide [0601] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide.
[0602] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide.
[0603] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide [0604] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide.
[0605] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide.
[0606] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide.
[0607] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is BCG.
[0608] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is BCG.
[0609] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG
[0610] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG.
[0611] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG
[0612] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG.
[0613] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG.
[0614] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG.
[0615] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG.
[0616] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is 1 evami sole [0617] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is levamisole.
[0618] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0619] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0620] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole [0621] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0622] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0623] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0624] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0625] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DHODH inhibitor.
[0626] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DHODH inhibitor.
[0627] According to embodiments, the DHODH inhibitor is a compound of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0628] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0629] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0630] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH
inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0631] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0632] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0633] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0634] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0635] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof [0636] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0637] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a kinase inhibitor.
[0638] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a kinase inhibitor.
[0639] According to embodiments, the kinase inhibitor is a serine and/or tyrosine kinase inhibitor.
[0640] According to embodiments, the kinase inhibitor is an inhibitor of FLT3 and/or BTK
[0641] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a FLT3 inhibitor.
[0642] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a FLT3 inhibitor.
[0643] According to embodiments, the FLT3 inhibitor is sorafenib, sunitinib, midostaurin (PKC412), lestaurtinib (CEP-701), tandutinib (MLN518), quizartinib (AC220), gilteritinib (ASP2215), or KW-2449.
[0644] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is sorafenib [0645] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is sorafenib.
[0646] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0647] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0648] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0649] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0650] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0651] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0652] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0653] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is sunitinib.
[0654] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is sunitinib.
[0655] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0656] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0657] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0658] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0659] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0660] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0661] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib [0662] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is midostaurin.
[0663] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is midostaurin [0664] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin [0665] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin.
[0666] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin.
[0667] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin.
[0668] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin.
[0669] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin.
[0670] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin [0671] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is lestaurtinib [0672] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is lestaurtinib.
[0673] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0674] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0675] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0676] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0677] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0678] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0679] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0680] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is tandutinib.
[0681] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is tandutinib [0682] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0683] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0684] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0685] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0686] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0687] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0688] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0689] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is AC220.
[0690] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is AC220.
[0691] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220.
[0692] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220 [0693] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220.
[0694] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220.
[0695] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220 [0696] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220 [0697] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220.
[0698] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ASP2215.
[0699] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ASP2215.
[0700] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0701] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0702] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0703] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0704] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0705] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0706] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0707] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is KW-2449.
[0708] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is KW-2449.
[0709] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0710] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0711] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0712] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449 [0713] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0714] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0715] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0716] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a BTK inhibitor.
[0717] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a BTK inhibitor.
[0718] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0719] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0720] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0721] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0722] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0723] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0724] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0725] According to embodiments, the BTK inhibitor is ibrutinib [0726] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ibrutinib.
[0727] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ibrutinib [0728] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib.
[0729] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib [0730] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib [0731] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib [0732] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib.
[0733] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib.
[0734] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib [0735] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a CD20 inhibitor.
[0736] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a CD20 inhibitor.
[0737] According to embodiments, the CD20 inhibitor is an anti-CD20 antibody, in particular obinutuzumab (GA101).
[0738] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0739] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0740] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0741] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0742] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0743] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0744] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0745] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is GA101.
[0746] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is GA101 [0747] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0748] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0749] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0750] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0751] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0752] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0753] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0754] All possible combinations of the above indicated embodiments are considered to be embraced within the scope of the invention [0755] In some embodiments, provided are methods for treating a subject who has been diagnosed with a hematopoietic disorder. The present invention relates, for example, to novel methods that comprise administering to the subject a therapeutically effective amount of a menin-MLL inhibitor as described herein; and a therapeutically effective amount of a BCL-2 inhibitor; and optionally, a therapeutically effective amount of at least one other antineoplastic agent.
[0756] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof is administered orally to a subject.
[0757] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered in a dose of from about 1 mg/kg to about 50 mg/kg to the subject.
[0758] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered in a dose of from about 2.5 mg/kg to about 25 mg/kg to the subject.
[0759] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered in a dose of from about 7.5 mg/kg to about 12.5 mg/kg to the subject.
[0760] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered in a dose of from about 8 mg/kg to about 10 mg/kg to the subject.
[0761] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof is administered in a dose of from about 0.1 mg to about 5 mg to the subject.
[0762] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered orally to a subject.
[0763] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered in a dose of from about 1 mg/kg to about 50 mg/kg to the subject.
[0764] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered in a dose of from about 2.5 mg/kg to about 25 mg/kg to the subject.
[0765] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered in a dose of from about 7.5 mg/kg to about 12.5 mg/kg to the subject.
[0766] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered in a dose of from about 8 mg/kg to about 10 mg/kg to the subject.
[0767] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered in a dose of from about 0,1 mg to about 5 mg to the subject.
[0768] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered to the subject intravenously or subcutaneously.
[0769] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered intravenously or subcutaneously in a dose of from about 10 mg/m2 to about 250 mg/m2 to the subject.
[0770] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered intravenously or subcutaneously in a dose of from about 50 mg/m2 to about 150 mg/m2 to the subject.
[0771] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered intravenously or subcutaneously in a dose of from about 60 mg/m2 to about 100 mg/m2 to the subject.
[0772] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered intravenously or subcutaneously in a dose of about 75 mg/m2 to the subject.
[0773] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered to the subject orally in a dose of from about 1 mg to about 500 mg to the subject.
[0774] An additional embodiment of the invention relates to methods for treating a subject who has been diagnosed with cancer (e.g., wherein the cancer is a hematopoietic disorder, such as myelodysplastic syndrome (MDS), acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL), a small lymphocytic lymphoma (SLL) or chronic lymphocytic leukemia (CLL)), wherein the method comprises administering to the subject:
a therapeutically effective amount of a menin-MLL inhibitor of Formula (I), or a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt or a solvate thereof; and a therapeutically effective amount of a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof;
for example, wherein the menin-MLL inhibitor and the DHODH inhibitor are administered in accordance with their dosing schedules for a time period, e.g., (i) simultaneously or sequentially in either order on the same day(s) within a time period (e.g., a 21-day period, or a 28-day period, or a 3-month period, or a 6-month period, or a one-year period, etc.), and/or (ii) on different days within a time period.
[0775] An additional embodiment of the invention relates to methods for treating a subject who has been diagnosed with cancer (e.g., wherein the cancer is a hematopoietic disorder, such as myelodysplastic syndrome (MDS), acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL), a small lymphocytic lymphoma (SLL) or chronic lymphocytic leukemia (CLL)), wherein the method comprises administering to the subject:
a therapeutically effective amount of a menin-MLL inhibitor that is Compound A
or a pharmaceutically acceptable salt or solvate thereof (e.g., Compound Al, or Compound A2, or Compound A3, or Compound A4-a or a solvate thereof, or Compound A4-b or a hydrate thereof, or Compound A4); and a therapeutically effective amount of a DHODH inhibitor that is Compound 22 or a pharmaceutically acceptable salt, solvate, stereoisomer, isotopic variant, or N-oxide thereof (e.g., 6-(4-Ethyl -3 -(hy droxym ethyl)-5-oxo-4,5-di hy dro-1H-1,2,4-tri azol -1 -y1)-7-fluoro-4-i sopropy1-2-(o-tolypi soquinolin-1(2H)-one);
for example, wherein the menin-MLL inhibitor and the DHODH inhibitor are administered in accordance with their dosing schedules for a time period, e.g., (i) simultaneously or sequentially in either order on the same day(s) within a time period (e.g., a 21-day period, or a 28-day period, or a 3-month period, or a 6-month period, or a one-year period, etc.), and/or (ii) on different days within a time period.
[0776] An additional embodiment of the invention relates to methods as described herein wherein compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered to the subject daily.
[0777] An additional embodiment of the invention relates to methods as described herein wherein compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered to the subject daily for at least 7 days.
[0778] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered to the subject daily.
[0779] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered to the subject daily for at least 7 days.
[0780] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered to the subject daily.
[0781] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered to the subject daily for at least 21 days.
[0782] Optimal dosages of any of the therapeutic compounds described herein to be administered may be readily determined and will vary with the particular compound used, the mode of administration, the strength of the preparation, and the advancement of the disease, syndrome, condition or disorder. In addition, factors associated with the particular subject being treated, including subject gender, age, weight, diet and time of administration, will result in the need to adjust the dose to achieve an appropriate therapeutic level and desired therapeutic effect.
[0783] The above dosages are thus exemplary of the average case. There can be, of course, individual instances wherein higher or lower dosage ranges are merited, and such are within the scope of this invention.
[0784] The therapeutic compounds described herein may be administered in any of the foregoing compositions and dosage regimens or by means of those compositions and dosage regimens established in the art whenever use of the therapeutic compounds described herein is administered to a subject in need thereof [0785] The therapeutic compounds described herein may be administered to the subject simultaneously or sequentially.
[0786] When administered sequentially, the menin-lVILL inhibitor of Formula (I) may be administered first. When administration is simultaneous, the combination may be administered either in the same or a different pharmaceutical composition. For instance, the menin-MLL
inhibitor of Formula (I) may be administered prior to, simultaneous with, or after the administration of the BCL-2 inhibitor. For instance, the BCL-2 inhibitor may be administered prior to, simultaneous with, or after the administration of the optional other antineoplastic agent.
Adjunctive therapy, i.e., where one or two agent(s) are used as the primary treatment and the other agent is used to assist that primary treatment, is also an embodiment of the present invention.
[0787] An embodiment of the invention relates to a therapeutically effective amount of a menin-MLL inhibitor including the compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the embodiments, for use in combination with a therapeutically effective amount of a BCL-2 inhibitor; and optionally, a therapeutically effective amount of at least one other antineoplastic agent. In certain embodiments, the aforementioned therapeutically effective amounts are administered in separate dosage forms for use in treating a subject who has been diagnosed with a hematopoietic disorder.
[0788] An embodiment of the invention relates to a pharmaceutical product including a menin-MILL inhibitor of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the embodiments, and a BCL-2 inhibitor; and optionally, at least one other antineoplastic agent as a combined preparation for simultaneous, separate or sequential use in treating a subject who has been diagnosed with a hematopoietic disorder.
[0789] The following Examples are provided to illustrate some of the concepts described within this disclosure. While the Example is considered to provide an embodiment, it should not be considered to limit the more general embodiments described herein.
EXAMPLES
General Synthetic Schemes Venetoclax [0790] Venetoclax is available commercially.
Azacitidine [0791] Azacitidine is available commercially.
Compounds of Formula I
[0792] In this section, as in all other sections unless the context indicates otherwise, references to Formula (I) also include all other sub-groups and examples thereof as defined herein.
[0793] The general preparation of some typical examples of the compounds of Formula (I) is described hereunder and in the specific examples, and are generally prepared from starting materials which are either commercially available or prepared by standard synthetic processes commonly used by those skilled in the art of organic chemistry. The following schemes are only meant to represent examples of the invention and are in no way meant to be a limit of the invention.
[0794] Alternatively, compounds of Formula (I) may also be prepared by analogous reaction protocols as described in the general schemes below, combined with standard synthetic processes commonly used by those skilled in the art.
[0795] The skilled person will realize that in the reactions described in the Schemes, although this is not always explicitly shown, it may be necessary to protect reactive functional groups (for example hydroxy, amino, or carboxy groups) where these are desired in the final product, to avoid their unwanted participation in the reactions. In general, conventional protecting groups (PG) can be used in accordance with standard practice. The protecting groups may be removed at a convenient subsequent stage using methods known from the art.
[0796] The skilled person will realize that in the reactions described in the Schemes, it may be advisable or necessary to perform the reaction under an inert atmosphere, such as for example under N2-gas atmosphere.
[0797] It will be apparent for the skilled person that it may be necessary to cool the reaction mixture before reaction work-up (refers to the series of manipulations required to isolate and purify the product(s) of a chemical reaction such as for example quenching, column chromatography, extraction).
[0798] The skilled person will realize that heating the reaction mixture under stirring may enhance the reaction outcome. In some reactions microwave heating may be used instead of conventional heating to shorten the overall reaction time.
[0799] The skilled person will realize that another sequence of the chemical reactions shown in the Schemes below, may also result in the desired compound of Formula (I).
[0800] The skilled person will realize that intermediates and final compounds shown in the Schemes below may be further functionalized according to methods well-known by the person skilled in the art. The intermediates and compounds described herein can be isolated in free form or as a salt, or a solvate thereof. The intermediates and compounds described herein may be synthesized in the form of mixtures of tautomers and stereoisomeric forms that can be separated from one another following art-known resolution procedures.
[0801] All abbreviations used in the general schemes for Formula (I) are as defined in Table 1B below in the part Examples. Variables are as defined in the scope or as specifically defined in the general Schemes.
Part A) Schemes la, lb, lc, 2a, 2b and 3 Rn = C1_6alkyl-NR8aPG or C1_6alkyl-OPG or C1_6alkyl-C(=0)0R9', PG = protecting group Scheme la 0 k ,PG halo Step 1 R4_, ,Ci.6alkyl-NHPG
+ I. If , R4 -Mg 0 Ci_6alkyl' HO Rn ________________________ Step 2 H Rn + R4 _ivighalo Step 3 R4, ,Rn Step 2 R4, ,Rn ).- y _________________________________________________ > T
---- __________________________________________________________________ >
o OH
_ PG step 4 HO Rn Step 5 N Rn halo Step 6 R4 Rn ,'- N-, _______________________________ 43- y + R4-Mg or R4 Li 1- ---Tr-, . 0 C1 .6alkyl' Scheme lb HO, _OH
4:11 + e gab OH Step 7 __________________________________________________________ ).- 0 OH }
halo Riblitillij R1' Rib OH
Rxb Rxb , 4 0 , r:, 0 Rib Rxa Rxb Step 5 Rxa Step 8 Rxa b ,+ -N-H
Ri R16el Rib Scheme lc PG
PG N
N halo n3(X)n4 r13% + )n4 hal ' J,õ Step 9 n1( )n2 U
I _________________________________________________ J.-- N
n1( )n2 N,-51, N half,i) H I
N N../.., [0802] In Scheme la, lb and lc the following reaction conditions apply.
[0803] Step 1: at a suitable temperature such as for example -70 C, in the presence of a suitable base such as for example TMEDA and a suitable organometallic reagent such as for example isopropylmagnesium bromide, in a suitable solvent such as for example THF;
[0804] Step 2: at a suitable temperature such as for example from 0 C to RT, in the presence of a suitable oxidative reagent such as for example DMP, in a suitable solvent such as for example DCM;
[0805] Step 3: at a suitable temperature such as for example from -20 C to RT, in the presence of a suitable organometallic reagent such as for example isopropylmagnesium bromide, in a suitable solvent such as for example THF;
[0806] Step 4: at a suitable temperature such as for example 80 C, in the presence of a suitable base such as for example NaOH, in suitable solvents such as for example THY
and H20;
[0807] Step 5: at a suitable temperature such as for example RT, in the presence of suitable amide condensation reagents such as for example EDCI and HOBt, in the presence of a suitable base such as for example NiVEVI, in a suitable solvent such as for example DCM;
[0808] Step 6: at a suitable temperature such as for example -70 C, in the presence of a suitable organometallic reagent such as for example isopropyllithium, in a suitable solvent such as for example THE;
[0809] Step 7: at a suitable temperature such as for example 90 C, in the presence of a suitable organometallic catalyst such as for example Pd(dppf)C12, in the presence of a suitable base such as for example Na2CO3, in suitable solvents such as for example 1,4-dioxane and H20;
[0810] Step 8: at a suitable temperature such as for example from 0 C to RT, in the presence of a suitable Lewis acid such as for example BBr3, in a suitable solvent such as for example DCM;
[0811] Step 9: at a suitable temperature such as for example from -78 C to 40 'V, in particular from 0 C to RT, in the presence of a suitable base such as for example TEA, DBU or K2CO3, in a suitable solvent such as for example DCM, TETT or DIVIT;
Scheme 2a PG PG
PG
I N
N
N
Rla n3(X)n4 n3()n2 )n4 n3%)n4 OH
Step 9), n1( Step 10 n1( )n2 n1( )n2 N Rla Rib + . ''.- hale, U o)-1N R2 = halo 1j1 I
R1' IV-I%1 N-N-,, -,--, R2 N-N/I,R2 R1 bill.
Step 11 1 R2 = H
R4Rn H
N
N n3(X)n4 n3()n4 R4 ,, Rn n1(X )n2 11õ n1( )n2 0 Wa N
Ri a N
-.4 ______________________________________________________________ Rib 0-11)'-= Step 12 u I
N-N.) 0 NI,N Rib.
Scheme 2b n3( )X
n1( )n2 0 PG
Step 12 R4 Rn R4,y, Rn Step 11 N R4 Rn n3()n4 n3( )n4 n1( )n2 n1( )n2 n3(X)n4 PG Step 14 n1( )n2 R1 a R1 a R1a OH
Step 13OyN IV
R
oN Rib N NN
Rib ib Step 41 Rla -C1_4alkyl ON
R1b NN%
1 Step 9 Ria 0 0 'Ci_4alkyl OH + CI 1N
R" NNJ
[0812] In Scheme 2a and 2b, the following reaction conditions apply:
[0813] Step 9: See Step 9 in Scheme 1;
[0814] Step 10: at a suitable temperature such as for example RT, in the presence of a suitable catalyst such as for example Pd/C, in the presence of a suitable reductive reagent such as for example H2, optionally in the presence of a suitable base such as for example TEA, in a suitable solvent such as for example THF; Alternatively, at a suitable temperature such as RT, in the presence of a suitable catalyst such as for example Pd(dpp0C12-13CM complex, a suitable reducing agent such NaBH4, a suitable base such as for example TMEDA, in a suitable solvent such as for example THF.
[0815] Step 11: for N deprotection, at a suitable temperature such as for example RT, in the presence of a suitable acid as for example TFA, in a suitable solvent such as for example DCM;
for 0 deprotection, at a suitable temperature such as for example RT, in the presence of a suitable acid as for example 4-methylbenzenesulfonic acid, in a suitable solvent such as for example Me0H, [0816] Step 12: at a suitable temperature such as for example 80 C, optionally in the presence of a suitable Lewis acid such as for example ZnC12, in the presence of a suitable reductive reagent such as for example NaBH3CN, in a suitable solvent such as for example Me0H;
[0817] Step 13: at a suitable temperature such as for example RT, in the presence of a suitable organometallic catalyst such as for example Ag(Phen)20Tf, in the presence of a suitable brominating reagent such as for example 1,3-dibromo-1,3,5-triazinane-2,4,6-trione, in a suitable solvent such as for example DCE;
[0818] Step 14: at a suitable temperature such as for example RT, in the presence of a suitable chlorinating reagent such as for example oxalyl chloride, in the presence of DMF, in a suitable solvent such as for example DCM.
Scheme 3 y.
When Rn = C1_salkyl-NR8'PG R4 cioikyi-NR8aReb N
n3(X )n4 n1( )n2 R4yC1.Ealkyl-NR8aPG R4 C16alkyl-NHR8e 0 R1a N
N N abi rk,N
n1( n3(X)n4 n3(X)n4 <05/
isl, N
S,,,/ RibilliW )n2 Step 11 n1( )n2 R1' N _____ y N (31-)--u it CJ
,),,,, Febglam Rib 'N
124 yCi.oalkyl-NRii -C(=0)-0-C1_4alkyl-O-C(=0)-C1.4alkyl N
n3(X)n4 n1( )n2 Rla grah 0Nu Rib FtlIF N
When Rn = Ci_Galkyl-OPG R4i Ci _6alkyl-OPG R4,f, Ci_6alkyl-OH
N N
"3K ,)n4 n3(X)n4 Step 11 n1( )n2 ____ v) ___ n1( )n2 R1a N R1 t a N
iiiii Oyk,, u a (3?-'1_1 ' 1,1 Ribl NN Rib IPI .11P1' 'NJ
When Rn = C1_olkyl-C(=0)0R9 R4õCi.6alkyl-C(.0)0R9a Fl4, ,Ci.5alkyl-C(.0)-NRIaR91' T T
N N
n3(X)n4 n3(X)n4 Step 16 n1( )n2 _____ 7.-- n1( )n2 R1' N 121' N
gli lb NI, NI, 121 b.11'111IPP. N Rib"-LIPIP N
[0819] In Scheme 3, the following reaction conditions apply:
[0820] Step 11-12: See Step 11-12 in Scheme 2;
[0821] Step 15: at a suitable temperature such as for example 80 C, in the presence of a suitable base such as for example Cs2CO3, in suitable solvent such as for example DMF;
[0822] Step 16: at a suitable temperature such as for example 40 C, in the presence of a suitable base such as for example ammonia, in suitable solvent such as for example 1,4-dioxane.
Part B) Schemes 4, 5, 6, 7, 8, 9, 10, 11 and 12 Scheme 4 4 H0_13,0H
1) 0 + OH Step 1 _______________________________________________________ > / OH }
halo 1 R1a Rib -,,, Rib ..j.,,. OH
o i xb Rxb ' ,N a Rib X
O
+ Fe; .. Rxb Step 2 ., ___________________________________ ).- R..,N 0 Step 3 Rxa _______________________________________________________ ).-- OH
,.._,,,, Rib Rib Rib Ri a 0-,......,.õ.0,R9a Ri a 0,.,,,,.0, R9a Ria OOH
OH OH Jitep5 + Cl- - N Step 4 S
- -, N, -,J
N'N-,-- N, --õ,---Rib Rib N Rib N
R1a O'-:,--- OH
Ria OH R1a OCF3 0, Step 6 NI
N'N 0 --i----I Step N, .,,,,,/,- N,ie Rib Rib N Rib [0823] In Scheme 4, the following reaction conditions apply:
[0824] Step 1: at a suitable temperature such as for example 90 C, in the presence of a suitable organometallic catalyst such as for example Pd(dppf)C12, in the presence of a suitable base such as for example Na2CO3, in suitable solvents such as for example 1,4-dioxane and H20;
[0825] Step 2: at a suitable temperature such as for example RT, in the presence of suitable amide condensation reagent such as for example HATU, in the presence of a suitable base such as for example DIEA, in a suitable solvent such as for example DCM;
[0826] Step 3: at a suitable temperature such as for example from -78 C to RT, in the presence of a suitable Lewis acid such as for example BBr3, in a suitable solvent such as for example DCM;
[0827] Step 4: at a suitable temperature such as for example from -78 C to 40 C, in particular from 0 C to RT, in the presence of a suitable base such as for example TEA, DBU or K2CO3, in a suitable solvent such as for example DCM, THY or DMF;
[0828] Step 5: at a suitable temperature such as for example RT, in the presence of a suitable base such as for example LiORH20, in suitable solvents such as for example THF
and H20;
[0829] Step 6: at a suitable temperature such as for example RT, in the presence of a suitable organometallic catalyst such as for example Ag(Phen)20Tf, in the presence of a suitable brominating reagent such as for example 1,3-dibromo-1,3,5-triazinane-2,4,6-trione, in a suitable solvent such as for example DCE;
[0830] Step 7: at a suitable temperature such as for example RT, in the presence of a suitable brominating reagent such as 1,3-dibromo-1,3,5-tri azinane-2,4,6-tri one, in the presence of 2,2,2-trifluoroethan-1-ol as solvent.
Scheme 5 PG
PG
ll N
PG
N halo n3( ) )n4 R1a n3(X)n4 n3)n4 + hal,ort, Step 8 n1( )n2 Step +
R1 St 9 n1( )n2 '' U _____________________________ 1.- ,-.)./OH ___ )....-N
n1( )n2 halo I, ii ' II R1b ,,,-,--(3-1----LU
H
N. -R2 I
N,N ,i-,R
N
R1b R2 = hay 2 Step 11 Step 10 H PG
H
N N
N
n3(X)n4 n3(X)n4 n3%)n4 n1( )n2 Step 11 n1( )n2 Ria N Ri' N
NI' N.J l=
el I , N I
Kill Rib Rlb Rib -H
Rt_ ,R3 Rty,R3 I
N
N T halo n3(X)n4 n3( ) )n4 + RR3 Step 123._ n3(XN )n4 Step 11 N
halo) Step 8 ,, n1( )n2 X
0 n1( )n2 > n3( ) )n4 +
N
--.halo N n1( )n2 N.N
PIG N N
hahrz,) PG H
I --- N
N.N.J,, halo [0831] In Scheme 5, the following reaction conditions apply:
[0832] Step 8: at a suitable temperature such as for example from -78 C to 40 'V, in particular from 0 C to RT, in the presence of a suitable base such as for example TEA, DBU or K2CO3, in a suitable solvent such as for example DCM, THE or DMF;
[0833] Step 9: at a suitable temperature such as for example from -78 C to 40 C, in particular from 0 C to RT, in the presence of a suitable base such as for example TEA, DBU or K2CO3, in a suitable solvent such as for example DCM, TELF or DMF;
[0834] Step 10: at a suitable temperature such as for example RT, in the presence of a suitable organometallic catalyst as for example Pd/C and a suitable base as for example TEA, in a suitable solvent such as for example Me0H under H2 atmosphere;
[0835] Step 11: When PG is Boc, at a suitable temperature such as for example RT, in the presence of a suitable acid as for example TFA, in a suitable solvent such as for example DCM.
Scheme 6 (Rw)In m = 1, 2, 3 R4 C,,,alkyl-OPS Rw = H, CN, halo, OH, 0-C1alkyl (R.). N
Step 12 n3(X)n4 RAõCi.fialkyl-OPG _______ ).
if n1( )n2 0 Ria N
60,___õ,..
, ii H Feb 'N
N (R). (R,,)õ, n3(g)n4 R4,(04.6alkyl-OH R4.õ Ci,salkyl-LG
n1( )n2 T
We N N N
Step 12 n3(X)n4 Step 13 n3( _X)n4 0 ) _____________________ ) n1( )n2 ,....
n1( Au Rib 'N R1' N R1' N
(3 S ' --"I'-' 0 .0 124yC1.6alkyl-NRa'Rsb a ILI 7 n3(%
Rib R1e-Y
R4 Ci_Balkyl-OH HNRR'RRb (R).,,0 t''67v (R.).
...""9" ' R' n1( )n2 R4 Ci_5alkyl¨< ] R4 Ci_51kyl¨/( cnN.0`
Y o --r- H
R4 C15alkyl¨( 1 [1 0 n1( )n2 ..,,, , o: Step 12 ,,3(X)4 N
Step 15 n3r4 Rib -N--.õ,, _____________________ ) ' ___________________________________________ ).-n1( )n2 0 Rta N Rla N
Rib N Rib N
[0836] In Scheme 6, the following reaction conditions apply:
[0837] Step 12: reductive amination condition, at a suitable temperature such as for example from RT to 80 C, in the presence or absence of a suitable Lewis acid such as for example ZnC12 or an acid for example AcOH, in the presence of a suitable reducing agent such as for example NaBH3CN, in a suitable solvent such as for example Me0H;
[0838] Step 13: at a suitable temperature such as for example 0 C, in the presence of a suitable electrophile as for example MsCl, in the presence of a suitable base such as for example TEA, in a suitable solvent such as for example DCM;
[0839] Step 14: at a suitable temperature such as for example from 0 C to RT, in the presence of a suitable oxidizing agent as for example DAV, in a suitable solvent such as for example DCM, [0840] Step 15: at a suitable temperature such as for example 50 C, in the presence of a suitable acid as for example HC1, in a suitable solvent such as for example ACN;
[0841] Step 16: at a suitable temperature such as for example RT, in the presence or absence of a suitable base as for example TEA, in a suitable solvent such as for example TEIF.
Scheme 7 m = 1, 2, 3 Rw = H, ON, halo, OH, 0-C1.4alkyl (Rw)m H R4 Ci.Galkyl-NRgaRgb N
n3 ,)n4 N
(Rw). Step 12 Ri n3(X)n4 nif )n2 11 R1a N + R4. Ci_calkyl-NR8aRth ... -n1( )n2 N
R, NM + I I ri IRIE. N --N_,L,' R2 (R.A.
R4 Ci Balkyl-N123 PG Step 12 _ /Step12 or Step 17 (Fly.). (Rw).
(Rw)nl R4 Ci_0a1ky1-NR8ePG R4 01_6alkyl-NHR8a R
Ci_olkyl-NR"
n3()n4 Step 11 n3(X)n4 Step 17 n3(X )n4 Cr n1( )n2 n1( )n2 02N n1( )n2 R1a N 12 iF
1e N Rla N
0-'''''Ci,alkyl u el ii ___________________________________________________ 0 --,--0 --T)--,u 0}0"---'0)1'Ci_4alkyl _i----..- ,,,--I I 1 Y ul 1216,-----:õ._,, - N'N---)-õR2 --,_ ,--- N N --,:-1, R2 Rib ---,,,,-- N,N!---,R, Rib H
N
n3%)n4 (Rw)m (Rw)m n1( )n2 R4yCi.salky1-0(.0)0R9' R4 , C1.6alkyl-C(.0)-NRg'R9b R1' N -r--N N
n3(X)n4 n3(X)n4 II ill Step 12 Step 18 + FINR9'reb -)'-N,...",,R, n1( )n2 n1( )n2 Rib -I- R1' N R1a N
0, ------i R4yCi.olkyl-C(=0)0R9 R16 'N" R2 121b .----,..,..- N N,,,- ,R2 [0842] In Scheme 7, the following reaction conditions apply:
[0843] Step 11: When PG is Boc, at a suitable temperature such as for example RT, in the presence of a suitable acid as for example TFA, in a suitable solvent such as for example DCM;
[0844] Step 12: reductive amination condition, at a suitable temperature such as for example from RT to 80 C, in the presence or absence of a suitable Lewis acid such as for example ZnC12 or an acid for example AcOH, in the presence of a suitable reducing agent such as for example NaBH3CN, in a suitable solvent such as for example Me0H;
[0845] Step 17: at a suitable temperature such as for example from RT to 80 C, in the presence of a suitable base such as for example DIEA or Cs2CO3, in suitable solvent such as for example DCM or DMF;
[0846] Step 18: at a suitable temperature such as for example 40 'V, in the presence of a suitable base such as for example ammonia, in suitable solvent such as for 1,4-dioxane.
Scheme 8 Rta OH
, _.J-, 0 _ RtT,R3 R4,T,R3 Rib j f 1-õIN N
Ir , µ94 r.3%).4 n3(X= )n4 + n1( )n2 R1' N
n1( )n2 ,0S
N Ria 171--C F3 .µ . j1----:, H j II
AO Or ,o,J,N
Rib -.N'-- N-N
N--Rib 1 Step 10 R'1R3 RR3 R4r.R3 T
N N
N
RI n3(X)n4 n3(X)n4 n3(X)n4 j__ _OH Step 9 Step 21 --- -,--- + ________ n1( )n2 ).- __ n1( )n2 S¨ n1( )n2 N Ria N Rla N
Rtb hal.-1-- - 0 0 ' N
I
N,=
----(L-I N
'---(L-I N
N halo Rib N -N-1, halo Rib =
-N 0C1.4alkyl Step 20 ly Step 22 N
N n3( ) On4 n3(X)n4 n1( )n2 n1( )n2 Rla N
Ria N
o.--1---k N
1 f 1 NI
R1b N NR7aR7b Rtb [0847] In Scheme 8, the following reaction conditions apply:
[0848] Step 9: at a suitable temperature such as for example from -78 C to 40 C, in particular from 0 C to RT, in the presence of a suitable base such as for example TEA, DBU or K2CO3, in a suitable solvent such as for example DCM, Tlif or DMF;
[0849] Step 10: at a suitable temperature such as for example RT, in the presence of a suitable organometallic catalyst as for example Pd/C, optionally in the presence of a suitable base as for example TEA, in a suitable solvent such as for example Me0H under H2 atmosphere;
[0850] Step 19: at a suitable temperature such as for example RT, in the presence of a suitable chlorinating reagent such as for example oxalyl chloride, in the presence of DMF, in a suitable solvent such as for example DCM;
[0851] Step 20: at a suitable temperature such as for example 90 C, in the presence of a suitable nucleophilic amine, in a suitable solvent such as for example Et0H;
[0852] Step 21: at a suitable temperature such as for example RT, in the presence of a suitable acid such as for example HC1 in dioxane, in a suitable solvent such as for example Me0H;
[0853] Step 22: at a suitable temperature such as for example 110 "V, in the presence of a suitable boron reagent such as for example trimethylboroxine, in the presence of a suitable organometallic catalyst such as for example tetrakis(triphenylphosphine)palladium(0), in the presence of a suitable base such as for example K2CO3, in a suitable solvent such as for example 1,4-dioxane;
Scheme 9 CI CI
CO2C1_4alkyl Step 23 CO2C1_4alkyl Step 24 ¨0 n1(4)n2 + 1.----",ci ).-- n1( )n2 ¨)."- n1( )n2 N N N
PG PG PG
0 'N Step R4i,11,0H LC) Step 25 ll'ir-I-LO Step 260.. _________ ,_...---- Step 27 . R -4'--- Boco, R4 N __ I.- +
HN , NH .:,-.3.., ,--1\ Boc -Boc 0 0"-C\ Boc 0 0 HNIRsiRsb R8b R4 -,,,r,--, N - R8 b CI Step 29 N,R8b Step 30 NH , ) \ Step 31 8' HN kBa __ ). \ ______ ..- N
for 1 h, then cooled to room temperature. The mixture was filtered through a pad of Celite , and the pad was washed with Et0Ac. The filtrate was combined, washed with brine, and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 -40% Et0Ac in petroleum ether) to give the title compound as a colorless amorphous solid (5 g, yield: 96%). ESI-MS: mass calcd. for C23H25FIN304, 553.1; m/z found, 554.1 [M+H]t 1H
NMR (400 MHz, CDC13) 6 8.16 (d, J = 7.1 Hz, 1 H), 7.62 (d, J = 10.8 Hz, 1 H), 7.29 - 7.45 (m, 5 H), 4.61 (s, 2 H), 4.50 (s, 2 H), 3.84 (q, J= 7.2 Hz, 211), 1.63 (s, 9H), 1.35 (t, J = 7.2 Hz, 3 H) ppm; 19F NMR (376 MHz, CDC13) 6 -119.09 (dd, J= 10.6, 7.0 Hz, 1 F) ppm.
[0398] Step C. 4-(34(Benzyloxy)methyl)-4-ethyl-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoic acid.
[0399] To a solution of tert-butyl 4-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-111-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoate (5 g, 9 mmol) in DCM (50 mL) was slowly added TFA (10 mL). The reaction mixture was stirred at room temperature overnight.
The reaction mixture was concentrated under vacuum. The obtained residue was triturated with petroleum ether at room temperature for 30 min. The mixture was filtered and the solid was rinsed with petroleum ether. The precipitate was collected and dried in vacuo to give the title compound as a white solid (4.1 g, yield: 91%). ESI-MS: mass calcd. for C191117FIN304, 497.0; m/z found, 498.0 [M Hr.1H NMR (400 MHz, DMSO-d6) 6 8.16 (d, J= 7.3 Hz, 111), 7.78 (d, J =
11.0 Hz, 1 H), 7.28 - 7.43 (m, 5 H), 4.60 (s, 2 H), 4.57 (s, 2 H), 3.74 (q, J= 7.2 Hz, 2 H), 1.23 (t, J
= 7.2 Hz, 3 H) ppm; 19F NMR (376 MHz, DMSO-d6) 6 -119.91 (s, 1 F) ppm.
[0400] Step D. 4-(34(Benzyloxy)methyl)-4-ethyl-5-oxo-4,5-dihydro-1H-1.,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoyl chloride.
[0401] A solution of 4-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-5-fluoro-2-iodobenzoic acid (3.5 g, 7 mmol) in SOC12 (14 mL) was heated at reflux for 15 min. The reaction mixture was cooled to room temperature and concentrated. To the residue was added anhydrous toluene, then the mixture was evaporated to give the crude product as a yellow gum (3.6 g), which was directly used for the next step without further purification.
Intermediate 6: 2-Chloro-6-fluoro-N-(3-methylpent-2-en-1-yl)aniline.
CI
[0402] Step A. Ethyl 3-methylpent-2-enoate.
[0403] To a solution of 2-butanone (52 g, 717.6 mmol) and (carbethoxymethylene) triphenylphosphorane (50 g, 143.5 mmol) in toluene (65 mL) was added benzoic acid (3.5 g, 28.7 mmol). The reaction mixture was heated at reflux for 16 h. The mixture was diluted with petroleum ether and filtered through a short pad of silica gel. The silica gel was washed with hexane. The filtrate was concentrated under reduced pressure at 0-2 C. The residue was purified by silica column chromatography (elution: 0 - 10% Et0Ac in petroleum ether) to give the title compound as a colorless liquid (23.3 g crude). 1-fl NMR (400 MHz, CDC13) 6 5.58 -5.69 (m, 1 H), 4.13 (qd, J= 7.1, 4.9 Hz, 2 H), 2.62 (q, J= 7.5 Hz, 1 H), 2.09 -2.20 (m, 3 H), 1.86 (d, J= 1.2 Hz, 1 H), 1.24- 1.28 (m, 3 H), 1.01 - 1.09 (m, 3 H) ppm.
[0404] Step B. 3-Methylpent-2-en-1 -ol.
[0405] To a toluene solution (1 M) of DIBAL-H (118 mL, 118 mmol) at -78 C was added a toluene solution (40 mL) of ethyl 3-methylpent-2-enoate (20 g crude) dropwise under nitrogen.
The reaction mixture was stirred at -78 'V for 2 h. The mixture was warmed to room temperature and slowly poured into saturated aqueous potassium sodium tartrate solution at 0 C. The mixture was stirred for 2 h and filtered through a short pad of Celite . The pad was washed with DC1V1/Et0Ac (v/v, 3/1), and the filtrate was extracted with DCM.
The organic extract was separated, dried over Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (elution: 0 - 100% DCM in petroleum ether, then 0 - 30%
Et0Ac in DCM) to give the title compound as a colorless liquid (7 g, yield of two steps: 57%).
1I-1 NM:ft (400 MiElz, CDC13) 6 5.35- 5.46(m, 1 H), 4.11 - 4.21 (m, 2 H), 2.02 - 2.13 (m, 2 H), 1.67- 1.76 (m, 311), 0.98 - 1.06 (m, 3 H) ppm.
[0406] Step C. 3-Methylpent-2-enal.
[0407] To a solution of 3-methylpent-2-en-1-ol (2 g, 20.0 mmol) in DCM (20 mL) was added Dess-martin periodinane (10 g, 24.0 mmol). The reaction mixture was stirred at room temperature for 1 h. The mixture was filtered through a short pad of Centel.
The pad was washed with DCM. The combined filtrate was washed with saturated aqueous NaHCO3 solution.
The organic layer was separated, dried over Na2SO4, filtered and concentrated under reduced pressure at 0 - 2 'C. The crude was purified by silica column chromatography (elution: DCM) to give the title compound as a colorless liquid (1.5 g, yield: 77%). 1H NMR
(400 MHz, CDC13) 6 9.91 - 10.04 (m, 1 H), 5.78 - 5.90 (m, 1 H), 2.58 (q, J= 7.6 Hz, 1 H), 2.23 (d, J= 7.3 Hz, 1 H), 2.16 (s, 2 H), 1.96 (dõI = 1.1 Hz, 1 H), 1.16 (tõI = 7.6 Hz, 1 H), 1.09 (tõI = 7.4 Hz, 2 H) PPm -[0408] Step D. N-(2-Chloro-6-fluoropheny1)-3-methylpent-2-en-1-imine.
[0409] To a mixture of 2-chloro-6-fluoroaniline (1.2 g, 8.2 mmol) and 3-methylpent-2-enal (0.97 g, 9.9 mmol) in DCM (18 mL) under nitrogen at 0 C was added triethylamine (4.6 mL, 33 mmol), followed by the addition of a DCM solution (1 M) of TiC14 (5 mL, 5 mmol) dropwise.
The resulting mixture was stirred at 0 C for 1 h, then warmed to room temperature and stirred for 4 h. The mixture was poured into saturated aqueous NH4C1 solution. The mixture became cloudy and filtered through a pad of Celite . The pad was washed with Et0Ac.
The combined filtrate was diluted with DCM and water. The organic layer was separated, and aqueous layer was extracted with DCM. The combined organic layers were washed with brine, dried over Na2SO4, filtered and concentrated. The residue product was purified by silica gel column chromatography (gradient elution: 0 - 5% DCM in petroleum ether) to give the title compound as a pale yellow oil (1.3 g, yield: 70%).
[0410] Step E. 2-Chl oro-6-fluoro-N -(3 -methylp ent-2 -en-1 -yl)aniline.
[0411] To a solution of N-(2-chloro-6-fluoropheny1)-3 -methyl pent-2-en-1 -imine (1.3 g, 5.76 mmol) in Me0H (20 mL) was added NaBH4 (218 mg, 5.8 mmol), and after 1 h, another batch of NaBH4 (218 mg, 5.8 mmol) was added. A total of NaBH4 (1.1 g, 29 mmol) was added. The reaction mixture was stirred at room temperature overnight. The mixture was concentrated, and then diluted with water and extracted with Et0Ac. The organic layer was separated, washed with brine, dried over Na2SO4, filtered and concentrated. The residue was purified by combi flash column chromatography over silica gel (eluent: 0 - 5% DCM in petroleum ether) to give the title compound as a yellow oil (430 mg, yield: 33%). 1H NM:1Z (400 MHz, CDC13) 6 6.95 -7.02 (m, 1 H), 6.84 (ddd, J = 12.2, 8.3, 1.3 Hz, 1 H), 6.52 - 6.63 (m, 1 H), 5.17 -5.28 (m, 1 H), 3.85 (d, J= 5.6 Hz, 2 H), 3.73 (s, 1 H), 1.91 -2.07 (m, 2 H), 1.58 - 1.68 (m, 3 H), 0.89 - 0.96 (m, 3 H).
Intermediate 7: 5-Chloro-3-methy1-1-(tetrahydro-2H-pyran-2-y1)-1H-pyrazol-4-amine.
THP
[0412] Step A. 5-Chloro-3-methy1-4-nitro-1-(tetrahydro-2H-pyran-2-y1)-1H-pyrazole.
[0413] To a solution of 3-methyl-4-nitropyrazole (2 g, 15.7 mmol) in Et0Ac (20 mL) was added DHP (2 g, 23.6 mmol) and Ts0H.H20 (150 mg, 0.79 mmol) at room temperature. The mixture was stirred at room temperature for overnight. Et3N (0.4 mL) was added and the mixture was washed with brine. Then the organic layer was separated, dried over anhydrous Na2SO4, filtered and concentrated. The residue was dissolved in THE (45 mL) and the temperature was lowered to -78 C. A THF (1 M) solution of LiHMDS (10.6 mL, 13.8 mmol) was added to the mixture under nitrogen. After 45 minutes at -78 C, the solution of hexachloroethane (8.9 g, 37.8 mmol) in THE (20 mL) was added dropwise. The reaction mixture was warmed to room temperature and stirred for overnight. The mixture was poured into saturated aqueous NTI4C1 solution and extracted with Et0Ac. The organic phase was separated, washed with brine, dried over anhydrous Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 -40% Et0Ac in petroleum ether) to give the title compound as white solid (1.8 g, yield:
58%). 1H NAAR (400 MHz, CDC13) 6 5.52 (dd, J = 10.0, 2.7 Hz, 1 H), 4.07 - 4.15 (m, 1 H), 3.70 (td, J = 11.3, 2.8 Hz, 1 H), 2.57 (s, 3 H), 2.37 - 2.47 (m, 1 H), 2.11 -2.19 (m, 1 H), 1.86- 1.90 (m, 1 H), 1.72 -1.75 (m, 1 H), 1.64 (d, J= 2.0 Hz, 1 H), 1.53 (d, J= 6.6 Hz, 1 H) ppm.
[0414] Step B. 5 -C hl oro-3 -methyl-1 -(tetrahy dro-2H-pyran-2-y1)-1H-pyrazol-4-ami ne.
[0415] To a mixture of 5 -chl oro-3 -methyl -4-nitro-1 -(tetrahy dro-2H-pyran-2-y1)-1H-pyrazol e (100 mg, 0.4 mmol) in Me0H/THF/H20 (v/v/v, 1/1/1, 3 mL) was added iron powder (114 mg, 2.0 mmol) and NH4C1 (109 mg, 2.0 mmol). The mixture was stirred at 70 "V for 1.5 h. The mixture was cooled to room temperature and filtered through a pad of Celite.
The pad was washed with Et0Ac. The combined filtrate was washed with saturated aqueous NaHCO3 solution. The organic layer was separated, and the aqueous layer was extracted with Et0Ac.
The combined organic extract was washed with brine, dried over anhydrous Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution:
0 - 50% Et0Ac in petroleum ether) to give the title compound as a yellow oil (70 mg, yield:
79%). ESI-MS: mass calcd. for C9H14C1N30, 215.1; m/z found, 216.1 [M+H].
Intermediate 8: 3 -(2-((tert-Butyl diphenyl silyl)oxy)ethoxy)-2-chloroaniline.
Sc' TBDPS
[0416] Step A. tert-Butyl (2-(2-chl oro-3 -nitrophenoxy) eth oxy)diphenyl silane .
[0417] To a mixture of 2-chloro-3-nitrophenol (200 mg, 1.2 mmol), 2-((tert-butyldiphenylsilyl)oxy)ethan-1 -ol (554 mg, 1.8 mmol) and PPh3 (453 mg, 1.7 mmol) in TT-IF
(10 mL) was added DEAD (281 mg, 161 mmol) at 0 C under nitrogen. The mixture was warmed to room temperature and stirred at room temperature for 12 h. Saturated aqueous NH4C1 solution was added, and the mixture was extracted with Et0Ac. The organic was separated, washed with brine, dried over anhydrous Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 -10% Et0Ac in petroleum ether) to give the title compound as a yellow oil (240 mg, yield:
46%). 1H NAIR (400 MHz, CDC13) 6 7.72 (dd, J = 7.8, 1.5 Hz, 4 H), 7.35 - 7.49 (m, 7 H), 7.30 (t, J = 8.2 Hz, 1 H), 7.12 (dd, J= 8.3, 1.2 Hz, 1 H), 4.20 - 4.25 (m, 2 H), 4.06 (t, J= 4.9 Hz, 2 H), 1.06 (s, 9 H) ppm.
[0418] Step B. 3-(2-((tert-Butyldiphenylsilyl)oxy)ethoxy)-2-chloroaniline.
[0419] To a mixture of tert-buty1(2-(2-chloro-3-nitrophenoxy)ethoxy)diphenylsilane (220 mg, 0.5 mmol), NH4C1 (258 mg, 4.8 mmol) in THE (3 mL), Me0H (3 mL) and H20 (3 mL) was added iron powder (269 mg, 4.8 mmol). The reaction mixture was stirred at 70 C for 2 h. The mixture was cooled to room temperature, diluted with Et0Ac, and filtered through a pad of Celite . The Celite was washed with Et0Ac. The combined filtrate was washed with brine, dried over Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 - 11% Et0Ac in petroleum ether) to give the title compound as a yellow solid (192 mg, yield: 92%). ESI-MS: mass calcd. for C24H28C1NO2Si, 425.2; m/z found, 426.1[M+H]t 1H NMR (400 MHz, CDC13) 6 7.75 (dd, J= 7.9, 1.6 Hz, 4H), 7.35 - 7.48 (m, 6H), 6.97 (t, J= 8.1 Hz, 1 H), 6.42 (dd, J = 8.2, 1.1 Hz, 1 H), 6.33 (dd, J = 8.2, 1.1 Hz, 1 H), 4.13 - 4.17 (m, 2H), 4.07 - 4.13 (m, 2 H), 4.01 -4.06 (m, 2 H), 1.06 (s, 9 H) ppm.
Intermediate 9: 5-((B enzyloxy)m ethyl)-4-ethy1-2-(7-m ethyl -1 -oxo-4-(prop-1-en-2-y1)-1H-i sochromen-6-y1)-2,4-dihydro-3H-1,2,4-tri azol -3- one.
Bn0 0,1f [0420] Step A. tert-Butyl 2-bromo-4-fluoro-5-methylbenzoate.
[0421] To a solution of 2-bromo-4-fluoro-5-methylbenzoic acid (1 g, 4.3 mmol) in TI-IF (10 mL) was added (Boc)20 (1.9 g, 8.6 mmol), followed by the addition of DMAP (262 mg, 2.1 mmol). The reaction mixture turned orange and was stirred under nitrogen at 50 C for overnight. The mixture was cooled to room temperature, diluted with Et0Ac, and then washed with brine. The organic layer was separated, dried over Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (elution: 0 - 3% Et0Ac in petroleum ether) to give the title compound as colorless oil (900 mg, yield: 72%). 1H
NMIt (400 MHz, CDC13) 6 7.57 (d, J= 8.1 Hz, 1 H), 7.24 (d, J= 4.6 Hz, 1 H), 2.22 (d, J= 1.5 Hz, 3 H), 1.58 (s, 9 H) ppm.
[0422] Step B. tert-Butyl 4-(3 -((b en zyl oxy)m ethyl)-4-ethyl-5 -ox o-4,5 -di hydro-1H-1,2, 4-tri azol-1-y1)-2 -bromo-5-methylbenzoate.
[0423] A mixture of tert-butyl 2-bromo-4-fluoro-5-methylbenzoate. (750 mg, 2.6 mmol), 5-((benzyloxy)methyl)-4-ethy1-2,4-dihydro-3H-1,2,4-triazol-3-one (800 mg, 3.4 mmol) and Cs2CO3 (1.7 g, 5.2 mmol) in DMF (8 mL) was stirred at 90 C for 16 h. The reaction was quenched by the addition of aqueous saturated N1H4C1 solution. The mixture was extracted with Et0Ac. The organic layer was separated, washed with brine, dried over Na2SO4, filtered and concentrated. The residue was purified by combi-flash chromatography (SiO2, eluent: 0 - 22%
Et0Ac in petroleum ether) to give the title compound as colorless gum (1 g, yield: 71%). ESI-MS: mass calcd. for C24H28BrN304, 501.1; m/z found, 502.1 [M+H]t 1H NAIR (400 MHz, CDC13) 6 7.64 (d, J= 6.1 Hz, 2 H), 7.33 - 7.43 (m, 5 H), 4.61 (s, 2 H), 4.50 (s, 2 H), 3.85 (qõI
= 7.3 Hz, 2 H), 2.31 (s, 3 H), 1.62 (s, 9 H), 1.36 (t, J= 7.2 Hz, 3 H) ppm.
[0424] Step C. 4-(34(Benzyloxy)methyl)-4-ethyl-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-bromo-5-methylbenzoic acid.
[0425] To a mixture of tert-butyl 4-(3 -((b enzyl oxy)methyl)-4-ethy1-5 -oxo-4, 5 -di hy dro-1H-1,2,4-triazol-1-y1)-2-bromo-5-methylbenzoate (500 mg, 0.90 mmol) in DCM (5 mL) was added TFA (1 mL). The mixture was stirred at room temperature for 12 h. The mixture was concentrated. The residue was dissolved with DCM, and petroleum ether was added slowly.
The mixture was stirred at room temperature for 30 min. The mixture was filtered, and the precipitate was rinsed with petroleum ether. The solid was collected and dried in vacuo to give the title compound as a white solid (360 mg, yield: 86%). ESI-MS: mass calcd.
for C201-120BrN304, 445.1; m/z found, 446.0 [M+H] . 1H NMR (400 MHz, DMSO-d6) 6 7.77 (s, 1 H), 7.70 (s, 1 H), 7.29 -7.41 (m, 5 H), 4.59 (s, 2 H), 4.56 (s, 2 H), 3.74 (q, J= 7.0 Hz, 2 H), 2.24 (s, 3 H), 1.23 (t, J= 7.2 Hz, 3 H) ppm.
[0426] Step D. 5 -((B enzyl oxy)methyl)-4-ethy1-2 -(7-methyl- 1 -oxo-4-(prop-1 -en-2-y1)-1H-isochromen-6-y1)-2,4-dihydro-3H-1,2,4-triazol-3-one.
[0427] To a mixture of 4-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-triazol--y1)-2-bromo-5-methylbenzoi c acid (560 mg, 1.26 mmol), 3-methyl buta-1,2-di en-l-yl acetate (Intermediate 12, 1.58 g, 12.5 mmol), AcOK (369 mg, 3.76 mmol) and TBAB (809 mg, 2.51 mmol) in DMF (3.9 mL) under nitrogen was added Pd(OAc)2 (141 mg, 0.63 mmol).
