CA3109897A1 - Vaccination against coronavirus with poliomyelitis vaccine - Google Patents
Vaccination against coronavirus with poliomyelitis vaccine Download PDFInfo
- Publication number
- CA3109897A1 CA3109897A1 CA3109897A CA3109897A CA3109897A1 CA 3109897 A1 CA3109897 A1 CA 3109897A1 CA 3109897 A CA3109897 A CA 3109897A CA 3109897 A CA3109897 A CA 3109897A CA 3109897 A1 CA3109897 A1 CA 3109897A1
- Authority
- CA
- Canada
- Prior art keywords
- poliovirus
- poliomyelitis vaccine
- vaccine
- inactivated
- certain embodiments
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/295—Polyvalent viral antigens; Mixtures of viral and bacterial antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5252—Virus inactivated (killed)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5254—Virus avirulent or attenuated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/32011—Picornaviridae
- C12N2770/32611—Poliovirus
- C12N2770/32634—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/32011—Picornaviridae
- C12N2770/32611—Poliovirus
- C12N2770/32671—Demonstrated in vivo effect
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Virology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Oncology (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Communicable Diseases (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Attorney Docket No. 805A002W001 ABSTRACT OF THE DISCLOSURE Provided herein is a poliomyelitis vaccine for use in preventing a person from an infection by a Coronaviridae virus. Also provided herein is a poliomyelitis vaccine for use in inducing a protective immune response in a person against a Coronaviridae virus. - 25 -Date Recue/Date Received 2021-02-22
Description
Attorney Docket No. 805A002W001 VACCINATION AGAINST CORONAVIRUS WITH POLIOMYELITIS VACCINE
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of the priority of U.S.
Provisional Application Nos. 63/008,664, filed April 11,2020; 63/010,678, filed April 15, 2020; and 63/013,561, filed April 22, 2020; and U.S. Application No. 17/098,449, filed November 15, 2020;
the disclosure of each of which is incorporated herein by reference in its entirety.
FIELD
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of the priority of U.S.
Provisional Application Nos. 63/008,664, filed April 11,2020; 63/010,678, filed April 15, 2020; and 63/013,561, filed April 22, 2020; and U.S. Application No. 17/098,449, filed November 15, 2020;
the disclosure of each of which is incorporated herein by reference in its entirety.
FIELD
[0002] Provided herein is a poliomyelitis vaccine for use in preventing a person from an infection by a Coronaviridae virus. Also provided herein is a poliomyelitis vaccine for use in inducing a protective immune response in a person against a Coronaviridae virus.
REFERENCE TO A SEQUENCE LISTING
REFERENCE TO A SEQUENCE LISTING
[0003] The present specification is being filed with a Sequence Listing in Computer Readable Form (CRF), which is entitled 805A002W001 SEQ LISTING ST25.txt of 20,153 bytes in size and created January 20, 2021; the content of which is incorporated herein by reference in its entirety.
BACKGROUND
BACKGROUND
[0004] Coronavirus disease 2019 (COVID-19) is caused by severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2). Gorbalenya et al., Nat. Microbiol. 2020,
5, 536-44;
Zhang et al., Science 2020, 368, 409-12. On March 11, 2020, the World Health Organization declared COVID-19 a global pandemic. Zhang et al., Science 2020, 368, 409-12;
Dai et al., Science 2020, 368, 1331-5. By mid-July of 2020, COVID-19 has spread almost to every corner of the world. As of October 2020, there are almost 50 million confirmed cases and over a million confirmed deaths globally. The COVID-19 pandemic poses as a great public health threat to the world.
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 [0005] COVID-19 can be fatal, especially to older people and those with pre-existing medical conditions. Shahid et al., J. Am. Geriatr. Soc. 2020, 68, 926-9.
Common symptoms of COVID-19 include fever or chills, cough, shortness of breath or difficulty breathing, fatigue, muscle or body aches, headache, loss of taste or smell, sore throat, congestion or runny nose, nausea or vomiting, and diarrhea. Id. Currently, there is no FDA-approved vaccine for COVID-19. Therefore, there is an urgent need for an immunization method to battle the COVID-19 pandemic.
SUMMARY OF THE DISCLOSURE
Zhang et al., Science 2020, 368, 409-12. On March 11, 2020, the World Health Organization declared COVID-19 a global pandemic. Zhang et al., Science 2020, 368, 409-12;
Dai et al., Science 2020, 368, 1331-5. By mid-July of 2020, COVID-19 has spread almost to every corner of the world. As of October 2020, there are almost 50 million confirmed cases and over a million confirmed deaths globally. The COVID-19 pandemic poses as a great public health threat to the world.
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 [0005] COVID-19 can be fatal, especially to older people and those with pre-existing medical conditions. Shahid et al., J. Am. Geriatr. Soc. 2020, 68, 926-9.
Common symptoms of COVID-19 include fever or chills, cough, shortness of breath or difficulty breathing, fatigue, muscle or body aches, headache, loss of taste or smell, sore throat, congestion or runny nose, nausea or vomiting, and diarrhea. Id. Currently, there is no FDA-approved vaccine for COVID-19. Therefore, there is an urgent need for an immunization method to battle the COVID-19 pandemic.
SUMMARY OF THE DISCLOSURE
[0006] Provided herein is a method for preventing a person from being infected by a Group IV virus, comprising administrating to the person an effective amount of a poliomyelitis vaccine.
[0007] Also provided herein is a method for treating a person with an infectious disease caused by a Group IV virus, comprising administrating to the person an effective amount of a poliomyelitis vaccine.
[0008] Additionally, provided herein is a method of inducing a protective immune response against a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
[0009] Furthermore, provided herein is a method of inducing a protective gastrointestinal immune response against a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
[0010] Provided herein is a method of inducing an immune response protective against severe acute respiratory syndrome caused by an infection of a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
[0011] Provided herein is a method of reducing the severity of one or more symptoms of an infectious disease caused by a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001
[0012] Provided herein is a method of reducing the severity of one or more symptoms of severe acute respiratory syndrome caused by an infection of a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
[0013] Provided herein is a method of inhibiting replication of a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
BRIEF DESCRIPTION OF THE DRAWINGS
BRIEF DESCRIPTION OF THE DRAWINGS
[0014] FIG. 1 shows anti-SARS-CoV-2 RDRP antibody levels before and after poliovirus vaccine immunization of adult human subjects.
[0015] FIG. 2 shows anti-SARS-CoV-2 RDRP antibody levels before and during the COVID-19 pandemic from pediatric human subjects.
DETAILED DESCRIPTION
DETAILED DESCRIPTION
[0016] To facilitate understanding of the disclosure set forth herein, a number of terms are defined below.
[0017] Generally, the nomenclature used herein and the laboratory procedures in biochemistry, biology, immunology, virology, and pharmacology described herein are those well-known and commonly employed in the art. Unless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs.
[0018] The terms "treat," "treating," and "treatment" are meant to include alleviating or abrogating a disorder, disease, or condition, or one or more of the symptoms associated with the disorder, disease, or condition; or alleviating or eradicating the cause(s) of the disorder, disease, or condition itself.
[0019] The terms "prevent," "preventing," and "prevention" are meant to include a method of delaying and/or precluding the onset of a disorder, disease, or condition, and/or its Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 attendant symptoms; barring a person from acquiring a disorder, disease, or condition; or reducing a person's risk of acquiring a disorder, disease, or condition.
[0020] The terms "alleviate" and "alleviating" refer to easing or reducing one or more symptoms (e.g., pain) of a disorder, disease, or condition. The terms can also refer to reducing adverse effects associated with an active ingredient. Sometimes, the beneficial effects that a person derives from a prophylactic or therapeutic agent do not result in a cure of the disorder, disease, or condition.
[0021] The term "effective amount" or "immunologically effective amount"
is meant to include the amount of a vaccine that, when administered, is sufficient to prevent development of, or alleviate to some extent, one or more of the symptoms of the disorder, disease, or condition being prevented or alleviated.
is meant to include the amount of a vaccine that, when administered, is sufficient to prevent development of, or alleviate to some extent, one or more of the symptoms of the disorder, disease, or condition being prevented or alleviated.
[0022] The term "about" or "approximately" means an acceptable error for a particular value as determined by one of ordinary skill in the art, which depends in part on how the value is measured or determined. In certain embodiments, the term "about" or "approximately" means within 1, 2, or 3 standard deviations. In certain embodiments, the term "about" or "approximately" means within 25%, 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, or 0.05% of a given value or range.
[0023] In one embodiment, provided herein is a method for preventing a person from being infected by a Group IV virus, comprising administering to the person an effective amount of a poliomyelitis vaccine.
[0024] In another embodiment, provided herein is a method for treating a person with an infectious disease caused by a Group IV virus, comprising administering to the person an effective amount of a poliomyelitis vaccine.
