CA3000549C - Haemophilus influenzae fusion protein and construction method and use thereof - Google Patents
Haemophilus influenzae fusion protein and construction method and use thereof Download PDFInfo
- Publication number
- CA3000549C CA3000549C CA3000549A CA3000549A CA3000549C CA 3000549 C CA3000549 C CA 3000549C CA 3000549 A CA3000549 A CA 3000549A CA 3000549 A CA3000549 A CA 3000549A CA 3000549 C CA3000549 C CA 3000549C
- Authority
- CA
- Canada
- Prior art keywords
- hid
- hin47
- protein
- linker
- haemophilus influenzae
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 241000606768 Haemophilus influenzae Species 0.000 title claims abstract description 99
- 229940047650 haemophilus influenzae Drugs 0.000 title claims abstract description 99
- 108020001507 fusion proteins Proteins 0.000 title claims abstract description 77
- 102000037865 fusion proteins Human genes 0.000 title claims abstract description 76
- 238000010276 construction Methods 0.000 title claims abstract description 14
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 97
- 108010060123 Conjugate Vaccines Proteins 0.000 claims abstract description 67
- 229940031670 conjugate vaccine Drugs 0.000 claims abstract description 62
- 150000004676 glycans Chemical class 0.000 claims abstract description 58
- 229920001282 polysaccharide Polymers 0.000 claims abstract description 58
- 239000005017 polysaccharide Substances 0.000 claims abstract description 58
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 58
- 102000036639 antigens Human genes 0.000 claims abstract description 40
- 108091007433 antigens Proteins 0.000 claims abstract description 39
- 239000000427 antigen Substances 0.000 claims abstract description 38
- 230000004927 fusion Effects 0.000 claims description 30
- 238000002360 preparation method Methods 0.000 claims description 18
- 229960005486 vaccine Drugs 0.000 claims description 18
- 239000000178 monomer Substances 0.000 claims description 17
- 239000000203 mixture Substances 0.000 claims description 13
- 239000002244 precipitate Substances 0.000 claims description 12
- 230000014509 gene expression Effects 0.000 claims description 11
- 238000000034 method Methods 0.000 claims description 10
- 238000012360 testing method Methods 0.000 claims description 10
- 108091006629 SLC13A2 Proteins 0.000 claims description 9
- 239000013604 expression vector Substances 0.000 claims description 9
- 239000006228 supernatant Substances 0.000 claims description 9
- 108010042407 Endonucleases Proteins 0.000 claims description 8
- 239000007788 liquid Substances 0.000 claims description 8
- 102000004533 Endonucleases Human genes 0.000 claims description 7
- 230000001131 transforming effect Effects 0.000 claims description 6
- 239000013598 vector Substances 0.000 claims description 6
- 238000009472 formulation Methods 0.000 claims description 5
- 102000012410 DNA Ligases Human genes 0.000 claims description 4
- 108010061982 DNA Ligases Proteins 0.000 claims description 4
- 238000012258 culturing Methods 0.000 claims description 4
- 238000001962 electrophoresis Methods 0.000 claims description 4
- 239000013612 plasmid Substances 0.000 claims description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 claims description 4
- 238000000527 sonication Methods 0.000 claims description 4
- 238000011144 upstream manufacturing Methods 0.000 claims description 4
- 201000009906 Meningitis Diseases 0.000 claims description 3
- 206010035664 Pneumonia Diseases 0.000 claims description 3
- 238000010367 cloning Methods 0.000 claims description 3
- 208000037386 Typhoid Diseases 0.000 claims description 2
- 239000004480 active ingredient Substances 0.000 claims description 2
- 239000007853 buffer solution Substances 0.000 claims description 2
- 208000001848 dysentery Diseases 0.000 claims description 2
- 101150067432 hid gene Proteins 0.000 claims description 2
- 239000000843 powder Substances 0.000 claims description 2
- 239000003755 preservative agent Substances 0.000 claims description 2
- 230000002194 synthesizing effect Effects 0.000 claims description 2
- 201000008297 typhoid fever Diseases 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims 1
- 230000005847 immunogenicity Effects 0.000 abstract description 27
- 102100037840 Dehydrogenase/reductase SDR family member 2, mitochondrial Human genes 0.000 abstract 1
- 101150007028 HTRA1 gene Proteins 0.000 abstract 1
- 101710188053 Protein D Proteins 0.000 abstract 1
- 101710132893 Resolvase Proteins 0.000 abstract 1
- 150000001413 amino acids Chemical group 0.000 description 14
- 230000003053 immunization Effects 0.000 description 11
- 238000002649 immunization Methods 0.000 description 11
- 108010078791 Carrier Proteins Proteins 0.000 description 10
- 102000014914 Carrier Proteins Human genes 0.000 description 10
- 238000000746 purification Methods 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 9
- 210000004027 cell Anatomy 0.000 description 9
- 238000006243 chemical reaction Methods 0.000 description 9
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 230000001580 bacterial effect Effects 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 5
- 230000028993 immune response Effects 0.000 description 5
- 208000015181 infectious disease Diseases 0.000 description 5
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 210000001541 thymus gland Anatomy 0.000 description 5
- 206010033078 Otitis media Diseases 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 238000000855 fermentation Methods 0.000 description 4
- 230000004151 fermentation Effects 0.000 description 4
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 238000007619 statistical method Methods 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 2
- 230000006820 DNA synthesis Effects 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 101001121408 Homo sapiens L-amino-acid oxidase Proteins 0.000 description 2
- 102100026388 L-amino-acid oxidase Human genes 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 244000052616 bacterial pathogen Species 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 208000035143 Bacterial infection Diseases 0.000 description 1