The reaction mixture was stirred under nitrogen at 90 C for overnight. The mixture was cooled to room temperature, diluted with Et0Ac, and washed with brine. The organic layer was separated, and the aqueous layer was extracted with Et0Ac. The combined organic layers were combined, dried over Na2SO4, filtered, and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 - 70% Et0Ac in petroleum ether) to give the title compound as a yellow solid (410 mg, yield: 73%). ESI-MS: mass calcd. for C25H25N304, 431.2;
m/z found, 432.1 [M+H] . 1H NIVIR (400 MHz, CDC13) 6 8.28 (s, 1 H), 7.59 (s, 1 H), 7.31 -7.46 (m, 5 H), 7.17 (s, 1 H), 5.30 - 5.37 (m, 1 H), 5.15 (s, 1 H), 4.63 (s, 2 H), 4.52 (s, 2 H), 3.87 (q, 1=7.1 Hz, 2 H), 2.46 (s, 3 H), 2.10 (s, 3 IT), 1.38 (t, = 7.2 Hz, 31-1) ppm.
Intermediate 10: Isopropyl 6-(3 -((benzyloxy)methyl)-4-ethyl-5-oxo-4, 5-dihy dro-1H-1, 2,4-tri azol-1-y1)-2-chl oro-5 -fl uoroni coti nate.
/--OBn CI N
reA
\r0 [0428] Step A. 2,6-Dichloro-5-fluoronicotinoyl chloride.
[0429] To a solution of 2,6-dichloro-5-fluoronicotinic acid (20 g, 95 mmol) in THF (200 mL) was added (C0C1)2 (12.7 g, 10.0 mmol) and DMF (69.6 mg, 0.952 mmol) at 0 C
dropwise.
The mixture was stirred at 0 C for 30 min, then warmed to 25 C, and stirred for 1 h. The reaction mixture was concentrated under reduced pressure to afford desired product (21.7 g, crude) as a colorless oil, which was used without further purification.
[0430] Step B. Isopropyl 2,6-dichloro-5-fluoronicotinate.
[0431] To a mixture of propan-2-ol (8.56 g, 142 mmol, 10.9 mL) and pyridine (9.02 g, 114 mmol) in THF (200 mL) was added a solution of 2,6-dichloro-5-fluoronicotinoyl chloride (21.7 g, 96.0 mmol) in THF (50 mL) at 0 C. The mixture was stirred at 25 C for 1 h. The mixture was poured into water (300 mL). The aqueous phase was extracted with ethyl acetate (300 mL).
The combined organic phase was dried with anhydrous Na2SO4, filtered and concentrated. The residue was purified by column chromatography (SiO2, Petroleum ether/Ethyl acetate=1/1 to 10:1) to afford the title compound (21 g, 86.82% yield). MS (ESI): mass calcd.
for C9H8C12FN02, 250.1; m/z found, 252.0 [M+H]+. 1H NMR (400 MHz, CDC13) 6 7.97 -7.95 (d, J= 7.2 Hz, 1H), 5.32 - 5.25 (m, 1H), 1.58 - 1.39 (in, 6H) ppm.
[0432] Step C. Isopropyl 6-(3-((benzyloxy)methyl)-4-ethyl-5-oxo-4,5-dihydro-1H-1,2,4-tri azol-1-y0-2 -chloro-5 -fl uoroni cotinate.
[0433] To a mixture of isopropyl 2,6-dichloro-5-fluoronicotinate (4 g, 15.87 mmol) in DMSO
(40 mL) was added 3-((benzyloxy)methyl)-4-ethyl-1H-1,2,4- triazol-5(4H)-one (3.89 g, 16.66 mmol) and K2CO3 (3.29 g, 23.80 mmol). The mixture was stirred at 80 C for 3 hr. LCMS
showed the starting material was consumed and desired mass was detected. The mixture was diluted with H20 (30 mL) and extracted with Et0Ac (50 mL x 3). The combined organic layers were washed with brine (100 mL), dried over Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, Petroleum ether/Ethyl acetate=1/0 to 1:1) to afford the title compound (5.7g, 79.86% yield). MS
(ESI): mass calcd.
for C21H22C1FN404, 448.1; m/z found, 449.2 [M+H]+. 1H NMR (400 MHz, CDC13) 6 8.10 (d, J= 8.8 Hz, 1H), 7.43 - 7.31 (m, 5H), 5.30 (td, J= 6.3, 12.5 Hz, 1H), 4.61 (s, 2H), 4.54 (s, 2H), 3.85 (q, J= 7.2 Hz, 2H), 1.41 (d, J= 6.2 Hz, 6H), 1.37 - 1.31 (m, 3H) ppm.
Intermediate 11: 5-((B enzyl oxy)m ethyl)-4-ethy1-2-(7-fluoro-3 -hy droxy-4-i sopropy1-1-oxoi sochrom an-6-y1)-2,4- di hy dro-3H-1,2,4-tri azol-3 -one.
Fy N N OH
Bn0 [0434] Step A. Methyl 4-(3-((benzyl oxy)methyl)-4-ethyl -5-oxo-4, 5-di hydro-1H-1,2,4-tri azol -1-y1)-2-bromo-5-fluorobenzoate.
[0435] To a flask charged with methyl 2-bromo-4,5-difluorobenzoate (100.0 g, 398 mmol), 5-((b enzyl oxy)m ethyl)-4-ethy1-2,4-dihy dro-3H-1,2,4-tri azol-3 -one (Intermediate 1, 113.5 g, 508 mmol) and K2CO3 (100.0 g, 724 mmol) was added anhydrous DNIF (1000 mL). The reaction mixture was heated under nitrogen at 50 C for 16 h, and then additional 5-((benzyloxy)methyl)-4-ethy1-2,4-dihydro-3H-1,2,4-triazol-3-one (11 g, 51 mmol) was added.
The reaction mixture continued to be stirred at 50 C. The mixture was cooled to room temperature and stirred for 10 min. Water (1000 mL) was added dropwise, and the mixture was stirred at room temperature for 2 h. The precipitate was collected by filtration and dried to give the crude product (190 g). The product was stirred in DMF (500 mL) for 30 min, then water (500 mL) was added. The mixture was stirred for 2 h. The precipitate was collected by filtration and dried to give the title compound (180 g, yield: 90%). 1H NMR (300 MHz, CDC13) 6 7.95 (d, J= 6.7 Hz, 1H), 7.73 (d, J= 10.7 Hz, 1H), 7.44-7.27 (m, 5 H), 4.60 (s, 2 H), 4.50 (s, 2 H), 3.95 (s, 3H), 3.84 (q, .1 = 7.2 Hz, 2 H), 1.34 (t, .1 = 7.2 Hz, 3 H) ppm.
[0436] Step B. 5 -((B enzyl oxy)methyl)-4-ethy1-2-(7-fluoro-3 -hydroxy -4-i sopropy1-1-oxoi sochrom an-6 -y1)-2,4-di hy dro-3H-1, 2,4-tri azol-3 -one.
[0437] To a mixture of methyl 4-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-2-bromo-5-fluorobenzoate (30 g, 65.9 mmol), Xantphos (4.02 g, 6.6 mmol), [Pd(ally1)C1]2 (1.38 g, 3.77 mmol), Cs2CO3 (42.6 g, 130 mmol) in dimethylacetamide (300 mL) was added 3-methylbutanal (41.4 mL, 386 mmol) slowly. The reaction mixture was heated under nitrogen at 80 C for 22 h. The mixture was filtered and quenched with aqueous NU1IC1 solution until "pH" turned 7-8. The mixture was extracted with ethyl acetate (2000 mL x2). The combined organic extract was concentrated. The residue was purified by column chromatography (SiO2, gradient elution: 1-33% ethyl acetate in petroleum ether) to give the title compound as an oil (61.7 g, yield: 56%). 111 NMIR (300 1V111z, CDC13) 6 7.93 (d, J = 10.4 Hz, 1H), 7.55 (d, J= 6.7 Hz, 1H), 7.44-7.28 (m, 5H), 5.92 (s, 1H), 4.61 (s, 2H), 4.51 (s, 2H), 4.37 (br s, 1H), 3.85 (q, J = 7.2 Hz, 2H), 2.80 (d, J= 7.1 Hz, 1H), 1.92 (spt, J= 6.8 Hz, 1H), 1.35 (t, J= 7.2 Hz, 3H), 1.05 (d, J= 6.8 Hz, 3H), 0.93 (d, 1= 6.8 Hz, 3H) ppm.
Intermediate 12: 3 -Methylbuta-1,2-di en-1 -y1 acetate.
[0438] Step A. 2-Methylbut-3-yn-2-y1 acetate.
[0439] To a mixture of Mg(C104)2 (796 mg, 3.6 mmol) in acetic anhydride (38 g, 371 mmol) at 0 C was added 2-methyl-3-butyn-2-ol (30 g, 357 mmol) dropwise. The reaction mixture was stirred at 0 'V for 10 min, then warmed to room temperature and stirred for overnight. The reaction mixture was diluted with DCM, then washed with aqueous saturated NaHCO3 solution and aqueous saturated Na2CO3 solution. The organic layer was separated, dried over Na2SO4, filtered and concentrated at 0 C. The residue was purified by silica column chromatography (elution: DCM) to give the title compound as pale yellow oil (35.8 g, yield:
80%). 1H NMR
(400 MHz, CDC13) 5 2.54 (s, 1 H), 2.03 (s, 3 H), 1.67 (s, 6 H) ppm.
[0440] Step B. 3-Methylbuta-1,2-dien-1 -y1 acetate.
[0441] To a solution of 2-methylbut-3-yn-2-y1 acetate (2.5 g, 20 mmol) in DCM
(20 mL) was added AgBF4 (117 mg, 0.6 mmol) under nitrogen. The resulting colorless solution was stirred under nitrogen at 35 C for 2 h until the mixture turned into a black solution. The mixture was washed with aqueous ammonia (10%). The organic layer was separated, and the aqueous layer was extracted with DCM. The combined organic layer was dried over Na2SO4, filtered and concentrated. The residue was purified by silica column chromatography (gradient elution: 0 ¨
3% Et0Ac in petroleum ether) to give the title compound as yellow oil (650 mg, yield: 26%).
1H NMR (400 MHz, CDC13) 5 7.20 (dt, J= 4.1, 2.0 Hz, 1 H), 2.11 (s, 3 H), 1.81 (d, J= 2.0 Hz, 6 H) ppm.
Example 22 of PCT/IB2020/053601 (which published as WO 2020/212897 on October 22, 2020) discloses 6-(4-Ethyl-3-(hydroxym ethyl)-5-oxo-4,5-di hydro- 1H-1,2,4-tri azol -1-y1)-7-fluoro-4-isopropy1-2-(o-tolyl)isoquinolin-1(2H)-one (Compound 22).
HO
1tII
Ns-2 N
[0442] Step A. 6-(3-((Benzyloxy)methyl)-4-ethyl-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropyl-2-(o-tolypisoquinolin-1(2H)-one.
[0443] To a mixture of 5-((benzyloxy)methyl)-4-ethy1-2-(7-fluoro-3-hydroxy-4-isopropyl-1-oxoisochroman-6-y1)-2,4-dihydro-3H-1,2,4-triazol-3-one (Intermediate 11, 56 g, 123 mmol) in AcOH (160 mL) was added o-toluidine (14.8 g, 138 mmol). The reaction mixture was heated at 80 C for 16 h. The mixture was concentrated, and then the -pH- was adjusted to 7-8 with aqueous NaHCO3 solution. The mixture was extracted with ethyl acetate (160 mL
x2). The combined organic extract was concentrated. The residue was purified by flash chromatography (SiO2, 0-20% Ethyl acetate in DCM) to give the title compound as an oil (32.5 g, yield: 50%).
MS (ESI): mass calcd. for C311-131FN403, 526.2; m/z found, 527.4 [M-F1-1] .
NMR (300 MHz, CDC13) 6 8.33 (d, J = 10.9 Hz, 1H), 8.07 (d, J = 6.8 Hz, 1H), 7.44-7.27 (m, 9H), 6.84 (s, 1H), 4.64 (s, 2H), 4.55 (s, 2H), 3.89 (q, J= 7.2 Hz, 2H), 3.23 (spt, J= 6.8 Hz, 1H), 2.16 (s, 3H), 1.39 (t, J= 7.2 Hz, 3H), 1.31 (dd, J= 6.8, 2.1 Hz, 6H) ppm.
[0444] Step B. 6-(4-Ethy1-3-(hydroxymethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-y1)-7-fluoro-4-isopropy1-2-(o-toly1)isoquinolin-1(2H)-one.
[0445] To a stirred solution of 6-(3-((benzyloxy)methyl)-4-ethy1-5-oxo-4,5-dihydro-1H-1,2,4-tri azol sopropy1-2-(o-tol yl)i soquinolin-1(2H)-one (26. 5 g, 50.3 mmol) in DCM (230 mL) at -78 C was added a DCM solution (1 M) of BC13 (290 mL, 290 mL) under nitrogen. The reaction mixture was stirred at 15 C for 0.5 h. The reaction was quenched by Me0H (100 mL) at -78 C to -20 C. The mixture was partitioned between water and DCM. The organic layer was separated, and the aqueous layer was extracted with DCM (110 mL x 2). The combined organic extract was washed with brine (30 mLx2), dried with anhydrous Na2SO4, filtered, and concentrated to give a crude product (27.5 g). The product was triturated with methyl ethyl ketone (82 mL) and heptane (290 mL) to give a pure product (17.5 g), which was re-crystallized in ethanol and water to give the title compound as a white solid (16 g, yield:
73%). MS (ESI): mass caled. for C24H25FN403, 436.2; m/z found, 437.2 [M+Hr 11-INMR (400 MHz, CDC13) 6 8.33 (d, J = 11.2, 1 H), 8.08 (d, 1= 6.8, 1 7.39-7.33 (m, 3 H), 7.28 (s, 1 H), 6.85 (s, 1 H), 4.69 (br s, 2 H), 3.94 (q, J= 7.11 Hz, 2 H), 3.27 (td, J=
13.66, 6.82 Hz, 1 H), 2.32 (br s, 1 H), 2.17 (s, 3 H), 1.45 (t, J = 7.11 Hz, 3 H), 1.32 (dd, J =
6.82, 1.83 Hz, 6 H) ppm.
[0446] It is noted that compounds of Formula (Z) described herein are described in PCT/IB2020/053601 (which published as WO 2020/212897 on October 22, 2020), which is incorporated by reference herein, in its entirety for all purposes.
[0447] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent.
[0448] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a hypomethylating agent.
[0449] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a hypomethylating agent.
[0450] According to embodiments, the hypomethylating agent is azacitidine, decitabine, or pharmaceutically acceptable salts or solvates thereof.
[0451] According to particular embodiments, the hypomethylating agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0452] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof and a BCL-2 inhibitor.
[0453] In some embodiments, provided is a combination therapy consisting of a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof and a BCL-2 inhibitor.
[0454] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0455] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0456] In some embodiments, provided is a combination therapy comprising Compound Al and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0457] In some embodiments, provided is a combination therapy comprising Compound A2 and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0458] In some embodiments, provided is a combination therapy comprising Compound A3 and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0459] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0460] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0461] In some embodiments, provided is a combination therapy comprising Compound A4 and venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
[0462] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0463] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof, and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0464] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof [0465] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof [0466] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0467] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0468] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0469] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0470] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0471] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0472] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof, and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0473] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0474] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0475] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0476] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0477] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0478] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0479] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
[0480] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0481] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0482] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0483] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof [0484] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof [0485] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0486] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0487] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0488] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is decitabine, or a pharmaceutically acceptable salt or solvate thereof.
[0489] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DNA intercalating agent.
[0490] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DNA intercalating agent [0491] According to embodiments, the DNA intercalating agent is an anthracycline.
[0492] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an anthracycline.
[0493] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an anthracycline.
[0494] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0495] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0496] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0497] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0498] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0499] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0500] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is an anthracycline.
[0501] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a pyrimidine analog [0502] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a pyrimidine analog.
[0503] According to embodiments, the pyrimidine analog is cytarabine.
[0504] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is cytarabine.
[0505] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is cytarabine [0506] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0507] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0508] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0509] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0510] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0511] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine.
[0512] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is cytarabine [0513] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a purine analog.
[0514] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a purine analog.
[0515] According to embodiments, the purine analog is fludarabine.
[0516] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is fludarabine [0517] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is fludarabine [0518] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0519] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0520] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0521] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0522] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0523] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0524] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is fludarabine.
[0525] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an IDH inhibitor.
[0526] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an isocitrate dehydrogenase-1 inhibitor (e.g., ivosidenib) [0527] According to embodiments, the IDH inhibitor is ivosidenib.
[0528] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ivosidenib [0529] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ivosidenib.
[0530] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0531] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0532] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0533] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib [0534] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0535] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0536] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ivosidenib.
[0537] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an isocitrate dehydrogenase-2 inhibitor (e.g., enasidenib).
[0538] According to embodiments, the 1DH inhibitor is enasidenib.
[0539] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is enasidenib.
[0540] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is enasidenib.
[0541] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib [0542] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib.
[0543] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib.
[0544] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib.
[0545] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib [0546] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib.
[0547] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is enasidenib.
[0548] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an immunomodulatory antineoplastic agent.
[0549] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an immunomodulatory antineoplastic agent which is a PD-1 inhibitor.
[0550] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an immunomodulatory antineoplastic agent.
[0551] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is an immunomodulatory antineoplastic agent which is a PD-1 inhibitor.
[0552] According to embodiments, the immunomodulatory antineoplastic agent is nivolumab, atezolizumab, pembrolizumab, thalidomide, lenalidomide, pomalidomide, Bacillus Calmette¨
Guerin (BCG) or levamisole.
[0553] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is nivolumab.
[0554] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is nivolumab.
[0555] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab.
[0556] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab.
[0557] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab.
[0558] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab [0559] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab.
[0560] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab.
[0561] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is nivolumab [0562] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is atezolizumab.
[0563] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is atezolizumab [0564] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0565] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0566] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0567] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0568] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0569] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab [0570] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is atezolizumab.
[0571] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is pembrolizumab.
[0572] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is pembrolizumab.
[0573] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0574] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0575] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0576] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0577] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0578] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab [0579] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pembrolizumab.
[0580] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is thalidomide.
[0581] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is thalidomide.
[0582] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide [0583] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0584] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0585] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0586] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0587] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0588] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is thalidomide.
[0589] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is lenalidomide.
[0590] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is lenalidomide.
[0591] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0592] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0593] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0594] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0595] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0596] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0597] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lenalidomide.
[0598] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is pomalidomide.
[0599] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is pomalidomide.
[0600] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide [0601] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide.
[0602] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide.
[0603] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide [0604] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide.
[0605] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide.
[0606] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is pomalidomide.
[0607] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is BCG.
[0608] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is BCG.
[0609] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG
[0610] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG.
[0611] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG
[0612] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG.
[0613] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG.
[0614] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG.
[0615] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is BCG.
[0616] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is 1 evami sole [0617] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is levamisole.
[0618] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0619] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0620] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole [0621] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0622] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0623] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0624] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is levamisole.
[0625] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DHODH inhibitor.
[0626] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DHODH inhibitor.
[0627] According to embodiments, the DHODH inhibitor is a compound of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0628] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0629] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0630] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH
inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0631] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0632] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0633] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0634] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0635] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof [0636] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof.
[0637] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a kinase inhibitor.
[0638] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a kinase inhibitor.
[0639] According to embodiments, the kinase inhibitor is a serine and/or tyrosine kinase inhibitor.
[0640] According to embodiments, the kinase inhibitor is an inhibitor of FLT3 and/or BTK
[0641] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a FLT3 inhibitor.
[0642] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a FLT3 inhibitor.
[0643] According to embodiments, the FLT3 inhibitor is sorafenib, sunitinib, midostaurin (PKC412), lestaurtinib (CEP-701), tandutinib (MLN518), quizartinib (AC220), gilteritinib (ASP2215), or KW-2449.
[0644] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is sorafenib [0645] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is sorafenib.
[0646] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0647] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0648] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0649] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0650] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0651] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0652] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sorafenib.
[0653] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is sunitinib.
[0654] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is sunitinib.
[0655] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0656] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0657] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0658] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0659] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0660] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib.
[0661] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is sunitinib [0662] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is midostaurin.
[0663] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is midostaurin [0664] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin [0665] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin.
[0666] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin.
[0667] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin.
[0668] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin.
[0669] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin.
[0670] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is midostaurin [0671] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is lestaurtinib [0672] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is lestaurtinib.
[0673] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0674] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0675] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0676] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0677] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0678] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0679] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is lestaurtinib.
[0680] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is tandutinib.
[0681] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is tandutinib [0682] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0683] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0684] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0685] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0686] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0687] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0688] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is tandutinib.
[0689] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is AC220.
[0690] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is AC220.
[0691] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220.
[0692] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220 [0693] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220.
[0694] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220.
[0695] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220 [0696] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220 [0697] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is AC220.
[0698] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ASP2215.
[0699] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ASP2215.
[0700] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0701] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0702] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0703] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0704] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0705] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0706] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ASP2215.
[0707] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is KW-2449.
[0708] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is KW-2449.
[0709] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0710] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0711] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0712] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449 [0713] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0714] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0715] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is KW-2449.
[0716] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a BTK inhibitor.
[0717] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a BTK inhibitor.
[0718] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0719] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0720] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0721] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0722] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0723] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0724] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a BTK inhibitor.
[0725] According to embodiments, the BTK inhibitor is ibrutinib [0726] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ibrutinib.
[0727] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is ibrutinib [0728] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib.
[0729] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib [0730] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib [0731] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib [0732] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib.
[0733] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib.
[0734] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is ibrutinib [0735] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a CD20 inhibitor.
[0736] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is a CD20 inhibitor.
[0737] According to embodiments, the CD20 inhibitor is an anti-CD20 antibody, in particular obinutuzumab (GA101).
[0738] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0739] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0740] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0741] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0742] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0743] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0744] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is a CD20 inhibitor.
[0745] In some embodiments, provided is a combination therapy comprising a menin-MILL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, a BCL-2 inhibitor and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is GA101.
[0746] In some embodiments, provided is a combination therapy comprising a menin-MLL
inhibitor of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent, wherein at least one other antineoplastic agent is GA101 [0747] In some embodiments, provided is a combination therapy comprising Compound A or a pharmaceutically acceptable salt or solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0748] In some embodiments, provided is a combination therapy comprising Compound Al, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0749] In some embodiments, provided is a combination therapy comprising Compound A2, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0750] In some embodiments, provided is a combination therapy comprising Compound A3, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0751] In some embodiments, provided is a combination therapy comprising Compound A4-a or a solvate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0752] In some embodiments, provided is a combination therapy comprising Compound A4-b or a hydrate thereof, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0753] In some embodiments, provided is a combination therapy comprising Compound A4, venetoclax, or a pharmaceutically acceptable salt or solvate thereof and at least one other antineoplastic agent is GA101.
[0754] All possible combinations of the above indicated embodiments are considered to be embraced within the scope of the invention [0755] In some embodiments, provided are methods for treating a subject who has been diagnosed with a hematopoietic disorder. The present invention relates, for example, to novel methods that comprise administering to the subject a therapeutically effective amount of a menin-MLL inhibitor as described herein; and a therapeutically effective amount of a BCL-2 inhibitor; and optionally, a therapeutically effective amount of at least one other antineoplastic agent.
[0756] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof is administered orally to a subject.
[0757] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered in a dose of from about 1 mg/kg to about 50 mg/kg to the subject.
[0758] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered in a dose of from about 2.5 mg/kg to about 25 mg/kg to the subject.
[0759] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered in a dose of from about 7.5 mg/kg to about 12.5 mg/kg to the subject.
[0760] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered in a dose of from about 8 mg/kg to about 10 mg/kg to the subject.
[0761] An additional embodiment of the invention relates to methods as described herein wherein the compound of Formula (1), or a pharmaceutically acceptable salt or a solvate thereof is administered in a dose of from about 0.1 mg to about 5 mg to the subject.
[0762] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered orally to a subject.
[0763] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered in a dose of from about 1 mg/kg to about 50 mg/kg to the subject.
[0764] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered in a dose of from about 2.5 mg/kg to about 25 mg/kg to the subject.
[0765] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered in a dose of from about 7.5 mg/kg to about 12.5 mg/kg to the subject.
[0766] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered in a dose of from about 8 mg/kg to about 10 mg/kg to the subject.
[0767] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered in a dose of from about 0,1 mg to about 5 mg to the subject.
[0768] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered to the subject intravenously or subcutaneously.
[0769] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered intravenously or subcutaneously in a dose of from about 10 mg/m2 to about 250 mg/m2 to the subject.
[0770] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered intravenously or subcutaneously in a dose of from about 50 mg/m2 to about 150 mg/m2 to the subject.
[0771] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered intravenously or subcutaneously in a dose of from about 60 mg/m2 to about 100 mg/m2 to the subject.
[0772] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered intravenously or subcutaneously in a dose of about 75 mg/m2 to the subject.
[0773] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered to the subject orally in a dose of from about 1 mg to about 500 mg to the subject.
[0774] An additional embodiment of the invention relates to methods for treating a subject who has been diagnosed with cancer (e.g., wherein the cancer is a hematopoietic disorder, such as myelodysplastic syndrome (MDS), acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL), a small lymphocytic lymphoma (SLL) or chronic lymphocytic leukemia (CLL)), wherein the method comprises administering to the subject:
a therapeutically effective amount of a menin-MLL inhibitor of Formula (I), or a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt or a solvate thereof; and a therapeutically effective amount of a DHODH inhibitor of Formula (Z), or a pharmaceutically acceptable salt, isotope, N-oxide, solvate, or stereoisomer thereof;
for example, wherein the menin-MLL inhibitor and the DHODH inhibitor are administered in accordance with their dosing schedules for a time period, e.g., (i) simultaneously or sequentially in either order on the same day(s) within a time period (e.g., a 21-day period, or a 28-day period, or a 3-month period, or a 6-month period, or a one-year period, etc.), and/or (ii) on different days within a time period.
[0775] An additional embodiment of the invention relates to methods for treating a subject who has been diagnosed with cancer (e.g., wherein the cancer is a hematopoietic disorder, such as myelodysplastic syndrome (MDS), acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL), a small lymphocytic lymphoma (SLL) or chronic lymphocytic leukemia (CLL)), wherein the method comprises administering to the subject:
a therapeutically effective amount of a menin-MLL inhibitor that is Compound A
or a pharmaceutically acceptable salt or solvate thereof (e.g., Compound Al, or Compound A2, or Compound A3, or Compound A4-a or a solvate thereof, or Compound A4-b or a hydrate thereof, or Compound A4); and a therapeutically effective amount of a DHODH inhibitor that is Compound 22 or a pharmaceutically acceptable salt, solvate, stereoisomer, isotopic variant, or N-oxide thereof (e.g., 6-(4-Ethyl -3 -(hy droxym ethyl)-5-oxo-4,5-di hy dro-1H-1,2,4-tri azol -1 -y1)-7-fluoro-4-i sopropy1-2-(o-tolypi soquinolin-1(2H)-one);
for example, wherein the menin-MLL inhibitor and the DHODH inhibitor are administered in accordance with their dosing schedules for a time period, e.g., (i) simultaneously or sequentially in either order on the same day(s) within a time period (e.g., a 21-day period, or a 28-day period, or a 3-month period, or a 6-month period, or a one-year period, etc.), and/or (ii) on different days within a time period.
[0776] An additional embodiment of the invention relates to methods as described herein wherein compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered to the subject daily.
[0777] An additional embodiment of the invention relates to methods as described herein wherein compound of Formula (I), or a pharmaceutically acceptable salt or a solvate thereof is administered to the subject daily for at least 7 days.
[0778] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered to the subject daily.
[0779] An additional embodiment of the invention relates to methods as described herein wherein the BCL-2 inhibitor is administered to the subject daily for at least 7 days.
[0780] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered to the subject daily.
[0781] An additional embodiment of the invention relates to methods as described herein wherein at least one other antineoplastic agent is administered to the subject daily for at least 21 days.
[0782] Optimal dosages of any of the therapeutic compounds described herein to be administered may be readily determined and will vary with the particular compound used, the mode of administration, the strength of the preparation, and the advancement of the disease, syndrome, condition or disorder. In addition, factors associated with the particular subject being treated, including subject gender, age, weight, diet and time of administration, will result in the need to adjust the dose to achieve an appropriate therapeutic level and desired therapeutic effect.
[0783] The above dosages are thus exemplary of the average case. There can be, of course, individual instances wherein higher or lower dosage ranges are merited, and such are within the scope of this invention.
[0784] The therapeutic compounds described herein may be administered in any of the foregoing compositions and dosage regimens or by means of those compositions and dosage regimens established in the art whenever use of the therapeutic compounds described herein is administered to a subject in need thereof [0785] The therapeutic compounds described herein may be administered to the subject simultaneously or sequentially.
[0786] When administered sequentially, the menin-lVILL inhibitor of Formula (I) may be administered first. When administration is simultaneous, the combination may be administered either in the same or a different pharmaceutical composition. For instance, the menin-MLL
inhibitor of Formula (I) may be administered prior to, simultaneous with, or after the administration of the BCL-2 inhibitor. For instance, the BCL-2 inhibitor may be administered prior to, simultaneous with, or after the administration of the optional other antineoplastic agent.
Adjunctive therapy, i.e., where one or two agent(s) are used as the primary treatment and the other agent is used to assist that primary treatment, is also an embodiment of the present invention.
[0787] An embodiment of the invention relates to a therapeutically effective amount of a menin-MLL inhibitor including the compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the embodiments, for use in combination with a therapeutically effective amount of a BCL-2 inhibitor; and optionally, a therapeutically effective amount of at least one other antineoplastic agent. In certain embodiments, the aforementioned therapeutically effective amounts are administered in separate dosage forms for use in treating a subject who has been diagnosed with a hematopoietic disorder.
[0788] An embodiment of the invention relates to a pharmaceutical product including a menin-MILL inhibitor of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the embodiments, and a BCL-2 inhibitor; and optionally, at least one other antineoplastic agent as a combined preparation for simultaneous, separate or sequential use in treating a subject who has been diagnosed with a hematopoietic disorder.
[0789] The following Examples are provided to illustrate some of the concepts described within this disclosure. While the Example is considered to provide an embodiment, it should not be considered to limit the more general embodiments described herein.
EXAMPLES
General Synthetic Schemes Venetoclax [0790] Venetoclax is available commercially.
Azacitidine [0791] Azacitidine is available commercially.
Compounds of Formula I
[0792] In this section, as in all other sections unless the context indicates otherwise, references to Formula (I) also include all other sub-groups and examples thereof as defined herein.
[0793] The general preparation of some typical examples of the compounds of Formula (I) is described hereunder and in the specific examples, and are generally prepared from starting materials which are either commercially available or prepared by standard synthetic processes commonly used by those skilled in the art of organic chemistry. The following schemes are only meant to represent examples of the invention and are in no way meant to be a limit of the invention.
[0794] Alternatively, compounds of Formula (I) may also be prepared by analogous reaction protocols as described in the general schemes below, combined with standard synthetic processes commonly used by those skilled in the art.
[0795] The skilled person will realize that in the reactions described in the Schemes, although this is not always explicitly shown, it may be necessary to protect reactive functional groups (for example hydroxy, amino, or carboxy groups) where these are desired in the final product, to avoid their unwanted participation in the reactions. In general, conventional protecting groups (PG) can be used in accordance with standard practice. The protecting groups may be removed at a convenient subsequent stage using methods known from the art.
[0796] The skilled person will realize that in the reactions described in the Schemes, it may be advisable or necessary to perform the reaction under an inert atmosphere, such as for example under N2-gas atmosphere.
[0797] It will be apparent for the skilled person that it may be necessary to cool the reaction mixture before reaction work-up (refers to the series of manipulations required to isolate and purify the product(s) of a chemical reaction such as for example quenching, column chromatography, extraction).
[0798] The skilled person will realize that heating the reaction mixture under stirring may enhance the reaction outcome. In some reactions microwave heating may be used instead of conventional heating to shorten the overall reaction time.
[0799] The skilled person will realize that another sequence of the chemical reactions shown in the Schemes below, may also result in the desired compound of Formula (I).
[0800] The skilled person will realize that intermediates and final compounds shown in the Schemes below may be further functionalized according to methods well-known by the person skilled in the art. The intermediates and compounds described herein can be isolated in free form or as a salt, or a solvate thereof. The intermediates and compounds described herein may be synthesized in the form of mixtures of tautomers and stereoisomeric forms that can be separated from one another following art-known resolution procedures.
[0801] All abbreviations used in the general schemes for Formula (I) are as defined in Table 1B below in the part Examples. Variables are as defined in the scope or as specifically defined in the general Schemes.
Part A) Schemes la, lb, lc, 2a, 2b and 3 Rn = C1_6alkyl-NR8aPG or C1_6alkyl-OPG or C1_6alkyl-C(=0)0R9', PG = protecting group Scheme la 0 k ,PG halo Step 1 R4_, ,Ci.6alkyl-NHPG
+ I. If , R4 -Mg 0 Ci_6alkyl' HO Rn ________________________ Step 2 H Rn + R4 _ivighalo Step 3 R4, ,Rn Step 2 R4, ,Rn ).- y _________________________________________________ > T
---- __________________________________________________________________ >
o OH
_ PG step 4 HO Rn Step 5 N Rn halo Step 6 R4 Rn ,'- N-, _______________________________ 43- y + R4-Mg or R4 Li 1- ---Tr-, . 0 C1 .6alkyl' Scheme lb HO, _OH
4:11 + e gab OH Step 7 __________________________________________________________ ).- 0 OH }
halo Riblitillij R1' Rib OH
Rxb Rxb , 4 0 , r:, 0 Rib Rxa Rxb Step 5 Rxa Step 8 Rxa b ,+ -N-H
Ri R16el Rib Scheme lc PG
PG N
N halo n3(X)n4 r13% + )n4 hal ' J,õ Step 9 n1( )n2 U
I _________________________________________________ J.-- N
n1( )n2 N,-51, N half,i) H I
N N../.., [0802] In Scheme la, lb and lc the following reaction conditions apply.
[0803] Step 1: at a suitable temperature such as for example -70 C, in the presence of a suitable base such as for example TMEDA and a suitable organometallic reagent such as for example isopropylmagnesium bromide, in a suitable solvent such as for example THF;
[0804] Step 2: at a suitable temperature such as for example from 0 C to RT, in the presence of a suitable oxidative reagent such as for example DMP, in a suitable solvent such as for example DCM;
[0805] Step 3: at a suitable temperature such as for example from -20 C to RT, in the presence of a suitable organometallic reagent such as for example isopropylmagnesium bromide, in a suitable solvent such as for example THF;
[0806] Step 4: at a suitable temperature such as for example 80 C, in the presence of a suitable base such as for example NaOH, in suitable solvents such as for example THY
and H20;
[0807] Step 5: at a suitable temperature such as for example RT, in the presence of suitable amide condensation reagents such as for example EDCI and HOBt, in the presence of a suitable base such as for example NiVEVI, in a suitable solvent such as for example DCM;
[0808] Step 6: at a suitable temperature such as for example -70 C, in the presence of a suitable organometallic reagent such as for example isopropyllithium, in a suitable solvent such as for example THE;
[0809] Step 7: at a suitable temperature such as for example 90 C, in the presence of a suitable organometallic catalyst such as for example Pd(dppf)C12, in the presence of a suitable base such as for example Na2CO3, in suitable solvents such as for example 1,4-dioxane and H20;
[0810] Step 8: at a suitable temperature such as for example from 0 C to RT, in the presence of a suitable Lewis acid such as for example BBr3, in a suitable solvent such as for example DCM;
[0811] Step 9: at a suitable temperature such as for example from -78 C to 40 'V, in particular from 0 C to RT, in the presence of a suitable base such as for example TEA, DBU or K2CO3, in a suitable solvent such as for example DCM, TETT or DIVIT;
Scheme 2a PG PG
PG
I N
N
N
Rla n3(X)n4 n3()n2 )n4 n3%)n4 OH
Step 9), n1( Step 10 n1( )n2 n1( )n2 N Rla Rib + . ''.- hale, U o)-1N R2 = halo 1j1 I
R1' IV-I%1 N-N-,, -,--, R2 N-N/I,R2 R1 bill.
Step 11 1 R2 = H
R4Rn H
N
N n3(X)n4 n3()n4 R4 ,, Rn n1(X )n2 11õ n1( )n2 0 Wa N
Ri a N
-.4 ______________________________________________________________ Rib 0-11)'-= Step 12 u I
N-N.) 0 NI,N Rib.
Scheme 2b n3( )X
n1( )n2 0 PG
Step 12 R4 Rn R4,y, Rn Step 11 N R4 Rn n3()n4 n3( )n4 n1( )n2 n1( )n2 n3(X)n4 PG Step 14 n1( )n2 R1 a R1 a R1a OH
Step 13OyN IV
R
oN Rib N NN
Rib ib Step 41 Rla -C1_4alkyl ON
R1b NN%
1 Step 9 Ria 0 0 'Ci_4alkyl OH + CI 1N
R" NNJ
[0812] In Scheme 2a and 2b, the following reaction conditions apply:
[0813] Step 9: See Step 9 in Scheme 1;
[0814] Step 10: at a suitable temperature such as for example RT, in the presence of a suitable catalyst such as for example Pd/C, in the presence of a suitable reductive reagent such as for example H2, optionally in the presence of a suitable base such as for example TEA, in a suitable solvent such as for example THF; Alternatively, at a suitable temperature such as RT, in the presence of a suitable catalyst such as for example Pd(dpp0C12-13CM complex, a suitable reducing agent such NaBH4, a suitable base such as for example TMEDA, in a suitable solvent such as for example THF.
[0815] Step 11: for N deprotection, at a suitable temperature such as for example RT, in the presence of a suitable acid as for example TFA, in a suitable solvent such as for example DCM;
for 0 deprotection, at a suitable temperature such as for example RT, in the presence of a suitable acid as for example 4-methylbenzenesulfonic acid, in a suitable solvent such as for example Me0H, [0816] Step 12: at a suitable temperature such as for example 80 C, optionally in the presence of a suitable Lewis acid such as for example ZnC12, in the presence of a suitable reductive reagent such as for example NaBH3CN, in a suitable solvent such as for example Me0H;
[0817] Step 13: at a suitable temperature such as for example RT, in the presence of a suitable organometallic catalyst such as for example Ag(Phen)20Tf, in the presence of a suitable brominating reagent such as for example 1,3-dibromo-1,3,5-triazinane-2,4,6-trione, in a suitable solvent such as for example DCE;
[0818] Step 14: at a suitable temperature such as for example RT, in the presence of a suitable chlorinating reagent such as for example oxalyl chloride, in the presence of DMF, in a suitable solvent such as for example DCM.
Scheme 3 y.
When Rn = C1_salkyl-NR8'PG R4 cioikyi-NR8aReb N
n3(X )n4 n1( )n2 R4yC1.Ealkyl-NR8aPG R4 C16alkyl-NHR8e 0 R1a N
N N abi rk,N
n1( n3(X)n4 n3(X)n4 <05/
isl, N
S,,,/ RibilliW )n2 Step 11 n1( )n2 R1' N _____ y N (31-)--u it CJ
,),,,, Febglam Rib 'N
124 yCi.oalkyl-NRii -C(=0)-0-C1_4alkyl-O-C(=0)-C1.4alkyl N
n3(X)n4 n1( )n2 Rla grah 0Nu Rib FtlIF N
When Rn = Ci_Galkyl-OPG R4i Ci _6alkyl-OPG R4,f, Ci_6alkyl-OH
N N
"3K ,)n4 n3(X)n4 Step 11 n1( )n2 ____ v) ___ n1( )n2 R1a N R1 t a N
iiiii Oyk,, u a (3?-'1_1 ' 1,1 Ribl NN Rib IPI .11P1' 'NJ
When Rn = C1_olkyl-C(=0)0R9 R4õCi.6alkyl-C(.0)0R9a Fl4, ,Ci.5alkyl-C(.0)-NRIaR91' T T
N N
n3(X)n4 n3(X)n4 Step 16 n1( )n2 _____ 7.-- n1( )n2 R1' N 121' N
gli lb NI, NI, 121 b.11'111IPP. N Rib"-LIPIP N
[0819] In Scheme 3, the following reaction conditions apply:
[0820] Step 11-12: See Step 11-12 in Scheme 2;
[0821] Step 15: at a suitable temperature such as for example 80 C, in the presence of a suitable base such as for example Cs2CO3, in suitable solvent such as for example DMF;
[0822] Step 16: at a suitable temperature such as for example 40 C, in the presence of a suitable base such as for example ammonia, in suitable solvent such as for example 1,4-dioxane.
Part B) Schemes 4, 5, 6, 7, 8, 9, 10, 11 and 12 Scheme 4 4 H0_13,0H
1) 0 + OH Step 1 _______________________________________________________ > / OH }
halo 1 R1a Rib -,,, Rib ..j.,,. OH
o i xb Rxb ' ,N a Rib X
O
+ Fe; .. Rxb Step 2 ., ___________________________________ ).- R..,N 0 Step 3 Rxa _______________________________________________________ ).-- OH
,.._,,,, Rib Rib Rib Ri a 0-,......,.õ.0,R9a Ri a 0,.,,,,.0, R9a Ria OOH
OH OH Jitep5 + Cl- - N Step 4 S
- -, N, -,J
N'N-,-- N, --õ,---Rib Rib N Rib N
R1a O'-:,--- OH
Ria OH R1a OCF3 0, Step 6 NI
N'N 0 --i----I Step N, .,,,,,/,- N,ie Rib Rib N Rib [0823] In Scheme 4, the following reaction conditions apply:
[0824] Step 1: at a suitable temperature such as for example 90 C, in the presence of a suitable organometallic catalyst such as for example Pd(dppf)C12, in the presence of a suitable base such as for example Na2CO3, in suitable solvents such as for example 1,4-dioxane and H20;
[0825] Step 2: at a suitable temperature such as for example RT, in the presence of suitable amide condensation reagent such as for example HATU, in the presence of a suitable base such as for example DIEA, in a suitable solvent such as for example DCM;
[0826] Step 3: at a suitable temperature such as for example from -78 C to RT, in the presence of a suitable Lewis acid such as for example BBr3, in a suitable solvent such as for example DCM;
[0827] Step 4: at a suitable temperature such as for example from -78 C to 40 C, in particular from 0 C to RT, in the presence of a suitable base such as for example TEA, DBU or K2CO3, in a suitable solvent such as for example DCM, THY or DMF;
[0828] Step 5: at a suitable temperature such as for example RT, in the presence of a suitable base such as for example LiORH20, in suitable solvents such as for example THF
and H20;
[0829] Step 6: at a suitable temperature such as for example RT, in the presence of a suitable organometallic catalyst such as for example Ag(Phen)20Tf, in the presence of a suitable brominating reagent such as for example 1,3-dibromo-1,3,5-triazinane-2,4,6-trione, in a suitable solvent such as for example DCE;
[0830] Step 7: at a suitable temperature such as for example RT, in the presence of a suitable brominating reagent such as 1,3-dibromo-1,3,5-tri azinane-2,4,6-tri one, in the presence of 2,2,2-trifluoroethan-1-ol as solvent.
Scheme 5 PG
PG
ll N
PG
N halo n3( ) )n4 R1a n3(X)n4 n3)n4 + hal,ort, Step 8 n1( )n2 Step +
R1 St 9 n1( )n2 '' U _____________________________ 1.- ,-.)./OH ___ )....-N
n1( )n2 halo I, ii ' II R1b ,,,-,--(3-1----LU
H
N. -R2 I
N,N ,i-,R
N
R1b R2 = hay 2 Step 11 Step 10 H PG
H
N N
N
n3(X)n4 n3(X)n4 n3%)n4 n1( )n2 Step 11 n1( )n2 Ria N Ri' N
NI' N.J l=
el I , N I
Kill Rib Rlb Rib -H
Rt_ ,R3 Rty,R3 I
N
N T halo n3(X)n4 n3( ) )n4 + RR3 Step 123._ n3(XN )n4 Step 11 N
halo) Step 8 ,, n1( )n2 X
0 n1( )n2 > n3( ) )n4 +
N
--.halo N n1( )n2 N.N
PIG N N
hahrz,) PG H
I --- N
N.N.J,, halo [0831] In Scheme 5, the following reaction conditions apply:
[0832] Step 8: at a suitable temperature such as for example from -78 C to 40 'V, in particular from 0 C to RT, in the presence of a suitable base such as for example TEA, DBU or K2CO3, in a suitable solvent such as for example DCM, THE or DMF;
[0833] Step 9: at a suitable temperature such as for example from -78 C to 40 C, in particular from 0 C to RT, in the presence of a suitable base such as for example TEA, DBU or K2CO3, in a suitable solvent such as for example DCM, TELF or DMF;
[0834] Step 10: at a suitable temperature such as for example RT, in the presence of a suitable organometallic catalyst as for example Pd/C and a suitable base as for example TEA, in a suitable solvent such as for example Me0H under H2 atmosphere;
[0835] Step 11: When PG is Boc, at a suitable temperature such as for example RT, in the presence of a suitable acid as for example TFA, in a suitable solvent such as for example DCM.
Scheme 6 (Rw)In m = 1, 2, 3 R4 C,,,alkyl-OPS Rw = H, CN, halo, OH, 0-C1alkyl (R.). N
Step 12 n3(X)n4 RAõCi.fialkyl-OPG _______ ).
if n1( )n2 0 Ria N
60,___õ,..
, ii H Feb 'N
N (R). (R,,)õ, n3(g)n4 R4,(04.6alkyl-OH R4.õ Ci,salkyl-LG
n1( )n2 T
We N N N
Step 12 n3(X)n4 Step 13 n3( _X)n4 0 ) _____________________ ) n1( )n2 ,....
n1( Au Rib 'N R1' N R1' N
(3 S ' --"I'-' 0 .0 124yC1.6alkyl-NRa'Rsb a ILI 7 n3(%
Rib R1e-Y
R4 Ci_Balkyl-OH HNRR'RRb (R).,,0 t''67v (R.).
...""9" ' R' n1( )n2 R4 Ci_5alkyl¨< ] R4 Ci_51kyl¨/( cnN.0`
Y o --r- H
R4 C15alkyl¨( 1 [1 0 n1( )n2 ..,,, , o: Step 12 ,,3(X)4 N
Step 15 n3r4 Rib -N--.õ,, _____________________ ) ' ___________________________________________ ).-n1( )n2 0 Rta N Rla N
Rib N Rib N
[0836] In Scheme 6, the following reaction conditions apply:
[0837] Step 12: reductive amination condition, at a suitable temperature such as for example from RT to 80 C, in the presence or absence of a suitable Lewis acid such as for example ZnC12 or an acid for example AcOH, in the presence of a suitable reducing agent such as for example NaBH3CN, in a suitable solvent such as for example Me0H;
[0838] Step 13: at a suitable temperature such as for example 0 C, in the presence of a suitable electrophile as for example MsCl, in the presence of a suitable base such as for example TEA, in a suitable solvent such as for example DCM;
[0839] Step 14: at a suitable temperature such as for example from 0 C to RT, in the presence of a suitable oxidizing agent as for example DAV, in a suitable solvent such as for example DCM, [0840] Step 15: at a suitable temperature such as for example 50 C, in the presence of a suitable acid as for example HC1, in a suitable solvent such as for example ACN;
[0841] Step 16: at a suitable temperature such as for example RT, in the presence or absence of a suitable base as for example TEA, in a suitable solvent such as for example TEIF.
Scheme 7 m = 1, 2, 3 Rw = H, ON, halo, OH, 0-C1.4alkyl (Rw)m H R4 Ci.Galkyl-NRgaRgb N
n3 ,)n4 N
(Rw). Step 12 Ri n3(X)n4 nif )n2 11 R1a N + R4. Ci_calkyl-NR8aRth ... -n1( )n2 N
R, NM + I I ri IRIE. N --N_,L,' R2 (R.A.
R4 Ci Balkyl-N123 PG Step 12 _ /Step12 or Step 17 (Fly.). (Rw).
(Rw)nl R4 Ci_0a1ky1-NR8ePG R4 01_6alkyl-NHR8a R
Ci_olkyl-NR"
n3()n4 Step 11 n3(X)n4 Step 17 n3(X )n4 Cr n1( )n2 n1( )n2 02N n1( )n2 R1a N 12 iF
1e N Rla N
0-'''''Ci,alkyl u el ii ___________________________________________________ 0 --,--0 --T)--,u 0}0"---'0)1'Ci_4alkyl _i----..- ,,,--I I 1 Y ul 1216,-----:õ._,, - N'N---)-õR2 --,_ ,--- N N --,:-1, R2 Rib ---,,,,-- N,N!---,R, Rib H
N
n3%)n4 (Rw)m (Rw)m n1( )n2 R4yCi.salky1-0(.0)0R9' R4 , C1.6alkyl-C(.0)-NRg'R9b R1' N -r--N N
n3(X)n4 n3(X)n4 II ill Step 12 Step 18 + FINR9'reb -)'-N,...",,R, n1( )n2 n1( )n2 Rib -I- R1' N R1a N
0, ------i R4yCi.olkyl-C(=0)0R9 R16 'N" R2 121b .----,..,..- N N,,,- ,R2 [0842] In Scheme 7, the following reaction conditions apply:
[0843] Step 11: When PG is Boc, at a suitable temperature such as for example RT, in the presence of a suitable acid as for example TFA, in a suitable solvent such as for example DCM;
[0844] Step 12: reductive amination condition, at a suitable temperature such as for example from RT to 80 C, in the presence or absence of a suitable Lewis acid such as for example ZnC12 or an acid for example AcOH, in the presence of a suitable reducing agent such as for example NaBH3CN, in a suitable solvent such as for example Me0H;
[0845] Step 17: at a suitable temperature such as for example from RT to 80 C, in the presence of a suitable base such as for example DIEA or Cs2CO3, in suitable solvent such as for example DCM or DMF;
[0846] Step 18: at a suitable temperature such as for example 40 'V, in the presence of a suitable base such as for example ammonia, in suitable solvent such as for 1,4-dioxane.