[0025] In certain embodiments, the Group IV virus is an Arteriviridae, Astroviridae, Caliciviridae, Coronaviridae, Flaviviridae, Picornaviridae, or Togaviridae virus. In certain embodiments, the Group IV virus is an Arteriviridae, virus. In certain embodiments, the Group IV virus is an Astroviridae virus. In certain embodiments, the Group IV virus is a Caliciviridae virus. In certain embodiments, the Group IV virus is a Coronaviridae virus. In certain Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 embodiments, the Group IV virus is a Flaviviridae virus. In certain embodiments, the Group IV
virus is a Picornaviridae virus. In certain embodiments, the Group IV virus is a Togaviridae virus.
virus is a Picornaviridae virus. In certain embodiments, the Group IV virus is a Togaviridae virus.
[0026] In certain embodiments, the Group IV virus is an arterivirus, astrovirus, calicivirus, coronavirus, flavivirus, picornavirus, or togavirus. In certain embodiments, the Group IV virus is an arterivirus. In certain embodiments, the Group IV virus is an astrovirus. In certain embodiments, the Group IV virus is a calicivirus. In certain embodiments, the Group IV
virus is a coronavirus. In certain embodiments, the Group IV virus is a SARS
coronavirus. In certain embodiments, the Group IV virus is a COVID-19 coronavirus. In certain embodiments, the Group IV virus is a flavivirus. In certain embodiments, the Group IV virus is a picornavirus.
In certain embodiments, the Group IV virus is a togavirus.
virus is a coronavirus. In certain embodiments, the Group IV virus is a SARS
coronavirus. In certain embodiments, the Group IV virus is a COVID-19 coronavirus. In certain embodiments, the Group IV virus is a flavivirus. In certain embodiments, the Group IV virus is a picornavirus.
In certain embodiments, the Group IV virus is a togavirus.
[0027] In certain embodiments, the Group IV virus is a Betacoronavirus.
In certain embodiments, the Group IV virus is a Coronavirinae virus. In certain embodiments, the Coronaviridae virus is a severe acute respiratory syndrome coronavirus-1 (SARS-CoV-1), a severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), or a Middle East respiratory syndrome-related coronavirus (MERS-CoV). In certain embodiments, the Group IV
virus is a SARS-CoV-1. In certain embodiments, the Group IV virus is a SARS-CoV-2. In certain embodiments, the Group IV virus is a MERS-CoV.
In certain embodiments, the Group IV virus is a Coronavirinae virus. In certain embodiments, the Coronaviridae virus is a severe acute respiratory syndrome coronavirus-1 (SARS-CoV-1), a severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), or a Middle East respiratory syndrome-related coronavirus (MERS-CoV). In certain embodiments, the Group IV
virus is a SARS-CoV-1. In certain embodiments, the Group IV virus is a SARS-CoV-2. In certain embodiments, the Group IV virus is a MERS-CoV.
[0028] In certain embodiments, the infectious disease is caused by an Arteriviridae, Astroviridae, Caliciviridae, Coronaviridae, Flaviviridae, Picornaviridae, or Togaviridae virus.
In certain embodiments, the infectious disease is caused by an Arteriviridae, virus. In certain embodiments, the infectious disease is caused by an Astroviridae virus. In certain embodiments, the infectious disease is caused by a Caliciviridae virus. In certain embodiments, the infectious disease is caused by a Coronaviridae virus. In certain embodiments, the infectious disease is caused by a Flaviviridae virus. In certain embodiments, the infectious disease is caused by a Picornaviridae virus. In certain embodiments, the infectious disease is caused by a Togaviridae virus.
In certain embodiments, the infectious disease is caused by an Arteriviridae, virus. In certain embodiments, the infectious disease is caused by an Astroviridae virus. In certain embodiments, the infectious disease is caused by a Caliciviridae virus. In certain embodiments, the infectious disease is caused by a Coronaviridae virus. In certain embodiments, the infectious disease is caused by a Flaviviridae virus. In certain embodiments, the infectious disease is caused by a Picornaviridae virus. In certain embodiments, the infectious disease is caused by a Togaviridae virus.
[0029] In certain embodiments, the infectious disease is caused by an arterivirus, astrovirus, calicivirus, coronavirus, flavivirus, picornavirus, or togavirus.
In certain Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 embodiments, the infectious disease is caused by an arterivirus. In certain embodiments, the infectious disease is caused by an astrovirus. In certain embodiments, the infectious disease is caused by a calicivirus. In certain embodiments, the infectious disease is caused by a coronavirus. In certain embodiments, the infectious disease is caused by a SARS coronavirus (also known as a SARS-CoV-1). In certain embodiments, the infectious disease is caused by a COVID-19 coronavirus (also known as a SARS-CoV-2). In certain embodiments, the infectious disease is caused by a flavivirus. In certain embodiments, the infectious disease is caused by a picornavirus. In certain embodiments, the infectious disease is caused by a togavirus.
In certain Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 embodiments, the infectious disease is caused by an arterivirus. In certain embodiments, the infectious disease is caused by an astrovirus. In certain embodiments, the infectious disease is caused by a calicivirus. In certain embodiments, the infectious disease is caused by a coronavirus. In certain embodiments, the infectious disease is caused by a SARS coronavirus (also known as a SARS-CoV-1). In certain embodiments, the infectious disease is caused by a COVID-19 coronavirus (also known as a SARS-CoV-2). In certain embodiments, the infectious disease is caused by a flavivirus. In certain embodiments, the infectious disease is caused by a picornavirus. In certain embodiments, the infectious disease is caused by a togavirus.
[0030] In certain embodiments, the infectious disease is caused by a Betacoronavirus. In certain embodiments, the infectious disease is caused by a Coronavirinae virus. In certain embodiments, the infectious disease is caused by a SARS-CoV-1, SARS-CoV-2, or MERS-CoV.
In certain embodiments, the infectious disease is caused by a SARS-CoV-1. In certain embodiments, the infectious disease is caused by a SARS-CoV-2. In certain embodiments, the infectious disease is caused by a MERS-CoV.
In certain embodiments, the infectious disease is caused by a SARS-CoV-1. In certain embodiments, the infectious disease is caused by a SARS-CoV-2. In certain embodiments, the infectious disease is caused by a MERS-CoV.
[0031] In certain embodiments, the infections disease is coronavirus disease, which is also known as COVID-19. In certain embodiments, the infectious disease is severe acute respiratory syndrome.
[0032] In yet another embodiment, provided herein is a method of inducing a protective immune response against a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
[0033] In yet another embodiment, provided herein is a method of inducing a protective gastrointestinal immune response against a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
[0034] In yet another embodiment, provided herein is a method of inducing an immune response protective against severe acute respiratory syndrome caused by an infection of a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
[0035] In yet another embodiment, provided herein is a method of reducing the severity Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 of one or more symptoms of an infectious disease caused by a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine. In one embodiment, the infectious disease is severe acute respiratory syndrome.
[0036] In yet another embodiment, provided herein is a method of reducing the severity of one or more symptoms of severe acute respiratory syndrome caused by an infection of a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
[0037] In certain embodiments, the symptom of the severe acute respiratory syndrome is fever or chills, cough, shortness of breath or difficulty breathing, fatigue, muscle or body aches, headache, loss of taste or smell, sore throat, congestion or runny nose, nausea or vomiting, or diarrhea.
[0038] In still another embodiment, provided herein is a method of inhibiting replication of a Coronaviridae virus in a person, comprising administering to the person an immunologically effective amount of a poliomyelitis vaccine.
[0039] In certain embodiments, the Coronaviridae virus is a Coronavirinae virus. In certain embodiments, the Coronaviridae virus is a Betacoronavirus. In certain embodiments, the Coronaviridae virus is a SARS-CoV-1, SARS-CoV-2, or MERS-CoV. In certain embodiments, the Coronaviridae virus is a SARS-CoV-1. In certain embodiments, the Coronaviridae virus is a SARS-CoV-2. In certain embodiments, the Coronaviridae virus is a MERS-CoV.
[0040] In certain embodiments, the poliomyelitis vaccine is an inactivated poliomyelitis vaccine or an attenuated live poliomyelitis vaccine. In certain embodiments, the attenuated live poliomyelitis vaccine is an oral poliomyelitis vaccine (OPV).
[0041] In certain embodiments, the poliomyelitis vaccine is a monovalent, divalent, or trivalent poliomyelitis vaccine. In certain embodiments, the poliomyelitis vaccine is a monovalent poliomyelitis vaccine. In certain embodiments, the poliomyelitis vaccine is a divalent poliomyelitis vaccine. In certain embodiments, the poliomyelitis vaccine is a trivalent poliomyelitis vaccine.