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 1
- 206010010741 Conjunctivitis Diseases 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 1
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 1
- 101001114076 Homo sapiens Paladin Proteins 0.000 description 1
- 101001041393 Homo sapiens Serine protease HTRA1 Proteins 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 206010027202 Meningitis bacterial Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 102100023224 Paladin Human genes 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 206010057190 Respiratory tract infections Diseases 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 108010022999 Serine Proteases Proteins 0.000 description 1
- 102000012479 Serine Proteases Human genes 0.000 description 1
- 102100021119 Serine protease HTRA1 Human genes 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 201000009904 bacterial meningitis Diseases 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229940031416 bivalent vaccine Drugs 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000005252 bulbus oculi Anatomy 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 241000902900 cellular organisms Species 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000012043 crude product Substances 0.000 description 1
- -1 cyano-4-dimethylaminopyridine tetrafluoroborate Chemical compound 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 229960003983 diphtheria toxoid Drugs 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000013020 final formulation Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 210000004201 immune sera Anatomy 0.000 description 1
- 229940042743 immune sera Drugs 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 230000006054 immunological memory Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 244000039328 opportunistic pathogen Species 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 208000020029 respiratory tract infectious disease Diseases 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 230000001502 supplementing effect Effects 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/285—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Pasteurellaceae (F), e.g. Haemophilus influenza
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/102—Pasteurellales, e.g. Actinobacillus, Pasteurella; Haemophilus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/646—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6068—Other bacterial proteins, e.g. OMP
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6087—Polysaccharides; Lipopolysaccharides [LPS]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Mycology (AREA)
- Biomedical Technology (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Communicable Diseases (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Abstract
Provided are a fusion protein and a construction method thereof. The fusion protein consists of: a Haemophilus influenzae protein D and a Hin47 (Htra) protein. The fusion protein can serve as a protein vehicle for a Haemophilus influenzae polysaccharide-protein conjugate vaccine, thereby increasing immunogenicity of a polysaccharide antigen.
Description
HAEMOPHILUS INFLUENZAE FUSION PROTEIN AND CONSTRUCTION
METHOD AND USE THEREOF
FIELD OF THE INVENTION
The present invention relates to the technical field of the development of vaccine products, in particular to a Haemophilus influenzae fusion protein and a construction method and use thereof.
BACKGROUND OF THE INVENTION
Haemophilus influenzae (Hi) is a class of non-motile, spore-free, rod-shaped Gram-negative bacilli that live in the respiratory tract of normal people and are opportunistic pathogens, mainly causing upper respiratory infections, otitis media and pneumonia, as well as sepsis, meningitis and other serious infections in children.
Haemophilus influenzae can be divided into capsular (typeable) and non-capsular (nontypeable). The capsular Haemophilus influenzae can be classified into 6 serotypes, a, b, c, d, e and f according to the components of the capsular polysaccharide. The non-capsular is also called nontypeable Haemophilus influenzae (NTHI).
Haemophilus influenzae invasive diseases occur all over the world.
Haemophilus influenzae serotype B (Hib) is the most toxic and the main pathogenic bacterium which can cause bacterial meningitis in children under 5 years of age. The incidence of Haemophilus influenzae serotype b has been declined significantly with the worldwide promotion and use of the Hib conjugate vaccine, which is developed CA 03000549 2018-03-29 , based on Haemophilus influenzae serotype b capsular polysaccharide. The capsular polysaccharide is the major antigenic substance of Haemophilus influenzae and may induce a protective immune response in the human body, however, the capsular polysaccharide is a thymus-independent antigen, which can only produce weak IgM
antibodies but does not lead to immune memory, and cannot effectively protect infants and children within 2 years of age. Vaccine developers conjugate the capsular polysaccharide to a protein carrier to form a polysaccharide-protein conjugate vaccine, wherein the protein carrier changes the polysaccharide antigen from the thymus-independent antigen to the thymus-dependent antigen, thereby activating T
helper lymphocytes and prompting B cells to produce specific IgG antibodies The Hib conjugate vaccine is now widely used in the world. However, the Hib conjugate vaccine is effective only against Haemophilus influenzae serotype b, and cannot prevent infections by other serotypes of Haemophilus influenzae and nontypeable Haemophilus influenzae, resulting in a substantial increase in the infection rates of other serotypes of Haemophilus influenzae and nontypeable Haemophilus influenzae.
For example, the nontypeable Haemophilus influenzae may cause otitis media (OM), the Egyptian biota of Haemophilus influenzae may cause epidemic conjunctivitis and Brazilian purpuric fever. Vaccines for the prevention of Haemophilus influenzae other than serotype b or nontypeable Haemophilus influenzae have not yet been approved so far in the world.