Scheme 8 Rta OH
, _.J-, 0 _ RtT,R3 R4,T,R3 Rib j f 1-õIN N
Ir , µ94 r.3%).4 n3(X= )n4 + n1( )n2 R1' N
n1( )n2 ,0S
N Ria 171--C F3 .µ . j1----:, H j II
AO Or ,o,J,N
Rib -.N'-- N-N
N--Rib 1 Step 10 R'1R3 RR3 R4r.R3 T
N N
N
RI n3(X)n4 n3(X)n4 n3(X)n4 j__ _OH Step 9 Step 21 --- -,--- + ________ n1( )n2 ).- __ n1( )n2 S¨ n1( )n2 N Ria N Rla N
Rtb hal.-1-- - 0 0 ' N
I
N,=
----(L-I N
'---(L-I N
N halo Rib N -N-1, halo Rib =
-N 0C1.4alkyl Step 20 ly Step 22 N
N n3( ) On4 n3(X)n4 n1( )n2 n1( )n2 Rla N
Ria N
o.--1---k N
1 f 1 NI
R1b N NR7aR7b Rtb [0847] In Scheme 8, the following reaction conditions apply:
[0848] Step 9: at a suitable temperature such as for example from -78 C to 40 C, in particular from 0 C to RT, in the presence of a suitable base such as for example TEA, DBU or K2CO3, in a suitable solvent such as for example DCM, Tlif or DMF;
[0849] Step 10: at a suitable temperature such as for example RT, in the presence of a suitable organometallic catalyst as for example Pd/C, optionally in the presence of a suitable base as for example TEA, in a suitable solvent such as for example Me0H under H2 atmosphere;
[0850] Step 19: at a suitable temperature such as for example RT, in the presence of a suitable chlorinating reagent such as for example oxalyl chloride, in the presence of DMF, in a suitable solvent such as for example DCM;
[0851] Step 20: at a suitable temperature such as for example 90 C, in the presence of a suitable nucleophilic amine, in a suitable solvent such as for example Et0H;
[0852] Step 21: at a suitable temperature such as for example RT, in the presence of a suitable acid such as for example HC1 in dioxane, in a suitable solvent such as for example Me0H;
[0853] Step 22: at a suitable temperature such as for example 110 "V, in the presence of a suitable boron reagent such as for example trimethylboroxine, in the presence of a suitable organometallic catalyst such as for example tetrakis(triphenylphosphine)palladium(0), in the presence of a suitable base such as for example K2CO3, in a suitable solvent such as for example 1,4-dioxane;
Scheme 9 CI CI
CO2C1_4alkyl Step 23 CO2C1_4alkyl Step 24 ¨0 n1(4)n2 + 1.----",ci ).-- n1( )n2 ¨)."- n1( )n2 N N N
PG PG PG
0 'N Step R4i,11,0H LC) Step 25 ll'ir-I-LO Step 260.. _________ ,_...---- Step 27 . R -4'--- Boco, R4 N __ I.- +
HN , NH .:,-.3.., ,--1\ Boc -Boc 0 0"-C\ Boc 0 0 HNIRsiRsb R8b R4 -,,,r,--, N - R8 b CI Step 29 N,R8b Step 30 NH , ) \ Step 31 8' HN kBa __ ). \ ______ ..- N
12 N-Rsb 'Boc n1( )112 R8'' + N n1( )n2 CI PG N
¨0 PG
n1( )n2 'N
PG
FeN_Rsb N 118' 1- -Isl N 128a R1' ) n2 + OH N 12811 n1( )n2 Step 33 0 N ___________________________________________ > 1.11{X
Step 34 N _____________________________ Raa __________________________________________ Step 32 N
_________________________ > halo halcLri R1bõN
rr1(X)n2 halo PG -;:d.., - N R2 "
1221 N,R8b R(--..õ...,-,N_R8b --r-N 148a N 1482 n1( )n2 _________ Step 35 ).- n1(X)n2 R1 N R2= halo R1' N
0 oI'N
N*
RR1"-N R2 Rib N -N
[0854] In Scheme 9, the following reaction conditions apply:
[0855] Step 23: at a suitable temperature such as for example from -78 C to -25 C, in the presence of suitable bases such as for example DMA and n-BuLi, in a suitable solvent such as for example THF;
[0856] Step 24: at a suitable temperature such as for example between -65 C
and ¨ 55 C, in the presence of suitable reducing agent such as for example DIBAL-H, in a suitable solvent such as for example toluene, preferably conducted in a suitable flow chemistry system, [0857] Step 25: first at a suitable temperature such as for example from -10 C to 10 C, in the presence of a suitable base such as for example DMAP, in the presence of a suitable condensation agent such as for example DCC, in a suitable solvent such as for example DCM;
then at a suitable temperature such as for example from -10 C to 0 C, in the presence of a suitable acid such as for example AcOH, in the presence of a suitable reducing agent such as for example NaBH4, in a suitable solvent such as for example DCM;
[0858] Step 26: in a suitable solvent such as for example toluene and heated to reflux;
[0859] Step 27: at a suitable temperature such as for example from -5 C to 5 C, in the presence of suitable reducing agent such as for example LiBH4, in a suitable solvent such as for example 2-methyltetrahydrofuran;
[0860] Step 28: at a suitable temperature such as for example from 15 'V to 25 'V, in the presence of a suitable reducing agent such as for example NaBH(OAc)3, in a suitable solvent such as for example DCM;
[0861] Step 29: at a suitable temperature such as for example from 15 C to 25 'V, in the presence of a suitable acid such as for HC1, in a suitable solvent such as for example IPA;
[0862] Step 30: at a suitable temperature such as for example from 5 C to 30 C, in the presence of a suitable base such as for example TEA, in the presence of suitable reducing agent such as for example NaBH(OAc)3, in a suitable solvent such as for example toluene;
[0863] Step 31: at a suitable temperature such as for example from 50 C to 55 C, in the presence of a suitable base such as for example K2HPO4, in a suitable solvent such as for example H20;
[0864] Step 32: When PG is Bn at a suitable temperature such as for example from -5 C to 45 'V, under a hydrogen atmosphere within a suitable pressure range such as for example from 0.27 to 0.40 MPa, in the presence of a suitable catalyst such as for example palladium hydroxide on carbon, in the presence of a suitable acid as for example MSA in a suitable solvent such as Et0H;
[0865] Step 33: at a suitable temperature such as for example from -50 C to -40 C, in the presence of suitable base such as for example TEA, in a suitable solvent such as 2-methyltetrahydrofuran;
[0866] Step 34: at a suitable temperature such as for example from 20 C to 30 C, in the presence of suitable base such as for example TMG, in a suitable solvent such as 2-m ethy ltetrahy drofuran ;
[0867] Step 35: at a suitable temperature such as for example from 20 C to 30 C, under a hydrogen atmosphere within a suitable pressure range such as for example from 0.20 to 0.30 Mpa, in the presence of a suitable catalyst such as for example palladium on carbon, in a suitable solvent such as Me0H;
[0868] alternatively, at a suitable temperature such as room temperature, in the presence of a suitable catalyst such as for example I, F-Bis(diphenylphosphino)ferrocene-palladium(H) dichloride dichloromethane complex, a suitable reducing agent such sodium borohydride, a suitable base such as for example N,N,N',N'-tetramethylethylenediamine, in a suitable solvent such as for example tetrahydrofuran.
[0869] In general, compounds of Formula (1) wherein Y1 is limited to -CH2-, and R2 is limited to W1, hereby named compounds of Formula (Ia), can be prepared according to the following reaction Scheme 10. In Scheme 10, W1 represents chloro, bromo or iodo; all other variables are defined according to the scope of the present invention.
Scheme 10 R4i R3 R4Xi 'X ' n3(X)n4 Ria n3( )n4 CH2ZnBr Step 36 n1( )n2 n1( )n2 Ria R1b I U
N'Nhalo R1 NhaIo (la) [0870] In Scheme 10, the following reaction conditions apply:
[0871] Step 36: at a suitable temperature ranged from 60 C to 100 C, in presence of a suitable catalyst such as palladium acetate (Pd(OAc)2) or tris(dibenzylideneacetone)dipalladium(0) (Pd2(dba)3) or tetrakis(triphenylphosphine)palladium(0), in a suitable solvent such as for example tetrahydrofuran or dioxane.
[0872] The skilled person will realize that starting from compound (Ia), analogous chemistry as reported in step 10 in scheme 5 and in steps 20, 21 and 22 in scheme 8 could be performed.
[0873] In general, compounds of Formula (I) wherein Y' is limited to -CR5aR5b-and R2 is limited to Wl, hereby named compounds of Formula (Ib), can be prepared according to the following reaction Scheme 11. In Scheme 11 at least one of R5a and R5b is other than hydrogen.
All other variables are defined according to the scope of the present invention.
Scheme 11 'Xi n3(/) )n4 R1a R5a n3( )n4 R5b Step 37 niV n2 n1( )n2 RiaR5a R5b N
Rib w(LU U
N halo R1 halo (Lb) [0874] In Scheme 11, the following reaction condition apply:
[0875] Step 37: at a suitable temperature ranged from 80 C to 200 C, in presence of a suitable catalyst such as palladium acetate (Pd(OAc)2), in the presence of a suitable ligand such as for example triphenylphosphine or tricyclohexylphosphine, in a suitable solvent such as for example dioxane, preferably in sealed conditions, optionally under microwave irradiation.
[0876] The skilled person will realize that starting from compound (Ib), analogous chemistry as reported in step 10 in scheme 5 and in steps 20, 21 and 22 in scheme 8 could be performed.
Scheme 12 PG PG
Ri a n3(< )n4 n3( ) )n4 NHR5c n1( )n2 Step 38 n1( )n2 R1a R5c N
Rib halo RibXIII5 'N R2 [0877] In Scheme 12, the following reaction condition apply:
[0878] Step 38: at a suitable temperature such as for example from RT to 80 C, in the presence of a suitable base such as for example DIEA, Cs2CO3 or DBU, in suitable solvent such as for example DCM, THE or DMF;
[0879] Alternatively, at a suitable temperature such as for example RT to 100 C, in the presence of a suitable catalyst such as for example Pd2dba3, in the presence of a suitable ligand such as for example Xantphos, in the presence of a suitable base such as Cs2CO3 or Na2CO3, in a suitable solvent such dioxane or a mixture of dioxane and water.
[0880] The skilled person will realize that starting from intermediate Z, analogous chemistry as reported in case Yl represents 0 can be performed.
[0881] It will be appreciated that where appropriate functional groups exist, compounds of various formulae or any intermediates used in their preparation may be further derivatized by one or more standard synthetic methods employing condensation, substitution, oxidation, reduction, or cleavage reactions. Particular substitution approaches include conventional alkylation, arylation, heteroarylation, acylation, sulfonylation, halogenation, nitration, formylation and coupling procedures.
[0882] The compounds of Formula (I) may be synthesized in the form of racemic mixtures of enantiomers which can be separated from one another following art-known resolution procedures. The racemic compounds of Formula (I) containing a basic nitrogen atom may be converted into the corresponding diastereomeric salt forms by reaction with a suitable chiral acid. Said diastereomeric salt forms are subsequently separated, for example, by selective or fractional crystallization and the enantiomers are liberated therefrom by alkali. An alternative manner of separating the enantiomeric forms of the compounds of Formula (I) involves liquid chromatography using a chiral stationary phase. Said pure stereochemically isomeric forms may also be derived from the corresponding pure stereochemically isomeric forms of the appropriate starting materials, provided that the reaction occurs stereospecifically.
[0883] In the preparation of compounds of Formula (I), protection of remote functionality (e.g., primary or secondary amine) of intermediates may be necessary. The need for such protection will vary depending on the nature of the remote functionality and the conditions of the preparation methods. Suitable amino-protecting groups (NH-Pg) include acetyl, trifluoroacetyl, t-butoxycarbonyl (Boc), benzyloxycarbonyl (CBz) and 9-fluorenyl-methyleneoxycarbonyl (Fmoc). The need for such protection is readily determined by one skilled in the art. For a general description of protecting groups and their use, see T. W. Greene and P. G. M. Wuts, Protective Groups in Organic Synthesis, 4th ed., Wiley, Hoboken, New Jersey, 2007.
Several methods for preparing the compounds of Formula (I) are illustrated in the following examples. Unless otherwise noted, all starting materials were obtained from commercial suppliers and used without further purification, or alternatively can be synthesized by a skilled person by using well-known methods.
Table 1B - Abbreviations Abbreviation Meaning Ag(Phen)20Tf silver triflate¨bis(1,10-phenanthroline) complex 2-MeTHF 2-methyltetrahydrofuran ACN acetonitrile AcC1 acetyl chloride AcOH acetic acid Ac20 acetic anhydride aq. aqueous Ar argon BBr3 tribromoborane bn benzyl Boc tert-butyloxycarbonyl Boc20 di-tert-butyl dicarbonate n-BuLi n-butyllithium Cbz benzyloxycarbonyl CD3OD Methanol-d4 CHC13 chloroform Cs2CO3 cesium carbonate conc. concentrated DBU 1,8-diazabicyclo[5.4.0]undec-7-ene DCC dicyclohexylcarbodiimide DCE dichloroethane DCM dichloromethane DDQ 4,5-dichloro-3,6-dioxocyclohexa-1,4-diene-1,2-dicarbonitrile DEA diethylamine DIBAL-H diisobutylaluminum hydride DIEA or DIPEA N,N-diisopropylethylamine DMAP N,N-dimethylpyridin-4-amine DMF N,N-dimethylformamide DMP Dess-Martin periodinane DMSO dimethyl sulfoxide dppf 1,1'-ferrocenediyl-bis(diphenylphosphine) EDCI N-(3-Dimethylaminopropy1)-N-ethylcarbodiimide hydrochloride EA or Et0Ac ethyl acetate Et0H ethanol eq. equivalent(s) FA formic acid FCC flash column chromatography hour(s) 112 hydrogen HAT U 1 -[bi s(dimethylamino)methyl ene] -1H-1,2,3 -triazol o [4, 5-b]
pyridinium 3-oxid hexafluorophosphate 1120 water HC1 hydrochloric acid HOBt 1-Hydroxybenzotriazole HPLC high performance liquid chromatography ICH2C1 chloroiodomethane Abbreviation Meaning IPA isopropyl alcohol IPAc isopropyl acetate K2CO3 potassium carbonate KI potassium iodide K2 HP 04 dipotassium phosphate K3P 04 tripotassium phosphate LiAlD4 lithium aluminum deuteride LAH lithium aluminum hydride LiBH4 lithium borohydride LDA lithium diisopropylamide Lid lithium chloride LG leaving group Me methyl Me0H methanol 2-MeTHF 2-methyltetrahydrofuran min minute(s) mL milliliters mmol millimoles mg milligram MgSO4 magnesium sulfate MSA methanesulfonic acid MsC1 methanesulfonyl chloride MS molecular sieve MTBE methyl tert-butyl ether N2 nitrogen NA not available NaBH3CN sodium cyanoborohydride NaBH(OAc)3 sodium triacetoxyborohydride NaBD3CN sodium cyanoborodeuteride Na2CO3 sodium carbonate NaH sodium hydride NaHCO3 sodium bicarbonate Na! sodium iodide Na0Ac sodium acetate NaOH sodium hydroxide Na2S03 sodium sulfite Na2SO4 sodium sulfate NH4C1 ammonium chloride NMM 1-4-Methylmorpholine Pd2dba3 tris(dibenzylideneacetone)dipalladium(0) [1,1 1-bi s(diphenylphosphino)ferrocene] di chloropall adium(II), Pd(dppf)C12.DCM
complex with di chloromethane Pd(PPh3)4 tetrakis(triphenylphosphine)palladium(0) PE petroleum ether PG protecting group Phen phenanthroline psi pound per square inch Abbreviation Meaning p-Ts0H p-toluenesulfonic acid p-Ts011.1120 p-toluenesulfonic acid monohydrate Rt retention time Rochelle's salt potassium sodium tartrate tetrahydrate RT room temperature sat. saturated SFC supercritical fluid chromatography TBAF tetrabutylammonium fluoride TBDMS tert-butyldimethylsilyl TBDPS tert-butyldiphenylsilyl t-BuOK potassium tert-butoxide TEA triethylamine Tf trifluoromethanesulfonyl TFA trifluoroacetic acid THF tetrahydrofuran Ti(0iPr).1 titanium(IV) isopropoxide TLC thin layer chromatography TMEDA N,N,N1,AP-tetramethylethylenediamine TMG 1,1,3,3-tetramethylguanidine TMSI iodotrimethylsilane Ts p-toluenesulfonyl TsC1 p-toluenesulfonyl chloride v/v volume per volume vol. volume(s) wt weight Xantphos 4,5-bis(diphenylphosphino)-9,9-dimethylxanthene [0884] As understood by a person skilled in the art, compounds synthesized using the protocols as indicated may exist as a solvate e.g., hydrate, and/or contain residual solvent or minor impurities. Compounds or intermediates isolated as a salt form, may be integer stoichiometric i.e., mono- or di-salts, or of intermediate stoichiometry. When an intermediate or compound in the experimental part below is indicated as `HC1 salt' without indication of the number of equivalents of HC1, this means that the number of equivalents of HC1 was not determined. The same principle will also apply to all other salt forms referred to in the experimental part, such OH
as e.g., 'oxalate salt', 'formate salt' or' 0 salt [0885] A skilled person will realize that, even where not mentioned explicitly in the experimental protocols below, typically after a column chromatography purification, the desired fractions were collected and the solvent was evaporated.
[0886] In case no stereochemistry is indicated, this means it is a mixture of stereoisomers, unless otherwise is indicated or is clear from the context.
[0887] When a stereocenter is indicated with 'RS' this means that a racemic mixture was obtained at the indicated center, unless otherwise indicated.
Example 1 ¨ Synthesis of (R)-N-ethyl-5-fluoro-N-isopropyl-24(5-(2-(6-((2-methoxyethyl) (methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro [3.4] octan-6-yl)-1,2,4-triazin-6-yl)oxy) benzamide (Compound A) ¨ Preparation Method A
Preparation of intermediate I - tert-butyl (5-methyl-4-orohexAcarbamate Boc > Mg TMEDA, THF
Br [0888] To a solution of tert-butyl 2-oxopyrrolidine-1-carboxylate (5.0 g, 27 mmol) and TMEDA (5.0 mL, 33 mmol) in THF (60 mL) cooled at -70 C was slowly added isopropylmagnesium bromide solution (19 mL, 55 mmol, 2.9 M in 2-methyltetrahydrofuran), the resulting mixture was slowly warmed to RT and stirred for 12 h. The mixture was poured into sat. aq. NH4C1 (50 mL) solution and extracted with Et0Ac (50 mL x 3). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give the crude product, which was further purified by FCC
(PE/Et0Ac = 1:0 to 100:1) to afford the title intermediate (3.7 g, 60% yield) as a yellow oil.
Preparation of intermediate 13 - tert-hutyl 6-(3,6-dichloro-1,2,4-triazin-5-y1)-2,6-diazaspiro [3.4Joctane-2-carboxylate Boc Boc CI
N TEA, DCM
N
-N CI N Cl.'1)I N
N-NCI
[0889] To the solution of 3,5,6-trichloro-1,2,4-triazine (10.0 g, 54.2 mmol) and TEA (15.2 mL, 109 mmol) in DCM (100 mL) cooled at 0 C was added tert-butyl 2,6-diazaspiro[3.4]octane-2-carboxylate (9.21 g, 43.4 mmol), the mixture was warmed to RT and stirred for 1 h. The mixture was diluted with water (20 mL) and extracted with DCM (30 mL x 3). The combined organic layers were washed with brine, dried over Na2SO4, filtered and concentrated under reduced pressure to give the crude product which was purified by FCC on silica gel (PE/Et0Ac = 1:0 to 3:1) to afford the title intermediate (12.0 g, 58% yield) as a yellow solid.
Preparation of intermediate 27- N-ethyl-5-fluoro-N-isopropyl-2-methoxybenzamide HATU, DIEA, DCM 0 +
[0890] To the mixture of 5-fluoro-2-methoxybenzoic acid (8.00 g, 47.0 mmol) and N-ethylpropan-2-amine (8.19 g, 94.0 mmol) in dry DCM (150 m_L) cooled at 0 C, were slowly added HATU (21.5 g, 56.5 mmol) and DMA (9.10 g, 70.4 mmol) in portions. The resulting mixture was slowly warmed to RT and stirred for 8 h. The organic layer was washed with water (20 mL x 3) and dried over anhydrous Na2SO4. After filtration, the solvent was removed under reduced pressure and the crude product was purified by FCC (Et0Ac/PE = 0% to 20%) to afford the title intermediate (12.0 g, 96% yield) as a white solid.
Preparation of intermediate 28 - N-ethy1-5-fluoro-2-hydroxy-N-isopropyThenzarnide BBr3, DCM
[0891] To the solution of N-ethyl-5-fluoro-N-isopropy1-2-methoxybenzamide (intermediate 27) (12.0 g, 50.1 mmol) in dry DCM (100 mL) cooled at -78 C was slowly added BBr3 (14.4 mL, 152 mmol), the resulting mixture was slowly warmed to RT and stirred for 8 h.
The mixture was cooled to -78 C again and Me0H (5 mL) was added dropwise to quench the reaction. The resulting mixture was slowly warmed to RT and the pH value was adjusted to about 8 by adding sat. aq. NaHCO3 solution. The aqueous layer was extracted by DCM (50 mL x 3) and the combined organic layers were dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the crude product which was purified by FCC (Et0Ac/PE
= 0% to 20%) to afford the title intermediate (9.0 g, 78% yield) as a white solid.
Alternative preparation of intermediate 28 OH 1,1-Carbonyl diimidazole (1.2 eq.) THF,15-25 C OH
[0892] A mixture of 5-fluoro-2-hydroxy-benzoic acid (14.0 kg, 89.68mo1, 1.0 equiv.) in THF
(168 L, 12 volumes) was adjusted to between 15-25 C, and 1,1-carbonyldiimidazole, (17.45kg, 107.62 mol, 1.2 equiv.) was added over a period of 1 hour. After addition, the mixture was stirred for 18 hours at 15-25 'C. After this time N-ethylpropan-2-amine (14.85kg, 170.39mo1, 1.9 equiv.) was added to the mixture at 15-25 C over a period of 2 hours. The resulting mixture was further aged for between 18-24 hours at 15-25 C. The pH was the adjusted to between pH4-5 with aq. 10% H2SO4(140kg, 10 volumes) and the layers were separated. The organic phase was concentrated to between 42-56L maintaining a temperature below 40 C, and then n-heptane (43kg, 4.5 volumes) was added to the mixture at 15-25 C over a period of 3 hours. The mixture was then cooled to 0-10 C and stirred for an additional 6 hours. The resulting slurry was filtered and the cake was washed with a tert-butyl methyl ether (MTBE):n-heptane mixture (25 kg of a 2:3 volume/volume mixture of MTBE:n-heptane, 2.5 volumes). The cake wash was repeated a further two times and the resulting solid was dried in-vacuo at 50 C to afford intermediate 28 (16.5 kg, purity: 99.1%, yield: 80.4%).
Preparation of intermediate 14 - tert-butyl 6-(3-chloro-6-(2-(ethyl(isopropyl)earbamoyl)-4-fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.41octane-2-carboxylate poc Boc N
DB U, THF N 0 OH
CI
N-NCI NCI
[0893] The mixture of tert-butyl 6-(3,6-dichloro-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4]octane-2-carboxyl ate (intermediate 13) (12.0 g, 33.3 mmol), AT-ethy1-5-fluoro-2-hydroxy-AT-isopropylbenzamide (intermediate 28) (7.5 g, 33.3 mmol) and DBU (6.1 g, 40.1 mmol) in THY
(120 mL) was stirred at 25 C for 8 h. The mixture was diluted with water (30 mL) and extracted with DCM (30 mL x 3). The combined organic layers were washed with brine, dried over Na2SO4, filtered and concentrated under reduced pressure to give the crude product which was purified by FCC (PE/Et0Ac = 1:0 to 3:1) to afford the title intermediate (14.0 g, 73% yield) as green solid.
Preparation of intermediate 2 - tert-butyl 6-(6-(2-(ethyl(isopropyl)carbamoyI)-47fhtoro-phenoxy)-1,2,4-triazin-5-y1)-2,6-d1azasp1ro[3. 4Joctane-2-carboxylate Synthesis method A for intermediate 2:
,Boc ,Boc NaBH4, TMEDA
Pd(dppf)C12=DCM, THF
I
NCI F
NN
108941 To the mixture of tert-butyl 6-(3-chloro-6-(2-(ethyl(isopropyl)carbamoy1)-4-fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4]octane-2-carboxylate (intermediate 14) (20 g, 36.4 mmol), NaBH4 (2.48 g, 65.7 mmol) and TMEDA (8.54 g, 73.5 mmol) in THF (500 mL) was added Pd(dppf)C12=DCM (1.70 g, 2.08 mmol) under N2 atmosphere. After addition, the reaction mixture was stirred at 25 C for 14 h. The reaction mixture was filtered and the filtrate was concentrated, the residue was purified by FCC on silica gel (Et0Ac) to afford the title intermediate (15 g, 93% purity, 74% yield) as brown solid.
Synthesis method B fbr intermediate 2:
,Boc ,Boc Pd/C, H2 TEA, Me0H
OyJN OyJN
N-NCI
108951 To the solution of tert-butyl 6-(3-chloro-6-(2-(ethyl(isopropyl)carbamoy1)-4-fluorophenoxy)-1,2,4-tri azin-5-y1)-2,6-di azaspiro[3 .4]octane-2-carboxyl ate (intermediate 14) (22.0 g, 40.1 mmol), TEA (15 mL) in Me0H (100 mL) was added Pd/C (wet, 5.0 g, 10%) The resulting mixture was stirred under H2 atmosphere (30 psi) at 25 C for 8 h.
The reaction mixture was filtered through a celite pad and the filtrate was concentrated in men to afford the title intermediate (25.0 g, crude), which was used directly in next step without further purification.
Preparation of intermediate 3 - 2-((5-(2,6-diazaspiro[3.4Joclan-6-y1)-1,2,4-triazin-6-y1)oxy)-N-ethyl-5-fluoro-N-isopropylbenzamide ,Boc NH
r' TFA, DCM 0 -N
I
N I
N
F N -[0896] To the solution of tert-butyl 6-(6-(2-(ethyl(isopropyl)carbamoy1)-4-fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4]octane-2-carboxylate (intermediate 2) (300 mg, 0.583 mmol) in DCM (5 mL) was added TFA (0.5 mL, 6.4 mmol), the resulting mixture was stirred at RT for 3 h. Then 10% NaOH (5 mL) solution was slowly added into the mixture to adjust the pH value to about 12, the resulting mixture was extracted with DCM (10 mL
x 3). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated in vacuo to afford the title intermediate (220 mg, 90% yield) as a white solid.
Preparation of Compound 61 - tell-butyl (4-(6-(6-(2-(ethyl(isopropyl)carbamoy1)-4-.fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4loctan-2-y1)-5-inethylhexyl)carbamate NH
r--ZnCl2, NaBH3CN
HN¨Boc 0, HN¨Boc Me0H, 80'C NO N
NN T NJ
öOLN
[0897] The mixture 2-45-(2,6-diazaspiro[3 .4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)-N-ethy1-5-fluoro-N-isopropylbenzamide (intermediate 3) (1.0 g, 2.4 mmol), tert-butyl (5 -methy1-4-oxohexyl)carbamate (intermediate 1) (830 mg, 3.62 mmol) and ZnC12 (660 mg, 4.84 mmol) in Me0H (15 mL) was stirred at 80 C for 0.5 h. Then NaBH3CN (310 mg, 4.93 mmol) was added and the resulting mixture was stirred at 80 C for 6 h. After cooled to RT, the mixture was concentrated under reduced pressure to give the crude product, which was further purified by preparative HPLC using a Waters Xbridge Prep OBD (column: C18 150x40 mm 10 um;
eluent:
ACN/H20 (0.05% ammonia) from 45% to 75% v/v) to afford the title compound (700 mg, 46%
yield) as colorless oil.
Preparation of Compounds 62 and 63 - le rt-butyl (R)-(4-(6-(6-(2-(ethyl(isopropyl) carbainoy1)-47fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4Joctan-2-y1)-5-methylhexyl)carbamate and ten-butyl (S)-(4-(6-(6-(2-(ethyl(isopropyl)cctrbamoyh-47fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4loctan-2-y1)-5-methylhexyl)carbamate N R __________________________________________________________ HN¨Boc HN¨Boc SFC
0 C3 0 N./
N
N-NJ
Compound 61 Compound 62 N\
HN¨Boc yL N
Compound 63 [0898] tert-butyl (4-(6-(6-(2-(ethyl(i sopropyl)carb amoy1)-4-fluorophenoxy)-1,2,4-tri azin-5 -y1)-2,6-diazaspirot3 .4] octan-2-y1)-5-methylhexyl)carbamate (compound 61) (200 mg, 0.319 mmol) was purified by SFC over DAICEL CHlRALPAK IG (column: 250x30 mm 10 um;
isocratic elution: Et0H (containing 0.1% of 25% ammonia): supercritical CO2, 40%: 60% (v/v)) to afford the title compounds (compound 62) (85 mg, 42% yield) and (compound 63) (80 mg, 40% yield) both as light yellow oil.
Compound 64 - (R)-2-((5-(2-(6-amino-2-methylhexan-3-y1)-2,6-diazaspiro[3.4Joctan-6-y1)-1,2,4-triazin-6-yl)oxy)-N-ethyl-5-fluoro-N-isopropylbenzamide \ \
N R __________________________________________________________________ R __ r- HN¨Boc TFA, DCM
N.2 IN
[0899] To the solution of tert-butyl (R)-(4-(6-(6-(2-(ethyl(isopropyl)carbamoy1)-4-fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4]octan-2-y1)-5-methylhexyl)carbamate (compound 62) (550 mg, 0.876 mmol) in DCM (4 mL) was slowly added TFA (4 mL), and the resulting mixture was stirred at 25 C for 1 h. The reaction mixture was concentrated under reduced pressure to give a residue. The residue was diluted in DCM (40 mL) and the pH value was adjusted to around 12 by aq. NaOH (2 M, 16 mL) solution. The aqueous layer was extracted with DCM (10 mL x 2). The combined organic layers were dried over anhydrous Na2SO4, filtered and concentrated in vacuo to afford the title compound (460 mg, crude) as yellow solid, which was used directly in next step without further purification.
Compound 11 - (R)-N-ethy1-5-fluoro-N-isopropy1-245-(2-(6-((2-methoxyethyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro[3.4Joctan-6-y1)-1,2,4-triazin-6-y1)oxy)benzamide 0\
NR ________________________ NH2 N R _____________________________________________________________________ FI/N
+ , Cs2CO3,N. Nal )._ 0 isC5-3 Br 0 N
DMF, 80 C MW
0 1, 0 1, )N
N, N, Ni [0900] The mixture of (R)-24(5-(2-(6-amino-2-methylhexan-3-y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)-N-ethy1-5-fluoro-N-isopropylbenzamide (compound 64) (120 mg, crude), 1-bromo-2-methoxyethane (32 mg, 0.23 mmol), Cs2CO3 (222 mg, 0.681 mmol), NaI
(102 mg, 0.680 mmol) in DMF (1 mL) was stirred at 80 C via microwave irradiation for 1 h.
After cooling to RT, the mixture was diluted with H20 (10 mL) and extracted with Et0Ac (3 x mL). The combined organic layers were washed with H20 (10 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to afford the crude product which was further purified by HPLC over a Phenomenex Gemini-NX (column: 150x30 mm 5 um; eluent:
ACN/H20 (10mM NH4HCO3) from 51% to 71% (v/v)) and further purified by SFC over DAICEL CHIRALCEL OD-H (column: 250x30 mm 5 urn; eluent: supercritical CO2 in Et0H
(0.1% v/v ammonia) 25/25, v/v) to afford the title compound (5.13 mg, 96%
purity) as yellow solid.
[0901] LC-MS (ESI) (Method 1): Rt = 2.997 min, m/z found 586.3 [M+E-1] .
Compound A (R)-N-ethyl-5-iluoro-N-isopropyl-245-(2-(642-methoxyethyl) (methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro13.4Joctan-6-y1)- I ,2,4-triazin-6-yl)oxy) benzamide N
H/N¨\\_ R __________________________________ 0 N R _____________________________________________________________________ /
0 4,N HCOH, NaBH3CN 0 N AcOH, Me0H
Compound A
N-N I I
Compound 11 [0902] The mixture of (R)-N-ethyl-5-fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)amino)-2-methylhexan-3 -y1)-2, 6-di azaspiro [3.4] octan-6-y1)-1,2, 4-triazin-6-yl)oxy)benzami de (compound 11) (40.0 mg, 0.068 mmol), formaldehyde (55.4 mg, 0.683 mol, 37% in water) and AcOH (8.2 mg, 0.137 mmol) in anhydrous Me0H (2 mL) was stirred at 45 C for 1 h. Then, NaBH3CN (8.6 mg, 0.137 mmol) was added to the mixture and the resulting mixture was stirred at 45 C for another 1 h. After cooling to RT, the reaction mixture was treated with sat. aq. NaHCO3 (40 mL) to adjust the pH value to about 8 and further extracted with DCM (20 mL x 3). The combined organic layers were dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the crude which was purified by preparative 1-1PLC over Boston Prime (column: C18 150x30mm 5um, Mobile Phase A: H20 (0.04% ammonia+10mM NH4HCO3), Mobile Phase B: ACN, Flow rate: 25 mL/min, gradient condition B/A from 50% to 80% (50%B to 80% B)) to afford the title compound (9.62 mg, 99.10% purity, 23.3% yield) as yellow oil.
Example 2 ¨ Synthesis of (R)-N-ethyl-5-fluoro-N-isopropyl-2-45-(2-(6-02-methoxyethyl) (methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro [3.4] oetan-6-yl)-1,2,4-triazin-6-yl)oxy) benzamide (Compound A) ¨ Preparation Method B
Preparation of intermediate 7 - 4-((tert-butoxycarbonyl)(methyl)amino)butanoic acid (130c)20 TEA, Me0H
[0903] To a solution of 4-(methylamino)butanoic acid hydrochloride (3.0 g, 19.5 mmol) and TEA (7.78 mL, 58.6 mmol) in Me0H (30 mL) was added Boc20 (4.69 g, 21.5 mmol) dropwise.
The mixture was stirred at RT for 2 h. The mixture was concentrated under reduced pressure and the residue was diluted with Et0Ac (100 mL), washed with cooled 0.1 N HC1 (70 mL x 2), H20 (50 mL x 2) and brine (50 mL), dried over Na2SO4, filtered and concentrated to afford the title intermediate (1.80 g, crude) as colorless oil.
Preparation of intermediate 8 - tert-butyl (4-(methoxy(methyl)amino)-4-oxobutyl)(methyl) carbamate HO, Boc o EDCI, HOBt, NMM, CHCI3 N
IV"-B G
[0904] To a solution of 4-((tert-butoxycarbonyl)(methyl)amino)butanoic acid (intermediate 7) (1.80 g, crude) in CHC13 (30 mL) was added N,O-dimethylhydroxylamine hydrochloride (960 mg, 9.84 mmol), H013t (1.24 g, 9.18 mmol) and NMM (2.80 mL, 25.1 mmol). And, then EDO-(2.23 g, 11.6 mmol) was added and the reaction mixture was stirred at RT for 4 h. The reaction mixture was diluted with DCM (100 mL), washed with 1N HC1 (30 mL x 3), sat.
aq. NaHCO3 (30 mL x 3) and brine (30 mL), dried over Na2SO4, filtered and concentrated under in lactic) to afford the title intermediate (1.70 g, crude) as colorless oil.
Preparation of intermediate 9 - tert-butyl methyl(5-methyl-4-orohexyl)carbamate THF, -70 C
Boc ,,F.Boc 0 ) __ Li [0905] To a solution of tert-butyl (4-(methoxy(methyl)amino)-4-oxobutyl)(methyl)carbamate (intermediate 8) (200 mg, crude) in TUT' (5 mL) cooled at -70 C under N2 atmosphere was added dropwise isopropyllithium (3.2 mL, 2.24 mmol, 0.7M in pentane). The resulting mixture was stirred at -70 C for 2 h. The mixture was quenched with sat. aq. NH4C1 (15 mL), extracted with Et0Ac (30 mL x 2). The combined organic layers were washed with brine (30 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to give a crude product. The crude product was further purified by FCC (PE/Et0Ac = 10:1) to afford the title intermediate (60 mg) as colorless oil.
Preparation of Compound 60 - tert-butyl 64-(6-(6-(2-(ethyl(isopropyl)carbamoyl)-1-fluor ophenoxy)- I , 2 ,,l-triazin-5-yl)-2,6-diazaspiro [3 . octan-2-y1)-5-methylhexyl) (methyl) carbatnate NH
\N-Boc õT. N
-N + Boc ZnC12, NaBH3CN
,N ,0 _0 0 Me0H, 80 C
ii i Oyj'N
F
[0906] To a solution of 24(5-(2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)-N-ethyl-5-fluoro-N-isopropylbenzamide (intermediate 3) (600 mg, 1.45 mmol) and tert-butyl methyl(5-methy1-4-oxohexyl)carbamate (intermediate 9) (330 mg, 1.37 mmol) in Me0H (50 mL) was added ZnC12 (789 mg, 5.79 mmol). The resulting mixture was stirred at 80 C
for 2 h. Then NaBH3CN (729 mg, 11.6 mmol) was added and the reaction mixture was stirred at overnight. After cooling to RI, the mixture was concentrated under reduced pressure to give a crude residue, which was diluted with DCM (50 mL), quenched with sat. aq.
NH4C1 (50 mL) and extracted with DCM (50 rriL x 3). The combined organic layers were washed with brine (50 mL), dried over Na2SO4, filtered and the filtrate was concentrated under reduced pressure to give a crude product which was further purified by FCC (DCM/Me0H = 10:1) to afford the title compound (400 mg, 42% yield) as white solid.
Compound 67- N-ethyl-5-fluoro-N-isopropyl-245-(2-(2-methyl-6-(methylamino)hexan-3-yl)-2,6-diazaspiro[3.4loctan-6-yl)-1,2,4-triazin-6-yhoxj)benzamide hydrochloride \ Boc \ /NH
HCl/1,4-dioxane ciN
I
N I
HCl salt [0907] To a solution of tert-butyl (4-(6-(6-(2-(ethyl(isopropyl)carbamoy1)-4-fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diaza spiro[3 4] octan-2-y1)-5-methylhexyl)(methyl)carbamate (compound 60) (1 g, 1.56 mmol) in DCM (10 mL) was added 4M HC1 in dioxane (5 mL, 20 mmol), the resulting mixture was stirred at RT for 1 h. The reaction mixture was concentrated in vacuo to afford the title compound (960 mg, crude, HC1 salt) which was used directly in next step without further purification.
Compound A - (R)-N-ethyl-57fluoro-N-isopropyl-2-((5-(2-(6-((2-methoxyethyl) (methyl) amino)-2 -methylhexan- 3-yl)-2, 6-diazaspiro [3 . octan-6-yh- I, 2 ,z1-triazin-6-yl)oxy) benzamide \ F17¨
K2CO3, Nal ____________________________________________________ -.1=1 0 y-k-N Br I
N DMF, 50 C
oY14 HC I salt F
N 1 Compound Compound 67 SFC
5-1\s __________________________________________________________________ \_./
0yJN Compound A
[0908] To the mixture of AT-ethyl-5-fluoro-AT-i sopropy1-245-(2-(2-m ethyl -6-(m ethyl amino) hexan-3 -y1)-2,6-diazaspiro[3 .4] octan-6-y1)-1,2,4-tri azin-6-yl)oxy)b enzamide hydrochloride (compound 67) (480 mg, crude), K2CO3 (700 mg, 5.07 mmol) and NaI (400 mg, 2.67 mmol) in D1VIF (5 mL) was added 1-bromo-2-methoxyethane (230 mg, 1.65 mmol). The resulting mixture was stirred at 50 C overnight. After cooled to RT, the reaction mixture was quenched with H20 (30 mL) and extracted with DCM (30 mL x 3). The combined organic layers were washed with brine (30 mL x 3), dried over Na2SO4, filtered and concentrated to give a crude residue. The residue was purified by FCC (DCM/Me0H = 10:1) to afford N-ethy1-5-fluoro-N-i sopropy1-2-45-(2-(6-((2-m ethoxy ethyl)(m ethyl)ami no)-2-m ethylhexan-3 -y1)-2,6-diazaspiro[3 .4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide (compound 68) (250 mg, 48%
yield) as yellow oil.
[0909] The N-ethyl-5-fluoro-N-i sopropy1-24(5-(2-(64(2-methoxyethyl)(methypamino)-2-methylhexan-3-y1)-2,6-diazaspiro[3 . 4] octan-6-y1)-1,2,4-triazin-6-yl)oxy)b enzamide (compound 68) (960 mg, combined from several batches obtained by Method B) was first separated by SFC using DA10EL CH1RALPAK 1G (column: 250x30mm 10um; Mobile phase:
A: Supercritical CO2, B: Et0H (0.1% ammonia), A:B=40:60 at 60 mL/min) and further purified by preparative ITPLC using Boston Prime (column: 150x30mm 5um, Mobile Phase A:
(10mM NH4HCO3), Mobile Phase B: ACN, Flow rate: 25 mL/min, gradient condition B/A from 55% to 85%) to afford the title compound (270 mg) as colorless oil.
[0910] 1H NMR (400 MHz, Methanol-d4): 6 = 8.40 (s, 1H), 7.47-7.32 (m, 1H), 7.30-7.10 (m, 2H), 4.24-4.01 (m, 2H), 3.89-3.60 (m, 3H), 3.48 (br s, 3H), 2.63-2.51 (m, 2H), 2.43-2.32 (m, 2H), 2.29-2.07 (m, 6H), 1.86-1.72 (m, 1H), 1.62-1.44 (m, 2H), 1.39-1.02 (m, 10H), 0.99-0.66 (m, 9H). Some protons were hidden by the solvent peak and are not reported.
[0911] LCMS (ES!) (Method 2): Rt = 1.965 min, m/z found 600.3 [M-P111+.
[0912] SFC (Method 11): Rt = 4.904 min.
Example 3 ¨ Synthesis of (R)-N-ethyl-5-fluoro-N-isopropyl-2-45-(2-(6-02-methoxyethyl) (methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro [3.4] octan-6-yl)-1,2,4-triazin-6-yl)oxy) benzamide (Compound A) ¨ Preparation Method C
Preparation of intermediate 227- tert-butyl (R)-(1-(2,2-dimethy1-4,6-dioxo-1,3-dioxan-5-y1)-3-methylbutan-2-Acarbaniate 1. 0 0 DCC, DMAP, DCM
HN'Boc 2. NaBF14, AcOH
Boc,NH00 [0913] Boc-L-valine (44.9 kg), 2,2-dimethy1-1,3-dioxane-4,6-dione (32.9 kg) and DMAP (35.5 kg) in DCM (607 kg) pre-cooled at -10 to 0 C were added to a solution of DCC
(55.5 kg) in DCM (613 kg) over 3 h and aged for 16 h at -10 to 0 C. 10% citric acid aqueous solution (449 kg) was added whilst maintaining a temperature below 10 C. The resulting slurry was aged for 2 h at 0 to 10 C then filtered. The filter cake was washed with DCM (91 kg).
The filtrate was separated and the organic layer was washed with 10% citric acid aqueous solution (two times 450 kg) and 10% NaCl aqueous solution (449 kg). To organic phase (1200 kg), was added acetic acid (75.0 kg) whilst maintaining a temperature between -10 to 0 C.
Sodium Borohydride (18.0 kg) was added in portions over 5 h whilst maintaining a temperature in the range -10 to 0 C and then resulting mixture was aged at -10 to 0 C for an additional 16 h.
The mixture was warmed to 15 to 25 C, and aged for 2 h. The mixture was then washed with 14%
NaCl aqueous solution (450 kg) followed by a second wash with 14% NaCl aqueous solution (432 kg) and a final water wash (444 kg). The organic phase was concentrated under reduced pressure to 2-4 vol. !so-propanol (143 kg) was added to the residue and concentrated to 4-5 vol. under reduced pressure. After cooling to -10 to 0 C and aging for 8 h, the resulting slurry was filtered, washed with IPA (38 kg) and dried to afford the title intermediate (46.7 kg, 69%
yield) as a white solid.
Preparation of intermediate 228 - tert-butyl (R)-2-isopropy1-5-aropyrrolidine-I-carboxy1ate Reflux Boc",NH00 Toluene -7i-- Boo [0914] tert-butyl (R)-(1-(2,2-di m ethy1-4, 6-di oxo-1,3 -di oxan-5 -y1)-3 -methylbutan-2-yl)carbamate (intermediate 227) (46.7 kg) in toluene (333 kg) was heated to reflux and aged for 4 h. The mixture was cooled to ambient temperature, filtered and washed with toluene (20 kg).
The combined filtrates were concentrated to dryness at reduced pressure to afford the desired compound (31.05 kg, 96% yield) as an oil which was used directly without further purification.
Preparation of intermediate 229 - tert-butyl (5R)-2-hydroxy-5-isopropylpyrrolidine-1-carboxylate 0 LiBH4 OH
Boo 2-MeTHF
[0915] tert-butyl (R)-2-i sopropy1-5 -oxopyrrol i di ne-l-carb oxyl ate (intermediate 228) (30.9 kg) in 2-MeTHF (26.7 kg) was cooled to -5 to 5 C. A solution of LiBH4in 2-MeTHF
(1M, 45.2 kg, 54.4 mol) was added over 3 h and the mixture was aged for 4 h. A cold aqueous solution of 5%
NaHCO3 (163 kg) was added at -5 to 5 C over 3h and aged for an additional 2 h. The mixture was warmed to ambient temperature and aged for a further 2 h. The aqueous layer was separated and the organic layer was washed with 10% NaCl aqueous solution (170 kg) and water (155 kg). During the water wash, an emulsion formed and solid NaCl (3.1 kg) was added to affect the separation. After removal of the aqueous layer, the organic layer was concentrated under reduced pressure to dryness to afford the desired compound (28.5 kg, 91%
yield) as an oil, which was used directly without further purification.
Preparation of intermediate 230 - tert-butyl (R)-(64(2-methoxyethyl)(methyl)amino)-2-methylhexan-3-Acarbamate MeOCH2CH2NHMe NaBH(OAc)3 OH DCM
BocHN'Boc [0916] tert-butyl (5R)-2-hydroxy-5 sopropylpyrrol i dine-1 -carboxyl ate (intermediate 229) (28.55 kg) in DCM (344 kg), at 15 to 25 C was treated with 2-methoxy-N-methylethan-1 -amine (12.3 kg, 138.0 mol) and the resulting mixture was aged for 1 h. Sodium triacetoxyborohydride (40.12 kg) was added in portions over 5h whilst maintaining a temperature between 15 to 25 C
and the resulting mixture was aged for 48 h. The reaction mixture was quenched by the addition of 8% NaOH aqueous solution (184 kg) over 2 h whilst maintaining a temperature between 15 to 25 C and the mixture was aged for a further 2 h. The water layer was separated, and the organic layer was washed with water (169 kg). The organic layer was then concentrated under reduced pressure to dryness to afford the title intermediate (33.26 kg, 88%
yield) as an oil which was used directly without further purification.
Preparation of intermediate 231 - (R)-N1-(2-methoxyethyl)-N1,5-dimethylhexane-1,4-diamine, dihydrochloride HCI / IPA
HN, Boc NH2 2 HCI
[0917] To 4 molar solution of HC1 in iso-propanol (84.80 kg) at ambient temperature was added a solution of tert-butyl (R)-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-yl)carbamate (intermediate 230) (32.38 kg) in iso-propanol (25.6 kg) over 3 h and the mixture was aged at ambient temperature for an additional 19 h. Methyl tert-butyl ether (95.25 kg) was then added over 1 h and the mixture was aged for 2.5 h. The resulting slurry was filtered and washed with MTBE (53 kg). The filter cake was dried to afford the title compound (23.92 kg, 81% yield) as a white solid.
Preparation of intermediate 232 - ethyl 1-benzy1-3-(chloromethyl)pyrrolicline-3-carboxylate CO2Et DIPEA (1.1 eq.) CI
'(n-BuLi (1.0 eq.) 47\5CO2Et N.0 THF
ICH2CI (1.2 eq.) Bn -78 to -60 C
[0918] To a solution of D1PEA (952 g, 1.1 eq.) in THY (6 L) which was cooled to -35 to -25 C
was added n-BuLi (2.33 kg, 2.5 M in hexane, 1.0 eq.) whilst maintaining a temperature below -25 C. The resulting mixture was aged at -35 to -25 C for an additional 30 min then cooled to between -78 to -60 C. A solution of ethyl 1-benzylpyrrolidine-3-carboxylate (2 kg, 1.0 eq.) in THF (2 L) at -78 to -60 C was added and stirred for an addition 30 min.
Chloroiodomethane (1.81 kg, 1.2 eq.) was then charged at -78 to -60 C. The reaction mixture was aged at -60 to -40 C for 2 h. To the reaction mixture was added to citric acid aqueous solution (660 g in 6 L
H20) at a temperature between 0 to 10 C and the resulting mixture was aged at 20 to 30 C for an additional 20 min. After separating the layers, the aqueous layer was extracted with Et0Ac (6 L) and the combined organic layers washed with brine (6 L) then warmed to 50 to 60 C.
Oxalic acid (2.22 kg) was charged at 50 to 60 C. The resulting mixture was stirred at 50 to 60 C
for 3 h then cooled to 20 to 30 C and aged overnight. The resulting solid was filtered and the cake was washed with ethyl acetate (2 L). The wet cake was added to toluene (4 L), H20 (8 L) and K3PO4 (1.5 eq.) and the resulting mixture was aged at 20 to 30 C for 20 min. After separating the layers, the aqueous layer was extracted with toluene (2 L). The organic layers were combined and washed twice with water (2 L). The organic phase was concentrated under reduced pressure to afford 4.2 kg of the desired compound as a toluene solution (46 wt % by assay, giving an assay yield of 80%).
Preparation of intermediate 233 - 1-benzy1-3-(ch1oromethyOpyrrolidine-3-carbaldehyde CI Flow CO2Et 10)* CI '0 DIBAL-H (2.0 eq.) Ns Bn toluene Bn -65 to -55 C
[0919] Reaction conducted in a flow chemistry system: A solution of ethyl 1-benzy1-3-(chloromethyl)pyrrolidine-3-carboxylate (intermediate 232) (4.4 kg) in toluene (26 L) was pumped at 26.7 mL/min and cooled to -60 C. After cooling, it was then mixed with a cooled solution of DIBAL-H (28.1 mol) in toluene at -60 C (28 L) with a pumping rate of 32.1 mL/min.
The mixture was passed through a Perfluoroalkoxy (PFA) coil tube reactor at ¨60 C (total flow rate of 58.8 mL/min with a residence time of 5 seconds). The resulting mixture was mixed with cooled Me0H (-60 C) which was pumped at the rate of 15.2 mL/min. This mixed solution was pumped to another PFA coil tube reactor at ¨60 C (total flow rate of 74 mL/min with a residence time of 5 seconds). The resulting mixture was collected into a receiver which contained 20 wt %
aq. solution Rochelle' s salt (20 V). The layers were separated, and the organic phase was twice washed with water (2 x 44 L). The organic phase was combined with another 3.0 kg batch prepared in an analogous manner and concentrated under reduced pressure to afford 20.8 kg of a toluene solution of the desired compound (25.5 wt % assay by HPLC, giving an assay yield of 85%) which was used directly without further purification.
[0920] 111 NMR (300 MHz, Chloroform-d): 6 9.62 (s, 1H), 7.39 - 7.20 (m, 5H), 3.83 - 3.57 (m, 4H), 2.96 (d, J = 10.2 Hz, 1H), 2.80 - 2.55 (m, 3H), 2.17 (ddd, J = 13.9, 7.9, 6.1 Hz, 1H), 1.83 (ddd, J = 13.4, 7.8, 5.5 Hz, 1H).
Preparation of intermediate 234 - (R)-4-(6-benzy1-2,6-diazaspiro[3.4loctan-2-y1)-N-(2-methoxy ethyl)-N,5-dimethylhexan-l-amine OMe <
N- Cl2cCo K2HPO4 0.0 eq.)`
NH2 2 HCI ci FIN A H20 __ R
\-14, __________________________ k N-\ N-Bn Et3N (2.0 eq.) \-0Me 50-55 C
\-0Me NaBH(OAc)3 (3.2 eq.) N2 N
toluene Bn - Bn [0921] To a solution of 1-benzy1-3-(chloromethyl)pyrrolidine-3-carbaldehyde (intermediate 233) in toluene (3.0 kg, 10 wt %) diluted with toluene (30 L) and (R)-N1-(2-methoxyethyl)-M,5-dimethylhexane-1,4-diamine, dihydrochloride (intermediate 231) (3.47 kg) was added triethylamine (2.55 kg, 25.2 mol) at 20 to 30 C. The resulting mixture was aged for 2 h at 20 to 30 C. Then sodium triacetoxyborohydride (9.0 kg) was charged at 20 to 30 C and the mixture was aged for 12 h. The reaction mixture was cooled to 5 to 15 C and 25 wt %
NaOH aqueous solution (25 L, -16.75 eq.) was added maintaining a temperature below 35 C.
The resulting mixture was aged at 20 to 30 C for 25 mins and the layers were separated. The organic layer was washed with 15 wt % aq. NaCl (10 L) and the layers were again separated and water (18 L) was charged to the organic phase. The pH of the aqueous phase was adjusted to 6-7 with 4M aq. HC1 whilst maintaining an internal temperature below 35 C. The organic phase was then discarded and the aqueous phase was separated and basified to pH 8-9 with K2HPO4.
[0922] The resulting mixture was warmed to 50 to 55 C and aged for 3 h. The reaction mixture was then cooled to ambient temperature and combined with other two batches (2.4 kg + 3.0 kg).
The combined streams were washed with methyl tert-butyl ether three times (3 x 40 L). To the resulting aqueous layer was added additional methyl tert-butyl ether (83 L) and the aqueous phase was basified to pH 9-10 using 8 wt % aq. NaOH whilst maintaining a temperature between 15 to 35 C. The aqueous layer was separated, and the organic layer was washed with three times water (3 x 30 L). The organic layer was then concentrated under reduced pressure to approximately 3 volumes and then flushed with methanol three times (3 x 30 L) and concentrated to dryness to afford the desired intermediate (12.4 kg, 90%
isolated yield) as light-yellow oil, which was used directly without further purification.