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001
[0042] In certain embodiments, the poliomyelitis vaccine is an inactivated poliomyelitis vaccine (IPV). In certain embodiments, the poliomyelitis vaccine is an inactivated poliomyelitis vaccine comprising inactivated Type 1 (Mahoney) poliovirus, inactivated Type 2 (MEF-1) poliovirus, inactivated Type 3 (Saukett) poliovirus, or a mixture thereof. In certain embodiments, the poliomyelitis vaccine comprises inactivated Type 1 poliovirus. In certain embodiments, the poliomyelitis vaccine comprises inactivated Type 2 poliovirus. In certain embodiments, the poliomyelitis vaccine comprises inactivated Type 3 poliovirus. In certain embodiments, the poliomyelitis vaccine comprises inactivated Type 1 poliovirus, inactivated Type 2 poliovirus, and inactivated Type 3 poliovirus.
[0043] In certain embodiments, the poliomyelitis vaccine is IPOL . In certain embodiments, the poliomyelitis vaccine is an inactivated poliomyelitis vaccine comprising about 40 D antigen units of inactivated Type 1 poliovirus, about 8 D antigen units of inactivated Type 2 poliovirus, 32 D antigen units of inactivated Type 3 poliovirus, or a mixture thereof. In certain embodiments, the poliomyelitis vaccine is an inactivated poliomyelitis vaccine comprising about 40 D antigen units of inactivated Type 1 poliovirus. In certain embodiments, the poliomyelitis vaccine is an inactivated poliomyelitis vaccine comprising about 8 D antigen units of inactivated Type 2 poliovirus. In certain embodiments, the poliomyelitis vaccine is an inactivated poliomyelitis vaccine comprising 32 D antigen units of inactivated Type 3 poliovirus. In certain embodiments, the poliomyelitis vaccine is an inactivated poliomyelitis vaccine comprising about 40 D antigen units of inactivated Type 1 poliovirus, about 8 D antigen units of inactivated Type 2 poliovirus, and 32 D antigen units of inactivated Type 3 poliovirus.
[0044] In certain embodiments, the poliomyelitis vaccine is a monovalent, divalent, or trivalent inactivated poliomyelitis vaccine. In certain embodiments, the poliomyelitis vaccine is a monovalent inactivated poliomyelitis vaccine. In certain embodiments, the poliomyelitis vaccine is a divalent inactivated poliomyelitis vaccine. In certain embodiments, the poliomyelitis vaccine is a trivalent inactivated poliomyelitis vaccine.
[0045] In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine. In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising a Sabin poliovirus. In certain embodiments, the poliomyelitis Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus I, Sabin poliovirus II, Sabin poliovirus III, or a mixture thereof. In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus I
(LS-c, 2ab). In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus I, having a nucleic acid sequence disclosed in Nomoto et al., Proc. Nat'l. Acad. Sci. U.S.A. 1982, 79, 5793-7, the disclosure of which is incorporated herein by reference in its entirety. In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus II (P712, Ch, 2ab). In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus III (Leon 12ab). In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus I, Sabin poliovirus II, and Sabin poliovirus III.
(LS-c, 2ab). In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus I, having a nucleic acid sequence disclosed in Nomoto et al., Proc. Nat'l. Acad. Sci. U.S.A. 1982, 79, 5793-7, the disclosure of which is incorporated herein by reference in its entirety. In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus II (P712, Ch, 2ab). In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus III (Leon 12ab). In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus I, Sabin poliovirus II, and Sabin poliovirus III.
[0046] In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus I with a CCID50 of about 106, Sabin poliovirus II with a CCID50 of about 105, Sabin poliovirus III with a CCID50 of about 106, or a mixture thereof. In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus I with a CCID50 of about 106. In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus II
with a CCID50 of about 105. In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus III with a CCID50 of about 106. In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus I with a CCID50 of about 106, Sabin poliovirus II with a CCID50 of about 105, and Sabin poliovirus III with a CCID50 of about 106.
with a CCID50 of about 105. In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus III with a CCID50 of about 106. In certain embodiments, the poliomyelitis vaccine is an attenuated live poliomyelitis vaccine comprising Sabin poliovirus I with a CCID50 of about 106, Sabin poliovirus II with a CCID50 of about 105, and Sabin poliovirus III with a CCID50 of about 106.
[0047] In certain embodiments, the poliomyelitis vaccine is a monovalent, divalent, or trivalent attenuated live poliomyelitis vaccine. In certain embodiments, the poliomyelitis vaccine is a monovalent attenuated live poliomyelitis vaccine. In certain embodiments, the poliomyelitis vaccine is a divalent attenuated live poliomyelitis vaccine. In certain embodiments, the poliomyelitis vaccine is a trivalent attenuated live poliomyelitis vaccine.
[0048] In certain embodiments, the poliomyelitis vaccine is administered orally or Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 parenterally. In certain embodiments, the poliomyelitis vaccine is administered orally. In certain embodiments, the poliomyelitis vaccine is administered parenterally. In certain embodiments, the poliomyelitis vaccine is administered intradermally. In certain embodiments, the poliomyelitis vaccine is administered intramuscularly. In certain embodiments, the poliomyelitis vaccine is administered subcutaneously.
[0049] In certain embodiments, the inactivated poliomyelitis vaccine is administered orally or parenterally. In certain embodiments, the inactivated poliomyelitis vaccine is administered orally. In certain embodiments, the inactivated poliomyelitis vaccine is administered parenterally. In certain embodiments, the inactivated poliomyelitis vaccine is administered intradermally. In certain embodiments, the inactivated poliomyelitis vaccine is administered intramuscularly. In certain embodiments, the inactivated poliomyelitis vaccine is administered subcutaneously.
[0050] In certain embodiments, the attenuated live poliomyelitis vaccine is administered orally or parenterally. In certain embodiments, the attenuated live poliomyelitis vaccine is administered orally. In certain embodiments, the attenuated live poliomyelitis vaccine is administered parenterally. In certain embodiments, the attenuated live poliomyelitis vaccine is administered intradermally. In certain embodiments, the attenuated live poliomyelitis vaccine is administered intramuscularly. In certain embodiments, the attenuated live poliomyelitis vaccine is administered subcutaneously.
[0051] In certain embodiments, the poliomyelitis vaccine is administered from about 1 to about 50 times, from about 1 to about 20 times, from about 1 to about 10, or from about 1 to about 5 times in a lifetime. In certain embodiments, the poliomyelitis vaccine is administered from about 1 to about 50 times in a lifetime. In certain embodiments, the poliomyelitis vaccine is administered from about 1 to about 20 times in a lifetime. In certain embodiments, the poliomyelitis vaccine is administered from about 1 to about 10 in a lifetime.
In certain embodiments, the poliomyelitis vaccine is administered from about 1 to about 5 times in a lifetime.
In certain embodiments, the poliomyelitis vaccine is administered from about 1 to about 5 times in a lifetime.
[0052] In certain embodiments, the poliomyelitis vaccine is administered once or twice.
In certain embodiments, the poliomyelitis vaccine is administered once. In certain embodiments, Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 the poliomyelitis vaccine is administered once. In certain embodiments, the poliomyelitis vaccine is administered once as a booster dose. In certain embodiments, the poliomyelitis vaccine is administered once as a booster dose during a pandemic. In certain embodiments, the poliomyelitis vaccine is administered once as a booster dose during a COVID-19 pandemic.
In certain embodiments, the poliomyelitis vaccine is administered once. In certain embodiments, Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 the poliomyelitis vaccine is administered once. In certain embodiments, the poliomyelitis vaccine is administered once as a booster dose. In certain embodiments, the poliomyelitis vaccine is administered once as a booster dose during a pandemic. In certain embodiments, the poliomyelitis vaccine is administered once as a booster dose during a COVID-19 pandemic.
[0053] In certain embodiments, the poliomyelitis vaccine is administered twice within about a year, about 6 months, about 3 months, about 2 months, about 1 months, or about 14 days.
In certain embodiments, the poliomyelitis vaccine is administered twice within about a year. In certain embodiments, the poliomyelitis vaccine is administered twice within about 6 months. In certain embodiments, the poliomyelitis vaccine is administered twice within about 3 months. In certain embodiments, the poliomyelitis vaccine is administered twice within about 2 months. In certain embodiments, the poliomyelitis vaccine is administered twice within about 1 months. In certain embodiments, the poliomyelitis vaccine is administered twice within about 14 days.
In certain embodiments, the poliomyelitis vaccine is administered twice within about a year. In certain embodiments, the poliomyelitis vaccine is administered twice within about 6 months. In certain embodiments, the poliomyelitis vaccine is administered twice within about 3 months. In certain embodiments, the poliomyelitis vaccine is administered twice within about 2 months. In certain embodiments, the poliomyelitis vaccine is administered twice within about 1 months. In certain embodiments, the poliomyelitis vaccine is administered twice within about 14 days.