The D protein (HiD) is a lipoprotein on the surface of Haemophilus influenzae and has a relative molecular weight of 42 I(Da. The D protein is highly conserved in
METHOD AND USE THEREOF
FIELD OF THE INVENTION
The present invention relates to the technical field of the development of vaccine products, in particular to a Haemophilus influenzae fusion protein and a construction method and use thereof.
BACKGROUND OF THE INVENTION
Haemophilus influenzae (Hi) is a class of non-motile, spore-free, rod-shaped Gram-negative bacilli that live in the respiratory tract of normal people and are opportunistic pathogens, mainly causing upper respiratory infections, otitis media and pneumonia, as well as sepsis, meningitis and other serious infections in children.
Haemophilus influenzae can be divided into capsular (typeable) and non-capsular (nontypeable). The capsular Haemophilus influenzae can be classified into 6 serotypes, a, b, c, d, e and f according to the components of the capsular polysaccharide. The non-capsular is also called nontypeable Haemophilus influenzae (NTHI).
Haemophilus influenzae invasive diseases occur all over the world.
Haemophilus influenzae serotype B (Hib) is the most toxic and the main pathogenic bacterium which can cause bacterial meningitis in children under 5 years of age. The incidence of Haemophilus influenzae serotype b has been declined significantly with the worldwide promotion and use of the Hib conjugate vaccine, which is developed CA 03000549 2018-03-29 , based on Haemophilus influenzae serotype b capsular polysaccharide. The capsular polysaccharide is the major antigenic substance of Haemophilus influenzae and may induce a protective immune response in the human body, however, the capsular polysaccharide is a thymus-independent antigen, which can only produce weak IgM
antibodies but does not lead to immune memory, and cannot effectively protect infants and children within 2 years of age. Vaccine developers conjugate the capsular polysaccharide to a protein carrier to form a polysaccharide-protein conjugate vaccine, wherein the protein carrier changes the polysaccharide antigen from the thymus-independent antigen to the thymus-dependent antigen, thereby activating T
helper lymphocytes and prompting B cells to produce specific IgG antibodies The Hib conjugate vaccine is now widely used in the world. However, the Hib conjugate vaccine is effective only against Haemophilus influenzae serotype b, and cannot prevent infections by other serotypes of Haemophilus influenzae and nontypeable Haemophilus influenzae, resulting in a substantial increase in the infection rates of other serotypes of Haemophilus influenzae and nontypeable Haemophilus influenzae.
For example, the nontypeable Haemophilus influenzae may cause otitis media (OM), the Egyptian biota of Haemophilus influenzae may cause epidemic conjunctivitis and Brazilian purpuric fever. Vaccines for the prevention of Haemophilus influenzae other than serotype b or nontypeable Haemophilus influenzae have not yet been approved so far in the world.
The D protein (HiD) is a lipoprotein on the surface of Haemophilus influenzae and has a relative molecular weight of 42 I(Da. The D protein is highly conserved in
2 all Haemophilus influenzae strains (including Haemophilus influenzae with and without capsule), and is a specific antigen of human immunoglobulin D.
Although the D protein is effective in preventing otitis media caused by NTHi, HiD has a relatively low molecular weight and a weak immunogenicity.
Hin47 (also known as HtrA) is a heat shock protein expressed by Haemophilus influenzae under ambient pressure, which has serine protease activity. Hin47 is an important immune antigen, which can stimulate the body to produce B cells and T
cell responses as evidenced by experiments, and thus its immunogenicity has been fully confirmed.
SUMMARY OF THE INVENTION
The technical problem to be solved by the present invention is to provide a fusion protein Hin47-HiD as a protein carrier of conjugate vaccines.
Another technical problem to be solved by the present invention is to provide a method for the construction of the above-mentioned fusion protein.
Another technical problem to be solved by the present invention is to provide the use of the above-mentioned fusion protein Hin47-HiD, wherein the fusion protein is used as a protein carrier in the conjugate vaccine of Hia and Hib for the development of a universal Haemophilus influenzae conjugate vaccine.
In order to solve the above technical problems, the technical solution of the present invention is provided as follows:
a Haemophilus influenzae fusion protein which is obtainable by fusion of Haemophilus influenzae HiD protein and Haemophilus influenzae Hin47 protein,
Although the D protein is effective in preventing otitis media caused by NTHi, HiD has a relatively low molecular weight and a weak immunogenicity.
Hin47 (also known as HtrA) is a heat shock protein expressed by Haemophilus influenzae under ambient pressure, which has serine protease activity. Hin47 is an important immune antigen, which can stimulate the body to produce B cells and T
cell responses as evidenced by experiments, and thus its immunogenicity has been fully confirmed.
SUMMARY OF THE INVENTION
The technical problem to be solved by the present invention is to provide a fusion protein Hin47-HiD as a protein carrier of conjugate vaccines.
Another technical problem to be solved by the present invention is to provide a method for the construction of the above-mentioned fusion protein.
Another technical problem to be solved by the present invention is to provide the use of the above-mentioned fusion protein Hin47-HiD, wherein the fusion protein is used as a protein carrier in the conjugate vaccine of Hia and Hib for the development of a universal Haemophilus influenzae conjugate vaccine.