Preparation of intermediate 234a (citric acid salt of intermediate 234) citric acid salt (equivalents not determined) N
'B
[0923] Et0H (80 ml) and intermediate 234 (20 g) were added in a round bottom flask. Next, a 0.5 M solution of citric acid in Et0H (100 ml; 1 equivalent) was added to the mixture in the round bottom flask at room temperature. Subsequently, the mixture was evaporated till dryness (Rotavap, 40 C). Acetonitrile (200 ml) was added to the residue and the mixture was evaporated till dryness (Rotavap, 40 C). Acetonitrile (100 ml) was added to the residue and stirred overnight on a magnetic heating plate at room temperature. Finally, intermediate 234a was filtered off and dried at room temperature.
Preparation of crystalline form of citric acid salt of intermediate 234 (intermediate 2346) . HO2C4\CO2H
OH
Bn crystalline ratio intermediate/citric acid 3/2 [0924] Intermediate 234a (3.72 g) was added to acetonitrile (20 ml) at room temperature and the mixture was stirred. The mixture was heated to 60 C until the reaction mixture became homogeneous (about 10 minutes). Next, the mixture was cooled to 50 C at a rate of 0.5 C/min.
Next, seeds were added (19 mg of intermediate 234a; 0.5 w/w %) and the mixture was aged while stirring during 3 hours and 30 minutes. Next, the mixture was cooled non-linear to 20 C
over 8 hours with an exponent of 2,3. The obtained mixture was stirred overnight and the product was filtered off and dried (overnight at room temperature in hood).
After isolation, intermediate 234b was obtained (2.75 g; yield 73.9%) as the crystalline form of the citric acid salt of intermediate 234. The obtained ratio of the intermediate/citric acid is 3/2 (NMR).
The non-linear cooling referred to above was done according to the formula below:
A new linear ramp is started every 30 seconds during the defined duration of the cooling. The ramp is calculated according to the following equation:
t T action 30s I
set T T
startvalue [(Tstartvalue endvalue) * ( Duration Tset: Set value for each new ramp Tstart value: Measured mixture temperature at the start of the cooling trajectory Tend value: Defined end value of cooling trajectory taction: Actual time from the start of the cooling Duration: Defined cooling duration n: Exponent 1-1-1 NMR (400 MHz, Me0H-d4) 6 ppm 0.91 (3 H, d, J=6.88 Hz) 0.98 (3 H, d, J=6.88 Hz) 1.46 - 1.57(2 H, m) 1.67- 1.87(2 H, m) 1.94 - 2.03 (1 H, m) 2.20 - 2.29 (2 H, m) 2.62 - 2.69 (2 H, m) 2.72 -2.77 (4 H, m) 2.77 -2.82 (2 H, m) 2.90 (2 H, t, J=7.32 Hz) 2.95 -3.02 (2 H, m) 3.07 - 3.16 (2 H, m) 3.16 - 3.22 (2 H, m) 3.37(3 H, s) 3.68 -3.72 (2 H, m) 3.83 -3.89 (2 H, m) 3.90 - 3.92 (2 H, m) 3.94 -4.06 (2 H, m) 7.32 - 7.43 (5 H, m).
Preparation of intermediate 224 - (R)-N-(2-methoxyethyl)-N,5-dimethy1-4-(2,6-diazaspiro /3. 41 octan-2-yl)hexan- 1 -amine \ \
NR _______________________________ Pd(OH)2/C, MSA
N R _______________________________________________________________ \-0Me OMe Bn 109251 To palladium hydroxide on carbon (1.2kg) in Et0H (1.47 kg) cooled to -5 to 5 C were added methanesulfoni c acid (MS A) (11kg), (R)-4-(6-benzy1-2,6-di azaspiro[3 .4]octan -2-y1 - N-(2-methoxyethyl)-N,5-dimethylhexan-1-amine (intermediate 234) (10kg) and Et0H
(250L).
The mixture was warmed to 35-45 C and stirred under a hydrogen atmosphere (0.27 to 0.40 1\SPa) for 16-20h. The mixture was filtered over diatomite (20kg) and the pad was washed with Et0H (24L). The filtrate was concentrated under reduced pressure (<40 C) to 2-3 vol. and then flushed twice with 2-MeTHF (73kg and 47kg) to give a 2-3 vol. solution. After dilution with 2-MeTHF (65kg), 10% aq. sodium sulfate (30kg) was added and the mixture was cooled to 0 to 10 C, followed by the addition of 16% aq. NaOH (50kg) to adjust the pH to
¨0 PG
n1( )n2 'N
PG
FeN_Rsb N 118' 1- -Isl N 128a R1' ) n2 + OH N 12811 n1( )n2 Step 33 0 N ___________________________________________ > 1.11{X
Step 34 N _____________________________ Raa __________________________________________ Step 32 N
_________________________ > halo halcLri R1bõN
rr1(X)n2 halo PG -;:d.., - N R2 "
1221 N,R8b R(--..õ...,-,N_R8b --r-N 148a N 1482 n1( )n2 _________ Step 35 ).- n1(X)n2 R1 N R2= halo R1' N
0 oI'N
N*
RR1"-N R2 Rib N -N
[0854] In Scheme 9, the following reaction conditions apply:
[0855] Step 23: at a suitable temperature such as for example from -78 C to -25 C, in the presence of suitable bases such as for example DMA and n-BuLi, in a suitable solvent such as for example THF;
[0856] Step 24: at a suitable temperature such as for example between -65 C
and ¨ 55 C, in the presence of suitable reducing agent such as for example DIBAL-H, in a suitable solvent such as for example toluene, preferably conducted in a suitable flow chemistry system, [0857] Step 25: first at a suitable temperature such as for example from -10 C to 10 C, in the presence of a suitable base such as for example DMAP, in the presence of a suitable condensation agent such as for example DCC, in a suitable solvent such as for example DCM;
then at a suitable temperature such as for example from -10 C to 0 C, in the presence of a suitable acid such as for example AcOH, in the presence of a suitable reducing agent such as for example NaBH4, in a suitable solvent such as for example DCM;
[0858] Step 26: in a suitable solvent such as for example toluene and heated to reflux;
[0859] Step 27: at a suitable temperature such as for example from -5 C to 5 C, in the presence of suitable reducing agent such as for example LiBH4, in a suitable solvent such as for example 2-methyltetrahydrofuran;
[0860] Step 28: at a suitable temperature such as for example from 15 'V to 25 'V, in the presence of a suitable reducing agent such as for example NaBH(OAc)3, in a suitable solvent such as for example DCM;
[0861] Step 29: at a suitable temperature such as for example from 15 C to 25 'V, in the presence of a suitable acid such as for HC1, in a suitable solvent such as for example IPA;
[0862] Step 30: at a suitable temperature such as for example from 5 C to 30 C, in the presence of a suitable base such as for example TEA, in the presence of suitable reducing agent such as for example NaBH(OAc)3, in a suitable solvent such as for example toluene;
[0863] Step 31: at a suitable temperature such as for example from 50 C to 55 C, in the presence of a suitable base such as for example K2HPO4, in a suitable solvent such as for example H20;
[0864] Step 32: When PG is Bn at a suitable temperature such as for example from -5 C to 45 'V, under a hydrogen atmosphere within a suitable pressure range such as for example from 0.27 to 0.40 MPa, in the presence of a suitable catalyst such as for example palladium hydroxide on carbon, in the presence of a suitable acid as for example MSA in a suitable solvent such as Et0H;
[0865] Step 33: at a suitable temperature such as for example from -50 C to -40 C, in the presence of suitable base such as for example TEA, in a suitable solvent such as 2-methyltetrahydrofuran;
[0866] Step 34: at a suitable temperature such as for example from 20 C to 30 C, in the presence of suitable base such as for example TMG, in a suitable solvent such as 2-m ethy ltetrahy drofuran ;
[0867] Step 35: at a suitable temperature such as for example from 20 C to 30 C, under a hydrogen atmosphere within a suitable pressure range such as for example from 0.20 to 0.30 Mpa, in the presence of a suitable catalyst such as for example palladium on carbon, in a suitable solvent such as Me0H;
[0868] alternatively, at a suitable temperature such as room temperature, in the presence of a suitable catalyst such as for example I, F-Bis(diphenylphosphino)ferrocene-palladium(H) dichloride dichloromethane complex, a suitable reducing agent such sodium borohydride, a suitable base such as for example N,N,N',N'-tetramethylethylenediamine, in a suitable solvent such as for example tetrahydrofuran.
[0869] In general, compounds of Formula (1) wherein Y1 is limited to -CH2-, and R2 is limited to W1, hereby named compounds of Formula (Ia), can be prepared according to the following reaction Scheme 10. In Scheme 10, W1 represents chloro, bromo or iodo; all other variables are defined according to the scope of the present invention.
Scheme 10 R4i R3 R4Xi 'X ' n3(X)n4 Ria n3( )n4 CH2ZnBr Step 36 n1( )n2 n1( )n2 Ria R1b I U
N'Nhalo R1 NhaIo (la) [0870] In Scheme 10, the following reaction conditions apply:
[0871] Step 36: at a suitable temperature ranged from 60 C to 100 C, in presence of a suitable catalyst such as palladium acetate (Pd(OAc)2) or tris(dibenzylideneacetone)dipalladium(0) (Pd2(dba)3) or tetrakis(triphenylphosphine)palladium(0), in a suitable solvent such as for example tetrahydrofuran or dioxane.
[0872] The skilled person will realize that starting from compound (Ia), analogous chemistry as reported in step 10 in scheme 5 and in steps 20, 21 and 22 in scheme 8 could be performed.
[0873] In general, compounds of Formula (I) wherein Y' is limited to -CR5aR5b-and R2 is limited to Wl, hereby named compounds of Formula (Ib), can be prepared according to the following reaction Scheme 11. In Scheme 11 at least one of R5a and R5b is other than hydrogen.
All other variables are defined according to the scope of the present invention.
Scheme 11 'Xi n3(/) )n4 R1a R5a n3( )n4 R5b Step 37 niV n2 n1( )n2 RiaR5a R5b N
Rib w(LU U
N halo R1 halo (Lb) [0874] In Scheme 11, the following reaction condition apply:
[0875] Step 37: at a suitable temperature ranged from 80 C to 200 C, in presence of a suitable catalyst such as palladium acetate (Pd(OAc)2), in the presence of a suitable ligand such as for example triphenylphosphine or tricyclohexylphosphine, in a suitable solvent such as for example dioxane, preferably in sealed conditions, optionally under microwave irradiation.
[0876] The skilled person will realize that starting from compound (Ib), analogous chemistry as reported in step 10 in scheme 5 and in steps 20, 21 and 22 in scheme 8 could be performed.
Scheme 12 PG PG
Ri a n3(< )n4 n3( ) )n4 NHR5c n1( )n2 Step 38 n1( )n2 R1a R5c N
Rib halo RibXIII5 'N R2 [0877] In Scheme 12, the following reaction condition apply:
[0878] Step 38: at a suitable temperature such as for example from RT to 80 C, in the presence of a suitable base such as for example DIEA, Cs2CO3 or DBU, in suitable solvent such as for example DCM, THE or DMF;
[0879] Alternatively, at a suitable temperature such as for example RT to 100 C, in the presence of a suitable catalyst such as for example Pd2dba3, in the presence of a suitable ligand such as for example Xantphos, in the presence of a suitable base such as Cs2CO3 or Na2CO3, in a suitable solvent such dioxane or a mixture of dioxane and water.
[0880] The skilled person will realize that starting from intermediate Z, analogous chemistry as reported in case Yl represents 0 can be performed.
[0881] It will be appreciated that where appropriate functional groups exist, compounds of various formulae or any intermediates used in their preparation may be further derivatized by one or more standard synthetic methods employing condensation, substitution, oxidation, reduction, or cleavage reactions. Particular substitution approaches include conventional alkylation, arylation, heteroarylation, acylation, sulfonylation, halogenation, nitration, formylation and coupling procedures.
[0882] The compounds of Formula (I) may be synthesized in the form of racemic mixtures of enantiomers which can be separated from one another following art-known resolution procedures. The racemic compounds of Formula (I) containing a basic nitrogen atom may be converted into the corresponding diastereomeric salt forms by reaction with a suitable chiral acid. Said diastereomeric salt forms are subsequently separated, for example, by selective or fractional crystallization and the enantiomers are liberated therefrom by alkali. An alternative manner of separating the enantiomeric forms of the compounds of Formula (I) involves liquid chromatography using a chiral stationary phase. Said pure stereochemically isomeric forms may also be derived from the corresponding pure stereochemically isomeric forms of the appropriate starting materials, provided that the reaction occurs stereospecifically.
[0883] In the preparation of compounds of Formula (I), protection of remote functionality (e.g., primary or secondary amine) of intermediates may be necessary. The need for such protection will vary depending on the nature of the remote functionality and the conditions of the preparation methods. Suitable amino-protecting groups (NH-Pg) include acetyl, trifluoroacetyl, t-butoxycarbonyl (Boc), benzyloxycarbonyl (CBz) and 9-fluorenyl-methyleneoxycarbonyl (Fmoc). The need for such protection is readily determined by one skilled in the art. For a general description of protecting groups and their use, see T. W. Greene and P. G. M. Wuts, Protective Groups in Organic Synthesis, 4th ed., Wiley, Hoboken, New Jersey, 2007.
Several methods for preparing the compounds of Formula (I) are illustrated in the following examples. Unless otherwise noted, all starting materials were obtained from commercial suppliers and used without further purification, or alternatively can be synthesized by a skilled person by using well-known methods.
Table 1B - Abbreviations Abbreviation Meaning Ag(Phen)20Tf silver triflate¨bis(1,10-phenanthroline) complex 2-MeTHF 2-methyltetrahydrofuran ACN acetonitrile AcC1 acetyl chloride AcOH acetic acid Ac20 acetic anhydride aq. aqueous Ar argon BBr3 tribromoborane bn benzyl Boc tert-butyloxycarbonyl Boc20 di-tert-butyl dicarbonate n-BuLi n-butyllithium Cbz benzyloxycarbonyl CD3OD Methanol-d4 CHC13 chloroform Cs2CO3 cesium carbonate conc. concentrated DBU 1,8-diazabicyclo[5.4.0]undec-7-ene DCC dicyclohexylcarbodiimide DCE dichloroethane DCM dichloromethane DDQ 4,5-dichloro-3,6-dioxocyclohexa-1,4-diene-1,2-dicarbonitrile DEA diethylamine DIBAL-H diisobutylaluminum hydride DIEA or DIPEA N,N-diisopropylethylamine DMAP N,N-dimethylpyridin-4-amine DMF N,N-dimethylformamide DMP Dess-Martin periodinane DMSO dimethyl sulfoxide dppf 1,1'-ferrocenediyl-bis(diphenylphosphine) EDCI N-(3-Dimethylaminopropy1)-N-ethylcarbodiimide hydrochloride EA or Et0Ac ethyl acetate Et0H ethanol eq. equivalent(s) FA formic acid FCC flash column chromatography hour(s) 112 hydrogen HAT U 1 -[bi s(dimethylamino)methyl ene] -1H-1,2,3 -triazol o [4, 5-b]
pyridinium 3-oxid hexafluorophosphate 1120 water HC1 hydrochloric acid HOBt 1-Hydroxybenzotriazole HPLC high performance liquid chromatography ICH2C1 chloroiodomethane Abbreviation Meaning IPA isopropyl alcohol IPAc isopropyl acetate K2CO3 potassium carbonate KI potassium iodide K2 HP 04 dipotassium phosphate K3P 04 tripotassium phosphate LiAlD4 lithium aluminum deuteride LAH lithium aluminum hydride LiBH4 lithium borohydride LDA lithium diisopropylamide Lid lithium chloride LG leaving group Me methyl Me0H methanol 2-MeTHF 2-methyltetrahydrofuran min minute(s) mL milliliters mmol millimoles mg milligram MgSO4 magnesium sulfate MSA methanesulfonic acid MsC1 methanesulfonyl chloride MS molecular sieve MTBE methyl tert-butyl ether N2 nitrogen NA not available NaBH3CN sodium cyanoborohydride NaBH(OAc)3 sodium triacetoxyborohydride NaBD3CN sodium cyanoborodeuteride Na2CO3 sodium carbonate NaH sodium hydride NaHCO3 sodium bicarbonate Na! sodium iodide Na0Ac sodium acetate NaOH sodium hydroxide Na2S03 sodium sulfite Na2SO4 sodium sulfate NH4C1 ammonium chloride NMM 1-4-Methylmorpholine Pd2dba3 tris(dibenzylideneacetone)dipalladium(0) [1,1 1-bi s(diphenylphosphino)ferrocene] di chloropall adium(II), Pd(dppf)C12.DCM
complex with di chloromethane Pd(PPh3)4 tetrakis(triphenylphosphine)palladium(0) PE petroleum ether PG protecting group Phen phenanthroline psi pound per square inch Abbreviation Meaning p-Ts0H p-toluenesulfonic acid p-Ts011.1120 p-toluenesulfonic acid monohydrate Rt retention time Rochelle's salt potassium sodium tartrate tetrahydrate RT room temperature sat. saturated SFC supercritical fluid chromatography TBAF tetrabutylammonium fluoride TBDMS tert-butyldimethylsilyl TBDPS tert-butyldiphenylsilyl t-BuOK potassium tert-butoxide TEA triethylamine Tf trifluoromethanesulfonyl TFA trifluoroacetic acid THF tetrahydrofuran Ti(0iPr).1 titanium(IV) isopropoxide TLC thin layer chromatography TMEDA N,N,N1,AP-tetramethylethylenediamine TMG 1,1,3,3-tetramethylguanidine TMSI iodotrimethylsilane Ts p-toluenesulfonyl TsC1 p-toluenesulfonyl chloride v/v volume per volume vol. volume(s) wt weight Xantphos 4,5-bis(diphenylphosphino)-9,9-dimethylxanthene [0884] As understood by a person skilled in the art, compounds synthesized using the protocols as indicated may exist as a solvate e.g., hydrate, and/or contain residual solvent or minor impurities. Compounds or intermediates isolated as a salt form, may be integer stoichiometric i.e., mono- or di-salts, or of intermediate stoichiometry. When an intermediate or compound in the experimental part below is indicated as `HC1 salt' without indication of the number of equivalents of HC1, this means that the number of equivalents of HC1 was not determined. The same principle will also apply to all other salt forms referred to in the experimental part, such OH
as e.g., 'oxalate salt', 'formate salt' or' 0 salt [0885] A skilled person will realize that, even where not mentioned explicitly in the experimental protocols below, typically after a column chromatography purification, the desired fractions were collected and the solvent was evaporated.
[0886] In case no stereochemistry is indicated, this means it is a mixture of stereoisomers, unless otherwise is indicated or is clear from the context.
[0887] When a stereocenter is indicated with 'RS' this means that a racemic mixture was obtained at the indicated center, unless otherwise indicated.
Example 1 ¨ Synthesis of (R)-N-ethyl-5-fluoro-N-isopropyl-24(5-(2-(6-((2-methoxyethyl) (methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro [3.4] octan-6-yl)-1,2,4-triazin-6-yl)oxy) benzamide (Compound A) ¨ Preparation Method A
Preparation of intermediate I - tert-butyl (5-methyl-4-orohexAcarbamate Boc > Mg TMEDA, THF
Br [0888] To a solution of tert-butyl 2-oxopyrrolidine-1-carboxylate (5.0 g, 27 mmol) and TMEDA (5.0 mL, 33 mmol) in THF (60 mL) cooled at -70 C was slowly added isopropylmagnesium bromide solution (19 mL, 55 mmol, 2.9 M in 2-methyltetrahydrofuran), the resulting mixture was slowly warmed to RT and stirred for 12 h. The mixture was poured into sat. aq. NH4C1 (50 mL) solution and extracted with Et0Ac (50 mL x 3). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give the crude product, which was further purified by FCC
(PE/Et0Ac = 1:0 to 100:1) to afford the title intermediate (3.7 g, 60% yield) as a yellow oil.
Preparation of intermediate 13 - tert-hutyl 6-(3,6-dichloro-1,2,4-triazin-5-y1)-2,6-diazaspiro [3.4Joctane-2-carboxylate Boc Boc CI
N TEA, DCM
N
-N CI N Cl.'1)I N
N-NCI
[0889] To the solution of 3,5,6-trichloro-1,2,4-triazine (10.0 g, 54.2 mmol) and TEA (15.2 mL, 109 mmol) in DCM (100 mL) cooled at 0 C was added tert-butyl 2,6-diazaspiro[3.4]octane-2-carboxylate (9.21 g, 43.4 mmol), the mixture was warmed to RT and stirred for 1 h. The mixture was diluted with water (20 mL) and extracted with DCM (30 mL x 3). The combined organic layers were washed with brine, dried over Na2SO4, filtered and concentrated under reduced pressure to give the crude product which was purified by FCC on silica gel (PE/Et0Ac = 1:0 to 3:1) to afford the title intermediate (12.0 g, 58% yield) as a yellow solid.
Preparation of intermediate 27- N-ethyl-5-fluoro-N-isopropyl-2-methoxybenzamide HATU, DIEA, DCM 0 +
[0890] To the mixture of 5-fluoro-2-methoxybenzoic acid (8.00 g, 47.0 mmol) and N-ethylpropan-2-amine (8.19 g, 94.0 mmol) in dry DCM (150 m_L) cooled at 0 C, were slowly added HATU (21.5 g, 56.5 mmol) and DMA (9.10 g, 70.4 mmol) in portions. The resulting mixture was slowly warmed to RT and stirred for 8 h. The organic layer was washed with water (20 mL x 3) and dried over anhydrous Na2SO4. After filtration, the solvent was removed under reduced pressure and the crude product was purified by FCC (Et0Ac/PE = 0% to 20%) to afford the title intermediate (12.0 g, 96% yield) as a white solid.
Preparation of intermediate 28 - N-ethy1-5-fluoro-2-hydroxy-N-isopropyThenzarnide BBr3, DCM
[0891] To the solution of N-ethyl-5-fluoro-N-isopropy1-2-methoxybenzamide (intermediate 27) (12.0 g, 50.1 mmol) in dry DCM (100 mL) cooled at -78 C was slowly added BBr3 (14.4 mL, 152 mmol), the resulting mixture was slowly warmed to RT and stirred for 8 h.
The mixture was cooled to -78 C again and Me0H (5 mL) was added dropwise to quench the reaction. The resulting mixture was slowly warmed to RT and the pH value was adjusted to about 8 by adding sat. aq. NaHCO3 solution. The aqueous layer was extracted by DCM (50 mL x 3) and the combined organic layers were dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the crude product which was purified by FCC (Et0Ac/PE
= 0% to 20%) to afford the title intermediate (9.0 g, 78% yield) as a white solid.
Alternative preparation of intermediate 28 OH 1,1-Carbonyl diimidazole (1.2 eq.) THF,15-25 C OH
[0892] A mixture of 5-fluoro-2-hydroxy-benzoic acid (14.0 kg, 89.68mo1, 1.0 equiv.) in THF
(168 L, 12 volumes) was adjusted to between 15-25 C, and 1,1-carbonyldiimidazole, (17.45kg, 107.62 mol, 1.2 equiv.) was added over a period of 1 hour. After addition, the mixture was stirred for 18 hours at 15-25 'C. After this time N-ethylpropan-2-amine (14.85kg, 170.39mo1, 1.9 equiv.) was added to the mixture at 15-25 C over a period of 2 hours. The resulting mixture was further aged for between 18-24 hours at 15-25 C. The pH was the adjusted to between pH4-5 with aq. 10% H2SO4(140kg, 10 volumes) and the layers were separated. The organic phase was concentrated to between 42-56L maintaining a temperature below 40 C, and then n-heptane (43kg, 4.5 volumes) was added to the mixture at 15-25 C over a period of 3 hours. The mixture was then cooled to 0-10 C and stirred for an additional 6 hours. The resulting slurry was filtered and the cake was washed with a tert-butyl methyl ether (MTBE):n-heptane mixture (25 kg of a 2:3 volume/volume mixture of MTBE:n-heptane, 2.5 volumes). The cake wash was repeated a further two times and the resulting solid was dried in-vacuo at 50 C to afford intermediate 28 (16.5 kg, purity: 99.1%, yield: 80.4%).
Preparation of intermediate 14 - tert-butyl 6-(3-chloro-6-(2-(ethyl(isopropyl)earbamoyl)-4-fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.41octane-2-carboxylate poc Boc N
DB U, THF N 0 OH
CI
N-NCI NCI
[0893] The mixture of tert-butyl 6-(3,6-dichloro-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4]octane-2-carboxyl ate (intermediate 13) (12.0 g, 33.3 mmol), AT-ethy1-5-fluoro-2-hydroxy-AT-isopropylbenzamide (intermediate 28) (7.5 g, 33.3 mmol) and DBU (6.1 g, 40.1 mmol) in THY
(120 mL) was stirred at 25 C for 8 h. The mixture was diluted with water (30 mL) and extracted with DCM (30 mL x 3). The combined organic layers were washed with brine, dried over Na2SO4, filtered and concentrated under reduced pressure to give the crude product which was purified by FCC (PE/Et0Ac = 1:0 to 3:1) to afford the title intermediate (14.0 g, 73% yield) as green solid.
Preparation of intermediate 2 - tert-butyl 6-(6-(2-(ethyl(isopropyl)carbamoyI)-47fhtoro-phenoxy)-1,2,4-triazin-5-y1)-2,6-d1azasp1ro[3. 4Joctane-2-carboxylate Synthesis method A for intermediate 2:
,Boc ,Boc NaBH4, TMEDA
Pd(dppf)C12=DCM, THF
I
NCI F
NN
108941 To the mixture of tert-butyl 6-(3-chloro-6-(2-(ethyl(isopropyl)carbamoy1)-4-fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4]octane-2-carboxylate (intermediate 14) (20 g, 36.4 mmol), NaBH4 (2.48 g, 65.7 mmol) and TMEDA (8.54 g, 73.5 mmol) in THF (500 mL) was added Pd(dppf)C12=DCM (1.70 g, 2.08 mmol) under N2 atmosphere. After addition, the reaction mixture was stirred at 25 C for 14 h. The reaction mixture was filtered and the filtrate was concentrated, the residue was purified by FCC on silica gel (Et0Ac) to afford the title intermediate (15 g, 93% purity, 74% yield) as brown solid.
Synthesis method B fbr intermediate 2:
,Boc ,Boc Pd/C, H2 TEA, Me0H
OyJN OyJN
N-NCI
108951 To the solution of tert-butyl 6-(3-chloro-6-(2-(ethyl(isopropyl)carbamoy1)-4-fluorophenoxy)-1,2,4-tri azin-5-y1)-2,6-di azaspiro[3 .4]octane-2-carboxyl ate (intermediate 14) (22.0 g, 40.1 mmol), TEA (15 mL) in Me0H (100 mL) was added Pd/C (wet, 5.0 g, 10%) The resulting mixture was stirred under H2 atmosphere (30 psi) at 25 C for 8 h.
The reaction mixture was filtered through a celite pad and the filtrate was concentrated in men to afford the title intermediate (25.0 g, crude), which was used directly in next step without further purification.
Preparation of intermediate 3 - 2-((5-(2,6-diazaspiro[3.4Joclan-6-y1)-1,2,4-triazin-6-y1)oxy)-N-ethyl-5-fluoro-N-isopropylbenzamide ,Boc NH
r' TFA, DCM 0 -N
I
N I
N
F N -[0896] To the solution of tert-butyl 6-(6-(2-(ethyl(isopropyl)carbamoy1)-4-fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4]octane-2-carboxylate (intermediate 2) (300 mg, 0.583 mmol) in DCM (5 mL) was added TFA (0.5 mL, 6.4 mmol), the resulting mixture was stirred at RT for 3 h. Then 10% NaOH (5 mL) solution was slowly added into the mixture to adjust the pH value to about 12, the resulting mixture was extracted with DCM (10 mL
x 3). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated in vacuo to afford the title intermediate (220 mg, 90% yield) as a white solid.
Preparation of Compound 61 - tell-butyl (4-(6-(6-(2-(ethyl(isopropyl)carbamoy1)-4-.fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4loctan-2-y1)-5-inethylhexyl)carbamate NH
r--ZnCl2, NaBH3CN
HN¨Boc 0, HN¨Boc Me0H, 80'C NO N
NN T NJ
öOLN
[0897] The mixture 2-45-(2,6-diazaspiro[3 .4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)-N-ethy1-5-fluoro-N-isopropylbenzamide (intermediate 3) (1.0 g, 2.4 mmol), tert-butyl (5 -methy1-4-oxohexyl)carbamate (intermediate 1) (830 mg, 3.62 mmol) and ZnC12 (660 mg, 4.84 mmol) in Me0H (15 mL) was stirred at 80 C for 0.5 h. Then NaBH3CN (310 mg, 4.93 mmol) was added and the resulting mixture was stirred at 80 C for 6 h. After cooled to RT, the mixture was concentrated under reduced pressure to give the crude product, which was further purified by preparative HPLC using a Waters Xbridge Prep OBD (column: C18 150x40 mm 10 um;
eluent:
ACN/H20 (0.05% ammonia) from 45% to 75% v/v) to afford the title compound (700 mg, 46%
yield) as colorless oil.
Preparation of Compounds 62 and 63 - le rt-butyl (R)-(4-(6-(6-(2-(ethyl(isopropyl) carbainoy1)-47fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4Joctan-2-y1)-5-methylhexyl)carbamate and ten-butyl (S)-(4-(6-(6-(2-(ethyl(isopropyl)cctrbamoyh-47fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4loctan-2-y1)-5-methylhexyl)carbamate N R __________________________________________________________ HN¨Boc HN¨Boc SFC
0 C3 0 N./
N
N-NJ
Compound 61 Compound 62 N\
HN¨Boc yL N
Compound 63 [0898] tert-butyl (4-(6-(6-(2-(ethyl(i sopropyl)carb amoy1)-4-fluorophenoxy)-1,2,4-tri azin-5 -y1)-2,6-diazaspirot3 .4] octan-2-y1)-5-methylhexyl)carbamate (compound 61) (200 mg, 0.319 mmol) was purified by SFC over DAICEL CHlRALPAK IG (column: 250x30 mm 10 um;
isocratic elution: Et0H (containing 0.1% of 25% ammonia): supercritical CO2, 40%: 60% (v/v)) to afford the title compounds (compound 62) (85 mg, 42% yield) and (compound 63) (80 mg, 40% yield) both as light yellow oil.
Compound 64 - (R)-2-((5-(2-(6-amino-2-methylhexan-3-y1)-2,6-diazaspiro[3.4Joctan-6-y1)-1,2,4-triazin-6-yl)oxy)-N-ethyl-5-fluoro-N-isopropylbenzamide \ \
N R __________________________________________________________________ R __ r- HN¨Boc TFA, DCM
N.2 IN
[0899] To the solution of tert-butyl (R)-(4-(6-(6-(2-(ethyl(isopropyl)carbamoy1)-4-fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4]octan-2-y1)-5-methylhexyl)carbamate (compound 62) (550 mg, 0.876 mmol) in DCM (4 mL) was slowly added TFA (4 mL), and the resulting mixture was stirred at 25 C for 1 h. The reaction mixture was concentrated under reduced pressure to give a residue. The residue was diluted in DCM (40 mL) and the pH value was adjusted to around 12 by aq. NaOH (2 M, 16 mL) solution. The aqueous layer was extracted with DCM (10 mL x 2). The combined organic layers were dried over anhydrous Na2SO4, filtered and concentrated in vacuo to afford the title compound (460 mg, crude) as yellow solid, which was used directly in next step without further purification.
Compound 11 - (R)-N-ethy1-5-fluoro-N-isopropy1-245-(2-(6-((2-methoxyethyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro[3.4Joctan-6-y1)-1,2,4-triazin-6-y1)oxy)benzamide 0\
NR ________________________ NH2 N R _____________________________________________________________________ FI/N
+ , Cs2CO3,N. Nal )._ 0 isC5-3 Br 0 N
DMF, 80 C MW
0 1, 0 1, )N
N, N, Ni [0900] The mixture of (R)-24(5-(2-(6-amino-2-methylhexan-3-y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)-N-ethy1-5-fluoro-N-isopropylbenzamide (compound 64) (120 mg, crude), 1-bromo-2-methoxyethane (32 mg, 0.23 mmol), Cs2CO3 (222 mg, 0.681 mmol), NaI
(102 mg, 0.680 mmol) in DMF (1 mL) was stirred at 80 C via microwave irradiation for 1 h.
After cooling to RT, the mixture was diluted with H20 (10 mL) and extracted with Et0Ac (3 x mL). The combined organic layers were washed with H20 (10 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to afford the crude product which was further purified by HPLC over a Phenomenex Gemini-NX (column: 150x30 mm 5 um; eluent:
ACN/H20 (10mM NH4HCO3) from 51% to 71% (v/v)) and further purified by SFC over DAICEL CHIRALCEL OD-H (column: 250x30 mm 5 urn; eluent: supercritical CO2 in Et0H
(0.1% v/v ammonia) 25/25, v/v) to afford the title compound (5.13 mg, 96%
purity) as yellow solid.
[0901] LC-MS (ESI) (Method 1): Rt = 2.997 min, m/z found 586.3 [M+E-1] .
Compound A (R)-N-ethyl-5-iluoro-N-isopropyl-245-(2-(642-methoxyethyl) (methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro13.4Joctan-6-y1)- I ,2,4-triazin-6-yl)oxy) benzamide N
H/N¨\\_ R __________________________________ 0 N R _____________________________________________________________________ /
0 4,N HCOH, NaBH3CN 0 N AcOH, Me0H
Compound A
N-N I I
Compound 11 [0902] The mixture of (R)-N-ethyl-5-fluoro-N-i sopropy1-2-((5-(2-(6-((2-methoxyethyl)amino)-2-methylhexan-3 -y1)-2, 6-di azaspiro [3.4] octan-6-y1)-1,2, 4-triazin-6-yl)oxy)benzami de (compound 11) (40.0 mg, 0.068 mmol), formaldehyde (55.4 mg, 0.683 mol, 37% in water) and AcOH (8.2 mg, 0.137 mmol) in anhydrous Me0H (2 mL) was stirred at 45 C for 1 h. Then, NaBH3CN (8.6 mg, 0.137 mmol) was added to the mixture and the resulting mixture was stirred at 45 C for another 1 h. After cooling to RT, the reaction mixture was treated with sat. aq. NaHCO3 (40 mL) to adjust the pH value to about 8 and further extracted with DCM (20 mL x 3). The combined organic layers were dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the crude which was purified by preparative 1-1PLC over Boston Prime (column: C18 150x30mm 5um, Mobile Phase A: H20 (0.04% ammonia+10mM NH4HCO3), Mobile Phase B: ACN, Flow rate: 25 mL/min, gradient condition B/A from 50% to 80% (50%B to 80% B)) to afford the title compound (9.62 mg, 99.10% purity, 23.3% yield) as yellow oil.
Example 2 ¨ Synthesis of (R)-N-ethyl-5-fluoro-N-isopropyl-2-45-(2-(6-02-methoxyethyl) (methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro [3.4] oetan-6-yl)-1,2,4-triazin-6-yl)oxy) benzamide (Compound A) ¨ Preparation Method B
Preparation of intermediate 7 - 4-((tert-butoxycarbonyl)(methyl)amino)butanoic acid (130c)20 TEA, Me0H
[0903] To a solution of 4-(methylamino)butanoic acid hydrochloride (3.0 g, 19.5 mmol) and TEA (7.78 mL, 58.6 mmol) in Me0H (30 mL) was added Boc20 (4.69 g, 21.5 mmol) dropwise.
The mixture was stirred at RT for 2 h. The mixture was concentrated under reduced pressure and the residue was diluted with Et0Ac (100 mL), washed with cooled 0.1 N HC1 (70 mL x 2), H20 (50 mL x 2) and brine (50 mL), dried over Na2SO4, filtered and concentrated to afford the title intermediate (1.80 g, crude) as colorless oil.
Preparation of intermediate 8 - tert-butyl (4-(methoxy(methyl)amino)-4-oxobutyl)(methyl) carbamate HO, Boc o EDCI, HOBt, NMM, CHCI3 N
IV"-B G
[0904] To a solution of 4-((tert-butoxycarbonyl)(methyl)amino)butanoic acid (intermediate 7) (1.80 g, crude) in CHC13 (30 mL) was added N,O-dimethylhydroxylamine hydrochloride (960 mg, 9.84 mmol), H013t (1.24 g, 9.18 mmol) and NMM (2.80 mL, 25.1 mmol). And, then EDO-(2.23 g, 11.6 mmol) was added and the reaction mixture was stirred at RT for 4 h. The reaction mixture was diluted with DCM (100 mL), washed with 1N HC1 (30 mL x 3), sat.
aq. NaHCO3 (30 mL x 3) and brine (30 mL), dried over Na2SO4, filtered and concentrated under in lactic) to afford the title intermediate (1.70 g, crude) as colorless oil.
Preparation of intermediate 9 - tert-butyl methyl(5-methyl-4-orohexyl)carbamate THF, -70 C
Boc ,,F.Boc 0 ) __ Li [0905] To a solution of tert-butyl (4-(methoxy(methyl)amino)-4-oxobutyl)(methyl)carbamate (intermediate 8) (200 mg, crude) in TUT' (5 mL) cooled at -70 C under N2 atmosphere was added dropwise isopropyllithium (3.2 mL, 2.24 mmol, 0.7M in pentane). The resulting mixture was stirred at -70 C for 2 h. The mixture was quenched with sat. aq. NH4C1 (15 mL), extracted with Et0Ac (30 mL x 2). The combined organic layers were washed with brine (30 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to give a crude product. The crude product was further purified by FCC (PE/Et0Ac = 10:1) to afford the title intermediate (60 mg) as colorless oil.
Preparation of Compound 60 - tert-butyl 64-(6-(6-(2-(ethyl(isopropyl)carbamoyl)-1-fluor ophenoxy)- I , 2 ,,l-triazin-5-yl)-2,6-diazaspiro [3 . octan-2-y1)-5-methylhexyl) (methyl) carbatnate NH
\N-Boc õT. N
-N + Boc ZnC12, NaBH3CN
,N ,0 _0 0 Me0H, 80 C
ii i Oyj'N
F
[0906] To a solution of 24(5-(2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)-N-ethyl-5-fluoro-N-isopropylbenzamide (intermediate 3) (600 mg, 1.45 mmol) and tert-butyl methyl(5-methy1-4-oxohexyl)carbamate (intermediate 9) (330 mg, 1.37 mmol) in Me0H (50 mL) was added ZnC12 (789 mg, 5.79 mmol). The resulting mixture was stirred at 80 C
for 2 h. Then NaBH3CN (729 mg, 11.6 mmol) was added and the reaction mixture was stirred at overnight. After cooling to RI, the mixture was concentrated under reduced pressure to give a crude residue, which was diluted with DCM (50 mL), quenched with sat. aq.
NH4C1 (50 mL) and extracted with DCM (50 rriL x 3). The combined organic layers were washed with brine (50 mL), dried over Na2SO4, filtered and the filtrate was concentrated under reduced pressure to give a crude product which was further purified by FCC (DCM/Me0H = 10:1) to afford the title compound (400 mg, 42% yield) as white solid.
Compound 67- N-ethyl-5-fluoro-N-isopropyl-245-(2-(2-methyl-6-(methylamino)hexan-3-yl)-2,6-diazaspiro[3.4loctan-6-yl)-1,2,4-triazin-6-yhoxj)benzamide hydrochloride \ Boc \ /NH
HCl/1,4-dioxane ciN
I
N I
HCl salt [0907] To a solution of tert-butyl (4-(6-(6-(2-(ethyl(isopropyl)carbamoy1)-4-fluorophenoxy)-1,2,4-triazin-5-y1)-2,6-diaza spiro[3 4] octan-2-y1)-5-methylhexyl)(methyl)carbamate (compound 60) (1 g, 1.56 mmol) in DCM (10 mL) was added 4M HC1 in dioxane (5 mL, 20 mmol), the resulting mixture was stirred at RT for 1 h. The reaction mixture was concentrated in vacuo to afford the title compound (960 mg, crude, HC1 salt) which was used directly in next step without further purification.
Compound A - (R)-N-ethyl-57fluoro-N-isopropyl-2-((5-(2-(6-((2-methoxyethyl) (methyl) amino)-2 -methylhexan- 3-yl)-2, 6-diazaspiro [3 . octan-6-yh- I, 2 ,z1-triazin-6-yl)oxy) benzamide \ F17¨
K2CO3, Nal ____________________________________________________ -.1=1 0 y-k-N Br I
N DMF, 50 C
oY14 HC I salt F
N 1 Compound Compound 67 SFC
5-1\s __________________________________________________________________ \_./
0yJN Compound A
[0908] To the mixture of AT-ethyl-5-fluoro-AT-i sopropy1-245-(2-(2-m ethyl -6-(m ethyl amino) hexan-3 -y1)-2,6-diazaspiro[3 .4] octan-6-y1)-1,2,4-tri azin-6-yl)oxy)b enzamide hydrochloride (compound 67) (480 mg, crude), K2CO3 (700 mg, 5.07 mmol) and NaI (400 mg, 2.67 mmol) in D1VIF (5 mL) was added 1-bromo-2-methoxyethane (230 mg, 1.65 mmol). The resulting mixture was stirred at 50 C overnight. After cooled to RT, the reaction mixture was quenched with H20 (30 mL) and extracted with DCM (30 mL x 3). The combined organic layers were washed with brine (30 mL x 3), dried over Na2SO4, filtered and concentrated to give a crude residue. The residue was purified by FCC (DCM/Me0H = 10:1) to afford N-ethy1-5-fluoro-N-i sopropy1-2-45-(2-(6-((2-m ethoxy ethyl)(m ethyl)ami no)-2-m ethylhexan-3 -y1)-2,6-diazaspiro[3 .4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide (compound 68) (250 mg, 48%
yield) as yellow oil.
[0909] The N-ethyl-5-fluoro-N-i sopropy1-24(5-(2-(64(2-methoxyethyl)(methypamino)-2-methylhexan-3-y1)-2,6-diazaspiro[3 . 4] octan-6-y1)-1,2,4-triazin-6-yl)oxy)b enzamide (compound 68) (960 mg, combined from several batches obtained by Method B) was first separated by SFC using DA10EL CH1RALPAK 1G (column: 250x30mm 10um; Mobile phase:
A: Supercritical CO2, B: Et0H (0.1% ammonia), A:B=40:60 at 60 mL/min) and further purified by preparative ITPLC using Boston Prime (column: 150x30mm 5um, Mobile Phase A:
(10mM NH4HCO3), Mobile Phase B: ACN, Flow rate: 25 mL/min, gradient condition B/A from 55% to 85%) to afford the title compound (270 mg) as colorless oil.
[0910] 1H NMR (400 MHz, Methanol-d4): 6 = 8.40 (s, 1H), 7.47-7.32 (m, 1H), 7.30-7.10 (m, 2H), 4.24-4.01 (m, 2H), 3.89-3.60 (m, 3H), 3.48 (br s, 3H), 2.63-2.51 (m, 2H), 2.43-2.32 (m, 2H), 2.29-2.07 (m, 6H), 1.86-1.72 (m, 1H), 1.62-1.44 (m, 2H), 1.39-1.02 (m, 10H), 0.99-0.66 (m, 9H). Some protons were hidden by the solvent peak and are not reported.
[0911] LCMS (ES!) (Method 2): Rt = 1.965 min, m/z found 600.3 [M-P111+.
[0912] SFC (Method 11): Rt = 4.904 min.
Example 3 ¨ Synthesis of (R)-N-ethyl-5-fluoro-N-isopropyl-2-45-(2-(6-02-methoxyethyl) (methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro [3.4] octan-6-yl)-1,2,4-triazin-6-yl)oxy) benzamide (Compound A) ¨ Preparation Method C
Preparation of intermediate 227- tert-butyl (R)-(1-(2,2-dimethy1-4,6-dioxo-1,3-dioxan-5-y1)-3-methylbutan-2-Acarbaniate 1. 0 0 DCC, DMAP, DCM
HN'Boc 2. NaBF14, AcOH
Boc,NH00 [0913] Boc-L-valine (44.9 kg), 2,2-dimethy1-1,3-dioxane-4,6-dione (32.9 kg) and DMAP (35.5 kg) in DCM (607 kg) pre-cooled at -10 to 0 C were added to a solution of DCC
(55.5 kg) in DCM (613 kg) over 3 h and aged for 16 h at -10 to 0 C. 10% citric acid aqueous solution (449 kg) was added whilst maintaining a temperature below 10 C. The resulting slurry was aged for 2 h at 0 to 10 C then filtered. The filter cake was washed with DCM (91 kg).
The filtrate was separated and the organic layer was washed with 10% citric acid aqueous solution (two times 450 kg) and 10% NaCl aqueous solution (449 kg). To organic phase (1200 kg), was added acetic acid (75.0 kg) whilst maintaining a temperature between -10 to 0 C.
Sodium Borohydride (18.0 kg) was added in portions over 5 h whilst maintaining a temperature in the range -10 to 0 C and then resulting mixture was aged at -10 to 0 C for an additional 16 h.
The mixture was warmed to 15 to 25 C, and aged for 2 h. The mixture was then washed with 14%
NaCl aqueous solution (450 kg) followed by a second wash with 14% NaCl aqueous solution (432 kg) and a final water wash (444 kg). The organic phase was concentrated under reduced pressure to 2-4 vol. !so-propanol (143 kg) was added to the residue and concentrated to 4-5 vol. under reduced pressure. After cooling to -10 to 0 C and aging for 8 h, the resulting slurry was filtered, washed with IPA (38 kg) and dried to afford the title intermediate (46.7 kg, 69%
yield) as a white solid.
Preparation of intermediate 228 - tert-butyl (R)-2-isopropy1-5-aropyrrolidine-I-carboxy1ate Reflux Boc",NH00 Toluene -7i-- Boo [0914] tert-butyl (R)-(1-(2,2-di m ethy1-4, 6-di oxo-1,3 -di oxan-5 -y1)-3 -methylbutan-2-yl)carbamate (intermediate 227) (46.7 kg) in toluene (333 kg) was heated to reflux and aged for 4 h. The mixture was cooled to ambient temperature, filtered and washed with toluene (20 kg).
The combined filtrates were concentrated to dryness at reduced pressure to afford the desired compound (31.05 kg, 96% yield) as an oil which was used directly without further purification.
Preparation of intermediate 229 - tert-butyl (5R)-2-hydroxy-5-isopropylpyrrolidine-1-carboxylate 0 LiBH4 OH
Boo 2-MeTHF
[0915] tert-butyl (R)-2-i sopropy1-5 -oxopyrrol i di ne-l-carb oxyl ate (intermediate 228) (30.9 kg) in 2-MeTHF (26.7 kg) was cooled to -5 to 5 C. A solution of LiBH4in 2-MeTHF
(1M, 45.2 kg, 54.4 mol) was added over 3 h and the mixture was aged for 4 h. A cold aqueous solution of 5%
NaHCO3 (163 kg) was added at -5 to 5 C over 3h and aged for an additional 2 h. The mixture was warmed to ambient temperature and aged for a further 2 h. The aqueous layer was separated and the organic layer was washed with 10% NaCl aqueous solution (170 kg) and water (155 kg). During the water wash, an emulsion formed and solid NaCl (3.1 kg) was added to affect the separation. After removal of the aqueous layer, the organic layer was concentrated under reduced pressure to dryness to afford the desired compound (28.5 kg, 91%
yield) as an oil, which was used directly without further purification.
Preparation of intermediate 230 - tert-butyl (R)-(64(2-methoxyethyl)(methyl)amino)-2-methylhexan-3-Acarbamate MeOCH2CH2NHMe NaBH(OAc)3 OH DCM
BocHN'Boc [0916] tert-butyl (5R)-2-hydroxy-5 sopropylpyrrol i dine-1 -carboxyl ate (intermediate 229) (28.55 kg) in DCM (344 kg), at 15 to 25 C was treated with 2-methoxy-N-methylethan-1 -amine (12.3 kg, 138.0 mol) and the resulting mixture was aged for 1 h. Sodium triacetoxyborohydride (40.12 kg) was added in portions over 5h whilst maintaining a temperature between 15 to 25 C
and the resulting mixture was aged for 48 h. The reaction mixture was quenched by the addition of 8% NaOH aqueous solution (184 kg) over 2 h whilst maintaining a temperature between 15 to 25 C and the mixture was aged for a further 2 h. The water layer was separated, and the organic layer was washed with water (169 kg). The organic layer was then concentrated under reduced pressure to dryness to afford the title intermediate (33.26 kg, 88%
yield) as an oil which was used directly without further purification.
Preparation of intermediate 231 - (R)-N1-(2-methoxyethyl)-N1,5-dimethylhexane-1,4-diamine, dihydrochloride HCI / IPA
HN, Boc NH2 2 HCI
[0917] To 4 molar solution of HC1 in iso-propanol (84.80 kg) at ambient temperature was added a solution of tert-butyl (R)-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-yl)carbamate (intermediate 230) (32.38 kg) in iso-propanol (25.6 kg) over 3 h and the mixture was aged at ambient temperature for an additional 19 h. Methyl tert-butyl ether (95.25 kg) was then added over 1 h and the mixture was aged for 2.5 h. The resulting slurry was filtered and washed with MTBE (53 kg). The filter cake was dried to afford the title compound (23.92 kg, 81% yield) as a white solid.
Preparation of intermediate 232 - ethyl 1-benzy1-3-(chloromethyl)pyrrolicline-3-carboxylate CO2Et DIPEA (1.1 eq.) CI
'(n-BuLi (1.0 eq.) 47\5CO2Et N.0 THF
ICH2CI (1.2 eq.) Bn -78 to -60 C
[0918] To a solution of D1PEA (952 g, 1.1 eq.) in THY (6 L) which was cooled to -35 to -25 C
was added n-BuLi (2.33 kg, 2.5 M in hexane, 1.0 eq.) whilst maintaining a temperature below -25 C. The resulting mixture was aged at -35 to -25 C for an additional 30 min then cooled to between -78 to -60 C. A solution of ethyl 1-benzylpyrrolidine-3-carboxylate (2 kg, 1.0 eq.) in THF (2 L) at -78 to -60 C was added and stirred for an addition 30 min.
Chloroiodomethane (1.81 kg, 1.2 eq.) was then charged at -78 to -60 C. The reaction mixture was aged at -60 to -40 C for 2 h. To the reaction mixture was added to citric acid aqueous solution (660 g in 6 L
H20) at a temperature between 0 to 10 C and the resulting mixture was aged at 20 to 30 C for an additional 20 min. After separating the layers, the aqueous layer was extracted with Et0Ac (6 L) and the combined organic layers washed with brine (6 L) then warmed to 50 to 60 C.
Oxalic acid (2.22 kg) was charged at 50 to 60 C. The resulting mixture was stirred at 50 to 60 C
for 3 h then cooled to 20 to 30 C and aged overnight. The resulting solid was filtered and the cake was washed with ethyl acetate (2 L). The wet cake was added to toluene (4 L), H20 (8 L) and K3PO4 (1.5 eq.) and the resulting mixture was aged at 20 to 30 C for 20 min. After separating the layers, the aqueous layer was extracted with toluene (2 L). The organic layers were combined and washed twice with water (2 L). The organic phase was concentrated under reduced pressure to afford 4.2 kg of the desired compound as a toluene solution (46 wt % by assay, giving an assay yield of 80%).
Preparation of intermediate 233 - 1-benzy1-3-(ch1oromethyOpyrrolidine-3-carbaldehyde CI Flow CO2Et 10)* CI '0 DIBAL-H (2.0 eq.) Ns Bn toluene Bn -65 to -55 C
[0919] Reaction conducted in a flow chemistry system: A solution of ethyl 1-benzy1-3-(chloromethyl)pyrrolidine-3-carboxylate (intermediate 232) (4.4 kg) in toluene (26 L) was pumped at 26.7 mL/min and cooled to -60 C. After cooling, it was then mixed with a cooled solution of DIBAL-H (28.1 mol) in toluene at -60 C (28 L) with a pumping rate of 32.1 mL/min.
The mixture was passed through a Perfluoroalkoxy (PFA) coil tube reactor at ¨60 C (total flow rate of 58.8 mL/min with a residence time of 5 seconds). The resulting mixture was mixed with cooled Me0H (-60 C) which was pumped at the rate of 15.2 mL/min. This mixed solution was pumped to another PFA coil tube reactor at ¨60 C (total flow rate of 74 mL/min with a residence time of 5 seconds). The resulting mixture was collected into a receiver which contained 20 wt %
aq. solution Rochelle' s salt (20 V). The layers were separated, and the organic phase was twice washed with water (2 x 44 L). The organic phase was combined with another 3.0 kg batch prepared in an analogous manner and concentrated under reduced pressure to afford 20.8 kg of a toluene solution of the desired compound (25.5 wt % assay by HPLC, giving an assay yield of 85%) which was used directly without further purification.