[0054] In certain embodiments, the poliomyelitis vaccine is administered twice with an interval ranging from about 7 days to about 6 months, from about 7 days to about 3 months, from about 7 days to about 2 months, or from about 7 days to about 1 month. In certain embodiments, the poliomyelitis vaccine is administered twice with an interval ranging from about 7 days to about 6 months. In certain embodiments, the poliomyelitis vaccine is administered twice with an interval ranging from about 7 days to about 3 months. In certain embodiments, the poliomyelitis vaccine is administered twice with an interval ranging from about 7 days to about 2 months. In certain embodiments, the poliomyelitis vaccine is administered twice with an interval ranging from about 7 days to about 1 month.
[0055] In certain embodiments, the poliomyelitis vaccine is administered twice with the first dose as a priming dose and the second dose as a booster dose. In certain embodiments, the poliomyelitis vaccine is administered twice with both doses as booster doses.
[0056] In certain embodiments, the person to be given the poliomyelitis vaccine is unvaccinated against a poliovirus. In certain embodiments, the unvaccinated person receives 1, 2, or 3 doses of the poliomyelitis vaccine. In certain embodiments, the unvaccinated person receives 1 dose of the poliomyelitis vaccine. In certain embodiments, the unvaccinated person receives 2 doses of the poliomyelitis vaccine within about 1 or about two months. In certain Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 embodiments, the unvaccinated person receives 3 doses of the poliomyelitis vaccine within about 3 months or about two years.
[0057] In certain embodiments, the person to be given the poliomyelitis vaccine is incompletely vaccinated against a poliovirus. In certain embodiments, the incompletely vaccinated person receives 1 or 2 doses of the poliomyelitis vaccine. In certain embodiments, the incompletely vaccinated person receives 1 dose of the poliomyelitis vaccine. In certain embodiments, the incompletely vaccinated person receives 2 doses of the poliomyelitis vaccine within about 1 or about two months.
[0058] In certain embodiments, the person to be given the poliomyelitis vaccine is completely vaccinated. In certain embodiments, the completely vaccinated person receives 1 dose of the poliomyelitis vaccine.
[0059] In certain embodiments, the immunologically effective amount of the inactivated poliomyelitis vaccine is ranging from about 1 to about 500, from about 2 to about 200, from about 5 to about 100, or from about 10 to about 100 D antigen units of an inactivated poliovirus.
In certain embodiments, the immunologically effective amount of the inactivated poliomyelitis vaccine is ranging from about 1 to about 500 D antigen units of an inactivated poliovirus. In certain embodiments, the immunologically effective amount of the inactivated poliomyelitis vaccine is ranging from about 2 to about 200 D antigen units of an inactivated poliovirus. In certain embodiments, the immunologically effective amount of the inactivated poliomyelitis vaccine is ranging from about 5 to about 100 D antigen units of an inactivated poliovirus. In certain embodiments, the immunologically effective amount of the inactivated poliomyelitis vaccine is ranging from about 10 to about 100 D antigen units of an inactivated poliovirus.
In certain embodiments, the immunologically effective amount of the inactivated poliomyelitis vaccine is ranging from about 1 to about 500 D antigen units of an inactivated poliovirus. In certain embodiments, the immunologically effective amount of the inactivated poliomyelitis vaccine is ranging from about 2 to about 200 D antigen units of an inactivated poliovirus. In certain embodiments, the immunologically effective amount of the inactivated poliomyelitis vaccine is ranging from about 5 to about 100 D antigen units of an inactivated poliovirus. In certain embodiments, the immunologically effective amount of the inactivated poliomyelitis vaccine is ranging from about 10 to about 100 D antigen units of an inactivated poliovirus.
[0060] In certain embodiments, the immunologically effective amount of the attenuated live poliomyelitis vaccine has a CCID50 ranging from about 1,000 to about 1010, from about 104 to about 108, or from about 105 to about 107. In certain embodiments, the immunologically effective amount of the attenuated live poliomyelitis vaccine has a CCID50 ranging from about 1,000 to about 1010. In certain embodiments, the immunologically effective amount of the attenuated live poliomyelitis vaccine has a CCID50 ranging from about 104 to about 108. In certain embodiments, the immunologically effective amount of the attenuated live poliomyelitis Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 vaccine has a CCID50 ranging from about 105 to about 107.
[0061] The disclosure will be further understood by the following non-limiting examples.
EXAMPLES
Example 1 Vaccination Against COVID-19 with Inactivated Poliomyelitis Vaccine
EXAMPLES
Example 1 Vaccination Against COVID-19 with Inactivated Poliomyelitis Vaccine
[0062] Four subjects each voluntarily took a booster dose of IPOL as recommended in the IPOL Label during the COVID-19 pandemic. Subject 1 (44-year-old, female) is a health care professional for more than 20 years. During the COVID-19 pandemic, Subject 1 had been exposed to COVID-19 on many occasions. Subject 1 and her family were planning to travel out of the country. Subject 1 encouraged the members of her family (Subject 2 -her husband (47-year-old), Subject 3 - her sister in her 50s, Subject 4 - her father (79-year-old), and Subject 5 -her mother (76-year-old)) to update all their immunizations prior to the travel. Subjects 1 and 3 to 5 received a booster dose of IPOL in June 2020 during the COVID19 pandemic, but Subject 2 decided not to receive a booster dose.
[0063] Subject 2 without receiving a booster dose became sick subsequently and was tested positive for COVID-19 shortly after. Subject 2 had since had unrelenting low-grade fevers (for more than five weeks), some confusion, and chronic weakness. Even though Subjects 1 and 3 to 5 had had frequent contact with Subject 2, none of them became ill.
[0064] Subjects 4 and 5, the parents of Subject 1, are elderly and in poor health. Subject 3, a sister of Subject 1, is also in poor health having a history of past stroke and cerebral palsy.
All three of them were vaccinated and continued to do well with no signs of illness despite contact with Subject 2.
Example 2 Vaccination Against COVID-19 with Inactivated Poliomyelitis Vaccine
All three of them were vaccinated and continued to do well with no signs of illness despite contact with Subject 2.
Example 2 Vaccination Against COVID-19 with Inactivated Poliomyelitis Vaccine
[0065] Subject A, a 70-year-old generally healthy female, received a booster dose of IPOL before travelling to Morocco in October 2019. Her husband, Subject B, a 69-year-old generally healthy male, received a booster dose of IPOL per advice of his physician on October Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 12, 2020. Subjects A and B were married and living together.
[0066] On October 14, 2020, their housekeeper had the symptoms of a dry throat, but continued to work in their house. While working in the house, the housekeeper wore a level 3 facemask, a face shield, and gloves. Subject A was in the house during the time when the housekeeper was working. The housekeeper was subsequently tested positive for COVID-19.
The housekeeper's husband was also tested and found to be negative at the time.
The housekeeper's husband was also tested and found to be negative at the time.
[0067] Five days after her exposure to the housekeeper, Subject A awoke with a sore throat, which started on October 16, 2020 and ran through October 19, 2020. On October 19, 2020, she was tested positive for COVID-19. On October 20, 2020, her symptoms resolved and she was tested again but negative. Subject B, who received a poliomyelitis vaccine booster dose recently, was tested negative for COVID-19 on October 14 and 24, 2020.
[0068] In summary, the two elderly subjects (Subjects A and B) were exposed to a COVID-19-positive housekeeper. Subject A, who had a poliomyelitis vaccine booster dose a year ago, developed mild symptoms and tested positive for COVID-19 by a PCT
test one day after exposure, but tested negative the following day using the same PCT test.
Subject B, who had a poliomyelitis vaccine booster dose recently, never developed symptoms and tested negative during the time.
Example 3 Vaccination Against COVID-19 with Inactivated Poliomyelitis Vaccine
test one day after exposure, but tested negative the following day using the same PCT test.
Subject B, who had a poliomyelitis vaccine booster dose recently, never developed symptoms and tested negative during the time.
Example 3 Vaccination Against COVID-19 with Inactivated Poliomyelitis Vaccine
[0069] A working place outbreak of COVID-19 with 6 employees occurred in a health care related facility. Five of the employees received a booster dose of IPOL , and the sixth employee, a young male adult, did not. Subsequently, the young adult contracted COVID-19 and brought the virus to the working place during the asymptomatic period. Few days later, he started showing some COVID-19 symptoms. The remaining five employees were tested positive for COVID-19 by PCR, but none of them showed any COVID-19 symptoms.
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 Example 4 Vaccination Against COVID-19 with Attenuated Live Poliomyelitis Vaccine
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 Example 4 Vaccination Against COVID-19 with Attenuated Live Poliomyelitis Vaccine
[0070] On the first week of December 2020, an adult was inoculated with 2 drops of an OPV solution. The adult met six people in a New Year's Eve party in Malaysia.
Few days later, all the six people contracted COVID-19. However, the male adult remained negative for COVID-19.
Example 5 Vaccination Against COVID-19 with Attenuated Live Poliomyelitis Vaccine
Few days later, all the six people contracted COVID-19. However, the male adult remained negative for COVID-19.