In order to solve the above technical problems, the technical solution of the present invention is provided as follows:
a Haemophilus influenzae fusion protein which is obtainable by fusion of Haemophilus influenzae HiD protein and Haemophilus influenzae Hin47 protein,
3 CA 03000549 2018-03-29 =
namely Hin47-HiD, wherein the amino acid sequence of Hin47 is the sequence shown in Sequence Listing <400> 1, and the amino acid sequence of HiD is the sequence shown in Sequence Listing <400> 3.
Preferably, the above-mentioned Haemophilus influenzae fusion protein is obtainable by fusion of Haemophilus influenzae HiD protein mutant and/or Haemophilus influenzae Hin47 protein mutant, the mutant each has 80% or more homology with the wild-type protein thereof, and the mutant can maintain immunogenicity of not less than 70% of that of the wild-type protein.
Preferably, the fusion gene expression system for the above-mentioned Haemophilus influenzae fusion protein includes, but is not limited to, a prokaryotic expression system, a eukaryotic expression system and a yeast expression system.
Preferably, for the above-mentioned Haemophilus influenzae fusion protein, the gene encoding Haemophilus influenzae HiD protein and the gene encoding Haemophilus influenzae Hin47 protein (monomer proteins constituting the fusion protein) include, but are not limited to, their wild types and mutants.
Preferably, in the above-mentioned Haemophilus influenzae fusion protein, the Hin47-HiD is obtainable by fusion of Hin47 and HiD in a 1: 1 ratio through a linker, and the linker enables the monomers of the Hin47 protein and the HiD protein to maintain their own unique conformations.
Preferably, in the above-mentioned Haemophilus influenzae fusion protein, the linker includes, but not limited to, G4S, DL or EL, wherein the linker enables the Hin47 protein and the HiD protein monomers to maintain their own unique
namely Hin47-HiD, wherein the amino acid sequence of Hin47 is the sequence shown in Sequence Listing <400> 1, and the amino acid sequence of HiD is the sequence shown in Sequence Listing <400> 3.
Preferably, the above-mentioned Haemophilus influenzae fusion protein is obtainable by fusion of Haemophilus influenzae HiD protein mutant and/or Haemophilus influenzae Hin47 protein mutant, the mutant each has 80% or more homology with the wild-type protein thereof, and the mutant can maintain immunogenicity of not less than 70% of that of the wild-type protein.
Preferably, the fusion gene expression system for the above-mentioned Haemophilus influenzae fusion protein includes, but is not limited to, a prokaryotic expression system, a eukaryotic expression system and a yeast expression system.
Preferably, for the above-mentioned Haemophilus influenzae fusion protein, the gene encoding Haemophilus influenzae HiD protein and the gene encoding Haemophilus influenzae Hin47 protein (monomer proteins constituting the fusion protein) include, but are not limited to, their wild types and mutants.
Preferably, in the above-mentioned Haemophilus influenzae fusion protein, the Hin47-HiD is obtainable by fusion of Hin47 and HiD in a 1: 1 ratio through a linker, and the linker enables the monomers of the Hin47 protein and the HiD protein to maintain their own unique conformations.
Preferably, in the above-mentioned Haemophilus influenzae fusion protein, the linker includes, but not limited to, G4S, DL or EL, wherein the linker enables the Hin47 protein and the HiD protein monomers to maintain their own unique
4 conformations.
Preferably, in the above-mentioned Haemophilus influenzae fusion protein, the linker is G4S with the sequence shown in Sequence Listing <400> 2.
Preferably, in the above-mentioned Haemophilus influenzae fusion protein, the composition form of a gene for the fusion protein is (n)Hin47-linker-(n)HiD, (n)HiD-linker-(n)Hin47, -linker-HiD-(Hin47-1 inker-HiD)n -linker-Hi n47-, -linker-Hin47-(HiD-linker-Hin47)n-linker-HiD-, wherein n is 1-3, representing the number of copies of the genes for the monomers.
Preferably, in the above-mentioned Haemophilus influenzae fusion protein, the composition form of the gene for the fusion protein is -linker-(Hin47-linker-HiD-linker)n-Hin47-, -linker-(HiD-linker-Hin47-linker)n -HiD-, wherein n is 1-3, representing the number of copies of the genes for the monomers.
Preferably, the above-mentioned Haemophilus influenzae fusion protein Hin47-HiD, as a protein carrier of a conjugate vaccine, can effectively improve the immunogenicity of a polysaccharide antigen.
Preferably, the above-mentioned Haemophilus influenzae fusion protein 11in47-HiD, can be used as a protein carrier in the development of the conjugate vaccines in which polysaccharide antigens are active ingredients, wherein the conjugate vaccines include, but not limited to, vaccines against Haemophilus influenzae, pneumonia, meningitis, dysentery, typhoid, and the like.
The present invention provides a broad-spectrum vaccine of Haemophilus influenzae polysaccharide-protein conjugate which is prepared by using one or more capsular polysaccharide(s) in Haemophilus influenzae serotype a, b, c, d, e and f as antigen(s), and Hin47- HID as a protein carrier.