[0920] 111 NMR (300 MHz, Chloroform-d): 6 9.62 (s, 1H), 7.39 - 7.20 (m, 5H), 3.83 - 3.57 (m, 4H), 2.96 (d, J = 10.2 Hz, 1H), 2.80 - 2.55 (m, 3H), 2.17 (ddd, J = 13.9, 7.9, 6.1 Hz, 1H), 1.83 (ddd, J = 13.4, 7.8, 5.5 Hz, 1H).
Preparation of intermediate 234 - (R)-4-(6-benzy1-2,6-diazaspiro[3.4loctan-2-y1)-N-(2-methoxy ethyl)-N,5-dimethylhexan-l-amine OMe <
N- Cl2cCo K2HPO4 0.0 eq.)`
NH2 2 HCI ci FIN A H20 __ R
\-14, __________________________ k N-\ N-Bn Et3N (2.0 eq.) \-0Me 50-55 C
\-0Me NaBH(OAc)3 (3.2 eq.) N2 N
toluene Bn - Bn [0921] To a solution of 1-benzy1-3-(chloromethyl)pyrrolidine-3-carbaldehyde (intermediate 233) in toluene (3.0 kg, 10 wt %) diluted with toluene (30 L) and (R)-N1-(2-methoxyethyl)-M,5-dimethylhexane-1,4-diamine, dihydrochloride (intermediate 231) (3.47 kg) was added triethylamine (2.55 kg, 25.2 mol) at 20 to 30 C. The resulting mixture was aged for 2 h at 20 to 30 C. Then sodium triacetoxyborohydride (9.0 kg) was charged at 20 to 30 C and the mixture was aged for 12 h. The reaction mixture was cooled to 5 to 15 C and 25 wt %
NaOH aqueous solution (25 L, -16.75 eq.) was added maintaining a temperature below 35 C.
The resulting mixture was aged at 20 to 30 C for 25 mins and the layers were separated. The organic layer was washed with 15 wt % aq. NaCl (10 L) and the layers were again separated and water (18 L) was charged to the organic phase. The pH of the aqueous phase was adjusted to 6-7 with 4M aq. HC1 whilst maintaining an internal temperature below 35 C. The organic phase was then discarded and the aqueous phase was separated and basified to pH 8-9 with K2HPO4.
[0922] The resulting mixture was warmed to 50 to 55 C and aged for 3 h. The reaction mixture was then cooled to ambient temperature and combined with other two batches (2.4 kg + 3.0 kg).
The combined streams were washed with methyl tert-butyl ether three times (3 x 40 L). To the resulting aqueous layer was added additional methyl tert-butyl ether (83 L) and the aqueous phase was basified to pH 9-10 using 8 wt % aq. NaOH whilst maintaining a temperature between 15 to 35 C. The aqueous layer was separated, and the organic layer was washed with three times water (3 x 30 L). The organic layer was then concentrated under reduced pressure to approximately 3 volumes and then flushed with methanol three times (3 x 30 L) and concentrated to dryness to afford the desired intermediate (12.4 kg, 90%
isolated yield) as light-yellow oil, which was used directly without further purification.
Preparation of intermediate 234a (citric acid salt of intermediate 234) citric acid salt (equivalents not determined) N
'B
[0923] Et0H (80 ml) and intermediate 234 (20 g) were added in a round bottom flask. Next, a 0.5 M solution of citric acid in Et0H (100 ml; 1 equivalent) was added to the mixture in the round bottom flask at room temperature. Subsequently, the mixture was evaporated till dryness (Rotavap, 40 C). Acetonitrile (200 ml) was added to the residue and the mixture was evaporated till dryness (Rotavap, 40 C). Acetonitrile (100 ml) was added to the residue and stirred overnight on a magnetic heating plate at room temperature. Finally, intermediate 234a was filtered off and dried at room temperature.
Preparation of crystalline form of citric acid salt of intermediate 234 (intermediate 2346) . HO2C4\CO2H
OH
Bn crystalline ratio intermediate/citric acid 3/2 [0924] Intermediate 234a (3.72 g) was added to acetonitrile (20 ml) at room temperature and the mixture was stirred. The mixture was heated to 60 C until the reaction mixture became homogeneous (about 10 minutes). Next, the mixture was cooled to 50 C at a rate of 0.5 C/min.
Next, seeds were added (19 mg of intermediate 234a; 0.5 w/w %) and the mixture was aged while stirring during 3 hours and 30 minutes. Next, the mixture was cooled non-linear to 20 C
over 8 hours with an exponent of 2,3. The obtained mixture was stirred overnight and the product was filtered off and dried (overnight at room temperature in hood).
After isolation, intermediate 234b was obtained (2.75 g; yield 73.9%) as the crystalline form of the citric acid salt of intermediate 234. The obtained ratio of the intermediate/citric acid is 3/2 (NMR).
The non-linear cooling referred to above was done according to the formula below:
A new linear ramp is started every 30 seconds during the defined duration of the cooling. The ramp is calculated according to the following equation:
t T action 30s I
set T T
startvalue [(Tstartvalue endvalue) * ( Duration Tset: Set value for each new ramp Tstart value: Measured mixture temperature at the start of the cooling trajectory Tend value: Defined end value of cooling trajectory taction: Actual time from the start of the cooling Duration: Defined cooling duration n: Exponent 1-1-1 NMR (400 MHz, Me0H-d4) 6 ppm 0.91 (3 H, d, J=6.88 Hz) 0.98 (3 H, d, J=6.88 Hz) 1.46 - 1.57(2 H, m) 1.67- 1.87(2 H, m) 1.94 - 2.03 (1 H, m) 2.20 - 2.29 (2 H, m) 2.62 - 2.69 (2 H, m) 2.72 -2.77 (4 H, m) 2.77 -2.82 (2 H, m) 2.90 (2 H, t, J=7.32 Hz) 2.95 -3.02 (2 H, m) 3.07 - 3.16 (2 H, m) 3.16 - 3.22 (2 H, m) 3.37(3 H, s) 3.68 -3.72 (2 H, m) 3.83 -3.89 (2 H, m) 3.90 - 3.92 (2 H, m) 3.94 -4.06 (2 H, m) 7.32 - 7.43 (5 H, m).
Preparation of intermediate 224 - (R)-N-(2-methoxyethyl)-N,5-dimethy1-4-(2,6-diazaspiro /3. 41 octan-2-yl)hexan- 1 -amine \ \
NR _______________________________ Pd(OH)2/C, MSA
N R _______________________________________________________________ \-0Me OMe Bn 109251 To palladium hydroxide on carbon (1.2kg) in Et0H (1.47 kg) cooled to -5 to 5 C were added methanesulfoni c acid (MS A) (11kg), (R)-4-(6-benzy1-2,6-di azaspiro[3 .4]octan -2-y1 - N-(2-methoxyethyl)-N,5-dimethylhexan-1-amine (intermediate 234) (10kg) and Et0H
(250L).
The mixture was warmed to 35-45 C and stirred under a hydrogen atmosphere (0.27 to 0.40 1\SPa) for 16-20h. The mixture was filtered over diatomite (20kg) and the pad was washed with Et0H (24L). The filtrate was concentrated under reduced pressure (<40 C) to 2-3 vol. and then flushed twice with 2-MeTHF (73kg and 47kg) to give a 2-3 vol. solution. After dilution with 2-MeTHF (65kg), 10% aq. sodium sulfate (30kg) was added and the mixture was cooled to 0 to 10 C, followed by the addition of 16% aq. NaOH (50kg) to adjust the pH to
13-14. The temperature was adjusted to 15 to 25 C and stirred for 30 to 60 min. The aqueous layer was separated and extracted twice with 2-MeTHF (47kg x 2). The combined organic layers were concentrated under reduced pressure (<40 C) to 3-4 vol. and 2-MeTHE (950g) was added.
After concentration under reduced pressure (<40 C) to 3-4 vol., the resulting solution was diluted with 2-MeTHF (30kg), dried by passing through 4A molecular sieves (25kg) and washed with 2-MeTHF (30kg). The final solution was concentrated to afford the desired compound (6.7kg) as an oil with 90.1% assay purity in a 79% corrected yield.
Preparation of intermediate 225 - (R)-4-(6-(3,6-dichloro-1,2,4-triazin-5-y1)-2,6-diazaspiro [3.4]octan-2-y1)-N-(2-methoxyethyl)-N,5-dimethylhexan-1-amine 1. TEA(1.0 eq.), 2-MeTHF
R \¨\
N R ______________________________ 2. CI N CI
/ \-0 I \¨ -pi0 a CI N-N
-`N
NI
(0.95-1.0 eq) c 109261 To (R)-N-(2-methoxyethyl)-N, 5 -dimethy1-4 -(2, 6-diazaspiro[3 .4]
octan-2-yl)hexan-1 -ami ne (intermediate 224) (100 g) was added 2-MeTHF (430 g) and TEA (68 g) and the mixture was cooled to -50 to -40 C. 3,5,6-trichloro-1,2,4-triazine (62 g) in 2-MeTHF
(172 g) was added and the mixture was stirred for 1 to 3 h. The resulting mixture was warmed to -20 to -10 C and a 7% NaHCO3 aqueous solution was added, the mixture was warmed to 20 to 30 C
and stirred for 30 to 60 min. The aqueous layer was removed and the organic layer was washed with 10%
Na2SO4 (500 g). The organic layer was dried by passing through 4A molecular sieves (220 g) and washed with 2-MeTHF (180 g). The title intermediate was afforded in 90%
assay yield as a solution 14.8 wt% in 2-MeTHF.
Compound 393 - (R)-2-((3-chloro-5-(2-(64(2-methoxyethyl)(methypamino)-2-methylhexan-3-y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-y1)oxy)-N-ethyl-5-fluoro-N-isopropyl-benzamide Synthesis method A for Compound 393:
N
OH
.71¨\ DBU, THF
\-0 ______________________________________________ N 0 ) N
NCI N ci [0927] The mixture of N-ethyl-5-fluoro-2-hydroxy-N-isopropylbenzamide (intermediate 28) (1.10 g, 4.88 mmol), (R)-4-(6-(3,6-dichloro-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4]octan-2-y1)-N-(2-methoxyethyl)-N,5-dimethylhexan-1-amine (intermediate 225) (1.70 g, 3.82 mmol) and DBU (750 mg, 4.93 mmol) in anhydrous THF (15 mL) was stirred at 40 C for 8 h.
After cooled to RT, the mixture was concentrated under reduced pressure, the resulting residue was diluted with DCM (60 mL) and washed with H20 (20 mL x 3). The organic layer was dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the crude product which was purified FCC (Me01-I/DCM = 0% to 10%) to afford a yellow oil (1.40 g), which was further separated by SFC over DAICEL CHIRALPAK AD (column: 250x50 mm,10 um;
Mobile phase: A: Supercritical CO2, B: Et0H (0.1% ammonia), A:B = 50:50 at 70 mL/min;
Column Temp: 38 C; Nozzle Pressure: 100Bar; Nozzle Temp: 60 C; Evaporator Temp: 20 C;
Trimmer Temp: 25 C; Wavelength: 220nm) to afford the title compound (1.0 g).
Synthesis method A for Compound 393:
NI/ R ________________________________ N
N R _________________________________________________________________ õ,e0 0 _________________________________________ 2-MeTH F
TMG
OH \¨ N az\
I
CI N 0 1, N
N
N CI NCI
[0928] To a 2-MeTHF solution of (R)-4-(6-(3,6-dichloro-1,2,4-triazin-5-y1)-2, 6-di azospiro [3 .4] octan-2-y1)-N-(2-m ethoxy ethyl)-N,5 -dim ethylhexan-1 -amine (intermediate 225) (676g of a 14.8 wt% solution in 2-MeTLIF, 100g corrected of intermediate 225) and N-ethy1-5-fluoro-2-hydroxy-N-isopropylbenzamide (intermediate 28) (50.6 g) in 2-MeTHF
(40 g) at 20 to 30 C was added tetramethylguanidine (31 g) and the mixture was stirred for 40 to 48 h. A
7% NaHCO3 aqueous solution (500g) was added and the mixture was stirred for 30 to 60 min.
The aqueous layer was removed and the organic layer was washed with twice with 4% NaOH
aqueous solution (2 x 500 g) and once with 10% Na2SO4 aqueous solution (500 g). The organic layer was concentrated under reduced pressure (<40 C) to 2.2-3.0 vol. and flushed three times with Me0H (1 x 790g and 2 x 395g) until both 2-MeTHF and water content were both <1.0%
to afford the desired compound in 86% assay yield as a 60.1 wt% solution in methanol.
Compound A - (R)-N-ethyl-5-fluoro-N-isopropyl-2-((5-(2-(6-((2-methoxyethyl) (methyl) cunino)-2-methylhexan-3-yl)-2,6-diazaspiro[3.4J0c1an-6-yl)- I ,2,4-trictzin-6-yl)oxy) benzcunide \NI_/-13 R ___________________________________ 1. Wet Pd/C, H2 R __ 2. MeOH, 20-30 C.
3. Filter.
N 0 7 \
_ 0 Compound 393 Compound A
N
TI
NNCI
[0929] A methanol solution of (R)-2-((3-chloro-5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro[3 4] octan-6-y1)-1,2,4-tri azin-6-yl)oxy-N-ethy1-5-fluoro-N-isopropylbenzamide (compound 393) (163.93g of a 60.1 wt % solution in Me0H, 100g corrected of compound 393), palladium on carbon (10 g) and Me0H (316 g) was stirred at 20 to 30 C under a hydrogen atmosphere (0.20 to 0.30 Mpa) for 18 h. The mixture was filtered over diatomite (75 g) and the cake was washed with Me0H (158 g). The filtrate was concentrated under reduced pressure (<40 C) to ¨3 vol., then flushed with isopropyl acetate (IPAc, 870 g) concentrating to ¨3 vol. The mixture was then diluted with IPAc (696 g) and a 20% Na2CO3 aqueous solution was added (500 g). The mixture was stirred for 30 to 60 min.
The aqueous layer was removed. The organic layer was washed with water (500 g) then concentrated under reduced pressure <45 C to ¨3 vol. The title intermediate was afforded in approximately 90% assay yield as a 48.1 wt% solution in IPAc.
Example 4 ¨ Synthesis of (R)-N-ethyl-5-fluoro-N-isopropyl-24(5-(2-(6-((2-methoxyethyl) (methyl)am ino)-2-methylhexan-3-y1)-2,6-diazaspiro 13.41octan-6-yl)-1,2,4-triazin-6-yl)oxy) benzamide oxalate (Compound A3) N ___________________________ \ \
o e N
I
'lei oxalate salt Compound A3 [0930] To a solution of (R)-N-ethyl-5-fluoro-N-isopropy1-2-05-(2-(6-((2-methoxyethyl) (methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3 4] octan-6-y1)-1,2,4-tri azin-6-yl)oxy) benzamide (Compound A) (270 mg, 0.450 mmol) in 20 mL of ACN (20 mL) was added oxalic acid (81.0 mg, 0.900 mmol). After addition, the reaction mixture was stirred at RT for 1 h. Then the reaction mixture was concentrated, the residue was re-dissolved in ACN and deionized water, and lyophilized to afford the title compound (350 mg) as white solid.
[0931] 111 NMR (400 MHz, Methanol-4): 6 = 8.48 (s, 1H), 7.52-7.11 (m, 3H), 4.54-3.64 (m, 12H), 3.40-3.34(m, 5H), 3.23-3.13 (m, 2H), 2.90(s, 3H), 2.54-2.27 (m, 2H), 2.19-2.03 (m, 1H), 1.97-1.77 (m, 2H), 1.75-1.50 (m, 2H), 1.35-065 (m, 17H).
[0932] 111 NMR (400 MHz, DMSO-d6): = 8.51 (s, 1H), 7.51-7.29 (m, 3H), 4.29-3.34 (m, 12H), 3.23-2.84 (m, 7H), 2.70 (s, 3H), 2.35-2.09 (m, 2H), 2.05-1.85 (m, 1H), 1.81-1.58 (m, 2H), 1.56-1.33 (m, 2H), 1.18-0.60 (m, 1711).
[0933] LCMS (ES!) (Method 2): It, = 1.969 min, m/z found 600.4 [M+H]
Example 5¨ Synthesis of Compound Al N
1. Conc. HCI(1.9 eq), Et0H
2, IPAC, seed( 2%). 2 HCI
3. IPAc N
x H20 4. Filter.
2-3) N¨N N¨N
Compound A Compound Al [0934] To a solution of Compound A (207.90 g of a 48 wt% solution in IPAc, 100g of active Compound A) in IPAc (360 g) was added Et0H (63 g) at 20 to 25 C. The solution was then treated with conc. HCl (32.9 g) in Et0H (49.5 g) over ¨15 min. The mixture was seeded with crystalline Compound Al seed (2 g, 2% seed load) then aged for 18 h. IPAc (870 g) was added slowly over 4 h at between 20 to 25 C and the slurry was stirred for an additional 18 h. After cooling to ¨5 C, the product was filtered, washed with IPAc (522 g) and dried under vac at 20-30 C to afford the weakly crystalline Compound Al as a white solid (91.0%
yield, 115.4 g).
(Note: A small amount of seed material used in the reaction was obtained via an analogous reaction protocol on small-scale.) [0935] Recrystallisation: A solution of weakly crystalline Compound Al (100 g), Et0H (166 g), purified water (21.5 g) and IPAc (178 g) was stirred at 20 to 30 C for 0.5-2 h to get a clear solution. Extra IPAc (522 g) was added dropwise over 1-2 h, and then the mixture was seeded with crystalline Compound Al seed (2 g, 2% seed load). Then the mixture was aged for 18 ¨20 h, IPAc (348 g) was added slowly over 12 h at between 20 to 30 C, and the slurry was stirred for an additional 55-60 h. The product was filtered, washed with IPAc (158 g) and dried in vacuo at 20-30 C to afford Compound Al as a white solid (85% yield, 85.0 g, net).
[0936] 114NMR (DMSO-d6, 400MHz): 6 = 11.60 (1H, brs), 10.8 (1H, brs), 8.52 (1H, s), 7.36 (3H, m), 3.97-4.20 (7H, m), 3.64-3.71 (4H, m), 3.47 (7H, m), 3.25 (2H, m), 3.05 (3H, m), 2.73 (3H, s), 2.10-2.45 (1H, m), 1.99 (1H, m), 1.78 (2H, m), 1.55 (2H, m), 0.83-1.12 (12H, m), 0.70 (2H, m).
[0937] LCMS (Method 7): Rt = 0.669 min, m/z found 600.5 [M-41]t Example 6 ¨ Synthesis of crystalline form A of (R)-N-ethyl-5-fluoro-N-isopropyl-2-054246-02-m ethoxyethyl)(methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro [3.4]octan-6-yl)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate (Compound A4) (equivalent water not determined) R _____________________________ _______________________________ \No \
NR \
\ /
___________________________________________ = N 0 FNN
Compound A
I
N,N
I
bis-besylate salt hydrate Crystalline form A
Compound A4 [0938] 43.06 g benzenesulfonic acid (2 equivalents with respect to the free base Compound A) was added to 840 ml of an acetone/water 95/5 v/v mixture and dissolved. 192.8 g of a solution of Compound A (containing 80 g API) in IPAc was added. The material was dissolved, resulting in a clear solution. A further 80 ml of IPAc is added and the temperature was adjusted to 25 C.
2% of seeds were added and the mixture is stirred for an hour at 25 C. Then 28.8 V (2312 ml) of IPAc was added over a period of 8 hours. Afterwards the suspension was stirred for 18 hours at 25 C. The suspension was filtered and washed with 320 ml of a mixture of acetone/water/IPAc 23.75/1.75/75 v/v/v. 122.91 g of crystalline form A bis-besylate hydrate (equivalent water not determined) was obtained.
[0939] A skilled person will understand that a small amount of initial seed material used in the reaction above can be obtained via an analogous reaction protocol on small-scale without addition of seeds and wait for spontaneous nucleation.
Initial seeds of the besylate salt were also obtained during salt screening experiments. In these experiments 100 mg of the free base was weighed into 2mL vials, and then 200pL
of ethyl acetate or acetone was added to dissolve the free base. 1 eq counter-ions (benzenesulfonic acid) were added to the samples, and the samples were stirred at 25 C for 3 days.
The suspension obtained was centrifuged and yielded initial seeds.
[0940] An appropriate amount of crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3 .4] octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate was dissolved in deuterated DMSO and the 1D NMR spectrum was recorded.
[0941] A Bruker AVANCE NEO-600 MHz NMR spectrometer equipped with a Bruker 5 mm PA BBO 600S3 BB-H-D-05 Z-GRD high resolution probe and running TOPSPIN 4.0 software, was used to collect a 1-dimensional proton experiment at 300K on the sample in deuterated DMSO.
[0942]
NMR (600 MHz, DMSO-d6) 6 ppm 0.69 (br s, 2 H) 0.82 - 0.98 (m, 9 H) 1.07 (br s, 4 H) 1.31 - 1.46 (m, 1 H) 1.51 (br d, J=2.91 Hz, 1 H) 1.69 (br d, J=3.45 Hz, 2 H) 1.98 (br s, 1 H) 2.06 - 2.45 (m, 2 H) 2.77 (br s, 3 H) 2.87 - 3.19 (m, 3 H) 3.24 (br s, 1 H) 3.31 (s, 6 H) 3.64 (br s, 4 H) 3.71 -4.59 (m, 7 H) 7.24 - 7.54 (m, 9 H) 7.61 (br d, J=7.27 Hz, 4 H) 8.45 - 8.60 (m, 1 H) 9.24 (br s, 1 H) 9.44 -9.82 (m, 1 H).
Example 7 - Alternative synthesis of crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-2-05-(2-(6-02-m ethoxyethyl)(m ethyl)am in o)-2-m ethyl h ex an-3-y1)-2,6- diazas piro [3.4] octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate (Compound A4) (equivalent water not determined) [0943] A mixture of isopropanol/water 95/5 (24 ml) was charged in a flask and heated to 40 C.
Benzenesulfonic acid (4.31 g; 98%) was added. Subsequently, 19.3 g of a solution of Compound A (containing 8 g of Compound A) in lPAc was added. Another 16 ml of IPAc was added. 2% of seeds were added and the mixture was stirred for 1 hour at 40 C.
Then IPAc was added (115.2 ml) dropwisc over a period of 8 hours. Next, the mixture was cooled to 0 C for 15 hours. The suspension was filtered and the wet cake was washed with (IPA/H20 95/5)/1PAc 1/6 (32 ml) The wet cake was dried at 25 C for 16 hours to obtain 11.44 g of crystalline form A bi s-besyl ate hydrate (equivalent water not determined).
Crystalline form A
[0944] Crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3 .4] octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate may be characterised by an X-ray powder diffraction pattern.
[0945] X-ray powder diffraction (XRPD) analysis was carried out on a PANalytical Empyrean diffractometer. The instrument is equipped with a Cu-Ka X-ray tube using iCore and dCore tunable optics for the incident and the diffracted beam, respectively. The compound was loaded into the cavity of a 16mm sample holder using the back loading technique.
[0946] Samples were run on XRPD using the method below:
Tube: Cu: K-Alpha (2=1.541874A) Generator: Voltage: 45 kV; Current: 40 mA
Geometry: Bragg-Brentano Scan mode: Continuous Scan Scan Range: 3 to 35 deg.
Step size: 0.0131 deg.
Counting time: 30s Spinner revolution time: 1 sec Incident beam path (iCore) Program. divergence slit: automatic Irradiated length: 10 mm Soller slit: 0.03 rad Mask 1: 14 mm Mask 2: 6 mm Width: 7.7 mm Diffracted beam path (dCore) Anti scatter slit: automatic Irradiated length: 10 mm Soller slit: 0.04 rad Detector: PIXcel3D- Medipix3 lx1 [0947] One skilled in the art will recognize that diffraction patterns and peak positions are typically substantially independent of the diffractometer used and whether a specific calibration method is utilized. Typically, the peak positions may differ by about 0.2 two theta, or less.
The intensities (and relative intensities) of each specific diffraction peak may also vary as a function of various factors, including, but not limited to particle size, orientation, sample purity, etc.
[0948] The X-ray powder diffraction pattern comprises peaks at 5.4, 7.2, 11.1, 11.9 and 21.7 degrees two theta 0.2 degrees two theta. The X-ray powder diffraction pattern may further comprise at least one peak selected from 13.7, 14.5, 14.7, 15.0, 16.5, 17.8, 19.0, 19.4, 20.1 degrees two theta 0.2 degrees two theta.
[0949] Form A may further be characterized by an X-ray powder diffraction pattern having four, five, six, seven, eight, nine or more peaks selected from those peaks identified in Table 2.
[0950] Form A may further be characterized by an X-ray powder diffraction pattern comprising those peaks identified in Table 2, wherein the relative intensity of the peaks is greater than about 2%, preferably greater than about 5%, more preferably greater than about 10%, more preferably greater than about 15%. However, a skilled person will realize that the relative intensity of the peaks may vary between different samples and different measurements on the same sample.
[0951] Form A may further be characterized by an X-ray powder diffraction pattern substantially as depicted in FIG. 1.
[0952] Table 2 provides peak listings and relative intensity for the XPRD of Crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-m ethyl hexan-3 -y1)-2,6-di azaspiro[3 .4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate BSA salt (FIG. 1).
Table 2 - Peak Listings and Relative Intensity for XRPD of Form A
Pos. [ 2Th.] Rel. Int. [%]
5.3965 16.30 7.1906 23.69 9.2513 8.14 9.4433 7.39 11.0719 11.34 11.9144 73.29 12.3921 29.17 12.5717 22.93 12.8791 8.93 13.6790 26.58 13.8694 15.67
After concentration under reduced pressure (<40 C) to 3-4 vol., the resulting solution was diluted with 2-MeTHF (30kg), dried by passing through 4A molecular sieves (25kg) and washed with 2-MeTHF (30kg). The final solution was concentrated to afford the desired compound (6.7kg) as an oil with 90.1% assay purity in a 79% corrected yield.
Preparation of intermediate 225 - (R)-4-(6-(3,6-dichloro-1,2,4-triazin-5-y1)-2,6-diazaspiro [3.4]octan-2-y1)-N-(2-methoxyethyl)-N,5-dimethylhexan-1-amine 1. TEA(1.0 eq.), 2-MeTHF
R \¨\
N R ______________________________ 2. CI N CI
/ \-0 I \¨ -pi0 a CI N-N
-`N
NI
(0.95-1.0 eq) c 109261 To (R)-N-(2-methoxyethyl)-N, 5 -dimethy1-4 -(2, 6-diazaspiro[3 .4]
octan-2-yl)hexan-1 -ami ne (intermediate 224) (100 g) was added 2-MeTHF (430 g) and TEA (68 g) and the mixture was cooled to -50 to -40 C. 3,5,6-trichloro-1,2,4-triazine (62 g) in 2-MeTHF
(172 g) was added and the mixture was stirred for 1 to 3 h. The resulting mixture was warmed to -20 to -10 C and a 7% NaHCO3 aqueous solution was added, the mixture was warmed to 20 to 30 C
and stirred for 30 to 60 min. The aqueous layer was removed and the organic layer was washed with 10%
Na2SO4 (500 g). The organic layer was dried by passing through 4A molecular sieves (220 g) and washed with 2-MeTHF (180 g). The title intermediate was afforded in 90%
assay yield as a solution 14.8 wt% in 2-MeTHF.
Compound 393 - (R)-2-((3-chloro-5-(2-(64(2-methoxyethyl)(methypamino)-2-methylhexan-3-y1)-2,6-diazaspiro[3.4]octan-6-y1)-1,2,4-triazin-6-y1)oxy)-N-ethyl-5-fluoro-N-isopropyl-benzamide Synthesis method A for Compound 393:
N
OH
.71¨\ DBU, THF
\-0 ______________________________________________ N 0 ) N
NCI N ci [0927] The mixture of N-ethyl-5-fluoro-2-hydroxy-N-isopropylbenzamide (intermediate 28) (1.10 g, 4.88 mmol), (R)-4-(6-(3,6-dichloro-1,2,4-triazin-5-y1)-2,6-diazaspiro[3.4]octan-2-y1)-N-(2-methoxyethyl)-N,5-dimethylhexan-1-amine (intermediate 225) (1.70 g, 3.82 mmol) and DBU (750 mg, 4.93 mmol) in anhydrous THF (15 mL) was stirred at 40 C for 8 h.
After cooled to RT, the mixture was concentrated under reduced pressure, the resulting residue was diluted with DCM (60 mL) and washed with H20 (20 mL x 3). The organic layer was dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the crude product which was purified FCC (Me01-I/DCM = 0% to 10%) to afford a yellow oil (1.40 g), which was further separated by SFC over DAICEL CHIRALPAK AD (column: 250x50 mm,10 um;
Mobile phase: A: Supercritical CO2, B: Et0H (0.1% ammonia), A:B = 50:50 at 70 mL/min;
Column Temp: 38 C; Nozzle Pressure: 100Bar; Nozzle Temp: 60 C; Evaporator Temp: 20 C;
Trimmer Temp: 25 C; Wavelength: 220nm) to afford the title compound (1.0 g).
Synthesis method A for Compound 393:
NI/ R ________________________________ N
N R _________________________________________________________________ õ,e0 0 _________________________________________ 2-MeTH F
TMG
OH \¨ N az\
I
CI N 0 1, N
N
N CI NCI
[0928] To a 2-MeTHF solution of (R)-4-(6-(3,6-dichloro-1,2,4-triazin-5-y1)-2, 6-di azospiro [3 .4] octan-2-y1)-N-(2-m ethoxy ethyl)-N,5 -dim ethylhexan-1 -amine (intermediate 225) (676g of a 14.8 wt% solution in 2-MeTLIF, 100g corrected of intermediate 225) and N-ethy1-5-fluoro-2-hydroxy-N-isopropylbenzamide (intermediate 28) (50.6 g) in 2-MeTHF
(40 g) at 20 to 30 C was added tetramethylguanidine (31 g) and the mixture was stirred for 40 to 48 h. A
7% NaHCO3 aqueous solution (500g) was added and the mixture was stirred for 30 to 60 min.
The aqueous layer was removed and the organic layer was washed with twice with 4% NaOH
aqueous solution (2 x 500 g) and once with 10% Na2SO4 aqueous solution (500 g). The organic layer was concentrated under reduced pressure (<40 C) to 2.2-3.0 vol. and flushed three times with Me0H (1 x 790g and 2 x 395g) until both 2-MeTHF and water content were both <1.0%
to afford the desired compound in 86% assay yield as a 60.1 wt% solution in methanol.
Compound A - (R)-N-ethyl-5-fluoro-N-isopropyl-2-((5-(2-(6-((2-methoxyethyl) (methyl) cunino)-2-methylhexan-3-yl)-2,6-diazaspiro[3.4J0c1an-6-yl)- I ,2,4-trictzin-6-yl)oxy) benzcunide \NI_/-13 R ___________________________________ 1. Wet Pd/C, H2 R __ 2. MeOH, 20-30 C.
3. Filter.
N 0 7 \
_ 0 Compound 393 Compound A
N
TI
NNCI
[0929] A methanol solution of (R)-2-((3-chloro-5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro[3 4] octan-6-y1)-1,2,4-tri azin-6-yl)oxy-N-ethy1-5-fluoro-N-isopropylbenzamide (compound 393) (163.93g of a 60.1 wt % solution in Me0H, 100g corrected of compound 393), palladium on carbon (10 g) and Me0H (316 g) was stirred at 20 to 30 C under a hydrogen atmosphere (0.20 to 0.30 Mpa) for 18 h. The mixture was filtered over diatomite (75 g) and the cake was washed with Me0H (158 g). The filtrate was concentrated under reduced pressure (<40 C) to ¨3 vol., then flushed with isopropyl acetate (IPAc, 870 g) concentrating to ¨3 vol. The mixture was then diluted with IPAc (696 g) and a 20% Na2CO3 aqueous solution was added (500 g). The mixture was stirred for 30 to 60 min.
The aqueous layer was removed. The organic layer was washed with water (500 g) then concentrated under reduced pressure <45 C to ¨3 vol. The title intermediate was afforded in approximately 90% assay yield as a 48.1 wt% solution in IPAc.
Example 4 ¨ Synthesis of (R)-N-ethyl-5-fluoro-N-isopropyl-24(5-(2-(6-((2-methoxyethyl) (methyl)am ino)-2-methylhexan-3-y1)-2,6-diazaspiro 13.41octan-6-yl)-1,2,4-triazin-6-yl)oxy) benzamide oxalate (Compound A3) N ___________________________ \ \
o e N
I
'lei oxalate salt Compound A3 [0930] To a solution of (R)-N-ethyl-5-fluoro-N-isopropy1-2-05-(2-(6-((2-methoxyethyl) (methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3 4] octan-6-y1)-1,2,4-tri azin-6-yl)oxy) benzamide (Compound A) (270 mg, 0.450 mmol) in 20 mL of ACN (20 mL) was added oxalic acid (81.0 mg, 0.900 mmol). After addition, the reaction mixture was stirred at RT for 1 h. Then the reaction mixture was concentrated, the residue was re-dissolved in ACN and deionized water, and lyophilized to afford the title compound (350 mg) as white solid.
[0931] 111 NMR (400 MHz, Methanol-4): 6 = 8.48 (s, 1H), 7.52-7.11 (m, 3H), 4.54-3.64 (m, 12H), 3.40-3.34(m, 5H), 3.23-3.13 (m, 2H), 2.90(s, 3H), 2.54-2.27 (m, 2H), 2.19-2.03 (m, 1H), 1.97-1.77 (m, 2H), 1.75-1.50 (m, 2H), 1.35-065 (m, 17H).
[0932] 111 NMR (400 MHz, DMSO-d6): = 8.51 (s, 1H), 7.51-7.29 (m, 3H), 4.29-3.34 (m, 12H), 3.23-2.84 (m, 7H), 2.70 (s, 3H), 2.35-2.09 (m, 2H), 2.05-1.85 (m, 1H), 1.81-1.58 (m, 2H), 1.56-1.33 (m, 2H), 1.18-0.60 (m, 1711).
[0933] LCMS (ES!) (Method 2): It, = 1.969 min, m/z found 600.4 [M+H]
Example 5¨ Synthesis of Compound Al N
1. Conc. HCI(1.9 eq), Et0H
2, IPAC, seed( 2%). 2 HCI
3. IPAc N
x H20 4. Filter.
2-3) N¨N N¨N
Compound A Compound Al [0934] To a solution of Compound A (207.90 g of a 48 wt% solution in IPAc, 100g of active Compound A) in IPAc (360 g) was added Et0H (63 g) at 20 to 25 C. The solution was then treated with conc. HCl (32.9 g) in Et0H (49.5 g) over ¨15 min. The mixture was seeded with crystalline Compound Al seed (2 g, 2% seed load) then aged for 18 h. IPAc (870 g) was added slowly over 4 h at between 20 to 25 C and the slurry was stirred for an additional 18 h. After cooling to ¨5 C, the product was filtered, washed with IPAc (522 g) and dried under vac at 20-30 C to afford the weakly crystalline Compound Al as a white solid (91.0%
yield, 115.4 g).
(Note: A small amount of seed material used in the reaction was obtained via an analogous reaction protocol on small-scale.) [0935] Recrystallisation: A solution of weakly crystalline Compound Al (100 g), Et0H (166 g), purified water (21.5 g) and IPAc (178 g) was stirred at 20 to 30 C for 0.5-2 h to get a clear solution. Extra IPAc (522 g) was added dropwise over 1-2 h, and then the mixture was seeded with crystalline Compound Al seed (2 g, 2% seed load). Then the mixture was aged for 18 ¨20 h, IPAc (348 g) was added slowly over 12 h at between 20 to 30 C, and the slurry was stirred for an additional 55-60 h. The product was filtered, washed with IPAc (158 g) and dried in vacuo at 20-30 C to afford Compound Al as a white solid (85% yield, 85.0 g, net).
[0936] 114NMR (DMSO-d6, 400MHz): 6 = 11.60 (1H, brs), 10.8 (1H, brs), 8.52 (1H, s), 7.36 (3H, m), 3.97-4.20 (7H, m), 3.64-3.71 (4H, m), 3.47 (7H, m), 3.25 (2H, m), 3.05 (3H, m), 2.73 (3H, s), 2.10-2.45 (1H, m), 1.99 (1H, m), 1.78 (2H, m), 1.55 (2H, m), 0.83-1.12 (12H, m), 0.70 (2H, m).
[0937] LCMS (Method 7): Rt = 0.669 min, m/z found 600.5 [M-41]t Example 6 ¨ Synthesis of crystalline form A of (R)-N-ethyl-5-fluoro-N-isopropyl-2-054246-02-m ethoxyethyl)(methyl)amino)-2-methylhexan-3-y1)-2,6-diazaspiro [3.4]octan-6-yl)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate (Compound A4) (equivalent water not determined) R _____________________________ _______________________________ \No \
NR \
\ /
___________________________________________ = N 0 FNN
Compound A
I
N,N
I
bis-besylate salt hydrate Crystalline form A
Compound A4 [0938] 43.06 g benzenesulfonic acid (2 equivalents with respect to the free base Compound A) was added to 840 ml of an acetone/water 95/5 v/v mixture and dissolved. 192.8 g of a solution of Compound A (containing 80 g API) in IPAc was added. The material was dissolved, resulting in a clear solution. A further 80 ml of IPAc is added and the temperature was adjusted to 25 C.
2% of seeds were added and the mixture is stirred for an hour at 25 C. Then 28.8 V (2312 ml) of IPAc was added over a period of 8 hours. Afterwards the suspension was stirred for 18 hours at 25 C. The suspension was filtered and washed with 320 ml of a mixture of acetone/water/IPAc 23.75/1.75/75 v/v/v. 122.91 g of crystalline form A bis-besylate hydrate (equivalent water not determined) was obtained.
[0939] A skilled person will understand that a small amount of initial seed material used in the reaction above can be obtained via an analogous reaction protocol on small-scale without addition of seeds and wait for spontaneous nucleation.
Initial seeds of the besylate salt were also obtained during salt screening experiments. In these experiments 100 mg of the free base was weighed into 2mL vials, and then 200pL
of ethyl acetate or acetone was added to dissolve the free base. 1 eq counter-ions (benzenesulfonic acid) were added to the samples, and the samples were stirred at 25 C for 3 days.
The suspension obtained was centrifuged and yielded initial seeds.
[0940] An appropriate amount of crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3 .4] octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate was dissolved in deuterated DMSO and the 1D NMR spectrum was recorded.
[0941] A Bruker AVANCE NEO-600 MHz NMR spectrometer equipped with a Bruker 5 mm PA BBO 600S3 BB-H-D-05 Z-GRD high resolution probe and running TOPSPIN 4.0 software, was used to collect a 1-dimensional proton experiment at 300K on the sample in deuterated DMSO.
[0942]
NMR (600 MHz, DMSO-d6) 6 ppm 0.69 (br s, 2 H) 0.82 - 0.98 (m, 9 H) 1.07 (br s, 4 H) 1.31 - 1.46 (m, 1 H) 1.51 (br d, J=2.91 Hz, 1 H) 1.69 (br d, J=3.45 Hz, 2 H) 1.98 (br s, 1 H) 2.06 - 2.45 (m, 2 H) 2.77 (br s, 3 H) 2.87 - 3.19 (m, 3 H) 3.24 (br s, 1 H) 3.31 (s, 6 H) 3.64 (br s, 4 H) 3.71 -4.59 (m, 7 H) 7.24 - 7.54 (m, 9 H) 7.61 (br d, J=7.27 Hz, 4 H) 8.45 - 8.60 (m, 1 H) 9.24 (br s, 1 H) 9.44 -9.82 (m, 1 H).
Example 7 - Alternative synthesis of crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-2-05-(2-(6-02-m ethoxyethyl)(m ethyl)am in o)-2-m ethyl h ex an-3-y1)-2,6- diazas piro [3.4] octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate (Compound A4) (equivalent water not determined) [0943] A mixture of isopropanol/water 95/5 (24 ml) was charged in a flask and heated to 40 C.
Benzenesulfonic acid (4.31 g; 98%) was added. Subsequently, 19.3 g of a solution of Compound A (containing 8 g of Compound A) in lPAc was added. Another 16 ml of IPAc was added. 2% of seeds were added and the mixture was stirred for 1 hour at 40 C.
Then IPAc was added (115.2 ml) dropwisc over a period of 8 hours. Next, the mixture was cooled to 0 C for 15 hours. The suspension was filtered and the wet cake was washed with (IPA/H20 95/5)/1PAc 1/6 (32 ml) The wet cake was dried at 25 C for 16 hours to obtain 11.44 g of crystalline form A bi s-besyl ate hydrate (equivalent water not determined).
Crystalline form A
[0944] Crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-methylhexan-3 -y1)-2,6-diazaspiro[3 .4] octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate may be characterised by an X-ray powder diffraction pattern.
[0945] X-ray powder diffraction (XRPD) analysis was carried out on a PANalytical Empyrean diffractometer. The instrument is equipped with a Cu-Ka X-ray tube using iCore and dCore tunable optics for the incident and the diffracted beam, respectively. The compound was loaded into the cavity of a 16mm sample holder using the back loading technique.
[0946] Samples were run on XRPD using the method below:
Tube: Cu: K-Alpha (2=1.541874A) Generator: Voltage: 45 kV; Current: 40 mA
Geometry: Bragg-Brentano Scan mode: Continuous Scan Scan Range: 3 to 35 deg.
Step size: 0.0131 deg.
Counting time: 30s Spinner revolution time: 1 sec Incident beam path (iCore) Program. divergence slit: automatic Irradiated length: 10 mm Soller slit: 0.03 rad Mask 1: 14 mm Mask 2: 6 mm Width: 7.7 mm Diffracted beam path (dCore) Anti scatter slit: automatic Irradiated length: 10 mm Soller slit: 0.04 rad Detector: PIXcel3D- Medipix3 lx1 [0947] One skilled in the art will recognize that diffraction patterns and peak positions are typically substantially independent of the diffractometer used and whether a specific calibration method is utilized. Typically, the peak positions may differ by about 0.2 two theta, or less.
The intensities (and relative intensities) of each specific diffraction peak may also vary as a function of various factors, including, but not limited to particle size, orientation, sample purity, etc.
[0948] The X-ray powder diffraction pattern comprises peaks at 5.4, 7.2, 11.1, 11.9 and 21.7 degrees two theta 0.2 degrees two theta. The X-ray powder diffraction pattern may further comprise at least one peak selected from 13.7, 14.5, 14.7, 15.0, 16.5, 17.8, 19.0, 19.4, 20.1 degrees two theta 0.2 degrees two theta.
[0949] Form A may further be characterized by an X-ray powder diffraction pattern having four, five, six, seven, eight, nine or more peaks selected from those peaks identified in Table 2.
[0950] Form A may further be characterized by an X-ray powder diffraction pattern comprising those peaks identified in Table 2, wherein the relative intensity of the peaks is greater than about 2%, preferably greater than about 5%, more preferably greater than about 10%, more preferably greater than about 15%. However, a skilled person will realize that the relative intensity of the peaks may vary between different samples and different measurements on the same sample.
[0951] Form A may further be characterized by an X-ray powder diffraction pattern substantially as depicted in FIG. 1.
[0952] Table 2 provides peak listings and relative intensity for the XPRD of Crystalline form A of (R)-N-ethy1-5-fluoro-N-isopropy1-2-((5-(2-(6-((2-methoxyethyl)(methyl)amino)-2-m ethyl hexan-3 -y1)-2,6-di azaspiro[3 .4]octan-6-y1)-1,2,4-triazin-6-yl)oxy)benzamide bis-besylate salt hydrate BSA salt (FIG. 1).
Table 2 - Peak Listings and Relative Intensity for XRPD of Form A
Pos. [ 2Th.] Rel. Int. [%]
5.3965 16.30 7.1906 23.69 9.2513 8.14 9.4433 7.39 11.0719 11.34 11.9144 73.29 12.3921 29.17 12.5717 22.93 12.8791 8.93 13.6790 26.58 13.8694 15.67
14.4793 38.19 14.7398 55.26 14.9599 56.99
15.8715 20.66
16.4606 22.37
17.0459 20.43 17.4421 34.59 17.8203 46.78
18.2871 30.73 18.9573 43.91
19.4485 41.00
20.1190 35.53 20.7356 18.05
21.0535 30.09 21.6801 100.00
22.0236 18.06 22.7925 29.92
23.5044 41.92 23.9959 43.96
24.5555 31.47
25.1401 25.01 25.7588 59.24
26.0910 53.05 26.6137 39.47
27.5409 24.89
28.5493 22.44
29.1699 13.97
30.1441 21.01
31.2560 14.66 31.8783 16.47
32.7054 17.11
33.2797 24.40 33.9762 15.63 Compound A4 described herein is disclosed in PCT/CN2021/100466 (filed June 17, 2021), which is incorporated by reference herein in its entirety, for all purposes.
ANALYTICAL METHODS
[0953] The analytical information in the compounds above or in the Tables below, was generated by using the analytical methods described below.
M1R-Methods [0954] Some NAIR experiments were carried out using a Bruker Avance III 400 spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with BBO
400MHz Si 5 mm probe head with z gradients and operating at 400 MI-lz for the proton and 100MHz for carbon. Chemical shifts (6) are reported in parts per million (ppm). J values are expressed in Hz.
[0955] Some NMR experiments were carried out using a Varian 400-MR
spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with Varian 400 4NUC PFG probe head with z gradients and operating at 400 MHz for the proton and 100MHz for carbon_ Chemical shifts (6) are reported in parts per million (ppm). J
values are expressed in Hz.
[0956] Some NMR experiments were carried out using a Varian 400-VNMRS
spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with Varian 400 ASW PFG probe head with z gradients and operating at 400 MHz for the proton and 100MHz for carbon. Chemical shifts (6) are reported in parts per million (ppm). J
values are expressed in Hz.
[0957] Some NMR experiments were carried out using a Bruker AVANCE III ETD 300 spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with PA BBO 300S1 BRF-1-1-D-05 7 5 mm probe head with z gradients and operating at 300 MHz for the proton and 75 MHz for carbon. Chemical shifts (d) are reported in parts per million (ppm). J values are expressed in Hz.
LCMS (Liquid chromatography/Mass õspectrometry) General procedure 109581 The High Performance Liquid Chromatography (HPLC) measurement was performed using a LC pump, a diode-array (DAD) or a UV detector and a column as specified in the respective methods. HPLC details are provided below in Table 3. If necessary, additional detectors were included (see Tables 3 and 4 below).
[0959] Flow from the column was brought to the Mass Spectrometer (MS) which was configured with an atmospheric pressure ion source. It is within the knowledge of the skilled person to set the tune parameters (e.g., scanning range, dwell time...) in order to obtain ions allowing the identification of the compound's nominal monoisotopic molecular weight (MW).
Data acquisition was performed with appropriate software.
[0960] Compounds are described by their experimental retention times (Rt) and ions. If not specified differently in the table of data, the reported molecular ion corresponds to the [M+H]+
(protonated molecule) and/or [M-H]- (deprotonated molecule). In case the compound was not directly ionizable the type of adduct is specified (i.e., [M+NH4] , [M+HC00]-, etc...). For molecules with multiple isotopic patterns (Br, Cl..), the reported value is the one obtained for the lowest isotope mass. All results were obtained with experimental uncertainties that are commonly associated with the method used.
[0961] Hereinafter, "SQD" means Single Quadrupole Detector, "RT- room temperature, "BEET' bridged ethylsiloxane/silica hybrid, "HS S" High Strength Silica, "DAD" Diode Array Detector.
Table 3 - LCMS Method Codes Flow Method Run Instrument Column Mobile phase Gradient code Column time 100%A was held for 1 min, A
Waters Mobile phase A: gradient from 100%A to 40%
0.8 XBridge H20 with A is applied in 4 min, and C18 0.04 % TFA; 40%A down to 15%A in 2.5 1 Agilent (2.0x50 mobile phase B: min. And then return to mm, 5 ACN with 100%A in 2 min and held for u M) 0.02 % TFA 0.5 min. The post time is 0.5 min.
First, 90% A was held for 0.8 Waters Mobile phase A:
min. Then a gradient was XBridge H20 with C18 0.04 % TFA;
applied to 20% A and 80% B 0.8 2 Agilent in 3.7 min and held for 3 min. ---- 10 (2.0x50 mobile phase B:
And then return to 90%A in 2 50 mm, 5 ACN with min and held for 0.5 min. The urn) 0.02 % TFA
post time is 0.5 min.
Time (min) A% 13%
Mobile phase A
XBridge 0.05% 95 5 1.5 0.05% TFA in Agilent LC C18, 4.6 H20 11.0 65 35 7 1260 with x150 13.0 5 95 Mobile phase B
MS6120 mm, 15.0 5 95 0.05 % TFA in 3.5 iõtrn 16.0 95 5 45 ACN
20.0 95 5 Flow expressed in mL/min; column temperature (T) in C; run time in minutes Analytical SFC
General procedure for SFC methods [0962] The SFC measurement was performed using an Analytical Supercritical fluid chromatography (SFC) system composed by a binary pump for delivering carbon dioxide (CO2) and modifier, an autosampler, a column oven, a diode array detector equipped with a high-pressure flow cell standing up to 400 bars. Analytical SFC details are provided below in Table 4. If configured with a Mass Spectrometer (MS) the flow from the column was brought to the (MS). It is within the knowledge of the skilled person to set the tune parameters (e.g., scanning range, dwell time...) in order to obtain ions allowing the identification of the compound's nominal monoisotopic molecular weight (MW). Data acquisition was performed with appropriate software.
Table 4 - Analytical SFC Details Run Method Flowtime column mobile phase gradient code Col T
RPR
Waters UPCC from 5% to 40% of with PDA A: Supercritical B in 4 min and 11 (Chiralpak IG-3 CO2 B: Et0II hold 40% for 2.5 100x4.6 mm (0.05% DEA) min, then 5% of B 35 1500 psi.
ID., 3 urn) for 1.5 min Flow expressed in mL/min; column temperature (T) in C; run time in minutes, Backpressure (BPR) in bars or pound-force per square inch (psi). "ACN- means acetonitrile;
"Me0H" means methanol; "Et0H" means ethanol; "DEA" means diethylamine. All other abbreviations used in Table 4 above are as defined before.
PHARMACOLOGICAL PART
1) Menin/1V1LL Homogenous Time-Resolved Fluorescence (HTRF) Assay [0963] To an untreated, white 384-well microtiter plate was added 40 nL 200X
test compound in DMSO and 4 itL 2X terbium chelate-labeled menin (vide infra for preparation) in assay buffer (40 mM Tris=HC1, pH 7.5, 50 mM NaC1, 1 mM DTT (dithiothreitol) and 0.05% Pluronic F-127). After incubation of test compound and terbium chelate-labeled menin for 30 min at ambient temperature, 4 uL 2X FITC-1VIBM1 peptide (FITC-I3-alanine-SARWRFPARPGT-NH2) ("FITC" means fluorescein isothiocyanate) in assay buffer was added, the microtiter plate centrifuged at 1000 rpm for 1 min and the assay mixtures incubated for 15 min at ambient temperature. The relative amount of meninTITC-MBM1 complex present in an assay mixture is determined by measuring the homogenous time-resolved fluorescence (HTRF) of the terbium/FITC donor /acceptor fluorophore pair using an EnVision microplate reader (ex. 337 nm/terbium em. 490 nm/FITC em. 520 nm) at ambient temperature. The degree of fluorescence resonance energy transfer (the HTRF value) is expressed as the ratio of the fluorescence emission intensities of the FITC and terbium fluorophores (Pm 520 nm/Fm 490 nm). The final concentrations of reagents in the binding assay are 200 pM terbium chelate-labeled menin, 75 nM FITC-1VIBM1 peptide and 0.5% DMSO in assay buffer. Dose-response titrations of test compounds are conducted using an 11 point, four-fold serial dilution scheme, starting typically at 10 itM.
[0964] Compound potencies were determined by first calculating % inhibition at each compound concentration according to equation 1:
% inhibition = ((HC - LC) - (HTRFcompound LC)) / (HC - LC)) *100 (Eqn 1) where LC and HC are the HTRF values of the assay in the presence or absence of a saturating concentration of a compound that competes with FITC-MBM1 for binding to menin, and HTRFenmP"nd is the measured HTRF value in the presence of the test compound.