Example 5 Vaccination Against COVID-19 with Attenuated Live Poliomyelitis Vaccine
[0071] On the first week of December 2020, all adults in a family were inoculated with 2 drops of an OPV solution, except a pregnant woman. After a New Year family reunion party, the pregnant woman contracted COVID-19 with minor symptoms, and her inoculated husband living with her was tested negative for COVID-19 and had no COVID-19 symptoms.
Example 6 Preparation of A Recombinant RDRP
Example 6 Preparation of A Recombinant RDRP
[0072] A SARS-CoV-2 RDRP gene encoding region was amplified by PCR from a SARS-CoV-2 cDNA reverse-transcripted from a SARS-CoV-2 viral RNA and cloned into AMERIDX insect cell expression vector pADX50. After sequencing confirmation, the purified vector was transiently transfected into insect cell line Schneider 2 (S2). After induction by an ADX inducer, the RDRP protein expressed was purified by an affinity Ni-NTA column and further purified by DETA SEPHAROSE chromatography.
Example 7 Western Blot for Analyzing Human Anti-SARS-CoV-2 RDRP Antibodies
Example 7 Western Blot for Analyzing Human Anti-SARS-CoV-2 RDRP Antibodies
[0073] A recombinant poliovirus RDRP protein (SEQ ID NO: 1) and two recombinant SARS-CoV-2 RDRP proteins (SEQ ID NO: 2 and SEQ ID NO: 3) were mixed with an SDS-PAGE loading buffer and separated on a protein gel by electrophoresis. After the proteins on the gel were transferred onto a nitrocellulose membrane by electrophoresis, the membrane was blocked with 5% BSA and then treated with a diluted human serum sample to be analyzed for 30 Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 mins. The membrane was washed and incubated with goat anti-human IgG/IgA/IgM
conjugated with an HRP enzyme for 30 min. The membrane was washed and treated with a PIERCETM
ECL Western blotting substrate to generate chemiluminescence signals, which were detected and analyzed. Four subjects were analyzed using this assay and the results are summarized in Table 1, where the positive control is an individual who recently received a booster dose of IPOL .
Before Poliovirus Vaccination After Poliovirus Vaccination Subject Poliovirus SARS-CoV- Poliovirus SARS-CoV-2 (age, sex) Poliovirus Poliovirus 12 yrs., M 1 3 3 2.5 14 yrs., F 3 1 3 3 2.5 43 yrs., F 3 3 2.5 47 yrs., M 2 3 1.5 Positive Control 3 3 2.5 Example 8 ELISA Assay for Analyzing Human Anti-SARS-CoV-2 RDRP Antibodies
conjugated with an HRP enzyme for 30 min. The membrane was washed and treated with a PIERCETM
ECL Western blotting substrate to generate chemiluminescence signals, which were detected and analyzed. Four subjects were analyzed using this assay and the results are summarized in Table 1, where the positive control is an individual who recently received a booster dose of IPOL .
Before Poliovirus Vaccination After Poliovirus Vaccination Subject Poliovirus SARS-CoV- Poliovirus SARS-CoV-2 (age, sex) Poliovirus Poliovirus 12 yrs., M 1 3 3 2.5 14 yrs., F 3 1 3 3 2.5 43 yrs., F 3 3 2.5 47 yrs., M 2 3 1.5 Positive Control 3 3 2.5 Example 8 ELISA Assay for Analyzing Human Anti-SARS-CoV-2 RDRP Antibodies
[0074] A recombinant poliovirus RDRP protein (SEQ ID NO: 1) and two recombinant SARS-CoV-2 RDRP proteins (SEQ ID NO: 2 and SEQ ID NO: 3) were coated separately onto the wells of an ELISA plate by adding one of the proteins (100 t.L) in a coating buffer (100 mM
sodium carbonate) to a well. The ELISA plate was incubated at room temperature overnight or 4 hours at 37 C and then blocked with 5% BSA in a phosphate-buffered saline solution. A diluted human serum or plasma to be analyzed was added to wells and the plate was incubated at room temperature. After washed with an ELISA washing buffer, the plate was incubated with goat anti-human IgG/IgA/IgM conjugated with an HRP enzyme. A TMB substrate was added. The reaction was stopped by adding 2 M sulfuric acid. The plate was read with an ELISA plate reader. Four human subjects were analyzed for anti-SARS-CoV-2 RDRP antibodies and the results are summarized in Table 2.
sodium carbonate) to a well. The ELISA plate was incubated at room temperature overnight or 4 hours at 37 C and then blocked with 5% BSA in a phosphate-buffered saline solution. A diluted human serum or plasma to be analyzed was added to wells and the plate was incubated at room temperature. After washed with an ELISA washing buffer, the plate was incubated with goat anti-human IgG/IgA/IgM conjugated with an HRP enzyme. A TMB substrate was added. The reaction was stopped by adding 2 M sulfuric acid. The plate was read with an ELISA plate reader. Four human subjects were analyzed for anti-SARS-CoV-2 RDRP antibodies and the results are summarized in Table 2.
[0075] Additional sixty-nine serum samples from adult human subjects were analyzed for anti-SARS-CoV-2 RDRP antibodies, of which forty-eight were pre-poliovirus vaccination samples and twenty-one were post-poliovirus vaccination sample. For the analysis, each serum Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 sample was diluted by 1:250. The results are shown in FIG. 1. For comparison, fifty-seven serum samples from pediatric subjects were also analyzed similarly for anti-SARS-CoV-2 RDRP
antibodies, of which forty were pre-pandemic samples and seventeen were pandemic samples.
The results are shown in FIG. 2.
Subject Before Poliovirus After Poliovirus (age, sex) Vaccination Vaccination 12 yrs., M 1 3 14 yrs., F 1.5 2.5 43 yrs., F 1 3 47 yrs., M - 2 Example 9 Antiviral Activity Against Live SARS-CoV-2
antibodies, of which forty were pre-pandemic samples and seventeen were pandemic samples.
The results are shown in FIG. 2.
Subject Before Poliovirus After Poliovirus (age, sex) Vaccination Vaccination 12 yrs., M 1 3 14 yrs., F 1.5 2.5 43 yrs., F 1 3 47 yrs., M - 2 Example 9 Antiviral Activity Against Live SARS-CoV-2
[0076] Four serum samples (Samples 1, 2, 3, and 4) were tested for their antiviral activity against a live SARS-CoV-2 (the MEX-BC2/2020 strain). Sample 1 was a serum sample from an individual under 5-year-old. Sample 2 was a serum sample from an individual under 5-year-old.
Sample 3 was a serum from an individual (43 yrs., female) receiving a booster dose of IPOL in June 2020. Sample 4 was a serum from an individual (47 yrs., male) prior to the receipt of the booster dose. Two different assay protocols (Protocols 1 and 2) were used to evaluate antiviral activity.
Antiviral Assay - Protocol 1:
Sample 3 was a serum from an individual (43 yrs., female) receiving a booster dose of IPOL in June 2020. Sample 4 was a serum from an individual (47 yrs., male) prior to the receipt of the booster dose. Two different assay protocols (Protocols 1 and 2) were used to evaluate antiviral activity.
Antiviral Assay - Protocol 1:
[0077] To evaluate antiviral activity against SARS-CoV-2 (MEX-BC2/2020), a CPE-based antiviral assay was performed by infecting Vero E6 cells in the presence or absence of a serum sample. Infection of cells leads to significant cytopathic effect and cell death after 4 days of infection. In this assay, reduction of CPE in the presence of a serum sample was used to determine its antiviral activity. A viability assay was run in parallel for each serum sample.
[0078] Vero E6 cells were maintained in DMEM with 10% fetal bovine serum (FBS).
The cells were seeded and incubated for 24 h before being pre-incubated with a serum sample.
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 After cell culture was removed from the cells, each serum sample at serial dilutions was added to the cells and incubated for 1 h at 37 C in a humidified incubator. The cells were then challenged with the viral inoculum resuspended in DMEM with 2% FB S. The amount of viral inoculum was previously titrated to result in a linear inhibitory response by an antiviral with activity against SARS-CoV-2. The cells were incubated in the presence of the virus inoculum and a serum sample for 96 h. The cell viability was then determined using the neutral red uptake assay.
The cells were seeded and incubated for 24 h before being pre-incubated with a serum sample.
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 After cell culture was removed from the cells, each serum sample at serial dilutions was added to the cells and incubated for 1 h at 37 C in a humidified incubator. The cells were then challenged with the viral inoculum resuspended in DMEM with 2% FB S. The amount of viral inoculum was previously titrated to result in a linear inhibitory response by an antiviral with activity against SARS-CoV-2. The cells were incubated in the presence of the virus inoculum and a serum sample for 96 h. The cell viability was then determined using the neutral red uptake assay.