Preferably, in the above-mentioned broad-spectrum vaccine of Haemophilus influenzae polysaccharide-protein conjugate, the polysaccharide antigen component can effectively prevent the corresponding Haemophilus influenzae serotype(s), and the protein carrier component can prevent the nontypeable Haemophilus influenzae.
Preferably, the above-mentioned broad-spectrum vaccine of Haemophilus influenzae polysaccharide-protein conjugate, is a bivalent conjugate vaccine comprising a conjugate of Hia with the protein carrier Hin47-HiD and a conjugate of Hib with the protein carrier Hin47-HiD.
Preferably, in the above-mentioned broad-spectrum vaccine of Haemophilus influenzae polysaccharide-protein conjugate, the formulation of the bivalent conjugate vaccine is in a liquid form or a freeze-dried powder, each dose containing 8-15 1.1g of polysaccharide serotype a, 8-15 tg of polysaccharide serotype b and 20-80 g of Hin47-HiD.
Preferably, in the above-mentioned broad-spectrum conjugate of Haemophilus influenzae polysaccharide-protein conjugate, the formulation of the bivalent conjugate vaccine is in a liquid form, each 0.5 ml dose containing 8-15 lug of polysaccharide serotype a, 8-15 g of polysaccharide serotype b and 20-80 g of Hin47-HiD.
Preferably, in the above-mentioned broad-spectrum vaccine of Haemophilus influenzae polysaccharide-protein conjugate, the bivalent conjugate vaccine contains no preservatives and may contain adjuvants, including but not limited to aluminum phosphate, and the buffer solution which is PB and NaC1, with a final concentration of 0.45% NaCl + 10 mM PB.
In yet another aspect, the present invention provides a Haemophilus influenzae fusion protein Hin47-HiD obtainable by fusion of Haemophilus influenzae HiD protein and Haemophilus influenzae Hin47 protein, wherein the amino acid sequence of Hin47 is the sequence of SEQ ID NO: 1, and the amino acid sequence of HiD is the sequence of SEQ ID NO: 3; or the fusion protein is obtainable by fusion of Haemophilus influenzae HiD protein mutant and/or Haemophilus influenzae Hin47 protein mutant, each said mutant having 80% or more identity with the wild-type protein thereof, wherein the mutant is selected to maintain immunogenicity of not less than 70% of that of the wild-type protein.
The above-mentioned method for the construction of the fusion protein involves specific steps as follows:
(1) DNA synthesis:
a fusion gene comprising one copy of the Hin47 gene and one copy of the HiD gene, with Hin47 in the upstream of HiD, and the designed restriction site in the 5' of the fusion gene being Ndel and in the 3' being BamH1;
(2) Cloning of the fusion gene on the T-vectror:
subjecting the fusion gene to double-digestion with NdeI and BamHI, ligating with a T vector double-digested with the same endonucleases through T4 DNA ligase, transforming into a DH5a competent cell, extracting the plasmid and confirming by PCR and double-digestion;
(3) Construction of the expression vector:
subjecting the T clone to double-digestion with NdeI and BamHI to obtain the fusion gene, ligating with pET9a double-digested with the same endonucleases, transforming into a BL21 competent cell, then verifying the expression vector by double-digestion and PCR;
(4) Testing of the expression:
picking a positive monoclonal colony, culturing in LB medium, centrifuging, collecting the precipitate, redissolving the precipitate with PBS, breaking by 7a sonication, and subjecting the supernatant to SDS-PAGE electrophoresis.
Preferably, the above-mentioned method for the construction of the fusion protein has the specific steps as follows:
(1) DNA synthesis:
synthesizing the Hin47-HiD fusion gene by Life Technologies Corporation, wherein the selected linker being G4S (GGGGS), the fusion gene comprising one copy of the gene for Hin47 and one copy of the gene for HiD, with Hin47 in the upstream of HiD, and the designed restriction site in the 5' of the fusion gene being Ndel and in the 3' being BamHI, wherein, the amino acid sequence of Hin47 being the sequence shown in Sequence Listing <400> 1, the amino acid sequence of the Linker being the sequence shown in Sequence Listing <400> 2, and the amino acid sequence of HiD being the sequence shown in Sequence Listing <400> 3, from which it can be seen that the Hin47-HiD fusion protein contains 790 aa and has a molecular weight of 87 I(Da;
The amino acid sequence of the Hin47-HiD fusion protein Amino acid sequence Hin47 MTLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPFLDDIPEEFKFFFGDRFAEQ
FGGRGESKRNFRGLGSGVIINASKGYVLTNNAVIDEADKITVQLQDGREFKAKLVGKDEL
SDIALVQLEKPSNLTEIKFADSDKLRVGDFTVAIGNPFGLGQTVTSGIVSALGRSTGSDS
GTYENYIQTDAAVNRGNSGGALVNLNGELIGINTAIISPSGGNAGIAFAIPSNQASNLVQ
QILEFGQVRIZGLLGIKGGELNADLAKAFNVSAQQGAFVSEVLPKSAAEKAGLKAGDIITA
MNGQKISSFAEIRAKIATTGAGKEISLTYLRDGKSHDVKMKLQADDSSQLSSKTELPALD
GATLKDYDAKGVKGIEITKIQPNSLAAQRGLKSGDIIIGINRQMIENIRELNKVLETEPS
AVALNILRGDSNFYLLVQ
Linker GGGGS
HiD DPSSHSSNIVIANTQMKSDKIIIAHRGASGYLPEHTLESKALAFAQQADYLEQDLAMTKDGR
LVVIHDHFLDGLTDVAKKFPHRHRKDGRYYVIDFTLICEIQSLEMTENFETKDGKQAQVYP
NRFPLWKSHFRIHTFEDEIEFIQGLEKSTGKKVGIYPEIKAPWFHHQNGKDIAAETLKVLKK
YGYDKKTDMVYLQTFDFNELKRIKTELLPQMGMDLKLVQLIAYTDWKETQEKDPKGYW
VNYNYDWMFKPGAMAEVVKYADGVGPGWYMLVNKEESKPDNIVYTPLVKELAQYNVE
VHPYTVRKDALPEFFTDVNQMYDALLNKSGATGVFTDFPDTGVEFLKGIK
(2) Cloning of the fusion gene on the T vector:
subjecting the fusion gene to double-digestion with NdeI and BamHI, ligating with a T vector double-digested with the same endonuclease through T4 DNA
ligase, transforming into a DH5a competent cell extracting the plasmid and identifying by PCR and double-digestion;
(3) Construction of the expression vector:
subjecting the T clone to double-digestion with NdeI and BamHI to obtain the fusion gene, ligating with pET9a double-digested with the same endonucleases, transforming into a BL21 competent cell, then confirming the expression vector by double-digestion and PCR;
(4) Testing of the expression:
picking a positive monoclonal colony, transferring to LB medium, culturing at 37 C while shaking at 200 rpm overnight, transferring to 50 ml fresh LB
medium, when 0D600=0.6-0.7, adding IPTG to a final concentration of 1 mM, inducing at 37 C for 4 hours, centrifuging and collecting the precipitate, redissolving the precipitate with PBS, breaking by sonication, subjecting the supernatant to SDS-PAGE electrophoresis. The results show that the constructed expression strain, when induced by IPTG, successfully expresses the target protein.
It should be noted that the techniques used in the above-mentioned construction and induction of the expression of the fusion protein Hin47-HiD are routine experimental procedures known to those skilled in the art and are available in published literature and in books.
The above-mentioned purification method of the fusion protein Hin47-HiD has the specific steps as follows:
(1) Bacterial fermentation fermenting bacteria by conventional methods, which can be found in the published literature or known to those skilled in the art; inoculating the bacterial cells in LB medium, shaking at 250 rpm overnight at 37 C; transferring the overnight culture to a 2L flask containing IL medium, when 0D600=0.6-0.7, adding IPTG to a final concentration of 1 mM, inducing expression for 4 hours, centrifuging at 8000rpm for 30 minutes and collecting the bacterial precipitate;
(2) Protein purification after the fermentation is completed, centrifuging and collecting the bacterial precipitate, redissolving the precipitate with PBS, breaking by sonication, centrifuging and collecting the supernatant, passing the supernatant through a Q
column, collecting the flowthrough liquid (the target protein flows through);
passing the Q column flowthrough liquid through a CHT column, using 150 mM PB + 170 mM NaC1 to wash the column, and 175 mM PB + 1 M NaC1 to elute the target protein.
The target protein with a purity of 80% or higher can be obtained by the two-step column purification and can be used in the subsequent development of the conjugate vaccine.
A preparation method of Hia and Hib bivalent conjugate vaccine has the specific steps as follows:
(1) Capsular polysaccharides purification and testing preparing the polysaccharide antigen by common methods, specifically including culturing Haemophilus influenzae by fermentation, subjecting the crude product to fractional precipitation with CTAB or ethanol, further recovering the capsular polysaccharide antigen by CL-4B gel separation, then dialyzing and freeze-drying;
the methods for the purification and identification of capsular polysaccharides of Haemophilus influenzae serotype a and serotype b can be found in the published literature;
(2) Preparation of the conjugate bulks of Hia and Hib preparation of the Hia conjugate vaccine: after adding serotype a capsular polysaccharide to CDAP (which is cyano-4-dimethylaminopyridine tetrafluoroborate) for 30s, adding 0.2 M TEA to adjust the pH to 9.5 to activate the polysaccharide for 2.5min; adjusting the pH to 9.0 and then adding the carrier protein according to the ratio of polysaccharide to protein of 1: 1, reacting at room temperature for lh, keeping the resulting mixture at 4 C overnight, then adding 2 M glycine to terminate the reaction; dialyzing to remove the reaction reagents, separating and purifying the conjugate by CL-4B gel; or preparation of the Hib conjugate vaccine: after adding serotype b capsular polysaccharide to CDAP for 30 s, adding 0.2 M TEA to adjust the pH to 9.5 to activate the polysaccharide for 2.5min, adjusting the pH to 9.0 and then adding the carrier protein according to the ratio of polysaccharide to protein of 1:1, reacting at room temperature for lh, keeping the resulting mixture at 4 C overnight, adding 2 M
glycine to terminate the reaction; dialyzing to remove the reaction reagents, separating and purifying the conjugate by CL-4B gel;
(3) Preparation of Hia and Hib bivalent conjugate vaccine the recommended final lot preparation contains 10 ug (polysaccharide content) of Hia and Hib conjugate, 0.45% NaC1 and 10 mM PB per dose; the product prepared based on above mentioned formulation can provide sufficient protection for the immunized population;
according to the final formulation and the concentration of the conjugate bulk, calculating the required amount of the conjugate bulk; taking the predetermined amount of conjugate bulk, adding PB and NaCl and then supplementing WFI so that the final concentration of Hia and Hib in the conjugate is 20 ug/ml (polysaccharide content), the final concentration of NaC1 is 0.9%, and the final concentration of PB is 20 mM; distributingto obtain the final lot;
(4) Immunogenicity study of bivalent conjugate vaccine of Hia and Hib the animals can produce antibody reactions against Hia capsular polysaccharide and Hib capsular polysaccharide, and antibody reaction against the carrier protein can also be generated after being immunized with the above-mentioned Hia and Hib bivalent conjugate vaccine in a 1/4 dose (125 I); wherein the antibody against Hia capsular polysaccharide can effectively prevent Haemophilus influenzae serotype a, the antibody against Hib capsular polysaccharide can effectively prevent Haemophilus influenzae serotype b, and the antibody against the carrier protein (Hin47, HiD) can effectively prevent non-typeable Haemophilus influenzae.