HC and LC
HTRF values represent an average of at least 10 replicates per plate. For each test compound, %
inhibition values were plotted vs. the logarithm of the test compound concentration, and the 1C'50 value derived from fitting these data to equation 2:
% inhibition = Bottom + (Top -B ottom)/(1+10^((log/C50-log [cm pd]) * h)) (Eqn 2) where Bottom and Top are the lower and upper asymptotes of the dose-response curve, respectively, /C50 is the concentration of compound that yields 50% inhibition of signal and h is the Hill coefficient.
[0965] Preparation of Terbium cryptate labeling of Menin: Menin (a.a 1-610-6xhis tag, 2.3 mg/mL in 20mM Hepes (2-[4-(2-Hydroxyethyl)-1-piperazinyl]ethane sulfonic acid), 80 mM
NaCl, 5mM DTT (Dithiothreitol), pH 7.5) was labeled with terbium cryptate as follows. 200 ug of Menin was buffer exchanged into lx Hepes buffer. 6.67 uM Menin was incubated with 8-fold molar excess NHS (N-hydroxysuccinimide)-terbium cryptate for 40 minutes at room temperature. Half of the labeled protein was purified away from free label by running the reaction over a NAPS column with elution buffer (0.1M Hepes, pH 7 + 0.1% BSA
(bovine serum albumin)). The other half was eluted with 0.1M phosphate buffered saline (PBS), pH7.
400 ul of eluent was collected for each, aliquoted and frozen at -80 C. The final concentration of terbium-labeled Menin protein was 115 ug/mL in Hepes buffer and 85 itg/mL
in PBS buffer, respectively.
MENIN Protein Sequence (SEO ID NO: I):
[0966] MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRV
DVHLALSEDHAWVVF GPNGEQ TAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKG
SYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALG
NLADLEELEP TP GRPDPL TLYHKGIA S AK T YYRDEHIYP YMYLAGYH CRNRNVREAL
QAWAD TATVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAA SLLEAGEERP GEQ SQ
GT Q S Q GS ALQDPECF AHLLRF YDGICKWEEGSP TPVLHVGWATFLVQ SLGRFEGQVR
QKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPEEPPPPKKPALDKGLGTGQG
AVS GPPRKPP GT VAGTARGPEGGS TAQVPAPAA SPPPEGPVLTF Q SEKMKGMKELLV
2a) Proliferation Assay [0967] The anti-proliferative effect of menin/MLL protein/protein interaction inhibitor test compounds was assessed in human leukemia cell lines. The cell line MOLM-14 harbors a MILL
translocation and expresses the WILL fusion protein MILL-AF9, respectively, as well as the wildtype protein from the second allele. OCI-AMIL3 cells that carry the NPM1c gene mutation were also tested. MILL rearranged cell lines (e.g., MOLM-14) and NPM1c mutated cell lines exhibit stem cell-like elevated HOXA/MEIS1 gene expression signatures. KO-52 was used as a control cell line containing two MLL (KIVIT2A) wildtype alleles in order to exclude compounds that display general cytotoxic effects.
[0968] MOLM-14 cells were cultured in RPM1-1640 (Sigma Aldrich) supplemented with 10%
heat-inactivated fetal bovine serum (HyClone), 2 mM L-glutamine (Sigma Aldrich) and 50 g/m1 gentamycin (Gibco). KO-52 and OCI-AML3 cell lines were propagated in alpha-MEM (Sigma Aldrich) supplemented with 20% heat-inactivated fetal bovine serum (HyClone), 2 mM L-glutamine (Sigma Aldrich) and 50 j.i.g/m1 gentamycin (Gibco). Cells were kept at 0.3 ¨ 2.5 million cells per ml during culturing and passage numbers did not exceed 20.
[0969] In order to assess the anti-proliferative effects, 200 MOLM-14 cells, cells or 300 KO-52 cells were seeded in 200 p1 media per well in 96-well round bottom, ultra-low attachment plates (Costar, catalogue number 7007). Cell seeding numbers were chosen based on growth curves to ensure linear growth throughout the experiment. Test compounds were added at different concentrations and the DMSO content was normalized to 0.3%. Cells were incubated for 8 days at 37 C and 5% CO2. Spheroid like growth was measured in real-time by live-cell imaging (IncuCyteZOOM, Essenbio, 4x objective) acquiring images at day 8.
Confluence (%) as a measure of spheroid size was determined using an integrated analysis tool.
[0970] In order to determine the effect of the test compounds over time, the confluence in each well as a measure of spheroid size, was calculated. Confluence of the highest dose of a reference compound was used as baseline for the LC (Low control) and the confluence of DMSO treated cells was used as 0% cytotoxicity (High Control, HC).
[0971] Absolute IC50 values were calculated as percent change in confluence as follows:
LC = Low Control: cells treated with e.g., I i_tM of the cytotoxic agent staurosporin, or e.g., cells treated with a high concentration of an alternative reference compound;
HC = High Control: Mean confluence (%) (DMSO treated cells);
% Effect = 100 - (100*(Sample-LC)/(HC-LC)); and GraphPad Prism (version 7.00) was used to calculate the IC50. Dose-response equation was used for the plot of % Effect vs Log10 compound concentration with a variable slope and fixing the maximum to 100% and the minimum to 0%.
2b) MEISI niRNA Expression Assay [0972] MEIS1 mRNA expression upon treatment of compound was examined by Quantigene Singleplex assay (Thermo Fisher Scientific). This technology allows for direct quantification of mRNA targets using probes hybridizing to defined target sequences of interest and the signal is detected using a Multimode plate reader Envision (PerkinElmer). The MOLM-14 cell line was used for this experiment. Cells were plated in 96-well plates at 3,750 cells/well in the presence of increasing concentrations of compounds. After incubation of 48 hours with compounds, cells were lysed in lysis buffer and incubated for 45 minutes at 55 C. Cell lysates were mixed with human ATEIS1 specific capture probe or human RPL28 (Ribosomal Protein L28) specific probe as a normalization control, as well as blocking probes.
Cell lysates were then transferred to the custom assay hybridization plate (Thermo Fisher Scientific) and incubated for 18 to 22 hours at 55 C. Subsequently, plates were washed to remove unbound materials followed by sequential addition of preamplifiers, amplifiers, and label probe. Signals (= gene counts) were measured with a Multimode plate reader Envision. IC5os were calculated by dose-response modelling using appropriate software. For all non-housekeeper genes response equal counts corrected for background and relative expression. For each sample, each test gene signal (background subtracted) was divided by the normalization gene signal (RPL28:
background subtracted). Fold changes were calculated by dividing the normalized values for the treated samples by the normalized values for the DMSO treated sample. Fold changes of each target gene were used for the calculation of IC5(is.
109731 The results are summarized below in Table 5.
Table 5 - Biological data ¨ HTRF, Proliferation and MEIS1 mRNA Expression Assays HTRF- MEIS1 spheroid OCI- spheroid Compound 30min ICso assay_OneTime AML3 assay_OneTime Number incubation (pM) MOLM-14 ICso ICso KO-52 ICso IC50 (nM) (PM) (p1M) (PM) 11 0.11 0.018 0.021 0.21 8.38 A 0.09 0.02 0.021 0.091 6.85 A3 0.098 0.017 0.017 0.12 7.75 Al 0.18 0.017 0.011 0.08 3) Mouse PK (In vivo T y? and oral bioavailahility) [0974] In vivo pharmacokinetics (PK) were assessed in fasted male CD-1 mice (age 6-8 weeks) following a single intravenous (IV, 0.5 or 1.0 mg/kg administered at 2.5 ml/kg) or oral (PO, 5 mg/kg administered at 10 ml solution/kg) dose of test article formulated in a 20% (w:vol) HP-I3-CD solution or in Pyrogen free water.
[0975] Plasma and/or whole blood samples were collected from the dorsal metatarsal vein at desired timepoints via serial capillary microsampling (approx. 0.03 mL) using EDTA as an anticoagulant. Concentrations of compound in the plasma and blood samples were analyzed using a qualified LC-MS/MS method. In silico analysis of main pharmacokinetic parameters was performed using WinNonlin (PhoenixTM, version 6.1) or similar software.) 4) Metabolic Stability in Human/Mouse Liver Microsomes Experimental Procedure [0976] The objective of this study is to measure in vitro metabolic stability of test compound(s) in human and mouse liver microsomes and provide quantitative information on the rate of metabolic turnover (i e , determination of the apparent intrinsic clearance of test).
[0977] Test items were prepared at a stock concentration of 10 mM in DMSO. For determination of metabolic turnover, a final working solution was prepared by adding 2 pL of mM DMSO stock solution for test compound or positive control compounds to 198 pL, of acetonitrile (100 p..M final concentration).
[0978] Incubations were performed as follows: First, liver microsomes were thawed on ice and a master solution containing liver microsomes in 100 mM PBS (phosphate-buffered saline) at pH 7.4 is prepared. Next, the liver microsomes solution was added to the incubation plates and 10 mM NADPH (Nicotinamide-adenine dinucleotide phosphate) was added (MW: 833.4 g/mol;
Roche Diagnostics GmbH, Germany. Dissolved in phosphate buffer (100 mmol/L, pH
7.4)).
The mixture was mixed for 10 seconds and pre-warmed in the incubation plate at 37 C for 10 minutes. The metabolic reaction was initiated with the addition of 5 pL of the 100 WV working solution for test compound or positive control compounds to incubation plate (final test item concentration = 1 p.M). The reaction final mixture should contain 1 mM NADPH, 0.5 mg/mL
microsomes protein and 1 [TM test compound or positive control compound in 100 mM PBS at pH 7.4. The percentage of organic solvent in incubation mixture is 1% with DMSO 0.02%.
[0979] The reaction was quenched by transferring 50 ML of the incubated mixture at selected time points into the quenching plate containing 200 p.1_, of cold methanol.
After sampling of all the timepoints the quenching plate was centrifuged at 4000 rpm for 40 minutes to precipitate protein. A total of 90 [IL of the supernatant was transferred to an analysis plate and ultra-pure H20 water is added into each well for LC/MS/MS analysis. All incubations and analysis were performed in duplicate.
Data analysis [0980] All calculations were carried out using Microsoft Excel. The slope value, k, was determined by linear regression of the natural logarithm of the remaining percentage of the parent drug vs. incubation time curve. The results are summarized below in Table 6.
[0981] The in vitro half-life (in vitro ti/2) was determined from the slope value:
in vitro t1i2= - (0.693 / k) Conversion of the in vitro t1/2 (in min) into the in vitro intrinsic clearance (in vitro CLint, in L/min/mg proteins) was done using the following equation:
0.693 volume of incubation (4) in vitro Clint_ = ( ______________________ ) * _____________________ ti amount of proteins (mg) Table 6 - Mouse PK and Metabolic Stability In vivo Bio- Human LM Mouse LM
Example Formulating T1/2 availability Clint Clint number agent (IV) (PO) (%) i/mg) ( 1/m in/m g) (h) A HP-13-CD 6.7 17 19 <7.5 Pyrogen free A3 9.0 34 19 <7.5 water 11 HP-f3-CD NA NA 14 <7.5 "NA" means not analyzed 5) Protocol JOT Pharmacodynamics (PI)) Activity in Subcutaneous (sc or SC) Xenografts of1VIOL11/1-14 or OCI-Alt/IL3 Cells Test Agents and Controls [0982] Compound A3 was formulated in 20% hydroxypropyl-beta-cyclodextrin (HP-I3-CD) and prepared to reach a total volume of 0.2 mL (10 mL/kg) per dose for a 20 g animal. Doses were adjusted by individual body weight each day. Working stocks of Compound A3 were prepared once per week for each study and stored at room temperature. Compound A3 was administered orally (PO), daily.
Assay 109831 The in vivo pharmacodynamics (PD) activity of compounds was evaluated in subcutaneous (SC) xenografts of MOLM-14 cells or OCI-AML3 cells. Nude NMIRI
mice (Crl:NMIRI-Foxn lnu/-) harboring MOLM-14 or OCI-AML3 tumors were treated with 3 daily doses of vehicle or compounds. Plasma samples were collected at 23 hours after day 2 dose, 0.5 hours post final dose, and 16 hours post final dose and tumor samples were collected 16 hours post final dose. To examine the effects of compounds on the expression of multiple Menin-KMT2A target genes (e.g., MEISI, MEF2C, FLT3) QuantiGene Plex technology (Thermo Fisher Scientific) was used. Frozen tumors were homogenized and transferred to individual lysing matrix tubes in lysis buffer and incubated for 30 minutes at 55 C. Cell lysates were mixed with target-specific capture probes, Luminex beads, and blocking probes, transferred to the custom assay hybridization plate (Thermo Fisher Scientific) and incubated for 18 to 22 hours at 54 C. Subsequently, plates were transferred to a magnetic separation plate and washed to remove unbound materials from beads followed by sequential hybridization of preamplifiers, amplifiers, and label probe and subsequent streptavidin phycoerythrin binding.
Signals from the beads were measured with a Luminex FlexMap three-dimensional instrument.
For all non-housekeeper genes response equal counts corrected for background and relative expression. For each sample, each test gene signal (background subtracted) was divided by the normalization gene signal (RPL19, RPL28, ATP6V1A: background subtracted). Fold changes were calculated by dividing the normalized values for the treated samples by the normalized values for the DMSO treated sample. The results are summarized below in Tables 7 and 8.
Table 7 - Expression Level (% relative to vehicle) of Selected Genes from MOLM-14 SC Model (mean values and standard deviations) Compound A3 (mg/kg) MEIS1 FLT3 MEF2C
0 101.30 + 15.06 104.80 + 10.07 103.50 +
11.02 3 83.49 + 25.48 78.67 + 20.74 85.50 +
22.77 62.84 + 4.06 74.91 + 8.97 68.04 + 14.43 30 23.16 + 2.75 52.61 + 4.51 27.83 2.17 50 14.40 + 3.39 36.14 + 3.50 18.75 +
2.38 100 10.97 + 3.21 35.82 + 1.10 14.18 +
1.56 Table 8 - Expression Level (% relative to vehicle) of Selected Genes from OCI-AML3 SC Model (mean values and standard deviations).
Compound A3 (mg/kg) MEIS1 0 100.30 8.53 3 87.90 + 39.75 48.81 15.30 30 32.66 + 3.71 50 23.83 1.34 100 16.76 1.92 [0984] Tables 7a and 8a show median values based on repeated experiments in optimized conditions with fresh tumor samples.
Table 7a - Expression level ("A relative to vehicle) of selected genes from model (Median values and Standard Deviations).
Compound A3 (mg/kg) MEIS1 FLT3 MEF2C
0 100.0 + 13.5 100.0 + 10.1 100.0 + 11.0 3 83.7 22.8 89.2 20.7 87.7 + 22.8 10 49.3 + 5.9 79.8 + 9.0 64.6 + 14.4 30 14.7 3.9 54.5 4.5 28.8 22 50 4.7 1.1 37.6 3.5 18.8 2.4 100 3.3 + 1.4 35.4 + 1.1 13.6 + 1.6 Table 8a - Expression level ("/0 relative to vehicle) of selected gene from model (Median values and Standard Deviations).
Compound A3 (mg/kg) MEIS1 0 100.0 11.2 3 71.2 15.1 10 26.5 + 4.3 30 25.1 11.2 50 8.5 2.2 100 9.4 1.2 6) Efficacy Study in MOLM-121 Subcutaneous Model Test Agents and Controls [0985] Compound A3 was formulated in 20% hydroxypropyl-beta-cyclodextrin (HIP-13-CD) and prepared to reach a total volume of 0.2 mL (10 mL/kg) per dose for a 20 g animal. Doses were adjusted by individual body weight each day. Working stocks of Compound A3 were prepared once per week for each study and stored at 25 C.
Animals [0986] Female MARI Nude mice (MOLM-14 SC) were used when they were approximately 6 to 8 weeks of age and weighed approximately 25 g. All animals could acclimate and recover from any shipping-related stress for a minimum of 7 days prior to experimental use. Autoclaved water and irradiated food were provided ad libitum, and the animals were maintained on a 12 hour light and dark cycle. Cages, bedding, and water bottles were autoclaved before use and changed weekly. Further details are provided below in Table 9.
Table 9 - Tissue Culture and Cell Injection Reagents DPBS (Dulbecco's phosphate-buffered saline) Heat-inactivated fetal bovine serum RPMI 1640 medium L-glutamine Gentamycin T175 Culture Flask Roller Bottle Tumor Model and Cell Culture Method [0987] Human AML MOLM-14 cells were cultured at 37 C, 5% CO2 in the indicated complete culture media (RPMI 1640 + 10% HI-FBS + 2mM L-glutamine + 50ug/m1 Gentamycin ). Cells were harvested while in logarithmic growth and resuspended in cold (4 C) Roswell Park Memorial Institute (RPMI) 1640 in serum-free medium.
[0988] Each mouse received 5 x106 MOLM-14 cells in 50% Matrigel in the right flank, in a total volume of 0.2 mL using a lcc syringe and a 27-gauge needle.
Study Designs [0989] Compound A3 was administered orally (PO), daily.
[0990] Day 0 is the day of tumor cell implantation and study initiation.
[0991] Mice bearing SC MOLM-14 tumors were randomized on Day 16 post-tumor implantation and assigned to treatment groups according to tumor volume (mean of ¨130 mm3;
n-10/group). Treatment with vehicle or Compound A3 (at 30 and 100 mg/kg) was initiated on the same day, with daily oral dosing for 21 days. Plasma was collected at 1, 2, 4, 8, and 23 hours after the last dose (n=4-5/group/time point) for PK (pharmacokinetics) analysis.
Animal Monitoring [0992] SC tumor volume was measured for each animal 2 to 3 times per week or more throughout the study.
Calculations [0993] Tumor volume was calculated using the formula:
Tumor volume (mm3) = (Dxd2/2); where 'ID' represents the larger diameter and d' the smaller diameter of the tumor as determined by caliper measurements. Tumor volume data was graphed as the mean tumor volume SEM.
[0994] The % ATGI was defined as the difference between mean tumor burden of the treatment and control groups, calculated as % ATGI = ([(TVeTVco)(TVITVio)]/(TVc TVco))x 100 where `I'Ve' is the mean tumor burden of a given control group, TVco' is the mean initial tumor burden of a given control group, 'TV' is the mean tumor burden of the treatment group, and `TVto' is the mean initial tumor burden of the treatment group. % TGI was defined as the difference between.
[0995] Mean tumor volumes of the treated and control groups, calculated as:
% TGI = ((TV:IVO/TN/) x100 where 'TV: is the mean tumor volume of the control group and TVt' is the mean tumor volume of the treatment group. As defined by National Cancer Institute criteria, >60% TGI is considered biologically significant.
[0996] The % Tumor Regression (TR), quantified to reflect the treatment-related reduction of tumor volume as compared to baseline independent of the control group, was calculated as %TR= (1-mean (TVti/TVtoi)) x 100 where `I'Vti' is the tumor burden of individual animals in a treatment group, and TVtoi' is the initial tumor burden of the animal.
Data Analysis [0997] Tumor volumes were graphed using Prism software (GraphPad version 7 or 8).
Statistical significance for most studies was evaluated for Compound A3-treated groups compared with HPI3CD vehicle-treated controls on the last day of the study when 2/3 or more mice remained in each group. Differences between groups were considered significant when p<0.05.
[0998] Statistical significance for animal tumor volume was calculated using the linear mixed-effects (LME) analysis in R software version 3.4.2 (using Janssen' s internally developed Shiny application version 4.0), with treatment and time as fixed effects and animal as random effect.
Logarithmic transformation was performed if individual longitudinal response trajectories were not linear.
[0999] The information derived from this model was used to make pairwise treatment comparisons of tumor volumes to that of the control group or between all the treatment groups.
The results are shown in FIG. 2.
7) Cardio-Electrophysiological Effects of the Testing Compounds in Synchronously Beating Human Pluripotent Stem Cell-Derived Cardionlyocytes (hSC-CMs) Using a Ca2+ -Fluorescence Assay (CTCM human) Protocol [1000] Compounds were tested in the 96-well plates.
[1001] Compounds were tested at 0.1 tiM, 0.2 tiM, 0.5 laM, 1 laM, 2.5 laM and 5 laM (n = 4 per dose) on Cor.4U 0-Cardiomyocytes or on iCell Cardiomyocytes2.
[1002] Alternatively, compounds were tested at 0.1 M, 0.3 M; 1 jiM, 3 p.M,10 p.M and 30 [tM (n = 4 per dose) mostly on iCell Cardiomyocytes2.
[1003] Positive and Negative controls Dofetilide at 3 nM
lsoproterenol at 100 nM
Nimodipine at 100-300 nM
Cetirizine at 3 1.1.M.
Vehicle control: Dimethylsulfoxide (DMSO). The solutions of the compound in DMSO or its solvent (final concentration of 0.1% DMSO; n = 8).
Preparation of Test Article and Controls [1004] Tested compounds were dissolved in DMSO at 1000-fold the intended concentrations.
A compound "mother-plate" was made, containing the test compounds and positive and negative controls at 1000-fold the final concentrations. At the experiment day, these stock solutions were diluted with Tyrode (Sigma), supplemented with 10 mM HEPES
(Gibco), to 2-fold the intended concentration (in round bottom compound plates). Final DMSO
concentration in test solutions and vehicle control was 0.1%.
Cells [1005] hSC-CMs (Cor.4U Cardiomyocytes) were obtained from CDI (Ncardia, Germany).
Cells are pre-plated and seeded in fibronectin-coated 96-well plates at a density suited to form a monolayer and maintained in culture in a stage incubator (37 C, 5% CO2), according to the instructions of the cell provider.
[1006] Second line hSC derived cardiomyocyte called iCelle Cardiomyocytes2 were purchased from FUJIFILM Cellular Dynamics (USA). The experiments with test drugs are carried out 5 to 7 days after plating the cells onto the plate to have a living, beating monolayer of hiPSC-derived cardiomyocytes. The beating monolayer in 96-well-plates are normally taken from 2 Vials of frozen iCelle Cardiomyocytes2 (--z5 million cells/vial), which will be plated onto three 96-well plates (50K/well).
Before Start of Experiment [1007] At least one hour before the start of the experiments the normal cell medium was replaced with Tyrode solution with Calcium dye (see below).
[1008] Cal 520 dye (AAT Bioquest) was dissolved in 11 ml of Tyrode supplemented with 10 mM HEPES and warmed up to 37 C before adding to the cells.
[1009] 35 ul cell culture medium was removed from each well and replaced with 35 [11 of pre-warmed Cal 520 dye solution and cell plate was incubated for 45 min at 37 C /
5% CO2. Cells were incubated for 5 min at 37 C.
Experiment [1010] Spontaneous electrical activity is recorded, using Cal520TM (AAT
Bioquest) calcium fluorescence-dye signalling. This dye integrates the total intracellular calcium activity over the whole well. A bottle of Ca1520 dye (50 g, MW: 1103/mol) is dissolved with 50 ul DMSO as a stock solution of 0.9 mM. 50 ML of the stock solution of the dye was added to 10 ml Tryodes solution to have dye concentration of 4.5 uM. Subsequently, 35 Ml of this dye solution was added into each well, to have a final dye concentration of 1.58 MM. The current dye protocol on this CTCM human assay was established recently (Ivan Kopljar et al, Journal of Pharmacological and toxicological methods 2018. 91: 80-86; Lu et al., Tox Sci 2019. 170 (2):
345-356).
[1011] Fluorescent signals (Ca2 transient morphology) were measured using the Functional Drug Screen System (FDSS/pCell; Hamamatsu, Japan) and the recordings were subsequently analyzed off-line, using appropriate software e.g., Notocord.
[1012] The cell plate was loaded into the FDSS/pCell for a test run: Ca2+
transients were measured for 4 minutes to check for synchronous beating of the cardiomyocytes in each well.
All 96 wells were measured simultaneously (sampling interval: 0.06 s, short exposure time: 10 ms; excitation wavelength 480 nm; emission wavelength 540 nm; FDSS/uCell warmed to 37 C).
When all showed synchronous beating, the 96-well plate was measured repeatedly for 3 times (to verify synchronous beating in all 96-well at baseline, wells that did not meet the preset criteria were excluded from the study and not treated with compound):
T = 0: control period (-5 to -1 min) + compound addition, followed for 3 min.
T ¨ 30: measured from 29 to 34 min after compound addition [1013] During the compound addition step, 100 jul of the respective double-concentrated test solutions was pipetted into each well simultaneously.
[1014] Data were analyzed off-line using appropriate software e.g., Notocord-Hem (version 4.3).
[1015] The following parameters of the Ca2+ transient morphology were measured:
- beat rate (BR) - amplitude of the Ca" transient (Amp), - CTD90: Ca2+ transient duration at 90% (time to 90% of the initial base value) [1016] The presence of various 'arrhythmia-like' activities were also noted during the experimental periods. These included:
= 'early afterdepolarization-like' (EAD-like) events (defined as "an extra small peak of the transient waveform following the initial peak of the transient"), = 'ventricular tachycardia-like' (VT-like) events (defined as a very fast beating rate) or = 'ventricular fibrillation-like' (VF -like) events (defined as "small amplitude, fast-rate Ca' waveforms with irregularities and non-measurable transient potentials) = 'cessation of beating' of the cells (no Ca2+ transients observed).
If compound-induced changes on the calcium transient signal could not be analyzed by the software, then these signals were identified as BQL (below quality analyses level).
Data Analysis [1017] Data, measured from the FDSS- Cell, were copied for off-line analysis and were analyzed and uploaded in SPEC-II (our operational management system) for further analysis.
The values of the variables before and after administration of the compound were collected and transferred into an Excel workbook.
[1018] All values (actual units and percentage changes from the baseline values) are expressed as median (minimum and maximum). Changes versus the corresponding baseline values (in actual units) observed in the compound group were compared with those in the solvent control group using the Wilcoxon-Mann-Whitney Test. Two-tailed tests with Bonferroni correction for multiplicity adjustment were conducted. Since there are 10 treatment groups each compared to the solvent group, alpha level of 0.05/10 (0.005) was considered to reflect a statistically significant difference from the solvent group. All statistical analysis was performed using appropriate software e.g., R software version 3.5.2.
[1019] Quality Control of the hiPSC-CMs in the plate:
Plates were rejected if they did not meet following criteria:
- Stable regular beating - Amplitude > 500 relative units - Beat rate between 25 and 80 beats per minute - CTD90 between 300 and 800 ms.
[1020] In the present study, the hiPSC-CMs in the plates met the above criteria.
[1021] These parameters combined with incidence of arrhythmia or cessation of beating were used to calculate the potential hazard level using a weighted scoring method (based on Kopljar et al., Stem Cell Reports 2018. 11, 1365-1377). This hazard score is calculated per concentration by adding weighted points based on the Tolerance Intervals (TI) on the changes of CTD90, the beat rate and amplitude (AA%) and incidence of beating stop and early afterdepolarization (EAD). Consequently, for each concentration one of four different hazard levels will be generated. This will be done after 30-min of incubated with compound. The hazard levels are:
No hazard: within the vehicle effect levels or small non-relevant changes.
Low hazard: relevant effect but potentially low risk for cardiac liabilities.
High hazard: relative high risk for cardiac liabilities.
Very high hazard: very high risk due to arrhythmic like events (EAD' s).
[1022] The 'Hazard Score' results provide an identification for potential acute cardiac drug-induced effects at free drug equivalent (as no plasma proteins are added to the wells).
Evaluation of hazard identification is conducted using a 'scoring reference book' called CTCM Scoring version 1 (Kopljar et al., Stem Cell Reports 2018. 11: 1365-1377), and levels are indicated according to the following color scheme of Table 10.
Table 10 ¨ Color Schemes of Hazardous Identification Legend Green No concern Yellow Low concern Red High concern Black Very high concern due to arrhythmic events Ranking of a testing compound according to hazard score severity on the Ca' transient assay measured in HiPSc-CMs as listed above in different colors and in the associated table.
RESULTS
Using iCell Cardiomyocytes2 as cell line [1023] Positive and negative controls: The positive and negative controls all had expected pharmacological effects in this assay. The results are summarized below in Tables 11 and 12.
Table 11 ¨ Hazard Scoring for Compound A3 rnpoun Co d Color @ Color @ Color @ Color @ Color @ Color @
0.1 uM 0.21.tM 0.51.tM luM 2.5 M
luM
A3 Green Green Green Green Green Green Table 12 ¨ Hazard Scoring for Compounds Al and 11 Compound Color @ Color @ Color .0/ Color @ Color @ Color @
0.1 uM 0.3 M luM 3 pM 10 MM
30pM
Al Green Green Green Green Green yellow 11 Green Green Green Green Green Green [1024] For Compound Al: with an efficacious dose in mouse xenograft models of 30 mg/kg, CTCM human concentration vs free Cmax would be estimated as follows:
Margin CTCM human 10 MM vs free Cmax >16 (mouse, human) Margin CTCM human 30 MM vs free Cmax >45 (mouse, human).
8) Effect on the Membrane Potassium Current 'Kr in hERG Transfected Cell Lines [1025] Protocol 1:
Abbreviations CHO Chinese hamster ovary cell line DMSO Dimethylsulfoxide hERG human ether-a-go-go-related gene rapidly activating delayed-rectifier I( current Methods [1026] Experiments were performed using CHO cells stably expressing the hERG
potassium channel. Cells were grown at 37 C and 5% CO2 in culture flasks in Ham's F12 Medium supplemented with 10% heat-inactivated fetal calf serum, hygromycin B (100 p.g/m1) and geneticin (100 pg/m1). For use in the automated patch-clamp system QPatch (Sophion) cells were harvested to obtain cell suspension of single cells.
[1027] Solutions: The bath solution contained (in mM) 145 NaCl, 4 KC1, 10 glucose, 10 HEPES ((4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid), 2 CaCl2 and 1 MgCl2 (pH 7.4 with NaOH). The pipette solution contained (in mM) 120 KC1, 10 EGTA (Ethylene glycol-bis(2-aminoethylether)-N,N,N,N-tetraacetic acid), 10 HEPES, 5.374 CaC12 and 1.75 MgCl2 (pH 7.2 with KOH).
[1028] Patch-clamp experiments were performed in the voltage-clamp mode and whole-cell currents were recorded with an automated patch-clamp assay utilizing the QPatch system (Sophion). Current signals were amplified and digitized, stored and analyzed by using the QPatch assay software.
[1029] The holding potential was -80 mV. The hERG current (Ktselective outward current) was determined as the maximal tail current at -40 mV after a 2 second depolarization to +60 mV. Pulse cycling rate was 15 s. A short pulse (90 ms) to -40 mV served as a baseline step to calculate the tail current amplitude. After establishing whole-cell configuration and a stability period, the solvent control (0.3% DMSO) was applied for 5 minutes followed by the test substance by four increasing concentrations of 3 x 10-7 M, 3 x 10' M, 10-5 M
and 3 x 10-5 M.
Each concentration of the test substance was applied twice. The effect of each concentration was determined after 5 min as an average current of 3 sequential voltage pulses. To determine the extent of block the residual current was compared with vehicle pre-treatment.
[1030] Concentration/response relations were calculated by non-linear least-squares fits to the individual data points. The half-maximal inhibiting concentration (IC50) was calculated by the fitting routine.
[1031] Protocol 2:
Cells [1032] The compound, vehicle control and positive control were tested on hERG-transfected EfEK293 cells. A human embryonic kidney cell line (FIEK293) with a stable transfection of hERG (Zhou Z et al. Biophysical Journal 1998. 74, 230-241; McDonald T.V.et al, Nature 1997.
388, 289-292) was used (University of Wisconsin, Madison, USA). The cells were kept in culture inlMEM (Minimum Essential Medium, Gibco) which was supplemented with (amounts indicated added to 500 ml 1MEM): 5 ml L-Glutamine-Penicillin-Streptomycin (Sigma), 50 ml Fetal Bovine serum (Bio-Whittaker), 5 ml Non-essential Amino Acids 100x (Gibco), 5 ml sodium pyruvate 100 mM (Gibco) and 4 ml geneticin 50 mg/ml (Gibco) using T175 flasks. The cells were incubated at 37 C in 5% CO2 atmosphere (in air).
Cell Harvesting for Assay [1033] Cells were harvested as described below using accumaxTM (Sigma) as the dissociating reagent. Cells were then resuspended in a mixture of 33% DMEM/F12 (Dulbecco's Modified Eagle Medium/Nutrient Mixture F-12 - Sigma) media/67% extracellular physiological solution.
[1034] The flasks were washed twice carefully with ¨5-10 ml phosphate buffered saline (PBS) (GibcoTM) containing 2mM EDTA (Ethylenediaminetetraacetic acid) (Sigma). The cells were dissociated using ¨3 ml of accumaxTM (cell detachment solution) and incubated for ¨5 to 10 min. at 37 C. Cold external physiological solution (2-5 ml) was added and the flasks are incubated at ¨4 C for 5-10 min. Then, the cell suspension in each flask was gently dissociated with a 5m1 pipette. The cell suspension was transferred to a low binding petri-dish (-10 mm diameter). Each flask was washed with ¨ additional 5 ml cold external physiological solution and this solution was also added to the petri-dish. The petri-dish was then incubated for another to 10 minutes at ¨4 C. After another gentle dissociation of the cell suspension in the petri dish, the cells were transferred to a reservoir kept on an orbital shaker at 200 rpm at 16 C.
Before experiments were performed, the cells recovered for ¨20 min.
Compounds [1035] A 10 mM solution of the compound was used and plated in a 384 well plate. Aliquots of the stock solutions are diluted with the recording solution using automated liquid handling (Biomek FXP; final DMSO concentration: 0.03 to 0.3 %). A standard range of screening concentrations was used ranging from 1 uM to 30 uM.
[1036] A positive control (E-4031) was included within each run to evaluate the sensitivity of the assay. Table 13 summarizes the external and intracellular solutions used in the experiments.
In Table 13, the composition of the intracellular and external buffer solutions is shown in [mM]
and "NIVIDG" means N-methyl-D-glucamine.
Table 13 - External and Intracellular Solutions Extracellular Intracellular Physiological Seal Enhancer Recording Solution Solution Solution / Chip Fill Solution Solution KC1 10 NaCl 140 NMDG 60 NMDG 60 KF 110 KCl 4 NaCl 80 NaCl 80 NaCl 10 Glucose 5 KC1 4 KC1 4 HEPES 10 HEPE S 10 CaCl2 10 CaCl2 2 EGTA 10 CaCl2 2 MgCl2 1 MgCl2 1 MgCl2 1 Glucose 5 Glucose 5 pH 7.2 (KOH) pH 7.4 NaOH)( pH 7.4 (HCL) pH 7.4 (HCL) Study Design [1037] The whole cell patch clamp technique on transfected cells allows the study of ion-channels with no - or limited interference from other ion-channels. The effects of the compounds on the hERG current were studied with an automated planar patch clamp system, SyncroPatch 384PE (Obergrussberger et al, Journal of Laboratory Automation 2016. 21 (6), 779-793). All cells were recorded in the whole cell mode of the patch clamp technique. The module is incorporated in a liquid handling pipetting robot system, Biomek FXP, for application of cells and compounds, vehicle control and positive control.
[1038] The different concentrations of the compounds were applied in two cumulatively increasing concentrations for the compounds (1 M and 10 M, and 3 MM and 30 MM, respectively). The hERG current was determined as the maximal tail current at -30 mV and percent inhibition upon compound or vehicle and positive control addition was reported.
[1039] After cells are caught onto the individual holes of the recording chips using the chip fill solution, the seal is increased with the seal enhancer solution (increased [Ca2]; then the cells were washed twice with recording solution before using a pressure protocol to go into the whole cell mode.
[1040] After the whole cell mode was achieved, test pulses were given for ¨10 minutes to quantify the hERG current in control conditions. During this control period vehicle control solution (recording solution containing 0.03% DMSO) was added three times into the individual wells. While continuing the pulse protocol, cumulatively increasing concentrations of the vehicle control, compound or positive control was added. The effect of the vehicle, compound and positive control was measured after 5 minutes of drug application. Two concentrations of the compound were tested per cell.
[1041] The use of the internal and recording solutions will result in ¨10 mV
liquid junction potential and the command voltage step will take this into account.
[1042] Electrophysiological measurements: The membrane current of the cells was measured at distinct membrane potentials with the patch clamp technique by means of an automated patch clamp system The holding potential is -70 mV The hERG current (K-h-sel ective outward current) was determined as the maximal tail current at -30 mV after a 2 second depolarization to +70 mV (refs. 1, 4). Pulse cycling rate was 15 s.
Data analysis [1043] The leak corrected hERG current (K -selective outward current) was determined as the maximal tail current at -30 mV after a 2-second of depolarization to +70 mV
measured between 2336.3 ms and 3083.6 ms. The median of three current amplitudes was taken at the end of the control period and at the end of each addition of compound, vehicle and positive control to calculate the percent inhibition.
[1044] QC parameters were set in the SyncroPatch 384PE PatchContro1384 software to automatically exclude wells from the analysis if values fall outside the range. The QC criteria are dependent on the type of recording plate (chip). Typically, a 4xChip (medium size hole) was used to record from hERG-transfected 1-1EK293 cells. QC criteria 4-6 were set before the first addition of the compound, QC criteria 4 and 5 were also set at the end of each compound addition.
[1045] QC Criteria and acceptable ranges:
1. Board Check: -500pA - 500pA
2. Contact seal resistance: -100kOhm - 10MOhm 3. Junction potential offset: 0 - 100mV
4. Rseal > 100 MOhm 5. Rseries: between 1 - 25 MOhm 6. hERG tail current? 0.2 nA before compound addition [1046] Each compound was replicated on the same plate in at least 5 wells.
Percent inhibition of at least 2-3 replicates per concentration will be reported as median. The results are summarized below in Tables 14 and 15 for Protocol 1 and Protocol 2, respectively.
Table 14 - hERG IC50 (pM) from Protocol 1 Compound Number hERG- ICso (M) A >30.2 Table 15 - hERG IC50 ( M) from Protocol 2 Example Number hERG ICso p.M
11 >30.2 9) Efficacy Study in Disseminated OCI-AML3 Model Test Agents and Controls [1047] Compound A3 was formulated in 20% hydroxypropyl-beta-cyclodextrin (EIP-13-CD) and prepared to reach a total volume of 0.2 mL (10 mL/kg) per dose for a 20 g animal. Doses were adjusted by individual body weight each day. Working stocks of Compound A3 were prepared once per week for each study and stored at 25 C.
Animals [1048] Female SCID beige mice (CB17 Cg-PrkdcscidLystbg-J/Cr1/-) were used when they were approximately 6 to 8 weeks of age and weighed approximately 25 g. All animals could acclimate and recover from any shipping-related stress for a minimum of 7 days prior to experimental use. Autoclaved water and irradiated food were provided ad libitum, and the animals were maintained on a 12 hour light and dark cycle. Cages, bedding, and water bottles were autoclaved before use and changed weekly. The tissue culture and cell injection reagents are summarized below in Table 16.
Table 16 - Tissue Culture and Cell Injection Reagents DPBS (Dulbecco's phosphate-buffered saline) Heat-inactivated fetal bovine serum MiEM Alpha medium L-glutamine Gentamycin T175 Culture Flask Roller Bottle Tumor Model and Cell Culture Method [1049] Human AML cell line OCI-AML3 was cultured at 37 C, 5% CO2 in the indicated complete culture media (MiEM Alpha + 20% HI-FBS (Heat-Inactivated Fetal Bovine Serum) +
2mM L-glutamine + 50ug/m1 Gentamycin). Cells were harvested while in logarithmic growth and resuspended in cold (4 C) MEM ((Minimum Essential Medium) Alpha in serum-free medium.
[1050] For the disseminated OCI-AML3 model, each mouse received 5x105 cells via IV
injection in a total volume of 0.2 mL using a 26-gauge needle.
Study Designs [1051] Compound A3 was administered orally (PO), daily.
[1052] Day 0 is the day of tumor cell implantation and study initiation.
[1053] In the efficacy study, mice bearing IV OCI-AML3 xenograft tumors were randomly assigned to treatment groups 3 days post-tumor cell engraftment. Treatment with vehicle or Compound A3 (at 30, 50, 100 mg/kg) was initiated on the same day, with daily dosing for 28 days.
Animal Monitoring [1054] Animals were monitored daily for clinical signs related to either compound toxicity or tumor burden (i.e., hind limb paralysis, lethargy, etc.).
Calculations [1055] For survival assessment, results were plotted as the percentage survival against days post tumor implant. Negative clinical signs and/or >20% body weight loss was used as a surrogate endpoint for death. Median survival was determined utilizing Kaplan-Meier survival analysis. The percent increased life span (ILS) was calculated as: ((median survival day of treated group - median survival day of control group) / median survival day of control group) 100. Animals failing to reach the surrogate endpoint due to adverse clinical signs (such as ulcerated tumors, body weight loss, etc.) or death unrelated to treatment were censored for the survival assessment. As defined by NCI criteria, >25% lLS is considered biologically significant. (Johnson JI et al. Br J Cancer. 2001. 84(10), 1424-1431).
Data Analysis [1056] Survival and body weight data were graphically represented utilizing Prism (Version 7).
Statistical significance for body weights was evaluated as described above.
Statistical significance was evaluated for Kaplan-Meier survival plots comparing therapeutic treatment group vs. appropriate vehicle-treated control using log-rank (Mantel-Cox) test in R software version 3.4.2. Differences between groups were considered significant when the p value was <0.05.
Survival [1057] The Kaplan-Meier survival curve is shown in FIG. 3. Mice bearing established OCI-AML3 tumors were orally dosed daily with Compound A3 at 30, 50, 100 mg/kg in 20% HP-13-CD formulation for a total of 28 days (n=9-10/group). For Compound A3 treated groups, the median days of survival were reached at the following days for 30 mg/kg at day 75.5, for 50 mg/kg at day 58.5 and for 100 mg/kg at day 75 this compared to a median survival of 38.5 days for the vehicle-treated control group. Compound A3 treatment resulted in statistically significant increased lifespan of OCI-AML3 tumor-bearing mice by 96.1%, 51.9%
and 94.8%
(at the 30, 50 and 100 mg/kg dose levels) as compared to that of control mice, (p<0.001). This was a biologically significant ILS as per NCI criteria threshold of >25% ILS
(Johnson JI et al.
Br. J Cancer. 2001. 84(10), 1424-1431).
10) Efficacy of Menin-MLL Inhibitor in Combination with Venetoclax, and Optionally, Azacitidine, in OCI-AML3 (NPM1c) IV Model in NSG Mice 110581 The disseminated OCI-AML3 model described above was also used to examine the efficacy of menin-MLL-inhibitor (formulated as described above) in combination with venetoclax (formulated in polyethylene glycol [PEG]-400/Phosa150/dimethyl sulfoxide [DMSO]), and optionally azacitidine (formulated in 10% DMSO), with the following differences: (i) instead of female SC1D beige, N SG (non-obese diabetic [NOD]
scid gamma or NOD.Cg-Prkdcse'd Il2rgtml wil/SzJ) were utilized, (ii) instead of 5x105 cells, each mouse received an injection of 1x106 cells, (iii) instead of 3 days, treatment with compound(s) was initiated 5 days after cell injection, and (iv) instead of a total volume of 0.2 mL (10 ml/kg) per dose, compound(s) prepared to reach a volume of 8 ml/kg Compound Al was given in the morning, and venetoclax or azacitidine was given in the afternoon, approximately 6-8 hr apart. The treatment of each group using compound(s) in this efficacy study is summarized in Table 17.
Table 17 ¨ Treatment of OCI-AML3 tumors in mice GROUP TREATMENT (n=10) DOSE
ROUTE SCHEDULE
1 Vehicles 8 mL/kg ip/po/po QD x 7/QD x 28/QD x 28 2 Azacitidine 2 rag/kg ip QD x 7 3 Venetoclax 100 mg/kg po QD x 28 4 Compound Al 30 mg/kg po QD x 28 Azacitidine 2 mg/kg ip/po QD x 7/QD x 28 +Venetoclax 100 mg/kg 6 Venetoclax 100 mg/kg po/po/po QD x 28/QD
x 28 +Compound Al 30 mg/kg 7 Azacitidinc 2 mg/kg ip/po/po QD x 7/QD x 28/QD x 28 +Venetoclax 100 mg/kg +Compound Al 30 mg/kg [1059] The Kaplan-Meier survival curve is shown in FIG. 4A. The impact on life span of treating mice bearing established OCI-AML3 tumors for 4 weeks is summarized in Table 18.
Table 18 Impact on Life Span following Treatment of OCI-AML3-tumors in mice TREATMENT %ILS
Azacitidine 18 Venetoclax 0 (ns) Compound Al 33 Azacitidine 14 +Venetoclax Venetoclax 33 +Compound Al Azacitidine 35*
+Venetoclax +Compound Al p<0.05 as compared with vehicle-treated control mice except where noted as not significant (ns). *p<0.05 versus Aza and Ven monotherapies, and Aza+Ven combination doublet.
110601 As reflected in Table 18, treatment of mice with Compound Al in combination with either venetoclax or venetoclax plus azacitidine resulted in statistically significant increased lifespan (1LS) of OC1-AML3 tumor-bearing mice as compared to that of vehicle control treated mice or with either azacitidine or venetoclax alone or the doublet combination of ventetoclax plus azacitidine. Notably, there is no antagonism with the triplet combination (Compound Al plus venetoclax and azacitidine) or doublets (venetoclax plus azacitidine or Compound Al), and efficacy seems solely driven by Compound Al.
11) Efficacy of Menin-MLT Inhibitor in Combination with Venetoclax and Optionally, Azacitidine, in MOLM-13 (KMT2A-r) IV Model in NSG Mice [1061] A similar approach to the disseminated OCI-AML3 model described herein for examining the efficacy of menin-MLL-inhibitor in combination with venetoclax, and optionally azacitidine, was adopted with the MOLM-13 cells being used instead of OCI-AML3 cells.
Tumor Model and Cell Culture Method [1062] Human AML cell line MOLM-13 was cultured at 37 C, 5% CO2 in the indicated complete culture media (RPMI, Roswell Park Memorial Institute [RPMI] 1640 10%
HI FBS
2mM L-glutamine 50 jig/m1 Gentamycin). Cells were harvested while in logarithmic growth and resuspended in cold (4 C) serum-free RPMI 1640 medium Each mouse received an injection of 1x105 MOLM-13 cells, and all other parameters were conducted as described for experiment (10).
[1063] The treatment of each group using compound(s) in this efficacy study is summarized in Table 19.
Table 19 ¨ Treatment of MOLM-13-tumors in mice GROUP TREATMENT (n=10) DOSE ROUTE SCHEDULE
1 Vehicles 8 mL/kg ip/po/po QD x 7/QD x 28/QD x 28 2 Azacitidine 2 mg/kg ip QD x 7 3 Venetoclax 100 mg/kg po QD x 28 4 Compound All 10 mg/kg po QD x 28 Azacitidine 2 mg/kg ip/po QD x 7/QD x 28 +Vene toclax 100 mg/kg 6 Venetoclax 100 mg/kg po/po +QD x 28/QD
x 28 +Compound Al 10 mg/kg 7 Azacitidine 2 mg/kg ip/po/po QD x 7/QD x 28/QD x 28 +Venetoclax 100 mg/kg +Compound Al 10 mg/kg [1064] The Kaplan-Meier survival curve is shown in FIG. 4B. The impact on life span of treating mice bearing established MOLM-13 tumors for 4 weeks is summarized in Table 20.
Table 20 - Impact on Life Span following Treatment of MOLM-13 tumors in Mice TREATMENT %ILS
Azacitidine 35 Venetoclax 6 Compound Al 35*
Azacitidine 53*
+Venetoclax Venetoclax 256**
+Co mpound Al Azacitidine 277**
+Venetoclax +Compound Al p<0.05 as compared with vehicle-treated control mice except where noted as not significant (ns). *p<0.05 versus Aza and Yen monotherapies. **p<0.05 versus Compound Al, Aza, and Yen monotherapies, and Aza+Ven combination doublet.
[1065] As reflected in Table 20, treatment of mice with Compound Al in combination with either venetoclax or venetoclax plus azacitidine resulted in statistically significant increased lifespan (TLS) of MOT,M-13 tumor-bearing mice as compared to that of mice treated with venetoclax alone or the doublet combination of ventetoclax plus azacitidine.
(12) In Vitro Proliferation Protocol (A) Menin-MLL Inhibitor in Combination with Venetoclax and Optionally, Azacitidine [1066] The effect of Compound A3 in combination with venetoclax, or in combination with venetoclax and azacitidine, was determined in proliferation assays using the (KiVIT2A-r) cell line. MOLM-13 cells were seeded at 500 cells/well in 96-well plates and exposed to the indicated drug alone or in combination at the specified concentration detailed in Table 21A and Table 21B. In particular, for the combination of Compound A3 with venetoclax (without azacitidine) a concentration range of Compound A3 (a 7-point, 4-fold serial dilution starting at an initial concentration of 1 i_tM) was combined venetoclax (a 6-point, 5-fold serial dilution starting at an initial concentration of 1 [tM). For the combination of Compound A3 with venetoclax and azacitidine a concentration range of Compound A3 (a 6-point, 4-fold serial dilution starting at an initial concentration of 1 1.,IM) was combined with the combination of azacitidine (a 7-point, 5-fold serial dilution starting at an initial concentration of 25 M) and venetoclax (a 7-point, 5-fold serial dilution starting at an initial concentration of 1 MM) in a 25:1 ratio. Compound A3 and azacitidine (when added) were treated at day 0 and venetoclax was added at day 4. MOLM-13 cells were incubated at 37 C, 5% CO2 with the indicated drug combination concentration for 8 days (Compound A3 and azacytidine) and for 4 days (venetoclax) in quadruplicate.
110671 Spheroid-like growth was monitored in real-time by non-invasive live-cell imaging using the 4x objective of the Incucyte ZOOM live cell imaging system (Essen BioScience), and acquiring images on Day 8. The percent confluence, as a measure of spheroid size, was determined using an integrated analysis tool that is the part of the Incucyte ZOOM software "IncuCyte ZOOM 2016B" (Essen BioScience). The DMSO content was normalized to 0.3%
and the percent confluence from the DMSO well was used as baseline response.
[1068] Potential combination effects were evaluated at day 8 and analyzed for synergy using an R-based Biochemically Intuitive Generalized Loewe (BIGL) model implemented with a highest single agent (HSA) null model (Van der Borght 2017). Data from 2 independent experiments were pooled and analyzed.
Results [1069] The doublet combination of Compound A3 with venetoclax led to significantly increased inhibition of cell proliferation compared to Compound A3 or venetoclax monotherapy (see FIG. 5A). Strong synergistic effects were observed across a range of concentrations in MOLM-13 cells as reflected in the contour plot (FIG. 5A) and detailed below in Table 21A where effect size is represented as the difference between the observed outcome and the expected outcome of combination treatments with 95% confidence interval shown in parentheses.
[1070] The triplet combination of Compound A3 with venetoclax and azacitidine led to significantly increased inhibition of cell proliferation compared to Compound A3 monotherapy or the doublet combination of venetoclax and azacitidine (see FIG. 5B) Strong synergistic effects were observed across a range of concentrations in MOLM-13 cells as reflected in the contour plot (FIG. 5B) and detailed below in Table 21B where effect size is represented as the difference between the observed outcome and the expected outcome of combination treatments with 95% confidence interval shown in parentheses.
Table 21A - Effect of Compound A3 in Combination with Venetoclax on MOLM-13 Cell Proliferation.
, _______________________________________________________________________________ __ 0.03 -0.01 -0.00 -0.03 -0.00 0.00 1 (-0.02, 0.07) (-0.05, 0.04) (-0.04, (:.O4) (-0.08, 0.01) (-0.05, 0.04) (-0.04, 0.04) 0.25 0.05 0.02 -0.00 -0.02 0.00 I -0.01 O..% (0.01, 0.09) ( 0.02, 0.07) ( 0.04, 0.04' ( 0.06, 0.03) (0.05, 0.05) 1 ( 0.06, 0.03) M 1 __ 0 0625 0.06* -0.03 -0.09 -0.22" -0.22" -0.26"
../.... .
(0.01,011) (-0.07,0.02) (-0.14,-0.04) (-0.26,Ø17) (-0.26, -0.17) (-0.31,-0.22) en . ______________________________________________________ < -"r0 0.0156 0.02 -0.01 0.00 -0.09 -0.17" -0.12"
C (-0.02, 0 07) (-0.05Ø03) (-0.04,0.05) (-0.13, -0.05) (-0.22-0.13) (-0.17, -0.07) =
O 0.004 0.04 -0.06 0.01 0.02 -0.01 0.03 11.