[0079] The virus-induced CPE was monitored under the microscope after 3 days of infection and at day 4, the cells were stained with neutral red to determine cell viability. Viable cells incorporate neutral red in their lysosomes. The uptake relies on the ability of live cells to maintain the pH inside the lysosomes lower than in the cytoplasm. This process requires ATP.
Inside the lysosome the dye becomes charged and is retained. After a 3 h incubation with neutral red (0.033%), the extra dye was washed and the neutral red taken by lysosomes was then extracted for 15 min with a solution containing 50% ethanol and 1% acetic acid to monitor absorbance at 540 nm.
Inside the lysosome the dye becomes charged and is retained. After a 3 h incubation with neutral red (0.033%), the extra dye was washed and the neutral red taken by lysosomes was then extracted for 15 min with a solution containing 50% ethanol and 1% acetic acid to monitor absorbance at 540 nm.
[0080] Each serum sample was evaluated in duplicates using serial 2-fold dilutions.
Controls included uninfected cells ("mock-infected"), and infected cells to which only vehicle was added. Full curves of positive plasma from convalescent patient (COV(+)) and GS-441524 were run as positive control inhibitors. GS-441524 is the main metabolite of remdesivir, a broad-spectrum antiviral that blocks the RNA polymerase of SARS-CoV-2.
Controls included uninfected cells ("mock-infected"), and infected cells to which only vehicle was added. Full curves of positive plasma from convalescent patient (COV(+)) and GS-441524 were run as positive control inhibitors. GS-441524 is the main metabolite of remdesivir, a broad-spectrum antiviral that blocks the RNA polymerase of SARS-CoV-2.
[0081] The average absorbance at 540 nm (A540) observed in infected cells (in the presence of vehicle alone) was calculated and then subtracted from all samples to determine the inhibition of the virus induced CPE. Data points were then normalized to the average A540 signal observed in uninfected cells ("mock") after subtraction of the absorbance signal observed in infected cells. In the neutral red CPE-based assay, uninfected cells remained viable and uptake the dye at higher levels than non-viable cells. In the absence of an antiviral agent, the virus-induced CPE kills infected cells and leads to lower A540 (this value equals 0% inhibition).
By contrast, incubation with an antiviral agent (COV(+) or GS-441524) prevents the virus induced CPE and leads absorbance levels similar to those observed in uninfected cells. Full Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 recovery of cell viability in infected cells represent 100% inhibition of virus replication.
Antiviral Assay - Protocol 2:
By contrast, incubation with an antiviral agent (COV(+) or GS-441524) prevents the virus induced CPE and leads absorbance levels similar to those observed in uninfected cells. Full Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 recovery of cell viability in infected cells represent 100% inhibition of virus replication.
Antiviral Assay - Protocol 2:
[0082] To evaluate antiviral activity against SARS-CoV-2 (MEX-BC2/2020), a CPE-based antiviral assay was performed by infecting Vero E6 cells in the presence or absence of a serum sample. Infection of cells leads to significant cytopathic effect and cell death after 4 days of infection. In this assay, reduction of CPE in the presence of a serum sample was used to determine its antiviral activity. A viability assay was run in parallel for each serum sample.
[0083] Vero E6 cells were maintained in DMEM with 10% fetal bovine serum (FBS).
The cells were seeded and incubated for 24 h before being pre-incubated with virus. After cell culture was removed from the cells, the cells were challenged with the viral inoculum resuspended in DMEM with 2% FBS for 3 h at 37 C in a humidified incubator.
The amount of viral inoculum was previously titrated to result in a linear inhibitory response by an antiviral with activity against SARS-CoV-2. Each serum sample at serial dilutions was then added the infected cells. The cells were incubated in the presence of the virus inoculum and a serum sample for 96 h. The cell viability was then determined using the neutral red uptake assay.
The cells were seeded and incubated for 24 h before being pre-incubated with virus. After cell culture was removed from the cells, the cells were challenged with the viral inoculum resuspended in DMEM with 2% FBS for 3 h at 37 C in a humidified incubator.
The amount of viral inoculum was previously titrated to result in a linear inhibitory response by an antiviral with activity against SARS-CoV-2. Each serum sample at serial dilutions was then added the infected cells. The cells were incubated in the presence of the virus inoculum and a serum sample for 96 h. The cell viability was then determined using the neutral red uptake assay.
[0084] The virus-induced CPE was monitored under the microscope after 3 days of infection and at day 4, the cells were stained with neutral red to determine cell viability. Viable cells incorporate neutral red in their lysosomes. The uptake relies on the ability of live cells to maintain the pH inside the lysosomes lower than in the cytoplasm. This process requires ATP.
Inside the lysosome the dye becomes charged and is retained. After a 3 h incubation with neutral red (0.033%), the extra dye was washed and the neutral red taken by lysosomes was then extracted for 15 min with a solution containing 50% ethanol and 1% acetic acid to monitor absorbance at 540 nm.
Inside the lysosome the dye becomes charged and is retained. After a 3 h incubation with neutral red (0.033%), the extra dye was washed and the neutral red taken by lysosomes was then extracted for 15 min with a solution containing 50% ethanol and 1% acetic acid to monitor absorbance at 540 nm.
[0085] Each serum sample was evaluated in duplicates using serial 2-fold dilutions.
Controls included uninfected cells ("mock-infected"), and infected cells to which only vehicle was added. Full curves of positive plasma from convalescent patient (COV(+)) and GS-441524 were run as positive control inhibitors. GS-441524 is the main metabolite of remdesivir, a broad-spectrum antiviral that blocks the RNA polymerase of SARS-CoV-2.
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001
Controls included uninfected cells ("mock-infected"), and infected cells to which only vehicle was added. Full curves of positive plasma from convalescent patient (COV(+)) and GS-441524 were run as positive control inhibitors. GS-441524 is the main metabolite of remdesivir, a broad-spectrum antiviral that blocks the RNA polymerase of SARS-CoV-2.
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001
[0086] The average absorbance at 540 nm (A540) observed in infected cells (in the presence of vehicle alone) was calculated and then subtracted from all samples to determine the inhibition of the virus induced CPE. Data points were then normalized to the average A540 signal observed in uninfected cells ("mock") after subtraction of the absorbance signal observed in infected cells. In the neutral red CPE-based assay, uninfected cells remained viable and uptake the dye at higher levels than non-viable cells. In the absence of an antiviral agent, the virus-induced CPE kills infected cells and leads to lower A540 (this value equals 0% inhibition).
By contrast, incubation with an antiviral agent (COV(+) or GS-441524) prevents the virus induced CPE and leads absorbance levels similar to those observed in uninfected cells. Full recovery of cell viability in infected cells represent 100% inhibition of virus replication.
Viability Assay:
By contrast, incubation with an antiviral agent (COV(+) or GS-441524) prevents the virus induced CPE and leads absorbance levels similar to those observed in uninfected cells. Full recovery of cell viability in infected cells represent 100% inhibition of virus replication.
Viability Assay:
[0087] Uninfected cells were incubated with the same eight concentrations of a serum sample as used in the antiviral assays. The incubation temperature and duration of the incubation period mirrored the conditions of the prevention of virus-induced CPE assay, and cell viability was evaluated with the same neutral red uptake method as used in the antiviral assays. The extent of viability was monitored by measuring absorbance at 540 nm. When analyzing the data, background levels obtained from wells with no cells were subtracted from all data-points.
Absorbance readout values were given as a percentage of the average signal observed in uninfected cells treated with vehicle alone.
Results:
Absorbance readout values were given as a percentage of the average signal observed in uninfected cells treated with vehicle alone.
Results:
[0088] Antiviral effect was observed for Samples 1 and 3 at 1:8 and 1:32 dilutions. The antiviral effect was stronger when the serum samples were pre-incubated with the Vero E6 cells (Protocol 1) than when the serum samples were added after viral adsorption (Protocol 2). In Protocol 1, Samples 2 and 3 brought the levels of neutral red uptake to about 25% and about 40%, respectively, as compared with uninfected cells. As expected, Samples 2 and 4 did not display significant inhibition of the virus-induced CPE in Protocol 1.
[0089] When the serum samples were assessed with Protocol 2, some prevention of the CPE was observed with Sample 4, but neutral red uptake only reached 25-30% of the level Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 observed in uninfected cells. No effect was observed with Samples 1, 2, and 3 when the serum samples were added after viral adsorption.
[0090] No cytotoxicity was observed in the viability assay at the concentrations evaluated for each serum sample.
[0091] Sequences described herein are provided in the sequence table below.