The beneficial effects of the present invention are as follows:
the Hin47-HiD fusion protein can effectively enhance the immunogenicity of individual protein antigen of Hin47 and HiD; furthermore, the fusion protein Hin47-HiD can effectively enhance the immunogenicity of the polysaccharide antigens as a protein carrier of the conjugate vaccine; the fusion protein Hin47-HiD
can be used as a protein carrier of the conjugate vaccine to develop a Hia conjugate vaccine, a Hib conjugate vaccine, and a bivalent vaccine containing the Hia conjugate vaccine and Hib conjugate vaccine.
BRIEF DESCRIPTION OF TIM DRAWINGS
FIG1 illustrates the testing of the expression of the fusion protein;
FIG.2 illustrates the purification process of the fusion protein Ilin47-HiD;
FIG.3 illustrates the comparison between immunogenicity of Hin47 and HiD
FIG.4 illustrates the comparison of anti-11in47 immunogenicity between Hin47 and Hin47-HiD, wherein, the immunization dose of the Hin47 monomer in the fusion protein Hin47-HiD is the same as that of the Hin47 antigen in the control group, wherein L, M and H indicate that the dose of the Hin47 monomer antigen (including Hin47 in control group) in fusion protein Hin47-HiD is 1 lag, 5 g and 10 1.1g, respectively;
FIG.5 illustrates the comparison of anti-HiD immunogenicity between HiD and Hin47-HiD, wherein the immunization dose of the HiD monomer in the fusion protein Hin47-HiD is the same as that of the HiD antigen in the control group, wherein L, M and H indicate that the dose of the HiD monomer antigen (including HiD in the control group) in the fusion protein Hin47-HiD is 1 ttg, 5 fig and 10 ug, respectively;
FIG.6 illustrates the purification process ofFlia conjugate;
FIG.7 illustrates the purification process of Hib conjugate.
DETAILED DESCRIPTION OF THE INVENTION
The technical solution of the present invention is further described below with reference to specific examples.
Example 1: Preparation of the fusion protein Hin47-HiD
(1) Construction of the Hin47-HiD expression vector The Hin47-HiD fusion gene was synthesized by Life Technologies Corporation, wherein the selected linker was G4S (GGGGS), the fusion gene comprised one copy of the gene for Hin47 and one copy of the gene for HiD, with Hin47 in the upstream of HiD, and the designed restriction site in the 5' of the fusion gene being NdeI and in the 3' being BamHI, wherein the amino acid sequence of Hin47 was the sequence shown in Sequence Listing <400> 1, the amino acid sequence of the Linker was the sequence shown in Sequence Listing <400> 2, and the amino acid sequence of the HiD was the sequence shown in Sequence Listing <400> 3, see Table 1 below for details.