(0.01, 0.08) (-0.09, -0.021 (-003,0.05) (-0.03, 0.06) (-0.03, 0.04) (-0.01,0.08) E
o 0.01 0.02 0.01 0.03 0.01 -0.00 µ11 0.001 (-0.01, 0.05) (-0.01, 0.06) (-n_oz. oil-, (-0.m, (Lim) (41.01, 0.06) (-0.04, 0.07) 0.02 0.09* 0.02 -0.01 0.04 0.02 0.0003 (-0.02, 0.05) (0.05, 0.13) (-0_02, 0.06) (-0.05, 0.04) (4...00, 0.09) (-0.03,0.06) Venetoclax ( M} 0.0003 0.0016 0.008 0.04 0.2 I.
Note that absence of any asterisk indicates an additive effect, antagonism is indicated by" * "
and synergy is indicated by" ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
Table 21B - Effect of Compound A3 in Combination with Venetoclax and Azacytidine on MOLM-13 Cell Proliferation.
0.01 4.01 -0.00 -0.05 -0.12" 0.00 0.00 i. (-0.05, 0.07) (-0.08, 0.05) (-0.06, ).06) (-0.11, 0.02) (-0.18. -0.06) (-0.05Ø06) (-0.05Ø06) .........
0.00 0.03 -0.02 -0.02 -0.11" -0.00 0.00 I. 0.25 (-106, 0.06) (-0.03,0.09) (-(L08, 0.04) (-0.08, 0.04) (-0.17, -0.05) (-0.06,0.05) (-0.05,0.06) ......... _________________________________________________________ 7 rn 0.0625 um -0.00 0.05 -0.13" -0.41" 0.01 0.00 < (-0.06,0.09) (4.08,0.08) (-0.03, 0.13) 1-0.20, -0.06) (-0.48, -0.34) (-0.05,0.06) (-0.05,0.06) C 0.04 -0.40 -0.01 0.01 -0.15" 0.00 0.00 = 0.0156 O (-0.03, 0.10) (-0.07, 0.07) (-0.08,0.05) (-0.06, 0.08) (-0.23, -0.08) (-0.05,0.06) (-0.05Ø06) CI.
E 0.004 0.06 0.04 -0.05 -0.02 0.07* 0.00 0.01 O (0.00, 0.12) (4.02,0.10) (-(L11, 0.00) (-0.08, 0.05) (-0.01, 0.15) (-(L05, 0.06) j-0.05, 0.06) I.) 0.04 0.02 0.01 0.02 0.09' 0.00 0.01 0.001 (-0 12, 0.10) f. -0.03, 0.08) (-0.04, ,.07) (-0.05, 0.08) '0.01, 0.17) (-0.05, 0.06) (-0.04,0.07) Ven et oc Tax (WO) GE-05 0.0003 0.0016 0.008 0.04 0.2 1 Azacitidine (p.M) 0.002 0.u08 0.04 0... 1 5 Note that absence of any asterisk indicates an additive effect, antagonism is indicated by" * "
and synergy is indicated by" ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
(B) Menin-MLL Inhibitor in Combination with Decitabine and Venetoclax The effect of Compound A4 in combination with decitabine as compared to in combination with decitabine and venetoclax was determined in proliferation assays using the MOLM-13 (KIVIT2A-r) and OCI-A1V11L3 (NPM1c) cell lines.
Cell lines AML cell lines MOLM-13 and OCI-AML3 were purchased from DSMZ. MOLM-13 were grown in RPMI medium supplemented with 10% Fetal Bovine Serum (FBS) and 1%
penicillin/streptomycin. OCI-AML3 cells were cultured in 80-90% alpha-MEM
(with ribo-and deoxyribonucleosides) + 10-20% FB S. All cell lines were cultured at 37 C
in 5% CO2 atmosphere.
Cell Titer Glo assays 110711 A1V1L cell lines, MOLM-13 and 0C1-AML3, (5 x 103 cells/well) were seeded in 96-well plates and grown for 6 days in serum (10%)-containing medium in the presence or absence of inhibitors at the indicated concentrations detailed below in Table 22A and Table 22B.
Proliferation was analyzed by means of a Cell Titer Glo assay using the CellTiter 96 Aqueous One Solution Cell Proliferation Assay (Promega, Madison, WI, USA), according to the manufacturer's instructions. Data are mean with standard deviation from two to four independent experiments in technical triplicates. Compound A4 and decitabine were added at day 0 and venetoclax (when added) was added at day 4.
Synergy calculations [1072] R-based Biochemically Intuitive Generalized Loewe (BIGL) model implemented with a highest single agent (HSA) null model. Specifically, the B1GL methodology was applied to calculate drug-drug interactions (Van der Borght, K., Tourny, A., Bagdziunas, R. et al. B1GL:
Biochemically Intuitive Generalized Loewe null model for prediction of the expected combined effect compatible with partial agonism and antagonism. Sci Rep 7, 17935 (2017); Thas, 0., Tourny, A., Verbist, B., Hawinkel, S., Nazarov, M., Mutambanengwe, K., &
Bijnens, L.
Statistical detection of synergy: New methods and a comparative study.
Pharmaceutical Statistics (2021)).
[1073] Synergy matrix results of the BIGL analysis of the cell line data with HSA as mean model calculated on the basis of the cellular metabolic activity using Cell Titer-Glo assay.
Bootstrap confidence intervals are indicated. Effect sizes and their confidence intervals are shown. Notably, each data point based on the p-value and sign of the respective maxR statistic with the size of the dots reflecting the degree of synergy or antagonism corresponding to graded scale. No significant average effect if zero is included in the interval.
Results A pairwise matrix combination of decitabine and Compound A4 in the absence or presence of venetoclax was evaluated in MOLM-13 (KMT2A-AF9; FLT3-ITD) and OCI-AML3 (NPM1c AML) cells using a 6-day CellTiter-Glo assay format. Notably, the combination of decitabine and Compound A4, with or without venetoclax, was synergistically cytotoxic in (KMT2A-AF9; FLT3-ITD) cells as reflected in the contour plots (FIG. 6A and FIG. 6B) and detailed below in Tables 22A and 22B, respectively.
Table 22A - Effect of Compound A4 in Combination with Decitabine on MOLM-13 Cell Proliferation.
-0.0237 -0.0274 -0.0185 -0.0029 -0.0014 Et 0577,11.015- p..n1 031 (-0_11436,11.11066) (-EL01 57,0_1111LN 0.01 3,14,0.
2 c -0.0156 -0.0637** -0.0463 -00109 41.0059 5- 10566,0.025d ).1007,41.0267) (-0.0706;0.022) (41.0228,0.0009) (41.0179,0.0062) -0.0232 -0.1574" -0.16 4" -0.0192 -0.0101 0.0569,0.0104 11879,-0.1268) (-0.1846,-(L1442) (-0.0305,-0.008) (-0.0219,0.0017) -0.0058 4/1435" -0.1783" -0.0211 -0.0107 0.1 0 0363,0024/ 11703,-0.1166) (-0.198,-0.1587) (-0.0323,-0.01) (-0.0224,0.001) Ø0041 -0.1694" -0.1895" -0.022 -0.0114 4.) 00328,0.0245 11932,-01456) (-02087,-0.1703) (-0.033,-0.0109) (-0.0231,0.0003) 0.0387 0.2" 0.1958" 0.0214 0.0116 0.0665,-0.010 -0.223,-0.177) (-02148,-01768) (-0.0325,-0.0102) (-0.0233,0.0001) Dedtablne (ph4) 0.0015 0.015 0.15 1.5 3 Note that absence of any asterisk indicates an additive effect, antagonism is indicated by * "
and synergy is indicated by ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
Table 22B - Effect of Compound A4 in Combination with Venetoclax and Decitabine on MOLM-13 Cell Proliferation.
0 001 -9.043 -0.0028 -0.0228 -0.0034 0.0004 .
(-0.139,0.053) (-0.0897,0.084) (4.0725,0.0269) (4.0297,0.0228) (-0.0272,0.028) 2 0.01 -0.0293 -0.0208 -0.0376 -0.0034 0.0904 =. (-0.1306,0.072) (-0.1067,0.0651) (-0.086,0.0107) (4.0296,0.0229) (-0.0273,0.028) Mt MO5 4.0059 -0.2397** -0.057 4.0037 -0.0001 <
(-0.0895,0.0778) (-0.3118,-0.1675) (-0.1035,-0.0104) (-0.0299,0.0224) (-0.0276,0.0275) *0 C 0.1 -0.0258 4.2477** -0.0607* -0.0036 -0.0003 0 (-0.0979,0.0462) (-0.3043,-0.1. .1) (41068,-0.0145) (4.0298,0.0226) (-0.0278,0.0272) _ E -0.0128 426** 4.0654** -0.0041 -0.0002 (-0.0835,0.0579 (-0.3178,-0 7077) (-0.1111,4)0197) (4.0307,0.07)) (41.0778,(10773) 10 -0.0363 -0.2876** -0.0676" -0.0039 -0.0003 (-0.1062,0.0336) (-0.339,4.2363) (41131,-0.0221) (-0.03,0.0223) (-0.0278,0.0273) Decitabine (pm) moan 0.015 0.15 1.5 3 Venetodax µ1.tM) 0.6..002 0.0002 0.002 0.02 0.2 Note that absence of any asterisk indicates an additive effect, antagonism is indicated by" * "
and synergy is indicated by" ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
Antagonistic effects in OCT-AML3 (NP1\41c AML) cells were observed at low doses of decitabine (15 n1V1), with or without venetoclax, as reflected in the contour plots (FIG. 7A and FIG. 7B) and detailed below in Tables 23A and 23B, respectively.
Table 23A - Effect of Compound A4 in Combination with Decitabine on OCI-AML3 Cell Proliferation.
r -0.0483 -0.0238 -0.0156 -0.024 -0.0127 0.001 (-0.1014,0.0047) (-0.0813,0.033: -0.065,0.0338) (4.0524,0.0043) (-0.0404,0.0151) 2 0.01 -0.0234 -0.1175** -0.038 40267 -0.0128 =_ (-0.0831,0.0364) (-0.1731,-0.06:
0.0869,0.0109) (-0.055,0.0015) (-0.0405,0.0149) .....
er 0.0136 0.0588 -0.0571 4.0258 -0.0136 < 0.05 (-0.0364,0.0636) (0.0078,0.109", ).1055,-0.0086) (-0.0541,0.0025) (-0.0413,0.0141) "0 = 0.0139 0.1279* -0.0603 -0.0228 -0.0136 = 0.1 0 (-0.0299,0.0576) (0.0814,0.174! ).1086,-0.0119) (-0.0512,0.0056) (-0.0413,0.0141) CL
E 0.0141 0.1688* -0.0504 -0.0246 -0.013 . (-0.0288;0.057) (0.122,0.2156 0.094,-0.0067) (-0.053,0.0037) (-0.04.07,0.0147) (...) __________________________________________________________ . _ 0.0288 0.1406* -0.0324 -0.018 -0.0114 (-0.0156,0.0734 (0.0934,0.1877) , 0.0767,0.012) (-0.0466,0_0106) (-0.0392,0.0163) - Dedtabine (niVT) 0.0015 0.015 0.15 1.5 3 Note that absence of any asterisk indicates an additive effect, antagonism is indicated by " * "
and synergy is indicated by" ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
Table 23B - Effect of Compound A4 in Combination with Venetoclax and Decitabine on OCT-AML3 Cell Proliferation.
t -0.0424 -0.0091 0.0094 -0.0239 -0.0114 0.001 10831,-0.0017) _ _ _ (-0.0527,0.0345) (-0.0278,0.0467) (-0.0485,0.0007) 1 (-0.0356,0.0128) +--2 c ! 0.0237 -0.0788 -0.0187 -0.023 -0.0127 8.0209,0.0683) (-0.1204,-0.0372) (-0.0555,0.0181) (-0.0476,0.0016) i (-0.0369,0.0115) V 0.0187 0.1041* -0.0351 -0.0224 -0.0118 04 ( 8.0182,0.0557) (0.0658,111424) (-0.0716,0.0014) (-0.047,0.0022) (41036,0.8124) C 0.0242 0.15' -0.0295 -0.0237 -0.0117 17 0.1 0. i-0.01,0_0584) (0.1137,0.1864) (-0.0662,0.0071) (-0.0483,0.0009) (-0.0359,0.0125) _ E 1 0.0362 0.2025* -0.0159 0.0222 -0.0109 a 3.0036,0.0689) (0.1668,0.2381) (-0.0476,0.0159) (-0.0468,0.0024) (-0.0352,0.0133) 0.06 0.1657* 0.005 4.0167 -0.0099 3.0257,0.0942) (0.1297,0.2018) (-0.0282,0.0382) (-0.0414,0.0081) (-0.0341,0.0144) i Decitabine (jiM) 0.0015 0.015 0.15 1.5 3 Venetaclax ( M) 0.00002 0.0002 0.002 0.02 0.2 Note that absence of any asterisk indicates an additive effect, antagonism is indicated by" * "
and synergy is indicated by " ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
ANALYTICAL METHODS
[0953] The analytical information in the compounds above or in the Tables below, was generated by using the analytical methods described below.
M1R-Methods [0954] Some NAIR experiments were carried out using a Bruker Avance III 400 spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with BBO
400MHz Si 5 mm probe head with z gradients and operating at 400 MI-lz for the proton and 100MHz for carbon. Chemical shifts (6) are reported in parts per million (ppm). J values are expressed in Hz.
[0955] Some NMR experiments were carried out using a Varian 400-MR
spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with Varian 400 4NUC PFG probe head with z gradients and operating at 400 MHz for the proton and 100MHz for carbon_ Chemical shifts (6) are reported in parts per million (ppm). J
values are expressed in Hz.
[0956] Some NMR experiments were carried out using a Varian 400-VNMRS
spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with Varian 400 ASW PFG probe head with z gradients and operating at 400 MHz for the proton and 100MHz for carbon. Chemical shifts (6) are reported in parts per million (ppm). J
values are expressed in Hz.
[0957] Some NMR experiments were carried out using a Bruker AVANCE III ETD 300 spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with PA BBO 300S1 BRF-1-1-D-05 7 5 mm probe head with z gradients and operating at 300 MHz for the proton and 75 MHz for carbon. Chemical shifts (d) are reported in parts per million (ppm). J values are expressed in Hz.
LCMS (Liquid chromatography/Mass õspectrometry) General procedure 109581 The High Performance Liquid Chromatography (HPLC) measurement was performed using a LC pump, a diode-array (DAD) or a UV detector and a column as specified in the respective methods. HPLC details are provided below in Table 3. If necessary, additional detectors were included (see Tables 3 and 4 below).
[0959] Flow from the column was brought to the Mass Spectrometer (MS) which was configured with an atmospheric pressure ion source. It is within the knowledge of the skilled person to set the tune parameters (e.g., scanning range, dwell time...) in order to obtain ions allowing the identification of the compound's nominal monoisotopic molecular weight (MW).
Data acquisition was performed with appropriate software.
[0960] Compounds are described by their experimental retention times (Rt) and ions. If not specified differently in the table of data, the reported molecular ion corresponds to the [M+H]+
(protonated molecule) and/or [M-H]- (deprotonated molecule). In case the compound was not directly ionizable the type of adduct is specified (i.e., [M+NH4] , [M+HC00]-, etc...). For molecules with multiple isotopic patterns (Br, Cl..), the reported value is the one obtained for the lowest isotope mass. All results were obtained with experimental uncertainties that are commonly associated with the method used.
[0961] Hereinafter, "SQD" means Single Quadrupole Detector, "RT- room temperature, "BEET' bridged ethylsiloxane/silica hybrid, "HS S" High Strength Silica, "DAD" Diode Array Detector.
Table 3 - LCMS Method Codes Flow Method Run Instrument Column Mobile phase Gradient code Column time 100%A was held for 1 min, A
Waters Mobile phase A: gradient from 100%A to 40%
0.8 XBridge H20 with A is applied in 4 min, and C18 0.04 % TFA; 40%A down to 15%A in 2.5 1 Agilent (2.0x50 mobile phase B: min. And then return to mm, 5 ACN with 100%A in 2 min and held for u M) 0.02 % TFA 0.5 min. The post time is 0.5 min.
First, 90% A was held for 0.8 Waters Mobile phase A:
min. Then a gradient was XBridge H20 with C18 0.04 % TFA;
applied to 20% A and 80% B 0.8 2 Agilent in 3.7 min and held for 3 min. ---- 10 (2.0x50 mobile phase B:
And then return to 90%A in 2 50 mm, 5 ACN with min and held for 0.5 min. The urn) 0.02 % TFA
post time is 0.5 min.
Time (min) A% 13%
Mobile phase A
XBridge 0.05% 95 5 1.5 0.05% TFA in Agilent LC C18, 4.6 H20 11.0 65 35 7 1260 with x150 13.0 5 95 Mobile phase B
MS6120 mm, 15.0 5 95 0.05 % TFA in 3.5 iõtrn 16.0 95 5 45 ACN
20.0 95 5 Flow expressed in mL/min; column temperature (T) in C; run time in minutes Analytical SFC
General procedure for SFC methods [0962] The SFC measurement was performed using an Analytical Supercritical fluid chromatography (SFC) system composed by a binary pump for delivering carbon dioxide (CO2) and modifier, an autosampler, a column oven, a diode array detector equipped with a high-pressure flow cell standing up to 400 bars. Analytical SFC details are provided below in Table 4. If configured with a Mass Spectrometer (MS) the flow from the column was brought to the (MS). It is within the knowledge of the skilled person to set the tune parameters (e.g., scanning range, dwell time...) in order to obtain ions allowing the identification of the compound's nominal monoisotopic molecular weight (MW). Data acquisition was performed with appropriate software.
Table 4 - Analytical SFC Details Run Method Flowtime column mobile phase gradient code Col T
RPR
Waters UPCC from 5% to 40% of with PDA A: Supercritical B in 4 min and 11 (Chiralpak IG-3 CO2 B: Et0II hold 40% for 2.5 100x4.6 mm (0.05% DEA) min, then 5% of B 35 1500 psi.
ID., 3 urn) for 1.5 min Flow expressed in mL/min; column temperature (T) in C; run time in minutes, Backpressure (BPR) in bars or pound-force per square inch (psi). "ACN- means acetonitrile;
"Me0H" means methanol; "Et0H" means ethanol; "DEA" means diethylamine. All other abbreviations used in Table 4 above are as defined before.
PHARMACOLOGICAL PART
1) Menin/1V1LL Homogenous Time-Resolved Fluorescence (HTRF) Assay [0963] To an untreated, white 384-well microtiter plate was added 40 nL 200X
test compound in DMSO and 4 itL 2X terbium chelate-labeled menin (vide infra for preparation) in assay buffer (40 mM Tris=HC1, pH 7.5, 50 mM NaC1, 1 mM DTT (dithiothreitol) and 0.05% Pluronic F-127). After incubation of test compound and terbium chelate-labeled menin for 30 min at ambient temperature, 4 uL 2X FITC-1VIBM1 peptide (FITC-I3-alanine-SARWRFPARPGT-NH2) ("FITC" means fluorescein isothiocyanate) in assay buffer was added, the microtiter plate centrifuged at 1000 rpm for 1 min and the assay mixtures incubated for 15 min at ambient temperature. The relative amount of meninTITC-MBM1 complex present in an assay mixture is determined by measuring the homogenous time-resolved fluorescence (HTRF) of the terbium/FITC donor /acceptor fluorophore pair using an EnVision microplate reader (ex. 337 nm/terbium em. 490 nm/FITC em. 520 nm) at ambient temperature. The degree of fluorescence resonance energy transfer (the HTRF value) is expressed as the ratio of the fluorescence emission intensities of the FITC and terbium fluorophores (Pm 520 nm/Fm 490 nm). The final concentrations of reagents in the binding assay are 200 pM terbium chelate-labeled menin, 75 nM FITC-1VIBM1 peptide and 0.5% DMSO in assay buffer. Dose-response titrations of test compounds are conducted using an 11 point, four-fold serial dilution scheme, starting typically at 10 itM.
[0964] Compound potencies were determined by first calculating % inhibition at each compound concentration according to equation 1:
% inhibition = ((HC - LC) - (HTRFcompound LC)) / (HC - LC)) *100 (Eqn 1) where LC and HC are the HTRF values of the assay in the presence or absence of a saturating concentration of a compound that competes with FITC-MBM1 for binding to menin, and HTRFenmP"nd is the measured HTRF value in the presence of the test compound.
HC and LC
HTRF values represent an average of at least 10 replicates per plate. For each test compound, %
inhibition values were plotted vs. the logarithm of the test compound concentration, and the 1C'50 value derived from fitting these data to equation 2:
% inhibition = Bottom + (Top -B ottom)/(1+10^((log/C50-log [cm pd]) * h)) (Eqn 2) where Bottom and Top are the lower and upper asymptotes of the dose-response curve, respectively, /C50 is the concentration of compound that yields 50% inhibition of signal and h is the Hill coefficient.
[0965] Preparation of Terbium cryptate labeling of Menin: Menin (a.a 1-610-6xhis tag, 2.3 mg/mL in 20mM Hepes (2-[4-(2-Hydroxyethyl)-1-piperazinyl]ethane sulfonic acid), 80 mM
NaCl, 5mM DTT (Dithiothreitol), pH 7.5) was labeled with terbium cryptate as follows. 200 ug of Menin was buffer exchanged into lx Hepes buffer. 6.67 uM Menin was incubated with 8-fold molar excess NHS (N-hydroxysuccinimide)-terbium cryptate for 40 minutes at room temperature. Half of the labeled protein was purified away from free label by running the reaction over a NAPS column with elution buffer (0.1M Hepes, pH 7 + 0.1% BSA
(bovine serum albumin)). The other half was eluted with 0.1M phosphate buffered saline (PBS), pH7.
400 ul of eluent was collected for each, aliquoted and frozen at -80 C. The final concentration of terbium-labeled Menin protein was 115 ug/mL in Hepes buffer and 85 itg/mL
in PBS buffer, respectively.
MENIN Protein Sequence (SEO ID NO: I):
[0966] MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRV
DVHLALSEDHAWVVF GPNGEQ TAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKG
SYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALG
NLADLEELEP TP GRPDPL TLYHKGIA S AK T YYRDEHIYP YMYLAGYH CRNRNVREAL
QAWAD TATVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAA SLLEAGEERP GEQ SQ
GT Q S Q GS ALQDPECF AHLLRF YDGICKWEEGSP TPVLHVGWATFLVQ SLGRFEGQVR
QKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPEEPPPPKKPALDKGLGTGQG
AVS GPPRKPP GT VAGTARGPEGGS TAQVPAPAA SPPPEGPVLTF Q SEKMKGMKELLV
2a) Proliferation Assay [0967] The anti-proliferative effect of menin/MLL protein/protein interaction inhibitor test compounds was assessed in human leukemia cell lines. The cell line MOLM-14 harbors a MILL
translocation and expresses the WILL fusion protein MILL-AF9, respectively, as well as the wildtype protein from the second allele. OCI-AMIL3 cells that carry the NPM1c gene mutation were also tested. MILL rearranged cell lines (e.g., MOLM-14) and NPM1c mutated cell lines exhibit stem cell-like elevated HOXA/MEIS1 gene expression signatures. KO-52 was used as a control cell line containing two MLL (KIVIT2A) wildtype alleles in order to exclude compounds that display general cytotoxic effects.
[0968] MOLM-14 cells were cultured in RPM1-1640 (Sigma Aldrich) supplemented with 10%
heat-inactivated fetal bovine serum (HyClone), 2 mM L-glutamine (Sigma Aldrich) and 50 g/m1 gentamycin (Gibco). KO-52 and OCI-AML3 cell lines were propagated in alpha-MEM (Sigma Aldrich) supplemented with 20% heat-inactivated fetal bovine serum (HyClone), 2 mM L-glutamine (Sigma Aldrich) and 50 j.i.g/m1 gentamycin (Gibco). Cells were kept at 0.3 ¨ 2.5 million cells per ml during culturing and passage numbers did not exceed 20.
[0969] In order to assess the anti-proliferative effects, 200 MOLM-14 cells, cells or 300 KO-52 cells were seeded in 200 p1 media per well in 96-well round bottom, ultra-low attachment plates (Costar, catalogue number 7007). Cell seeding numbers were chosen based on growth curves to ensure linear growth throughout the experiment. Test compounds were added at different concentrations and the DMSO content was normalized to 0.3%. Cells were incubated for 8 days at 37 C and 5% CO2. Spheroid like growth was measured in real-time by live-cell imaging (IncuCyteZOOM, Essenbio, 4x objective) acquiring images at day 8.
Confluence (%) as a measure of spheroid size was determined using an integrated analysis tool.
[0970] In order to determine the effect of the test compounds over time, the confluence in each well as a measure of spheroid size, was calculated. Confluence of the highest dose of a reference compound was used as baseline for the LC (Low control) and the confluence of DMSO treated cells was used as 0% cytotoxicity (High Control, HC).
[0971] Absolute IC50 values were calculated as percent change in confluence as follows:
LC = Low Control: cells treated with e.g., I i_tM of the cytotoxic agent staurosporin, or e.g., cells treated with a high concentration of an alternative reference compound;
HC = High Control: Mean confluence (%) (DMSO treated cells);
% Effect = 100 - (100*(Sample-LC)/(HC-LC)); and GraphPad Prism (version 7.00) was used to calculate the IC50. Dose-response equation was used for the plot of % Effect vs Log10 compound concentration with a variable slope and fixing the maximum to 100% and the minimum to 0%.
2b) MEISI niRNA Expression Assay [0972] MEIS1 mRNA expression upon treatment of compound was examined by Quantigene Singleplex assay (Thermo Fisher Scientific). This technology allows for direct quantification of mRNA targets using probes hybridizing to defined target sequences of interest and the signal is detected using a Multimode plate reader Envision (PerkinElmer). The MOLM-14 cell line was used for this experiment. Cells were plated in 96-well plates at 3,750 cells/well in the presence of increasing concentrations of compounds. After incubation of 48 hours with compounds, cells were lysed in lysis buffer and incubated for 45 minutes at 55 C. Cell lysates were mixed with human ATEIS1 specific capture probe or human RPL28 (Ribosomal Protein L28) specific probe as a normalization control, as well as blocking probes.
Cell lysates were then transferred to the custom assay hybridization plate (Thermo Fisher Scientific) and incubated for 18 to 22 hours at 55 C. Subsequently, plates were washed to remove unbound materials followed by sequential addition of preamplifiers, amplifiers, and label probe. Signals (= gene counts) were measured with a Multimode plate reader Envision. IC5os were calculated by dose-response modelling using appropriate software. For all non-housekeeper genes response equal counts corrected for background and relative expression. For each sample, each test gene signal (background subtracted) was divided by the normalization gene signal (RPL28:
background subtracted). Fold changes were calculated by dividing the normalized values for the treated samples by the normalized values for the DMSO treated sample. Fold changes of each target gene were used for the calculation of IC5(is.
109731 The results are summarized below in Table 5.
Table 5 - Biological data ¨ HTRF, Proliferation and MEIS1 mRNA Expression Assays HTRF- MEIS1 spheroid OCI- spheroid Compound 30min ICso assay_OneTime AML3 assay_OneTime Number incubation (pM) MOLM-14 ICso ICso KO-52 ICso IC50 (nM) (PM) (p1M) (PM) 11 0.11 0.018 0.021 0.21 8.38 A 0.09 0.02 0.021 0.091 6.85 A3 0.098 0.017 0.017 0.12 7.75 Al 0.18 0.017 0.011 0.08 3) Mouse PK (In vivo T y? and oral bioavailahility) [0974] In vivo pharmacokinetics (PK) were assessed in fasted male CD-1 mice (age 6-8 weeks) following a single intravenous (IV, 0.5 or 1.0 mg/kg administered at 2.5 ml/kg) or oral (PO, 5 mg/kg administered at 10 ml solution/kg) dose of test article formulated in a 20% (w:vol) HP-I3-CD solution or in Pyrogen free water.
[0975] Plasma and/or whole blood samples were collected from the dorsal metatarsal vein at desired timepoints via serial capillary microsampling (approx. 0.03 mL) using EDTA as an anticoagulant. Concentrations of compound in the plasma and blood samples were analyzed using a qualified LC-MS/MS method. In silico analysis of main pharmacokinetic parameters was performed using WinNonlin (PhoenixTM, version 6.1) or similar software.) 4) Metabolic Stability in Human/Mouse Liver Microsomes Experimental Procedure [0976] The objective of this study is to measure in vitro metabolic stability of test compound(s) in human and mouse liver microsomes and provide quantitative information on the rate of metabolic turnover (i e , determination of the apparent intrinsic clearance of test).
[0977] Test items were prepared at a stock concentration of 10 mM in DMSO. For determination of metabolic turnover, a final working solution was prepared by adding 2 pL of mM DMSO stock solution for test compound or positive control compounds to 198 pL, of acetonitrile (100 p..M final concentration).
[0978] Incubations were performed as follows: First, liver microsomes were thawed on ice and a master solution containing liver microsomes in 100 mM PBS (phosphate-buffered saline) at pH 7.4 is prepared. Next, the liver microsomes solution was added to the incubation plates and 10 mM NADPH (Nicotinamide-adenine dinucleotide phosphate) was added (MW: 833.4 g/mol;
Roche Diagnostics GmbH, Germany. Dissolved in phosphate buffer (100 mmol/L, pH
7.4)).
The mixture was mixed for 10 seconds and pre-warmed in the incubation plate at 37 C for 10 minutes. The metabolic reaction was initiated with the addition of 5 pL of the 100 WV working solution for test compound or positive control compounds to incubation plate (final test item concentration = 1 p.M). The reaction final mixture should contain 1 mM NADPH, 0.5 mg/mL
microsomes protein and 1 [TM test compound or positive control compound in 100 mM PBS at pH 7.4. The percentage of organic solvent in incubation mixture is 1% with DMSO 0.02%.
[0979] The reaction was quenched by transferring 50 ML of the incubated mixture at selected time points into the quenching plate containing 200 p.1_, of cold methanol.
After sampling of all the timepoints the quenching plate was centrifuged at 4000 rpm for 40 minutes to precipitate protein. A total of 90 [IL of the supernatant was transferred to an analysis plate and ultra-pure H20 water is added into each well for LC/MS/MS analysis. All incubations and analysis were performed in duplicate.
Data analysis [0980] All calculations were carried out using Microsoft Excel. The slope value, k, was determined by linear regression of the natural logarithm of the remaining percentage of the parent drug vs. incubation time curve. The results are summarized below in Table 6.
[0981] The in vitro half-life (in vitro ti/2) was determined from the slope value:
in vitro t1i2= - (0.693 / k) Conversion of the in vitro t1/2 (in min) into the in vitro intrinsic clearance (in vitro CLint, in L/min/mg proteins) was done using the following equation:
0.693 volume of incubation (4) in vitro Clint_ = ( ______________________ ) * _____________________ ti amount of proteins (mg) Table 6 - Mouse PK and Metabolic Stability In vivo Bio- Human LM Mouse LM
Example Formulating T1/2 availability Clint Clint number agent (IV) (PO) (%) i/mg) ( 1/m in/m g) (h) A HP-13-CD 6.7 17 19 <7.5 Pyrogen free A3 9.0 34 19 <7.5 water 11 HP-f3-CD NA NA 14 <7.5 "NA" means not analyzed 5) Protocol JOT Pharmacodynamics (PI)) Activity in Subcutaneous (sc or SC) Xenografts of1VIOL11/1-14 or OCI-Alt/IL3 Cells Test Agents and Controls [0982] Compound A3 was formulated in 20% hydroxypropyl-beta-cyclodextrin (HP-I3-CD) and prepared to reach a total volume of 0.2 mL (10 mL/kg) per dose for a 20 g animal. Doses were adjusted by individual body weight each day. Working stocks of Compound A3 were prepared once per week for each study and stored at room temperature. Compound A3 was administered orally (PO), daily.
Assay 109831 The in vivo pharmacodynamics (PD) activity of compounds was evaluated in subcutaneous (SC) xenografts of MOLM-14 cells or OCI-AML3 cells. Nude NMIRI
mice (Crl:NMIRI-Foxn lnu/-) harboring MOLM-14 or OCI-AML3 tumors were treated with 3 daily doses of vehicle or compounds. Plasma samples were collected at 23 hours after day 2 dose, 0.5 hours post final dose, and 16 hours post final dose and tumor samples were collected 16 hours post final dose. To examine the effects of compounds on the expression of multiple Menin-KMT2A target genes (e.g., MEISI, MEF2C, FLT3) QuantiGene Plex technology (Thermo Fisher Scientific) was used. Frozen tumors were homogenized and transferred to individual lysing matrix tubes in lysis buffer and incubated for 30 minutes at 55 C. Cell lysates were mixed with target-specific capture probes, Luminex beads, and blocking probes, transferred to the custom assay hybridization plate (Thermo Fisher Scientific) and incubated for 18 to 22 hours at 54 C. Subsequently, plates were transferred to a magnetic separation plate and washed to remove unbound materials from beads followed by sequential hybridization of preamplifiers, amplifiers, and label probe and subsequent streptavidin phycoerythrin binding.
Signals from the beads were measured with a Luminex FlexMap three-dimensional instrument.
For all non-housekeeper genes response equal counts corrected for background and relative expression. For each sample, each test gene signal (background subtracted) was divided by the normalization gene signal (RPL19, RPL28, ATP6V1A: background subtracted). Fold changes were calculated by dividing the normalized values for the treated samples by the normalized values for the DMSO treated sample. The results are summarized below in Tables 7 and 8.
Table 7 - Expression Level (% relative to vehicle) of Selected Genes from MOLM-14 SC Model (mean values and standard deviations) Compound A3 (mg/kg) MEIS1 FLT3 MEF2C
0 101.30 + 15.06 104.80 + 10.07 103.50 +
11.02 3 83.49 + 25.48 78.67 + 20.74 85.50 +
22.77 62.84 + 4.06 74.91 + 8.97 68.04 + 14.43 30 23.16 + 2.75 52.61 + 4.51 27.83 2.17 50 14.40 + 3.39 36.14 + 3.50 18.75 +
2.38 100 10.97 + 3.21 35.82 + 1.10 14.18 +
1.56 Table 8 - Expression Level (% relative to vehicle) of Selected Genes from OCI-AML3 SC Model (mean values and standard deviations).
Compound A3 (mg/kg) MEIS1 0 100.30 8.53 3 87.90 + 39.75 48.81 15.30 30 32.66 + 3.71 50 23.83 1.34 100 16.76 1.92 [0984] Tables 7a and 8a show median values based on repeated experiments in optimized conditions with fresh tumor samples.
Table 7a - Expression level ("A relative to vehicle) of selected genes from model (Median values and Standard Deviations).
Compound A3 (mg/kg) MEIS1 FLT3 MEF2C
0 100.0 + 13.5 100.0 + 10.1 100.0 + 11.0 3 83.7 22.8 89.2 20.7 87.7 + 22.8 10 49.3 + 5.9 79.8 + 9.0 64.6 + 14.4 30 14.7 3.9 54.5 4.5 28.8 22 50 4.7 1.1 37.6 3.5 18.8 2.4 100 3.3 + 1.4 35.4 + 1.1 13.6 + 1.6 Table 8a - Expression level ("/0 relative to vehicle) of selected gene from model (Median values and Standard Deviations).
Compound A3 (mg/kg) MEIS1 0 100.0 11.2 3 71.2 15.1 10 26.5 + 4.3 30 25.1 11.2 50 8.5 2.2 100 9.4 1.2 6) Efficacy Study in MOLM-121 Subcutaneous Model Test Agents and Controls [0985] Compound A3 was formulated in 20% hydroxypropyl-beta-cyclodextrin (HIP-13-CD) and prepared to reach a total volume of 0.2 mL (10 mL/kg) per dose for a 20 g animal. Doses were adjusted by individual body weight each day. Working stocks of Compound A3 were prepared once per week for each study and stored at 25 C.
Animals [0986] Female MARI Nude mice (MOLM-14 SC) were used when they were approximately 6 to 8 weeks of age and weighed approximately 25 g. All animals could acclimate and recover from any shipping-related stress for a minimum of 7 days prior to experimental use. Autoclaved water and irradiated food were provided ad libitum, and the animals were maintained on a 12 hour light and dark cycle. Cages, bedding, and water bottles were autoclaved before use and changed weekly. Further details are provided below in Table 9.
Table 9 - Tissue Culture and Cell Injection Reagents DPBS (Dulbecco's phosphate-buffered saline) Heat-inactivated fetal bovine serum RPMI 1640 medium L-glutamine Gentamycin T175 Culture Flask Roller Bottle Tumor Model and Cell Culture Method [0987] Human AML MOLM-14 cells were cultured at 37 C, 5% CO2 in the indicated complete culture media (RPMI 1640 + 10% HI-FBS + 2mM L-glutamine + 50ug/m1 Gentamycin ). Cells were harvested while in logarithmic growth and resuspended in cold (4 C) Roswell Park Memorial Institute (RPMI) 1640 in serum-free medium.
[0988] Each mouse received 5 x106 MOLM-14 cells in 50% Matrigel in the right flank, in a total volume of 0.2 mL using a lcc syringe and a 27-gauge needle.
Study Designs [0989] Compound A3 was administered orally (PO), daily.
[0990] Day 0 is the day of tumor cell implantation and study initiation.
[0991] Mice bearing SC MOLM-14 tumors were randomized on Day 16 post-tumor implantation and assigned to treatment groups according to tumor volume (mean of ¨130 mm3;
n-10/group). Treatment with vehicle or Compound A3 (at 30 and 100 mg/kg) was initiated on the same day, with daily oral dosing for 21 days. Plasma was collected at 1, 2, 4, 8, and 23 hours after the last dose (n=4-5/group/time point) for PK (pharmacokinetics) analysis.
Animal Monitoring [0992] SC tumor volume was measured for each animal 2 to 3 times per week or more throughout the study.
Calculations [0993] Tumor volume was calculated using the formula:
Tumor volume (mm3) = (Dxd2/2); where 'ID' represents the larger diameter and d' the smaller diameter of the tumor as determined by caliper measurements. Tumor volume data was graphed as the mean tumor volume SEM.
[0994] The % ATGI was defined as the difference between mean tumor burden of the treatment and control groups, calculated as % ATGI = ([(TVeTVco)(TVITVio)]/(TVc TVco))x 100 where `I'Ve' is the mean tumor burden of a given control group, TVco' is the mean initial tumor burden of a given control group, 'TV' is the mean tumor burden of the treatment group, and `TVto' is the mean initial tumor burden of the treatment group. % TGI was defined as the difference between.
[0995] Mean tumor volumes of the treated and control groups, calculated as:
% TGI = ((TV:IVO/TN/) x100 where 'TV: is the mean tumor volume of the control group and TVt' is the mean tumor volume of the treatment group. As defined by National Cancer Institute criteria, >60% TGI is considered biologically significant.
[0996] The % Tumor Regression (TR), quantified to reflect the treatment-related reduction of tumor volume as compared to baseline independent of the control group, was calculated as %TR= (1-mean (TVti/TVtoi)) x 100 where `I'Vti' is the tumor burden of individual animals in a treatment group, and TVtoi' is the initial tumor burden of the animal.
Data Analysis [0997] Tumor volumes were graphed using Prism software (GraphPad version 7 or 8).
Statistical significance for most studies was evaluated for Compound A3-treated groups compared with HPI3CD vehicle-treated controls on the last day of the study when 2/3 or more mice remained in each group. Differences between groups were considered significant when p<0.05.
[0998] Statistical significance for animal tumor volume was calculated using the linear mixed-effects (LME) analysis in R software version 3.4.2 (using Janssen' s internally developed Shiny application version 4.0), with treatment and time as fixed effects and animal as random effect.
Logarithmic transformation was performed if individual longitudinal response trajectories were not linear.
[0999] The information derived from this model was used to make pairwise treatment comparisons of tumor volumes to that of the control group or between all the treatment groups.
The results are shown in FIG. 2.
7) Cardio-Electrophysiological Effects of the Testing Compounds in Synchronously Beating Human Pluripotent Stem Cell-Derived Cardionlyocytes (hSC-CMs) Using a Ca2+ -Fluorescence Assay (CTCM human) Protocol [1000] Compounds were tested in the 96-well plates.
[1001] Compounds were tested at 0.1 tiM, 0.2 tiM, 0.5 laM, 1 laM, 2.5 laM and 5 laM (n = 4 per dose) on Cor.4U 0-Cardiomyocytes or on iCell Cardiomyocytes2.
[1002] Alternatively, compounds were tested at 0.1 M, 0.3 M; 1 jiM, 3 p.M,10 p.M and 30 [tM (n = 4 per dose) mostly on iCell Cardiomyocytes2.
[1003] Positive and Negative controls Dofetilide at 3 nM
lsoproterenol at 100 nM
Nimodipine at 100-300 nM
Cetirizine at 3 1.1.M.
Vehicle control: Dimethylsulfoxide (DMSO). The solutions of the compound in DMSO or its solvent (final concentration of 0.1% DMSO; n = 8).
Preparation of Test Article and Controls [1004] Tested compounds were dissolved in DMSO at 1000-fold the intended concentrations.
A compound "mother-plate" was made, containing the test compounds and positive and negative controls at 1000-fold the final concentrations. At the experiment day, these stock solutions were diluted with Tyrode (Sigma), supplemented with 10 mM HEPES
(Gibco), to 2-fold the intended concentration (in round bottom compound plates). Final DMSO
concentration in test solutions and vehicle control was 0.1%.
Cells [1005] hSC-CMs (Cor.4U Cardiomyocytes) were obtained from CDI (Ncardia, Germany).
Cells are pre-plated and seeded in fibronectin-coated 96-well plates at a density suited to form a monolayer and maintained in culture in a stage incubator (37 C, 5% CO2), according to the instructions of the cell provider.
[1006] Second line hSC derived cardiomyocyte called iCelle Cardiomyocytes2 were purchased from FUJIFILM Cellular Dynamics (USA). The experiments with test drugs are carried out 5 to 7 days after plating the cells onto the plate to have a living, beating monolayer of hiPSC-derived cardiomyocytes. The beating monolayer in 96-well-plates are normally taken from 2 Vials of frozen iCelle Cardiomyocytes2 (--z5 million cells/vial), which will be plated onto three 96-well plates (50K/well).
Before Start of Experiment [1007] At least one hour before the start of the experiments the normal cell medium was replaced with Tyrode solution with Calcium dye (see below).
[1008] Cal 520 dye (AAT Bioquest) was dissolved in 11 ml of Tyrode supplemented with 10 mM HEPES and warmed up to 37 C before adding to the cells.
[1009] 35 ul cell culture medium was removed from each well and replaced with 35 [11 of pre-warmed Cal 520 dye solution and cell plate was incubated for 45 min at 37 C /
5% CO2. Cells were incubated for 5 min at 37 C.
Experiment [1010] Spontaneous electrical activity is recorded, using Cal520TM (AAT
Bioquest) calcium fluorescence-dye signalling. This dye integrates the total intracellular calcium activity over the whole well. A bottle of Ca1520 dye (50 g, MW: 1103/mol) is dissolved with 50 ul DMSO as a stock solution of 0.9 mM. 50 ML of the stock solution of the dye was added to 10 ml Tryodes solution to have dye concentration of 4.5 uM. Subsequently, 35 Ml of this dye solution was added into each well, to have a final dye concentration of 1.58 MM. The current dye protocol on this CTCM human assay was established recently (Ivan Kopljar et al, Journal of Pharmacological and toxicological methods 2018. 91: 80-86; Lu et al., Tox Sci 2019. 170 (2):
345-356).
[1011] Fluorescent signals (Ca2 transient morphology) were measured using the Functional Drug Screen System (FDSS/pCell; Hamamatsu, Japan) and the recordings were subsequently analyzed off-line, using appropriate software e.g., Notocord.
[1012] The cell plate was loaded into the FDSS/pCell for a test run: Ca2+
transients were measured for 4 minutes to check for synchronous beating of the cardiomyocytes in each well.
All 96 wells were measured simultaneously (sampling interval: 0.06 s, short exposure time: 10 ms; excitation wavelength 480 nm; emission wavelength 540 nm; FDSS/uCell warmed to 37 C).
When all showed synchronous beating, the 96-well plate was measured repeatedly for 3 times (to verify synchronous beating in all 96-well at baseline, wells that did not meet the preset criteria were excluded from the study and not treated with compound):
T = 0: control period (-5 to -1 min) + compound addition, followed for 3 min.
T ¨ 30: measured from 29 to 34 min after compound addition [1013] During the compound addition step, 100 jul of the respective double-concentrated test solutions was pipetted into each well simultaneously.
[1014] Data were analyzed off-line using appropriate software e.g., Notocord-Hem (version 4.3).
[1015] The following parameters of the Ca2+ transient morphology were measured:
- beat rate (BR) - amplitude of the Ca" transient (Amp), - CTD90: Ca2+ transient duration at 90% (time to 90% of the initial base value) [1016] The presence of various 'arrhythmia-like' activities were also noted during the experimental periods. These included:
= 'early afterdepolarization-like' (EAD-like) events (defined as "an extra small peak of the transient waveform following the initial peak of the transient"), = 'ventricular tachycardia-like' (VT-like) events (defined as a very fast beating rate) or = 'ventricular fibrillation-like' (VF -like) events (defined as "small amplitude, fast-rate Ca' waveforms with irregularities and non-measurable transient potentials) = 'cessation of beating' of the cells (no Ca2+ transients observed).
If compound-induced changes on the calcium transient signal could not be analyzed by the software, then these signals were identified as BQL (below quality analyses level).
Data Analysis [1017] Data, measured from the FDSS- Cell, were copied for off-line analysis and were analyzed and uploaded in SPEC-II (our operational management system) for further analysis.
The values of the variables before and after administration of the compound were collected and transferred into an Excel workbook.
[1018] All values (actual units and percentage changes from the baseline values) are expressed as median (minimum and maximum). Changes versus the corresponding baseline values (in actual units) observed in the compound group were compared with those in the solvent control group using the Wilcoxon-Mann-Whitney Test. Two-tailed tests with Bonferroni correction for multiplicity adjustment were conducted. Since there are 10 treatment groups each compared to the solvent group, alpha level of 0.05/10 (0.005) was considered to reflect a statistically significant difference from the solvent group. All statistical analysis was performed using appropriate software e.g., R software version 3.5.2.
[1019] Quality Control of the hiPSC-CMs in the plate:
Plates were rejected if they did not meet following criteria:
- Stable regular beating - Amplitude > 500 relative units - Beat rate between 25 and 80 beats per minute - CTD90 between 300 and 800 ms.
[1020] In the present study, the hiPSC-CMs in the plates met the above criteria.
[1021] These parameters combined with incidence of arrhythmia or cessation of beating were used to calculate the potential hazard level using a weighted scoring method (based on Kopljar et al., Stem Cell Reports 2018. 11, 1365-1377). This hazard score is calculated per concentration by adding weighted points based on the Tolerance Intervals (TI) on the changes of CTD90, the beat rate and amplitude (AA%) and incidence of beating stop and early afterdepolarization (EAD). Consequently, for each concentration one of four different hazard levels will be generated. This will be done after 30-min of incubated with compound. The hazard levels are:
No hazard: within the vehicle effect levels or small non-relevant changes.
Low hazard: relevant effect but potentially low risk for cardiac liabilities.
High hazard: relative high risk for cardiac liabilities.
Very high hazard: very high risk due to arrhythmic like events (EAD' s).
[1022] The 'Hazard Score' results provide an identification for potential acute cardiac drug-induced effects at free drug equivalent (as no plasma proteins are added to the wells).
Evaluation of hazard identification is conducted using a 'scoring reference book' called CTCM Scoring version 1 (Kopljar et al., Stem Cell Reports 2018. 11: 1365-1377), and levels are indicated according to the following color scheme of Table 10.
Table 10 ¨ Color Schemes of Hazardous Identification Legend Green No concern Yellow Low concern Red High concern Black Very high concern due to arrhythmic events Ranking of a testing compound according to hazard score severity on the Ca' transient assay measured in HiPSc-CMs as listed above in different colors and in the associated table.
RESULTS
Using iCell Cardiomyocytes2 as cell line [1023] Positive and negative controls: The positive and negative controls all had expected pharmacological effects in this assay. The results are summarized below in Tables 11 and 12.
Table 11 ¨ Hazard Scoring for Compound A3 rnpoun Co d Color @ Color @ Color @ Color @ Color @ Color @
0.1 uM 0.21.tM 0.51.tM luM 2.5 M
luM
A3 Green Green Green Green Green Green Table 12 ¨ Hazard Scoring for Compounds Al and 11 Compound Color @ Color @ Color .0/ Color @ Color @ Color @
0.1 uM 0.3 M luM 3 pM 10 MM
30pM
Al Green Green Green Green Green yellow 11 Green Green Green Green Green Green [1024] For Compound Al: with an efficacious dose in mouse xenograft models of 30 mg/kg, CTCM human concentration vs free Cmax would be estimated as follows:
Margin CTCM human 10 MM vs free Cmax >16 (mouse, human) Margin CTCM human 30 MM vs free Cmax >45 (mouse, human).
8) Effect on the Membrane Potassium Current 'Kr in hERG Transfected Cell Lines [1025] Protocol 1:
Abbreviations CHO Chinese hamster ovary cell line DMSO Dimethylsulfoxide hERG human ether-a-go-go-related gene rapidly activating delayed-rectifier I( current Methods [1026] Experiments were performed using CHO cells stably expressing the hERG
potassium channel. Cells were grown at 37 C and 5% CO2 in culture flasks in Ham's F12 Medium supplemented with 10% heat-inactivated fetal calf serum, hygromycin B (100 p.g/m1) and geneticin (100 pg/m1). For use in the automated patch-clamp system QPatch (Sophion) cells were harvested to obtain cell suspension of single cells.
[1027] Solutions: The bath solution contained (in mM) 145 NaCl, 4 KC1, 10 glucose, 10 HEPES ((4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid), 2 CaCl2 and 1 MgCl2 (pH 7.4 with NaOH). The pipette solution contained (in mM) 120 KC1, 10 EGTA (Ethylene glycol-bis(2-aminoethylether)-N,N,N,N-tetraacetic acid), 10 HEPES, 5.374 CaC12 and 1.75 MgCl2 (pH 7.2 with KOH).
[1028] Patch-clamp experiments were performed in the voltage-clamp mode and whole-cell currents were recorded with an automated patch-clamp assay utilizing the QPatch system (Sophion). Current signals were amplified and digitized, stored and analyzed by using the QPatch assay software.
[1029] The holding potential was -80 mV. The hERG current (Ktselective outward current) was determined as the maximal tail current at -40 mV after a 2 second depolarization to +60 mV. Pulse cycling rate was 15 s. A short pulse (90 ms) to -40 mV served as a baseline step to calculate the tail current amplitude. After establishing whole-cell configuration and a stability period, the solvent control (0.3% DMSO) was applied for 5 minutes followed by the test substance by four increasing concentrations of 3 x 10-7 M, 3 x 10' M, 10-5 M
and 3 x 10-5 M.
Each concentration of the test substance was applied twice. The effect of each concentration was determined after 5 min as an average current of 3 sequential voltage pulses. To determine the extent of block the residual current was compared with vehicle pre-treatment.
[1030] Concentration/response relations were calculated by non-linear least-squares fits to the individual data points. The half-maximal inhibiting concentration (IC50) was calculated by the fitting routine.
[1031] Protocol 2:
Cells [1032] The compound, vehicle control and positive control were tested on hERG-transfected EfEK293 cells. A human embryonic kidney cell line (FIEK293) with a stable transfection of hERG (Zhou Z et al. Biophysical Journal 1998. 74, 230-241; McDonald T.V.et al, Nature 1997.
388, 289-292) was used (University of Wisconsin, Madison, USA). The cells were kept in culture inlMEM (Minimum Essential Medium, Gibco) which was supplemented with (amounts indicated added to 500 ml 1MEM): 5 ml L-Glutamine-Penicillin-Streptomycin (Sigma), 50 ml Fetal Bovine serum (Bio-Whittaker), 5 ml Non-essential Amino Acids 100x (Gibco), 5 ml sodium pyruvate 100 mM (Gibco) and 4 ml geneticin 50 mg/ml (Gibco) using T175 flasks. The cells were incubated at 37 C in 5% CO2 atmosphere (in air).
Cell Harvesting for Assay [1033] Cells were harvested as described below using accumaxTM (Sigma) as the dissociating reagent. Cells were then resuspended in a mixture of 33% DMEM/F12 (Dulbecco's Modified Eagle Medium/Nutrient Mixture F-12 - Sigma) media/67% extracellular physiological solution.