SEQUENCE TABLE
SEQ ID NO: Description Amino Acid Sequence EGSKEPAVLNPKDPRLKTDFEEAIFSKYTGNKIML
MDEYMEEAVDHYVGCLEPLDISVDPIPLESAMYG
MDGLEALDLTTSAGFPYLLQGKKKRDIFNRHTRDT
TEMTKMLEKYGVDLPFVTFVKDELRSREKVEKGK
SRLIEASSLNDSVAMRVAFGNLYATFHSNPGTATG
SAVGCDPDIFWSKIPILLDGEIFAFDYTGYDASLSPV
1 Poliovirus RDRP WFACLKKVLIKLGYTHQTSFIDYLCHSVHLYKDRK
YIVNGGMPSGS SGTSIFNTMINNIIIRTLLIRVYKGID
LDQFKMIAYGDDVIASYPHKIDPGLLAEAGKHYGL
VMTPADKGTSFVDTNWENVTFLKRYFRADDQYPF
LIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCYLA
WHNGEEAYDEFCRKIRSVPVGRALTLPAYSSLRRK
WLDSFLER
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAF
DIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYF
VVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFR
IDGDMVPHISRQRLTKYTMADLVYALRHFDEGNC
DTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRV
YANLGERVRQALLKTVQFCDAMRNAGIVGVLTLD
NQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLM
PILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEE
RLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCAN
FNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHF
RELGVVHNQDVNLHSSRLSFKELLVYAADPAMHA
(Full Length) DFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISD
YDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGG
CINANQVIVNNLDKSAGFPFNKWGKARLYYDSMS
YEDQDALFAYTKRNVIPTITQMNLKYAISAKNRAR
TVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGT
SKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDR
AMPNMLRIMASLVLARKHTTCCSLSHRFYRLANEC
AQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSV
FNICQAVTANVNALLSTDGNKIADKYVRNLQHRL
YECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDD
AVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSE
AKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLP
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 SEQ ID NO: Description Amino Acid Sequence YPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDA
YPLTKHPNQEYADVFHLYLQYIRKLHDELTGHML
DMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAF
DIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYF
VVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFR
IDGDMVPHISRQRLTKYTMADLVYALRHFDEGNC
- - YANLGERVRQALLKTVQFCDAMRNAGIVGVLTLD
NQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLM
PILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEE
RLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCAN
FNVLFSTVFPPTSFGPLVR
KIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRL
SFKELLVYAADPAMHAASGNLLLDKRTTCFSVAA
LTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSV
ELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLL
FVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGF
PFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTI
TQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQ
KLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYS
- - KHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLY
VKPGGTSSGDATTAYANSVFNICQAVTANVNALLS
TDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVN
EFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVAS
IKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFC
SQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIV
KTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHL
YLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYW
EPEFYEAMYTPHTVLQ
* * * * *
SEQUENCE TABLE
SEQ ID NO: Description Amino Acid Sequence EGSKEPAVLNPKDPRLKTDFEEAIFSKYTGNKIML
MDEYMEEAVDHYVGCLEPLDISVDPIPLESAMYG
MDGLEALDLTTSAGFPYLLQGKKKRDIFNRHTRDT
TEMTKMLEKYGVDLPFVTFVKDELRSREKVEKGK
SRLIEASSLNDSVAMRVAFGNLYATFHSNPGTATG
SAVGCDPDIFWSKIPILLDGEIFAFDYTGYDASLSPV
1 Poliovirus RDRP WFACLKKVLIKLGYTHQTSFIDYLCHSVHLYKDRK
YIVNGGMPSGS SGTSIFNTMINNIIIRTLLIRVYKGID
LDQFKMIAYGDDVIASYPHKIDPGLLAEAGKHYGL
VMTPADKGTSFVDTNWENVTFLKRYFRADDQYPF
LIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCYLA
WHNGEEAYDEFCRKIRSVPVGRALTLPAYSSLRRK
WLDSFLER
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAF
DIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYF
VVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFR
IDGDMVPHISRQRLTKYTMADLVYALRHFDEGNC
DTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRV
YANLGERVRQALLKTVQFCDAMRNAGIVGVLTLD
NQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLM
PILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEE
RLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCAN
FNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHF
RELGVVHNQDVNLHSSRLSFKELLVYAADPAMHA
(Full Length) DFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISD
YDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGG
CINANQVIVNNLDKSAGFPFNKWGKARLYYDSMS
YEDQDALFAYTKRNVIPTITQMNLKYAISAKNRAR
TVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGT
SKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDR
AMPNMLRIMASLVLARKHTTCCSLSHRFYRLANEC
AQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSV
FNICQAVTANVNALLSTDGNKIADKYVRNLQHRL
YECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDD
AVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSE
AKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLP
Date Recue/Date Received 2021-02-22 Attorney Docket No. 805A002W001 SEQ ID NO: Description Amino Acid Sequence YPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDA
YPLTKHPNQEYADVFHLYLQYIRKLHDELTGHML
DMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAF
DIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYF
VVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFR
IDGDMVPHISRQRLTKYTMADLVYALRHFDEGNC
- - YANLGERVRQALLKTVQFCDAMRNAGIVGVLTLD
NQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLM
PILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEE
RLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCAN
FNVLFSTVFPPTSFGPLVR
KIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRL
SFKELLVYAADPAMHAASGNLLLDKRTTCFSVAA
LTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSV
ELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLL
FVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGF
PFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTI
TQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQ
KLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYS
- - KHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLY
VKPGGTSSGDATTAYANSVFNICQAVTANVNALLS
TDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVN
EFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVAS
IKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFC
SQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIV
KTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHL
YLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYW
EPEFYEAMYTPHTVLQ
* * * * *
[0092] The examples set forth above are provided to give those of ordinary skill in the art with a complete disclosure and description of how to make and use the claimed embodiments, and are not intended to limit the scope of what is disclosed herein.
Modifications that are obvious to persons of skill in the art are intended to be within the scope of the following claims.
All publications, patents, and patent applications cited in this specification are incorporated herein by reference as if each such publication, patent or patent application were specifically and individually indicated to be incorporated herein by reference.
Date Recue/Date Received 2021-02-22
Modifications that are obvious to persons of skill in the art are intended to be within the scope of the following claims.
All publications, patents, and patent applications cited in this specification are incorporated herein by reference as if each such publication, patent or patent application were specifically and individually indicated to be incorporated herein by reference.
Date Recue/Date Received 2021-02-22
Claims (30)
1. A poliomyelitis vaccine for use in (i) preventing a person from an infection by a Coronaviridae virus, (ii) inducing a protective immune response in a person against a Coronaviridae virus, (iii) inducing an immune response in a person protective against severe acute respiratory syndrome caused by an infection of a Coronaviridae virus, or (iv) reducing the severity of one or more symptoms of an infectious disease caused by a Coronaviridae virus in a person.
2. The poliomyelitis vaccine for use of claim 1, wherein the poliomyelitis vaccine is for use in preventing a person from an infection by a Coronaviridae virus.
3. The poliomyelitis vaccine for use of claim 1 or 2, wherein the Coronaviridae virus is a Coronavirinae virus.
4. The poliomyelitis vaccine for use of any one of claims 1 to 3, wherein the Coronaviridae virus is a severe acute respiratory syndrome coronavirus-1, a severe acute respiratory syndrome coronavirus-2, or a Middle East respiratory syndrome-related coronavirus.
5. The poliomyelitis vaccine for use of any one of claims 1 to 4, wherein the Coronaviridae virus is a severe acute respiratory syndrome coronavirus-2.
6. The poliomyelitis vaccine for use of any one of claims 1 to 5, wherein the poliomyelitis vaccine is an inactivated poliomyelitis vaccine.
7. The poliomyelitis vaccine for use of claim 6, wherein the inactivated poliomyelitis vaccine comprises inactivated Type 1 (Mahoney) poliovirus, inactivated Type 2 (MEF-1) poliovirus, inactivated Type 3 (Saukett) poliovirus, or a mixture thereof.
8. The poliomyelitis vaccine for use of claim 6 or 7, wherein the inactivated poliomyelitis vaccine comprises inactivated Type 1 poliovirus, inactivated Type 2 poliovirus, and inactivated Type 3 poliovirus; or wherein the inactivated poliomyelitis vaccine comprises about 40 D antigen units of inactivated Type 1 poliovirus, about 8 D antigen units of inactivated Type 2 poliovirus, and 32 D antigen units of inactivated Type 3 poliovirus.
9. The poliomyelitis vaccine for use of any one of claims 1 to 5, wherein the Date Recue/Date Received 2021-03-10 poliomyelitis vaccine is an attenuated live poliomyelitis vaccine.
10. The poliomyelitis vaccine for use of claim 9, wherein the attenuated live poliomyelitis vaccine comprises Sabin poliovirus I, Sabin poliovirus II, Sabin poliovirus III, or a mixture thereof.