[1034] The flasks were washed twice carefully with ¨5-10 ml phosphate buffered saline (PBS) (GibcoTM) containing 2mM EDTA (Ethylenediaminetetraacetic acid) (Sigma). The cells were dissociated using ¨3 ml of accumaxTM (cell detachment solution) and incubated for ¨5 to 10 min. at 37 C. Cold external physiological solution (2-5 ml) was added and the flasks are incubated at ¨4 C for 5-10 min. Then, the cell suspension in each flask was gently dissociated with a 5m1 pipette. The cell suspension was transferred to a low binding petri-dish (-10 mm diameter). Each flask was washed with ¨ additional 5 ml cold external physiological solution and this solution was also added to the petri-dish. The petri-dish was then incubated for another to 10 minutes at ¨4 C. After another gentle dissociation of the cell suspension in the petri dish, the cells were transferred to a reservoir kept on an orbital shaker at 200 rpm at 16 C.
Before experiments were performed, the cells recovered for ¨20 min.
Compounds [1035] A 10 mM solution of the compound was used and plated in a 384 well plate. Aliquots of the stock solutions are diluted with the recording solution using automated liquid handling (Biomek FXP; final DMSO concentration: 0.03 to 0.3 %). A standard range of screening concentrations was used ranging from 1 uM to 30 uM.
[1036] A positive control (E-4031) was included within each run to evaluate the sensitivity of the assay. Table 13 summarizes the external and intracellular solutions used in the experiments.
In Table 13, the composition of the intracellular and external buffer solutions is shown in [mM]
and "NIVIDG" means N-methyl-D-glucamine.
Table 13 - External and Intracellular Solutions Extracellular Intracellular Physiological Seal Enhancer Recording Solution Solution Solution / Chip Fill Solution Solution KC1 10 NaCl 140 NMDG 60 NMDG 60 KF 110 KCl 4 NaCl 80 NaCl 80 NaCl 10 Glucose 5 KC1 4 KC1 4 HEPES 10 HEPE S 10 CaCl2 10 CaCl2 2 EGTA 10 CaCl2 2 MgCl2 1 MgCl2 1 MgCl2 1 Glucose 5 Glucose 5 pH 7.2 (KOH) pH 7.4 NaOH)( pH 7.4 (HCL) pH 7.4 (HCL) Study Design [1037] The whole cell patch clamp technique on transfected cells allows the study of ion-channels with no - or limited interference from other ion-channels. The effects of the compounds on the hERG current were studied with an automated planar patch clamp system, SyncroPatch 384PE (Obergrussberger et al, Journal of Laboratory Automation 2016. 21 (6), 779-793). All cells were recorded in the whole cell mode of the patch clamp technique. The module is incorporated in a liquid handling pipetting robot system, Biomek FXP, for application of cells and compounds, vehicle control and positive control.
[1038] The different concentrations of the compounds were applied in two cumulatively increasing concentrations for the compounds (1 M and 10 M, and 3 MM and 30 MM, respectively). The hERG current was determined as the maximal tail current at -30 mV and percent inhibition upon compound or vehicle and positive control addition was reported.
[1039] After cells are caught onto the individual holes of the recording chips using the chip fill solution, the seal is increased with the seal enhancer solution (increased [Ca2]; then the cells were washed twice with recording solution before using a pressure protocol to go into the whole cell mode.
[1040] After the whole cell mode was achieved, test pulses were given for ¨10 minutes to quantify the hERG current in control conditions. During this control period vehicle control solution (recording solution containing 0.03% DMSO) was added three times into the individual wells. While continuing the pulse protocol, cumulatively increasing concentrations of the vehicle control, compound or positive control was added. The effect of the vehicle, compound and positive control was measured after 5 minutes of drug application. Two concentrations of the compound were tested per cell.
[1041] The use of the internal and recording solutions will result in ¨10 mV
liquid junction potential and the command voltage step will take this into account.
[1042] Electrophysiological measurements: The membrane current of the cells was measured at distinct membrane potentials with the patch clamp technique by means of an automated patch clamp system The holding potential is -70 mV The hERG current (K-h-sel ective outward current) was determined as the maximal tail current at -30 mV after a 2 second depolarization to +70 mV (refs. 1, 4). Pulse cycling rate was 15 s.
Data analysis [1043] The leak corrected hERG current (K -selective outward current) was determined as the maximal tail current at -30 mV after a 2-second of depolarization to +70 mV
measured between 2336.3 ms and 3083.6 ms. The median of three current amplitudes was taken at the end of the control period and at the end of each addition of compound, vehicle and positive control to calculate the percent inhibition.
[1044] QC parameters were set in the SyncroPatch 384PE PatchContro1384 software to automatically exclude wells from the analysis if values fall outside the range. The QC criteria are dependent on the type of recording plate (chip). Typically, a 4xChip (medium size hole) was used to record from hERG-transfected 1-1EK293 cells. QC criteria 4-6 were set before the first addition of the compound, QC criteria 4 and 5 were also set at the end of each compound addition.
[1045] QC Criteria and acceptable ranges:
1. Board Check: -500pA - 500pA
2. Contact seal resistance: -100kOhm - 10MOhm 3. Junction potential offset: 0 - 100mV
4. Rseal > 100 MOhm 5. Rseries: between 1 - 25 MOhm 6. hERG tail current? 0.2 nA before compound addition [1046] Each compound was replicated on the same plate in at least 5 wells.
Percent inhibition of at least 2-3 replicates per concentration will be reported as median. The results are summarized below in Tables 14 and 15 for Protocol 1 and Protocol 2, respectively.
Table 14 - hERG IC50 (pM) from Protocol 1 Compound Number hERG- ICso (M) A >30.2 Table 15 - hERG IC50 ( M) from Protocol 2 Example Number hERG ICso p.M
11 >30.2 9) Efficacy Study in Disseminated OCI-AML3 Model Test Agents and Controls [1047] Compound A3 was formulated in 20% hydroxypropyl-beta-cyclodextrin (EIP-13-CD) and prepared to reach a total volume of 0.2 mL (10 mL/kg) per dose for a 20 g animal. Doses were adjusted by individual body weight each day. Working stocks of Compound A3 were prepared once per week for each study and stored at 25 C.
Animals [1048] Female SCID beige mice (CB17 Cg-PrkdcscidLystbg-J/Cr1/-) were used when they were approximately 6 to 8 weeks of age and weighed approximately 25 g. All animals could acclimate and recover from any shipping-related stress for a minimum of 7 days prior to experimental use. Autoclaved water and irradiated food were provided ad libitum, and the animals were maintained on a 12 hour light and dark cycle. Cages, bedding, and water bottles were autoclaved before use and changed weekly. The tissue culture and cell injection reagents are summarized below in Table 16.
Table 16 - Tissue Culture and Cell Injection Reagents DPBS (Dulbecco's phosphate-buffered saline) Heat-inactivated fetal bovine serum MiEM Alpha medium L-glutamine Gentamycin T175 Culture Flask Roller Bottle Tumor Model and Cell Culture Method [1049] Human AML cell line OCI-AML3 was cultured at 37 C, 5% CO2 in the indicated complete culture media (MiEM Alpha + 20% HI-FBS (Heat-Inactivated Fetal Bovine Serum) +
2mM L-glutamine + 50ug/m1 Gentamycin). Cells were harvested while in logarithmic growth and resuspended in cold (4 C) MEM ((Minimum Essential Medium) Alpha in serum-free medium.
[1050] For the disseminated OCI-AML3 model, each mouse received 5x105 cells via IV
injection in a total volume of 0.2 mL using a 26-gauge needle.
Study Designs [1051] Compound A3 was administered orally (PO), daily.
[1052] Day 0 is the day of tumor cell implantation and study initiation.
[1053] In the efficacy study, mice bearing IV OCI-AML3 xenograft tumors were randomly assigned to treatment groups 3 days post-tumor cell engraftment. Treatment with vehicle or Compound A3 (at 30, 50, 100 mg/kg) was initiated on the same day, with daily dosing for 28 days.
Animal Monitoring [1054] Animals were monitored daily for clinical signs related to either compound toxicity or tumor burden (i.e., hind limb paralysis, lethargy, etc.).
Calculations [1055] For survival assessment, results were plotted as the percentage survival against days post tumor implant. Negative clinical signs and/or >20% body weight loss was used as a surrogate endpoint for death. Median survival was determined utilizing Kaplan-Meier survival analysis. The percent increased life span (ILS) was calculated as: ((median survival day of treated group - median survival day of control group) / median survival day of control group) 100. Animals failing to reach the surrogate endpoint due to adverse clinical signs (such as ulcerated tumors, body weight loss, etc.) or death unrelated to treatment were censored for the survival assessment. As defined by NCI criteria, >25% lLS is considered biologically significant. (Johnson JI et al. Br J Cancer. 2001. 84(10), 1424-1431).
Data Analysis [1056] Survival and body weight data were graphically represented utilizing Prism (Version 7).
Statistical significance for body weights was evaluated as described above.
Statistical significance was evaluated for Kaplan-Meier survival plots comparing therapeutic treatment group vs. appropriate vehicle-treated control using log-rank (Mantel-Cox) test in R software version 3.4.2. Differences between groups were considered significant when the p value was <0.05.
Survival [1057] The Kaplan-Meier survival curve is shown in FIG. 3. Mice bearing established OCI-AML3 tumors were orally dosed daily with Compound A3 at 30, 50, 100 mg/kg in 20% HP-13-CD formulation for a total of 28 days (n=9-10/group). For Compound A3 treated groups, the median days of survival were reached at the following days for 30 mg/kg at day 75.5, for 50 mg/kg at day 58.5 and for 100 mg/kg at day 75 this compared to a median survival of 38.5 days for the vehicle-treated control group. Compound A3 treatment resulted in statistically significant increased lifespan of OCI-AML3 tumor-bearing mice by 96.1%, 51.9%
and 94.8%
(at the 30, 50 and 100 mg/kg dose levels) as compared to that of control mice, (p<0.001). This was a biologically significant ILS as per NCI criteria threshold of >25% ILS
(Johnson JI et al.
Br. J Cancer. 2001. 84(10), 1424-1431).
10) Efficacy of Menin-MLL Inhibitor in Combination with Venetoclax, and Optionally, Azacitidine, in OCI-AML3 (NPM1c) IV Model in NSG Mice 110581 The disseminated OCI-AML3 model described above was also used to examine the efficacy of menin-MLL-inhibitor (formulated as described above) in combination with venetoclax (formulated in polyethylene glycol [PEG]-400/Phosa150/dimethyl sulfoxide [DMSO]), and optionally azacitidine (formulated in 10% DMSO), with the following differences: (i) instead of female SC1D beige, N SG (non-obese diabetic [NOD]
scid gamma or NOD.Cg-Prkdcse'd Il2rgtml wil/SzJ) were utilized, (ii) instead of 5x105 cells, each mouse received an injection of 1x106 cells, (iii) instead of 3 days, treatment with compound(s) was initiated 5 days after cell injection, and (iv) instead of a total volume of 0.2 mL (10 ml/kg) per dose, compound(s) prepared to reach a volume of 8 ml/kg Compound Al was given in the morning, and venetoclax or azacitidine was given in the afternoon, approximately 6-8 hr apart. The treatment of each group using compound(s) in this efficacy study is summarized in Table 17.
Table 17 ¨ Treatment of OCI-AML3 tumors in mice GROUP TREATMENT (n=10) DOSE
ROUTE SCHEDULE
1 Vehicles 8 mL/kg ip/po/po QD x 7/QD x 28/QD x 28 2 Azacitidine 2 rag/kg ip QD x 7 3 Venetoclax 100 mg/kg po QD x 28 4 Compound Al 30 mg/kg po QD x 28 Azacitidine 2 mg/kg ip/po QD x 7/QD x 28 +Venetoclax 100 mg/kg 6 Venetoclax 100 mg/kg po/po/po QD x 28/QD
x 28 +Compound Al 30 mg/kg 7 Azacitidinc 2 mg/kg ip/po/po QD x 7/QD x 28/QD x 28 +Venetoclax 100 mg/kg +Compound Al 30 mg/kg [1059] The Kaplan-Meier survival curve is shown in FIG. 4A. The impact on life span of treating mice bearing established OCI-AML3 tumors for 4 weeks is summarized in Table 18.
Table 18 Impact on Life Span following Treatment of OCI-AML3-tumors in mice TREATMENT %ILS
Azacitidine 18 Venetoclax 0 (ns) Compound Al 33 Azacitidine 14 +Venetoclax Venetoclax 33 +Compound Al Azacitidine 35*
+Venetoclax +Compound Al p<0.05 as compared with vehicle-treated control mice except where noted as not significant (ns). *p<0.05 versus Aza and Ven monotherapies, and Aza+Ven combination doublet.
110601 As reflected in Table 18, treatment of mice with Compound Al in combination with either venetoclax or venetoclax plus azacitidine resulted in statistically significant increased lifespan (1LS) of OC1-AML3 tumor-bearing mice as compared to that of vehicle control treated mice or with either azacitidine or venetoclax alone or the doublet combination of ventetoclax plus azacitidine. Notably, there is no antagonism with the triplet combination (Compound Al plus venetoclax and azacitidine) or doublets (venetoclax plus azacitidine or Compound Al), and efficacy seems solely driven by Compound Al.
11) Efficacy of Menin-MLT Inhibitor in Combination with Venetoclax and Optionally, Azacitidine, in MOLM-13 (KMT2A-r) IV Model in NSG Mice [1061] A similar approach to the disseminated OCI-AML3 model described herein for examining the efficacy of menin-MLL-inhibitor in combination with venetoclax, and optionally azacitidine, was adopted with the MOLM-13 cells being used instead of OCI-AML3 cells.
Tumor Model and Cell Culture Method [1062] Human AML cell line MOLM-13 was cultured at 37 C, 5% CO2 in the indicated complete culture media (RPMI, Roswell Park Memorial Institute [RPMI] 1640 10%
HI FBS
2mM L-glutamine 50 jig/m1 Gentamycin). Cells were harvested while in logarithmic growth and resuspended in cold (4 C) serum-free RPMI 1640 medium Each mouse received an injection of 1x105 MOLM-13 cells, and all other parameters were conducted as described for experiment (10).
[1063] The treatment of each group using compound(s) in this efficacy study is summarized in Table 19.
Table 19 ¨ Treatment of MOLM-13-tumors in mice GROUP TREATMENT (n=10) DOSE ROUTE SCHEDULE
1 Vehicles 8 mL/kg ip/po/po QD x 7/QD x 28/QD x 28 2 Azacitidine 2 mg/kg ip QD x 7 3 Venetoclax 100 mg/kg po QD x 28 4 Compound All 10 mg/kg po QD x 28 Azacitidine 2 mg/kg ip/po QD x 7/QD x 28 +Vene toclax 100 mg/kg 6 Venetoclax 100 mg/kg po/po +QD x 28/QD
x 28 +Compound Al 10 mg/kg 7 Azacitidine 2 mg/kg ip/po/po QD x 7/QD x 28/QD x 28 +Venetoclax 100 mg/kg +Compound Al 10 mg/kg [1064] The Kaplan-Meier survival curve is shown in FIG. 4B. The impact on life span of treating mice bearing established MOLM-13 tumors for 4 weeks is summarized in Table 20.
Table 20 - Impact on Life Span following Treatment of MOLM-13 tumors in Mice TREATMENT %ILS
Azacitidine 35 Venetoclax 6 Compound Al 35*
Azacitidine 53*
+Venetoclax Venetoclax 256**
+Co mpound Al Azacitidine 277**
+Venetoclax +Compound Al p<0.05 as compared with vehicle-treated control mice except where noted as not significant (ns). *p<0.05 versus Aza and Yen monotherapies. **p<0.05 versus Compound Al, Aza, and Yen monotherapies, and Aza+Ven combination doublet.
[1065] As reflected in Table 20, treatment of mice with Compound Al in combination with either venetoclax or venetoclax plus azacitidine resulted in statistically significant increased lifespan (TLS) of MOT,M-13 tumor-bearing mice as compared to that of mice treated with venetoclax alone or the doublet combination of ventetoclax plus azacitidine.
(12) In Vitro Proliferation Protocol (A) Menin-MLL Inhibitor in Combination with Venetoclax and Optionally, Azacitidine [1066] The effect of Compound A3 in combination with venetoclax, or in combination with venetoclax and azacitidine, was determined in proliferation assays using the (KiVIT2A-r) cell line. MOLM-13 cells were seeded at 500 cells/well in 96-well plates and exposed to the indicated drug alone or in combination at the specified concentration detailed in Table 21A and Table 21B. In particular, for the combination of Compound A3 with venetoclax (without azacitidine) a concentration range of Compound A3 (a 7-point, 4-fold serial dilution starting at an initial concentration of 1 i_tM) was combined venetoclax (a 6-point, 5-fold serial dilution starting at an initial concentration of 1 [tM). For the combination of Compound A3 with venetoclax and azacitidine a concentration range of Compound A3 (a 6-point, 4-fold serial dilution starting at an initial concentration of 1 1.,IM) was combined with the combination of azacitidine (a 7-point, 5-fold serial dilution starting at an initial concentration of 25 M) and venetoclax (a 7-point, 5-fold serial dilution starting at an initial concentration of 1 MM) in a 25:1 ratio. Compound A3 and azacitidine (when added) were treated at day 0 and venetoclax was added at day 4. MOLM-13 cells were incubated at 37 C, 5% CO2 with the indicated drug combination concentration for 8 days (Compound A3 and azacytidine) and for 4 days (venetoclax) in quadruplicate.
110671 Spheroid-like growth was monitored in real-time by non-invasive live-cell imaging using the 4x objective of the Incucyte ZOOM live cell imaging system (Essen BioScience), and acquiring images on Day 8. The percent confluence, as a measure of spheroid size, was determined using an integrated analysis tool that is the part of the Incucyte ZOOM software "IncuCyte ZOOM 2016B" (Essen BioScience). The DMSO content was normalized to 0.3%
and the percent confluence from the DMSO well was used as baseline response.
[1068] Potential combination effects were evaluated at day 8 and analyzed for synergy using an R-based Biochemically Intuitive Generalized Loewe (BIGL) model implemented with a highest single agent (HSA) null model (Van der Borght 2017). Data from 2 independent experiments were pooled and analyzed.
Results [1069] The doublet combination of Compound A3 with venetoclax led to significantly increased inhibition of cell proliferation compared to Compound A3 or venetoclax monotherapy (see FIG. 5A). Strong synergistic effects were observed across a range of concentrations in MOLM-13 cells as reflected in the contour plot (FIG. 5A) and detailed below in Table 21A where effect size is represented as the difference between the observed outcome and the expected outcome of combination treatments with 95% confidence interval shown in parentheses.
[1070] The triplet combination of Compound A3 with venetoclax and azacitidine led to significantly increased inhibition of cell proliferation compared to Compound A3 monotherapy or the doublet combination of venetoclax and azacitidine (see FIG. 5B) Strong synergistic effects were observed across a range of concentrations in MOLM-13 cells as reflected in the contour plot (FIG. 5B) and detailed below in Table 21B where effect size is represented as the difference between the observed outcome and the expected outcome of combination treatments with 95% confidence interval shown in parentheses.
Table 21A - Effect of Compound A3 in Combination with Venetoclax on MOLM-13 Cell Proliferation.
, _______________________________________________________________________________ __ 0.03 -0.01 -0.00 -0.03 -0.00 0.00 1 (-0.02, 0.07) (-0.05, 0.04) (-0.04, (:.O4) (-0.08, 0.01) (-0.05, 0.04) (-0.04, 0.04) 0.25 0.05 0.02 -0.00 -0.02 0.00 I -0.01 O..% (0.01, 0.09) ( 0.02, 0.07) ( 0.04, 0.04' ( 0.06, 0.03) (0.05, 0.05) 1 ( 0.06, 0.03) M 1 __ 0 0625 0.06* -0.03 -0.09 -0.22" -0.22" -0.26"
../.... .
(0.01,011) (-0.07,0.02) (-0.14,-0.04) (-0.26,Ø17) (-0.26, -0.17) (-0.31,-0.22) en . ______________________________________________________ < -"r0 0.0156 0.02 -0.01 0.00 -0.09 -0.17" -0.12"
C (-0.02, 0 07) (-0.05Ø03) (-0.04,0.05) (-0.13, -0.05) (-0.22-0.13) (-0.17, -0.07) =
O 0.004 0.04 -0.06 0.01 0.02 -0.01 0.03 11.
(0.01, 0.08) (-0.09, -0.021 (-003,0.05) (-0.03, 0.06) (-0.03, 0.04) (-0.01,0.08) E
o 0.01 0.02 0.01 0.03 0.01 -0.00 µ11 0.001 (-0.01, 0.05) (-0.01, 0.06) (-n_oz. oil-, (-0.m, (Lim) (41.01, 0.06) (-0.04, 0.07) 0.02 0.09* 0.02 -0.01 0.04 0.02 0.0003 (-0.02, 0.05) (0.05, 0.13) (-0_02, 0.06) (-0.05, 0.04) (4...00, 0.09) (-0.03,0.06) Venetoclax ( M} 0.0003 0.0016 0.008 0.04 0.2 I.
Note that absence of any asterisk indicates an additive effect, antagonism is indicated by" * "
and synergy is indicated by" ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
Table 21B - Effect of Compound A3 in Combination with Venetoclax and Azacytidine on MOLM-13 Cell Proliferation.
0.01 4.01 -0.00 -0.05 -0.12" 0.00 0.00 i. (-0.05, 0.07) (-0.08, 0.05) (-0.06, ).06) (-0.11, 0.02) (-0.18. -0.06) (-0.05Ø06) (-0.05Ø06) .........
0.00 0.03 -0.02 -0.02 -0.11" -0.00 0.00 I. 0.25 (-106, 0.06) (-0.03,0.09) (-(L08, 0.04) (-0.08, 0.04) (-0.17, -0.05) (-0.06,0.05) (-0.05,0.06) ......... _________________________________________________________ 7 rn 0.0625 um -0.00 0.05 -0.13" -0.41" 0.01 0.00 < (-0.06,0.09) (4.08,0.08) (-0.03, 0.13) 1-0.20, -0.06) (-0.48, -0.34) (-0.05,0.06) (-0.05,0.06) C 0.04 -0.40 -0.01 0.01 -0.15" 0.00 0.00 = 0.0156 O (-0.03, 0.10) (-0.07, 0.07) (-0.08,0.05) (-0.06, 0.08) (-0.23, -0.08) (-0.05,0.06) (-0.05Ø06) CI.
E 0.004 0.06 0.04 -0.05 -0.02 0.07* 0.00 0.01 O (0.00, 0.12) (4.02,0.10) (-(L11, 0.00) (-0.08, 0.05) (-0.01, 0.15) (-(L05, 0.06) j-0.05, 0.06) I.) 0.04 0.02 0.01 0.02 0.09' 0.00 0.01 0.001 (-0 12, 0.10) f. -0.03, 0.08) (-0.04, ,.07) (-0.05, 0.08) '0.01, 0.17) (-0.05, 0.06) (-0.04,0.07) Ven et oc Tax (WO) GE-05 0.0003 0.0016 0.008 0.04 0.2 1 Azacitidine (p.M) 0.002 0.u08 0.04 0... 1 5 Note that absence of any asterisk indicates an additive effect, antagonism is indicated by" * "
and synergy is indicated by" ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
(B) Menin-MLL Inhibitor in Combination with Decitabine and Venetoclax The effect of Compound A4 in combination with decitabine as compared to in combination with decitabine and venetoclax was determined in proliferation assays using the MOLM-13 (KIVIT2A-r) and OCI-A1V11L3 (NPM1c) cell lines.
Cell lines AML cell lines MOLM-13 and OCI-AML3 were purchased from DSMZ. MOLM-13 were grown in RPMI medium supplemented with 10% Fetal Bovine Serum (FBS) and 1%
penicillin/streptomycin. OCI-AML3 cells were cultured in 80-90% alpha-MEM
(with ribo-and deoxyribonucleosides) + 10-20% FB S. All cell lines were cultured at 37 C
in 5% CO2 atmosphere.
Cell Titer Glo assays 110711 A1V1L cell lines, MOLM-13 and 0C1-AML3, (5 x 103 cells/well) were seeded in 96-well plates and grown for 6 days in serum (10%)-containing medium in the presence or absence of inhibitors at the indicated concentrations detailed below in Table 22A and Table 22B.
Proliferation was analyzed by means of a Cell Titer Glo assay using the CellTiter 96 Aqueous One Solution Cell Proliferation Assay (Promega, Madison, WI, USA), according to the manufacturer's instructions. Data are mean with standard deviation from two to four independent experiments in technical triplicates. Compound A4 and decitabine were added at day 0 and venetoclax (when added) was added at day 4.
Synergy calculations [1072] R-based Biochemically Intuitive Generalized Loewe (BIGL) model implemented with a highest single agent (HSA) null model. Specifically, the B1GL methodology was applied to calculate drug-drug interactions (Van der Borght, K., Tourny, A., Bagdziunas, R. et al. B1GL:
Biochemically Intuitive Generalized Loewe null model for prediction of the expected combined effect compatible with partial agonism and antagonism. Sci Rep 7, 17935 (2017); Thas, 0., Tourny, A., Verbist, B., Hawinkel, S., Nazarov, M., Mutambanengwe, K., &
Bijnens, L.
Statistical detection of synergy: New methods and a comparative study.
Pharmaceutical Statistics (2021)).
[1073] Synergy matrix results of the BIGL analysis of the cell line data with HSA as mean model calculated on the basis of the cellular metabolic activity using Cell Titer-Glo assay.
Bootstrap confidence intervals are indicated. Effect sizes and their confidence intervals are shown. Notably, each data point based on the p-value and sign of the respective maxR statistic with the size of the dots reflecting the degree of synergy or antagonism corresponding to graded scale. No significant average effect if zero is included in the interval.
Results A pairwise matrix combination of decitabine and Compound A4 in the absence or presence of venetoclax was evaluated in MOLM-13 (KMT2A-AF9; FLT3-ITD) and OCI-AML3 (NPM1c AML) cells using a 6-day CellTiter-Glo assay format. Notably, the combination of decitabine and Compound A4, with or without venetoclax, was synergistically cytotoxic in (KMT2A-AF9; FLT3-ITD) cells as reflected in the contour plots (FIG. 6A and FIG. 6B) and detailed below in Tables 22A and 22B, respectively.
Table 22A - Effect of Compound A4 in Combination with Decitabine on MOLM-13 Cell Proliferation.
-0.0237 -0.0274 -0.0185 -0.0029 -0.0014 Et 0577,11.015- p..n1 031 (-0_11436,11.11066) (-EL01 57,0_1111LN 0.01 3,14,0.
2 c -0.0156 -0.0637** -0.0463 -00109 41.0059 5- 10566,0.025d ).1007,41.0267) (-0.0706;0.022) (41.0228,0.0009) (41.0179,0.0062) -0.0232 -0.1574" -0.16 4" -0.0192 -0.0101 0.0569,0.0104 11879,-0.1268) (-0.1846,-(L1442) (-0.0305,-0.008) (-0.0219,0.0017) -0.0058 4/1435" -0.1783" -0.0211 -0.0107 0.1 0 0363,0024/ 11703,-0.1166) (-0.198,-0.1587) (-0.0323,-0.01) (-0.0224,0.001) Ø0041 -0.1694" -0.1895" -0.022 -0.0114 4.) 00328,0.0245 11932,-01456) (-02087,-0.1703) (-0.033,-0.0109) (-0.0231,0.0003) 0.0387 0.2" 0.1958" 0.0214 0.0116 0.0665,-0.010 -0.223,-0.177) (-02148,-01768) (-0.0325,-0.0102) (-0.0233,0.0001) Dedtablne (ph4) 0.0015 0.015 0.15 1.5 3 Note that absence of any asterisk indicates an additive effect, antagonism is indicated by * "
and synergy is indicated by ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
Table 22B - Effect of Compound A4 in Combination with Venetoclax and Decitabine on MOLM-13 Cell Proliferation.
0 001 -9.043 -0.0028 -0.0228 -0.0034 0.0004 .
(-0.139,0.053) (-0.0897,0.084) (4.0725,0.0269) (4.0297,0.0228) (-0.0272,0.028) 2 0.01 -0.0293 -0.0208 -0.0376 -0.0034 0.0904 =. (-0.1306,0.072) (-0.1067,0.0651) (-0.086,0.0107) (4.0296,0.0229) (-0.0273,0.028) Mt MO5 4.0059 -0.2397** -0.057 4.0037 -0.0001 <
(-0.0895,0.0778) (-0.3118,-0.1675) (-0.1035,-0.0104) (-0.0299,0.0224) (-0.0276,0.0275) *0 C 0.1 -0.0258 4.2477** -0.0607* -0.0036 -0.0003 0 (-0.0979,0.0462) (-0.3043,-0.1. .1) (41068,-0.0145) (4.0298,0.0226) (-0.0278,0.0272) _ E -0.0128 426** 4.0654** -0.0041 -0.0002 (-0.0835,0.0579 (-0.3178,-0 7077) (-0.1111,4)0197) (4.0307,0.07)) (41.0778,(10773) 10 -0.0363 -0.2876** -0.0676" -0.0039 -0.0003 (-0.1062,0.0336) (-0.339,4.2363) (41131,-0.0221) (-0.03,0.0223) (-0.0278,0.0273) Decitabine (pm) moan 0.015 0.15 1.5 3 Venetodax µ1.tM) 0.6..002 0.0002 0.002 0.02 0.2 Note that absence of any asterisk indicates an additive effect, antagonism is indicated by" * "
and synergy is indicated by" ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
Antagonistic effects in OCT-AML3 (NP1\41c AML) cells were observed at low doses of decitabine (15 n1V1), with or without venetoclax, as reflected in the contour plots (FIG. 7A and FIG. 7B) and detailed below in Tables 23A and 23B, respectively.
Table 23A - Effect of Compound A4 in Combination with Decitabine on OCI-AML3 Cell Proliferation.
r -0.0483 -0.0238 -0.0156 -0.024 -0.0127 0.001 (-0.1014,0.0047) (-0.0813,0.033: -0.065,0.0338) (4.0524,0.0043) (-0.0404,0.0151) 2 0.01 -0.0234 -0.1175** -0.038 40267 -0.0128 =_ (-0.0831,0.0364) (-0.1731,-0.06:
0.0869,0.0109) (-0.055,0.0015) (-0.0405,0.0149) .....
er 0.0136 0.0588 -0.0571 4.0258 -0.0136 < 0.05 (-0.0364,0.0636) (0.0078,0.109", ).1055,-0.0086) (-0.0541,0.0025) (-0.0413,0.0141) "0 = 0.0139 0.1279* -0.0603 -0.0228 -0.0136 = 0.1 0 (-0.0299,0.0576) (0.0814,0.174! ).1086,-0.0119) (-0.0512,0.0056) (-0.0413,0.0141) CL
E 0.0141 0.1688* -0.0504 -0.0246 -0.013 . (-0.0288;0.057) (0.122,0.2156 0.094,-0.0067) (-0.053,0.0037) (-0.04.07,0.0147) (...) __________________________________________________________ . _ 0.0288 0.1406* -0.0324 -0.018 -0.0114 (-0.0156,0.0734 (0.0934,0.1877) , 0.0767,0.012) (-0.0466,0_0106) (-0.0392,0.0163) - Dedtabine (niVT) 0.0015 0.015 0.15 1.5 3 Note that absence of any asterisk indicates an additive effect, antagonism is indicated by " * "
and synergy is indicated by" ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
Table 23B - Effect of Compound A4 in Combination with Venetoclax and Decitabine on OCT-AML3 Cell Proliferation.
t -0.0424 -0.0091 0.0094 -0.0239 -0.0114 0.001 10831,-0.0017) _ _ _ (-0.0527,0.0345) (-0.0278,0.0467) (-0.0485,0.0007) 1 (-0.0356,0.0128) +--2 c ! 0.0237 -0.0788 -0.0187 -0.023 -0.0127 8.0209,0.0683) (-0.1204,-0.0372) (-0.0555,0.0181) (-0.0476,0.0016) i (-0.0369,0.0115) V 0.0187 0.1041* -0.0351 -0.0224 -0.0118 04 ( 8.0182,0.0557) (0.0658,111424) (-0.0716,0.0014) (-0.047,0.0022) (41036,0.8124) C 0.0242 0.15' -0.0295 -0.0237 -0.0117 17 0.1 0. i-0.01,0_0584) (0.1137,0.1864) (-0.0662,0.0071) (-0.0483,0.0009) (-0.0359,0.0125) _ E 1 0.0362 0.2025* -0.0159 0.0222 -0.0109 a 3.0036,0.0689) (0.1668,0.2381) (-0.0476,0.0159) (-0.0468,0.0024) (-0.0352,0.0133) 0.06 0.1657* 0.005 4.0167 -0.0099 3.0257,0.0942) (0.1297,0.2018) (-0.0282,0.0382) (-0.0414,0.0081) (-0.0341,0.0144) i Decitabine (jiM) 0.0015 0.015 0.15 1.5 3 Venetaclax ( M) 0.00002 0.0002 0.002 0.02 0.2 Note that absence of any asterisk indicates an additive effect, antagonism is indicated by" * "
and synergy is indicated by " ** ". Antagonistic and synergistic effects are derived from the significant calls based on the maxR test and numbers associated with same interpreted as antagonistic or synergistic, respectively.
Claims (25)
1. A combination comprising:
= a therapeutically effective amount of a menin-mixed-lineage leukemia 1 (MLL) inhibitor of Formula (1), or a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt or a solvate thereof;
= a therapeutically effective amount of a B-cell lymphoma 2 (BCL-2) inhibitor; and = optionally, a therapeutically effective amount of at least one other antineoplastic agent;
wherein the menin-VILL inhibitor of Formula (I) has the structure:
wherein R1a- represents -C(=0)-NR ax Rxb Het; or Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety; wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalkyl and Cl_4alkyl;
It and WI' are each independently selected from the group consisting of hydrogen, Ci_ 4alkyl and C3_6cyc1oa1ky1;
-=-= lb rc represents F or Cl;
Y1 represents -CR5aR51)-, -0- or -NR5C-;
R2 is selected from the group consisting of hydrogen, halo, Ci_4a1ky1, -0-Ci4a1ky1, and ¨NR7aRM
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
X3 represents CH, and X2 represents N;
R4 represents isopropyl;
R5a, R5b, R5C, R7a, and R7b, are each independently selected from the group consisting of hydrogen, Ci_4alkyl and C3_6cyc1oa1ky1;
R3 represents -C1-6 alkyl-NR"Rib, -C1-6 a1ky1-C(=0)-NR9aR9b, -C1-6alkyl-OH, or 6alkyl-NR11-C(=0)-0-C1-4alkyl-O-C(=0)-C1-4alkyl; wherein each of the Ci_4a1ky1 or Ci_6a1ky1 moieties in the R3 definitions independently of each other may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8a- and Itsb are each independently selected from the group consisting of hydrogen; CI-(alkyl ; -C(=0)-C _4alkyl ; -C(=0)-0 -C 1_4alkyl ; -C(=0)-NR12aRl2b, and C1-6alkyl sub stituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci_4a1ky1, -C(=0)-NRmaRlob, and NIRlocC(=O)Ci and R9a, R9b, R10a, Rlob, RlOc, R11, R12a, and R12" are each independently selected from the group consisting of hydrogen and C1-6 alkyl.
= a therapeutically effective amount of a menin-mixed-lineage leukemia 1 (MLL) inhibitor of Formula (1), or a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt or a solvate thereof;
= a therapeutically effective amount of a B-cell lymphoma 2 (BCL-2) inhibitor; and = optionally, a therapeutically effective amount of at least one other antineoplastic agent;
wherein the menin-VILL inhibitor of Formula (I) has the structure:
wherein R1a- represents -C(=0)-NR ax Rxb Het; or Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety; wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cycloalkyl and Cl_4alkyl;
It and WI' are each independently selected from the group consisting of hydrogen, Ci_ 4alkyl and C3_6cyc1oa1ky1;
-=-= lb rc represents F or Cl;
Y1 represents -CR5aR51)-, -0- or -NR5C-;
R2 is selected from the group consisting of hydrogen, halo, Ci_4a1ky1, -0-Ci4a1ky1, and ¨NR7aRM
U represents N or CH;
nl, n2, n3 and n4 are each independently selected from 1 and 2;
X3 represents CH, and X2 represents N;
R4 represents isopropyl;
R5a, R5b, R5C, R7a, and R7b, are each independently selected from the group consisting of hydrogen, Ci_4alkyl and C3_6cyc1oa1ky1;
R3 represents -C1-6 alkyl-NR"Rib, -C1-6 a1ky1-C(=0)-NR9aR9b, -C1-6alkyl-OH, or 6alkyl-NR11-C(=0)-0-C1-4alkyl-O-C(=0)-C1-4alkyl; wherein each of the Ci_4a1ky1 or Ci_6a1ky1 moieties in the R3 definitions independently of each other may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
R8a- and Itsb are each independently selected from the group consisting of hydrogen; CI-(alkyl ; -C(=0)-C _4alkyl ; -C(=0)-0 -C 1_4alkyl ; -C(=0)-NR12aRl2b, and C1-6alkyl sub stituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci_4a1ky1, -C(=0)-NRmaRlob, and NIRlocC(=O)Ci and R9a, R9b, R10a, Rlob, RlOc, R11, R12a, and R12" are each independently selected from the group consisting of hydrogen and C1-6 alkyl.
2. The combination according to claim 1, wherein the menin-MLL inhibitor of Formula (I) is Compound A:
or a pharmaceutically acceptable salt or solvate thereof.
or a pharmaceutically acceptable salt or solvate thereof.
3. The combination according to claim 1, wherein the menin-MLL inhibitor of Formula (I) is Compound A4-a:
or a solvate thereof.
or a solvate thereof.
4. The combination according to any one of clairns 1-3, wherein the BCL-2 inhibitor is selected from obatoclax, HA14-1, nayitoclax, ABT-737, TW-37, AT101, sabutoclax, gamgogic acid, venetoclax, and pharmaceutically acceptable salts or solvates thereof.
5. The combination according to claim 4, wherein the BCL-2 inhibitor is venetoclax, or a pharmaceutically acceptable salt or solvate thereof.
6. The combination according to any one of claims 1-5, wherein the at least one other antineoplastic agent is a hypornethylating agent, a DNA intercalating agent, a pyrimidine analog, a purine analog, a kinase inhibitor, a CD20 inhibitor, an isocitrate dehydrogenase inhibitor, an immunornodulatory antineoplastic agent or a dihydroorotate dehydrogenase inhibitor.
7. The combination according to claim 6, wherein the at least one other antineoplastic agent is a hypornethylating agent.
8. The combination according to claim 7, wherein the hypornethylating agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
9. The combination according to claim 1, wherein the menin-MLL inhibitor is Compound A or a pharmaceutically acceptable salt or solvate thereof, the BCL-2 inhibitor is venetoclax, or a pharmaceutically acceptable salt or solvate thereof and the at least one other antineoplastic agent is a hypornethylating agent.
10. The cornbination according to claim 9, wherein the hypomethylating agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
11. A pharmaceutical composition comprising a combination as claimed in any one of claims 1 to 10 and a pharmaceutically acceptable carrier.
12. A combination as claimed in any one of claims 1 to 10 or a pharmaceutical composition as claimed in claim 11 for use as a medicament.
13. A combination as claimed in any one of claims 1 to 10 or a pharmaceutical composition as claimed in claim 11 for use in the prevention or treatment, in particular treatment, of a hematopoietic disorder.
14. The combination or pharmaceutical composition for use according to claim 13 wherein the hematopoietic disorder is a nucleophosmin 1 (NPM1)-mutated leukemia or MLL-rearranged leukemia.
15. The combination or pharmaceutical composition for use according to claim 13 wherein the hematopoietic disorder is acute myeloid leukemia (A1VIL) or acute lymphoblastic leukemia (ALL).
16. A method for treating a subject who has been diagnosed with a hematopoietic disorder comprising administering to the subject:
= a therapeutically effective amount of a menin-mixed-lineage leukemia 1 (MILL) inhibitor of Fonnula (I), or a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt or a solvate thereof;
= a therapeutically effective amount of a BCL-2 inhibitor; and = optionally, a therapeutically effective amount of at least one other antineoplastic agent;
wherein the menin-VILL inhibitor of Formula (I) has the structure:
wherein lea represents -C(=0)-NwaRxb; Het; or Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety; wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cyc1oa1ky1 and Ci_4a1ky1;
IV' and Itx" are each independently selected from the group consisting of hydrogen, Ci-4alkyl and C3_6cyc1oa1ky1;
lb tc represents F or Cl;
Y1 represents -CR5aR5b-, -0- or -NR5C-;
R2 is selected from the group consisting of hydrogen, halo, C1-4alkyl, -0-C1-4alkyl, and ¨NR7aR7b;
U represents N or CH, n I, n2, n3 and n4 are each independently selected from 1 and 2;
X1 represents CH, and X2 represents N, R4 represents isopropyl;
R5a, R5b, R5C, It7a, and R7b, are each independently selected from the group consisting of hydrogen, C1¨alkyl and C3_6cyc1oa1ky1;
R3 represents -Ci_6alkyl-NreaR8b, -Ci_6alkyl-C(=0)-NR9aR9b, -C1_6alkyl-OH, or -C 1_6alkyl-NR11-C(=0)-0-C i_4alkyl -0-C (=0)-C i_4alkyl; wherein each of the C 1_4alkyl or Ci_6a1ky1 moieties in the R3 definitions independently of each other may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
Rs' and Rsb are each independently selected from the group consisting of hydrogen;
C1_6alkyl, -C(-0)-Ci_4a1ky1, _C(=0)-NR12aR121); and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci_4alkyl, -0-C i_4alkyl, -C(=0)-NRloaRlob, and -NRlOc-C(=0)-CiAalkyl; and R9a, R9b, R10a, RPM, RlOc, R11, R12a, and Rl2b are each independently selected from the group consisting of hydrogen and C1_6a1ky1.
= a therapeutically effective amount of a menin-mixed-lineage leukemia 1 (MILL) inhibitor of Fonnula (I), or a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt or a solvate thereof;
= a therapeutically effective amount of a BCL-2 inhibitor; and = optionally, a therapeutically effective amount of at least one other antineoplastic agent;
wherein the menin-VILL inhibitor of Formula (I) has the structure:
wherein lea represents -C(=0)-NwaRxb; Het; or Het represents a 5- or 6-membered monocyclic aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety; wherein said 5- or 6-membered monocyclic aromatic ring is optionally substituted with one or two substituents selected from the group consisting of C3_6cyc1oa1ky1 and Ci_4a1ky1;
IV' and Itx" are each independently selected from the group consisting of hydrogen, Ci-4alkyl and C3_6cyc1oa1ky1;
lb tc represents F or Cl;
Y1 represents -CR5aR5b-, -0- or -NR5C-;
R2 is selected from the group consisting of hydrogen, halo, C1-4alkyl, -0-C1-4alkyl, and ¨NR7aR7b;
U represents N or CH, n I, n2, n3 and n4 are each independently selected from 1 and 2;
X1 represents CH, and X2 represents N, R4 represents isopropyl;
R5a, R5b, R5C, It7a, and R7b, are each independently selected from the group consisting of hydrogen, C1¨alkyl and C3_6cyc1oa1ky1;
R3 represents -Ci_6alkyl-NreaR8b, -Ci_6alkyl-C(=0)-NR9aR9b, -C1_6alkyl-OH, or -C 1_6alkyl-NR11-C(=0)-0-C i_4alkyl -0-C (=0)-C i_4alkyl; wherein each of the C 1_4alkyl or Ci_6a1ky1 moieties in the R3 definitions independently of each other may be substituted with one, two or three substituents each independently selected from the group consisting of cyano, halo, -OH, and -0-C1_4alkyl;
Rs' and Rsb are each independently selected from the group consisting of hydrogen;
C1_6alkyl, -C(-0)-Ci_4a1ky1, _C(=0)-NR12aR121); and C1_6alkyl substituted with one, two or three substituents each independently selected from the group consisting of -OH, cyano, halo, -S(=0)2-Ci_4alkyl, -0-C i_4alkyl, -C(=0)-NRloaRlob, and -NRlOc-C(=0)-CiAalkyl; and R9a, R9b, R10a, RPM, RlOc, R11, R12a, and Rl2b are each independently selected from the group consisting of hydrogen and C1_6a1ky1.
17. The method according to claim 16, wherein the menin-MLL inhibitor of Formula (I) is Compound A:
or a pharmaceutically acceptable salt or solvate thereof.
or a pharmaceutically acceptable salt or solvate thereof.
18. The method according to claim 11, wherein the menin-MLL inhibitor of Formula (I) is Compound A4-a:
or a solvate thereof.
or a solvate thereof.
19. The method according to any one of claims 16-18, wherein the BCL-2 inhibitor is selected from venetoclax, obatoclax, HA14-1, navitoclax, ABT-737, TW-37, AT101, sabutoclax, gamgogic acid, and pharmaceutically acceptable salts or solvates thereof.
20. The method according to claim 19, wherein the BCL-2 inhibitor is venetoclax, or a pharmaceutically acceptable salt or solvate thereof
21. The method according to any one of claims 16-20, wherein the at least one other antineoplastic agent is a hypomethylating agent, a DNA intercalating agent, a pyrimidine analog, a purine analog, a kinase inhibitor, a CD20 inhibitor, an isocitrate dehydrogenase inhibitor, an immunomodulatory antineoplastic agent or a dihydroorotate dehydrogenase inhibitor.
22. The method according to claim 21, wherein the at least one other antineoplastic agent is a hypomethylating agent.
23. The method according to claim 22, wherein the hypomethylating agent is azacitidine, or a pharmaceutically acceptable salt or solvate thereof.
24. The method according to any one of claims 16-23, wherein the hematopoietic disorder is a nucleophosmin 1 (NPM1)-mutated leukemia or MILL-rearranged leukemia.
25. The method according to any one of claims 16-23, wherein the hematopoietic disorder is acute myeloid leukemia (AMIL) or acute lymphoblastic leukemia (ALL).
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CNPCT/CN2021/093036 | 2021-05-11 | ||
CN2021093036 | 2021-05-11 | ||
CNPCT/CN2021/100523 | 2021-06-17 | ||
CN2021100523 | 2021-06-17 | ||
CN2022086004 | 2022-04-11 | ||
CNPCT/CN2022/086004 | 2022-04-11 | ||
PCT/CN2022/091679 WO2022237720A1 (en) | 2021-05-11 | 2022-05-09 | Combination therapies |
Publications (1)
Publication Number | Publication Date |
---|---|
CA3215313A1 true CA3215313A1 (en) | 2022-11-17 |
Family
ID=81753154
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA3215313A Pending CA3215313A1 (en) | 2021-05-11 | 2022-05-09 | Combination therapies |
Country Status (15)
Country | Link |
---|---|
EP (1) | EP4337216A1 (en) |
JP (1) | JP2024518497A (en) |
KR (1) | KR20240006631A (en) |
CN (1) | CN117460513A (en) |
AU (1) | AU2022274071A1 (en) |
CA (1) | CA3215313A1 (en) |
CL (1) | CL2023003239A1 (en) |
CO (1) | CO2023014322A2 (en) |
DO (1) | DOP2023000246A (en) |
IL (1) | IL308335A (en) |
MX (1) | MX2023013410A (en) |
PE (1) | PE20240593A1 (en) |
TW (1) | TW202308643A (en) |
UY (1) | UY39761A (en) |
WO (1) | WO2022237720A1 (en) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2024114666A1 (en) * | 2022-11-30 | 2024-06-06 | Janssen Pharmaceutica Nv | Combinations comprising a menin-mll inhibitor and a bcl-2 inhibitor |
WO2024114664A1 (en) * | 2022-11-30 | 2024-06-06 | Janssen Pharmaceutica Nv | Combinations comprising a menin-mll inhibitor and at least one other therapeutic agent |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2015365580B2 (en) | 2014-12-18 | 2020-04-02 | Takeda Pharmaceutical Company Limited | Solid state forms of fused heteroaromatic pyrrolidinones |
CN108779116A (en) * | 2015-12-22 | 2018-11-09 | 生命医药公司 | The inhibitor of Multiple Endocrine tumor albumen-MLL interactions |
KR102436430B1 (en) * | 2016-06-10 | 2022-08-24 | 비타이 파마슈티컬즈, 엘엘씨 | Inhibitors of Menin-MLL Interaction |
TW202104207A (en) | 2019-04-17 | 2021-02-01 | 美商健生生物科技公司 | Dihydroorotate dehydrogenase inhibitors |
AU2020404305A1 (en) | 2019-12-19 | 2022-08-04 | Janssen Pharmaceutica Nv | Substituted straight chain spiro derivatives |
-
2022
- 2022-05-09 CA CA3215313A patent/CA3215313A1/en active Pending
- 2022-05-09 IL IL308335A patent/IL308335A/en unknown
- 2022-05-09 AU AU2022274071A patent/AU2022274071A1/en active Pending
- 2022-05-09 EP EP22725158.4A patent/EP4337216A1/en active Pending
- 2022-05-09 WO PCT/CN2022/091679 patent/WO2022237720A1/en active Application Filing
- 2022-05-09 PE PE2023003030A patent/PE20240593A1/en unknown
- 2022-05-09 KR KR1020237042402A patent/KR20240006631A/en unknown
- 2022-05-09 MX MX2023013410A patent/MX2023013410A/en unknown
- 2022-05-09 CN CN202280034525.XA patent/CN117460513A/en active Pending
- 2022-05-09 JP JP2023569789A patent/JP2024518497A/en active Pending
- 2022-05-10 UY UY0001039761A patent/UY39761A/en unknown
- 2022-05-10 TW TW111117441A patent/TW202308643A/en unknown
-
2023
- 2023-10-25 CO CONC2023/0014322A patent/CO2023014322A2/en unknown
- 2023-10-31 CL CL2023003239A patent/CL2023003239A1/en unknown
- 2023-11-08 DO DO2023000246A patent/DOP2023000246A/en unknown
Also Published As
Publication number | Publication date |
---|---|
KR20240006631A (en) | 2024-01-15 |
EP4337216A1 (en) | 2024-03-20 |
AU2022274071A1 (en) | 2024-01-04 |
DOP2023000246A (en) | 2024-04-30 |
MX2023013410A (en) | 2023-12-06 |
CO2023014322A2 (en) | 2023-11-20 |
IL308335A (en) | 2024-01-01 |
CN117460513A (en) | 2024-01-26 |
CL2023003239A1 (en) | 2024-06-07 |
WO2022237720A1 (en) | 2022-11-17 |
UY39761A (en) | 2022-11-30 |
TW202308643A (en) | 2023-03-01 |
PE20240593A1 (en) | 2024-03-21 |
JP2024518497A (en) | 2024-05-01 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2017265100B2 (en) | Therapeutically active compounds and their methods of use | |
JP7554829B2 (en) | Substituted Linear Spiro Derivatives | |
JP5894638B2 (en) | NOVEL PHOSPHATE COMPOUND, PROCESS FOR PRODUCING THE SAME AND PHARMACEUTICAL COMPOSITION CONTAINING THE SAME | |
CA3120862C (en) | 9-substituted amino triazolo quinazoline derivatives as adenosine receptor antagonists, pharmaceutical compositions and their use | |
CA3215313A1 (en) | Combination therapies | |
KR20210144853A (en) | N-heteroaromatic amide derivatives for the treatment of cancer | |
CA3214861A1 (en) | Combination therapies | |
US20230416225A1 (en) | Diaminopyrimidine carboxamide inhibitors of hpk1 | |
WO2019074809A1 (en) | Indazolyl-spiro[2.2]pentane-carbonitrile derivatives as lrrk2 inhibitors, pharmaceutical compositions, and uses thereof | |
CN113164481A (en) | Cycloalkane-1, 3-diamine derivatives | |
CA3157167A1 (en) | Iso-citrate dehydrogenase (idh) inhibitor | |
EP3028703B1 (en) | Piperidine derivatives as wnt signaling inhibitor | |
CN118845786A (en) | Combination therapy | |
CN118845787A (en) | Combination therapy | |
WO2024114666A1 (en) | Combinations comprising a menin-mll inhibitor and a bcl-2 inhibitor | |
WO2024114664A1 (en) | Combinations comprising a menin-mll inhibitor and at least one other therapeutic agent | |
OA21024A (en) | Spiro compounds as melanocortin 4 receptor antagonists and uses thereof. |