11. The poliomyelitis vaccine for use of claim 9 or 10, wherein the attenuated live poliomyelitis vaccine comprises Sabin poliovirus I, Sabin poliovirus II, and Sabin poliovirus III;
or wherein the attenuated live poliomyelitis vaccine comprises Sabin poliovirus I with a CCID50 of about 106, Sabin poliovirus II with a CCID50 of about 105, and Sabin poliovirus III with a CCID5o of about 106.
or wherein the attenuated live poliomyelitis vaccine comprises Sabin poliovirus I with a CCID50 of about 106, Sabin poliovirus II with a CCID50 of about 105, and Sabin poliovirus III with a CCID5o of about 106.
12. The poliomyelitis vaccine for use of any one of claims 1 to 11, wherein the poliomyelitis vaccine is formulated for oral or parenteral administration.
13. The poliomyelitis vaccine for use of any one of claims 1 to 12, wherein the poliomyelitis vaccine is formulated for oral administration.
14. The poliomyelitis vaccine for use of any one of claims 1 to 12, wherein the poliomyelitis vaccine is formulated for parenteral administration.
15. The poliomyelitis vaccine for use of any one of claims 1 to 12 and 14, wherein the poliomyelitis vaccine is formulated for intradermal, intramuscular, or subcutaneous administration.
16. Use of an attenuated or inactivated poliovirus in the manufacture of a vaccine for (i) preventing a person from an infection by a Coronaviridae virus, (ii) inducing a protective immune response in a person against a Coronaviridae virus, (iii) inducing an immune response in a person protective against severe acute respiratory syndrome caused by an infection of a Coronaviridae virus, or (iv) reducing the severity of one or more symptoms of an infectious disease caused by a Coronaviridae virus in a person.
17. The use of claim 16, wherein the vaccine is for preventing a person from an infection by a Coronaviridae virus.
Date Recue/Date Received 2021-03-10
Date Recue/Date Received 2021-03-10
18. The use of claim 16 or 17, wherein the Coronaviridae virus is a Coronavirinae virus.
19. The use of any one of claims 16 to 18, wherein the Coronaviridae virus is a severe acute respiratory syndrome coronavirus-1, a severe acute respiratory syndrome coronavirus-2, or a Middle East respiratory syndrome-related coronavirus.
20. The use of any one of claims 16 to 19, wherein the Coronaviridae virus is a severe acute respiratory syndrome coronavirus-2.
21. The use of any one of claims 16 to 20, wherein the poliovirus is an inactivated poliovirus.
22. The use of claim 21, wherein the inactivated poliovims comprises inactivated Type 1 (Mahoney) poliovirus, inactivated Type 2 (MEF-1) poliovirus, inactivated Type 3 (Saukett) poliovirus, or a mixture thereof.
23. The use of claim 21 or 22, wherein the inactivated poliovirus comprises inactivated Type 1 poliovirus, inactivated Type 2 poliovirus, and inactivated Type 3 poliovirus; or wherein the inactivated poliovirus comprises about 40 D antigen units of inactivated Type 1 poliovirus, about 8 D antigen units of inactivated Type 2 poliovirus, and 32 D antigen units of inactivated Type 3 poliovirus.
24. The use of any one of claims 16 to 20, wherein the poliovirus is an attenuated live poliovirus.
25. The use of claim 24, wherein the attenuated live poliovirus comprises Sabin poliovirus I, Sabin poliovirus II, Sabin poliovirus III, or a mixture thereof.
26. The use of claim 24 or 25, wherein the attenuated live poliovirus comprises Sabin poliovirus I, Sabin poliovirus II, and Sabin poliovirus III; or wherein the attenuated live poliovirus comprises Sabin poliovirus I with a CCID50 of about 106, Sabin poliovirus II
with a CCID50 of about 105, and Sabin poliovirus III with a CCID5o of about 106.
with a CCID50 of about 105, and Sabin poliovirus III with a CCID5o of about 106.
27. The use of any one of claims 16 to 26, wherein the vaccine is formulated for oral or parenteral administration.
Date Recue/Date Received 2021-03-10
Date Recue/Date Received 2021-03-10
28. The use of any one of claims 16 to 27, wherein the vaccine is formulated for oral administration.
29. The use of any one of claims 16 to 28, wherein the vaccine is formulated for parenteral administration.
30. The use of any one of claims 16 to 27 and 29, wherein the vaccine is formulated for intradermal, intramuscular, or subcutaneous administration.
Date Recue/Date Received 2021-03-10
Date Recue/Date Received 2021-03-10
Applications Claiming Priority (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202063008664P | 2020-04-11 | 2020-04-11 | |
US63/008,664 | 2020-04-11 | ||
US202063010678P | 2020-04-15 | 2020-04-15 | |
US63/010,678 | 2020-04-15 | ||
US202063013561P | 2020-04-22 | 2020-04-22 | |
US63/013,561 | 2020-04-22 | ||
US17/098,449 US20210322542A1 (en) | 2020-04-11 | 2020-11-15 | Vaccination against coronavirus with poliomyelitis vaccine |
US17/098,449 | 2020-11-15 | ||
PCT/US2021/014253 WO2021206783A1 (en) | 2020-04-11 | 2021-01-20 | Vaccination against coronavirus with poliomyelitis vaccine |
Publications (1)
Publication Number | Publication Date |
---|---|
CA3109897A1 true CA3109897A1 (en) | 2021-06-10 |
Family
ID=76321159
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA3109897A Pending CA3109897A1 (en) | 2020-04-11 | 2021-01-20 | Vaccination against coronavirus with poliomyelitis vaccine |
Country Status (4)
Country | Link |
---|---|
EP (1) | EP3914293B1 (en) |
JP (2) | JP2022524251A (en) |
CN (1) | CN115697397A (en) |
CA (1) | CA3109897A1 (en) |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1793852A1 (en) * | 2004-08-27 | 2007-06-13 | Panacea Biotec Ltd. | Inactivated poliomyelitis vaccine derived from sabin strain of polio virus |
-
2021
- 2021-01-20 JP JP2021520218A patent/JP2022524251A/en active Pending
- 2021-01-20 CA CA3109897A patent/CA3109897A1/en active Pending
- 2021-01-20 CN CN202180040947.3A patent/CN115697397A/en active Pending
- 2021-01-20 EP EP21705092.1A patent/EP3914293B1/en active Active
-
2023
- 2023-03-01 JP JP2023030909A patent/JP2023060048A/en active Pending
Also Published As
Publication number | Publication date |
---|---|
EP3914293A4 (en) | 2022-03-16 |
EP3914293B1 (en) | 2024-07-03 |
CN115697397A (en) | 2023-02-03 |
JP2022524251A (en) | 2022-05-02 |
JP2023060048A (en) | 2023-04-27 |
EP3914293A1 (en) | 2021-12-01 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Shi et al. | An overview of COVID-19 | |
Hotez et al. | The potential role of Th17 immune responses in coronavirus immunopathology and vaccine-induced immune enhancement | |
Halsey et al. | Search for poliovirus carriers among people with primary immune deficiency diseases in the United States, Mexico, Brazil, and the United Kingdom | |
Oliveira et al. | Immune response in COVID-19: What do we currently know? | |
Wu et al. | Immunity to avirulent enterovirus 71 and coxsackie A16 virus protects against enterovirus 71 infection in mice | |
US11590221B2 (en) | Dengue vaccine unit dose and administration thereof | |
Diaz-San Segundo et al. | Synonymous deoptimization of foot-and-mouth disease virus causes attenuation in vivo while inducing a strong neutralizing antibody response | |
Ruben et al. | Influenza in a partially immunized aged population: effectiveness of killed Hong Kong vaccine against infection with the England strain | |
US20210315988A1 (en) | Vaccination against coronavirus with poliomyelitis vaccine | |
Ferreira et al. | SARS-CoV-2, Zika viruses and mycoplasma: Structure, pathogenesis and some treatment options in these emerging viral and bacterial infectious diseases | |
Zhu et al. | Biological features of human influenza A (H3N8) viruses in China | |
US20220226462A1 (en) | Vaccination against coronavirus with poliomyelitis vaccine | |
EP3914293B1 (en) | Vaccination against coronavirus with poliomyelitis vaccine | |
Nomier et al. | Distinctive Therapeutic Strategies against Corona Virus19 (COVID-19): A Pharmacological Review. | |
Dhurvey et al. | Two worst pandemics-Spanish Flu and COVID-19: a review | |
Jati et al. | Coronavirus Diseases (COVID-19): Features, Epidemiology, Mutational Variations and Treatments Across India. | |
Varghese et al. | Pandemic of the era: covid-19–an overview | |
US11426461B2 (en) | Methods for preventing dengue and hepatitis A | |
Khodaparast et al. | Threats to Arrangements COVID-19 | |
Tarro | AntiCOVID-19 Vaccines for Children | |
Abdu et al. | Biological property of novel coronavirus SARS-CoV-2 (2019-nCoV) | |
Al Awwadi et al. | Research Open | |
Gall | Routine maternal immunizations for all pregnant women | |
Cascella et al. | Continuing Education Activity | |
Mishra et al. | Pharmaceutical and Nano Sciences |