Table 1 Amino acid sequence of fusion protein Hin47-HiD
Amino acid sequence Hifl47 MTLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPFLDDIPEEFKFFFGDR
FAEQ
FGGRGESKRNFRGLGSGVIINASKGYVLTNNAVIDEADKITVQLQDGREFKAKIN
GKDEL
SDIALVQLEKPSNLTEIKFADSDKLRVGDFTVAIGNPFGLGQTVTSGIVSALGRSTG
SDS
GTYENYIQTDAAVNRGNSGGALVNLNGELIGINTAIISPSGGNAGIAFAIPSNQASN
LVQ
QILEFGQVRROLLGIKGGELNADLAKAFNVSAQQGAFVSEVLPKSAAEKAGLKA
GDIITA
MNGQKISSFAEIRAKIATTGAGKEISLTYLRDGKSHDVKMKLQADDS SQLSSKTEL
PALD
GATLKDYDAKGVKGIEITKIQPNSLAAQRGLKSGDIIIGINRQMIENIRELNKVLET
EPS
AVALNILRGDSNFYLLVQ
Linker GGGGS
HiD DPSSHSSNMANTQMKSDKIIIAHRGASGYLPEHTLESKALAFAQQADYLEQDLAM
TKDGR
INVINTITTPLDGLTDVAKKFPHRHRKDGRYYVIDFTLKEIQSLEMTENFETKDGKQ
AQVYPNRFPLWKSHFRIHTFEDEIEFIQGLEKSTGKKVGIYPEIKAPWFHHQNGKD
IAAETLKVLKKYGYDKKTDMVYLQTEDFNELKRIKTELLPQMGMDLKLVQLIAY
TDWKETQEKDPKGYWYNYNYDWMFKPGAMAEVVKYADGVGPGWYMLVNKE
ESKPDNIVYTPLVKELAQYNVEVHPYTVRKDALPEFFTDVNQMYDALLNKSGAT
GVFTDFPDTGVEFLKGIK
As can be seen from Table 1, the Hin47-HiD fusion protein contains 790 aa and has a molecular weight of 87 lcD.
The fusion gene was double-digested with NdeI and RamHI, ligated with a T
vector double-digested with the same endonucleases using T4 DNA ligase, the resulting plasmid was transformed into DH5a competent cells, and extracted and verified by PCR and double-digestion.
The T clone was double-digested with Ndel and BamHI to obtain the fusion gene, which was ligated with pET9a double-digested with the same endonucleases, the fusion gene on the expression plasmid was transformed into BL2 1 competent cells, and the expression vector was confirmed by double-digestion and PCR.
The positive monoclonal colonies were picked, transferred to LB medium, cultured at 37 C and shaken at 200 rpm overnight, transferred to 50 ml fresh LB
medium, when 0D600=0.6-0.7, IPTG at a final concentration of 1 mM was added, and after induction at 37 C for 4 hours, the cell pellet was collected by centrifugation.
The precipitate was redissolved with PBS and sonicated, and the supernatant was subjected to SDS-PAGE electrophoresis to analyze whether the protein was expressed, the result is shown in FIG1:
FIG.1 shows that the fusion protein was highly expressed in the supernatant.
It should be noted that the techniques used in the construction of the expression vector for the fusion protein Hin47-HiD and the induced expression are routine experimental procedures known to those skilled in the art and are available in published literature and in books.
(2) Purification of the fusion protein Hin47-HiD
The bacterial cells expressing Hin47-HiD were grown overnight, and then transferred to fermentation medium. When 0D600=0.6-0.7, IPTG was added to a final concentration of 1 mM, and after induction at 37 C for 4 hours, the bacteria was subjected to centrifugation to collect precipitate.
The precipitate was redissolved with PBS, sonicated, and centrifuged to collect the supernatant. The supernatant was passed through a Q column to collect the flowthrough liquid (the target protein flowed through), then the Q column flowthrough liquid was passed through a CHT column, and 150 mM PB + 170 mM
NaCl was used to wash the column, and 175 mM PB + 1 M NaC1 was used to elute the target protein. The purification process is advantageous since it has simple steps, can make use of conventional fillers, and can produce the target protein with the purity of 80% or higher with only two steps. The result is shown in FIG. 2.
As can be seen from FIG 2, the target protein with a purity of 80% or higher can be obtained by the two-step column purification.
Example 2: Study on immunogenicity of the fusion protein Hin47-HiD
BALB/C mouse was immunized with the fusion protein Hin47-HiD three times at intervals of two weeks to study its immunogenicity, with Hin47 and HiD as controls.
Whole blood was collected 14 days after the last immunization, and serum antibody levels were tested.
In the control groups, the immunization doses of the Hin47 or HiD protein antigen were 1 g, 5 g and 10 pg, respectively, while in the immunization group of the fusion protein, the doses of the protein monomer were 1 pg, 5 g and 10 g, respectively.
The mice were immunized with Hin47 and HiD antigens in three doses of 1 pg, lAg and 10 pg, respectively, and the antibody titers of the three immune sera were tested with the corresponding antigens, the results are shown in FIG 3.
Statistical analysis:
P(Hin47 1 HiD 1 pg)=-0.000<0.01 P(Hin47 5 pg: HiD 5 .i.g)=---0.000<0.01 P(Hin47 10 pg: HiD 10 pg)=0.000<0.01 The results showed that Hin47 generates a stronger immune response than HiD
at the same dose.
The immunogenicity of the fusion protein Hin47-HiD was studied in three doses, and the actual immunization dose of the protein monomer in the fusion protein was the same as that of the control antigen (Hin47 or HiD). In the comparison experiment for the immunogenicity between Hin47-HiD and Hin47, the three groups L, M and H
represented the doses of Hin47 monomer antigen in the fusion protein of 1 [tg,
Preferably, in the above-mentioned Haemophilus influenzae fusion protein, the linker is G4S with the sequence shown in Sequence Listing <400> 2.
Preferably, in the above-mentioned Haemophilus influenzae fusion protein, the composition form of a gene for the fusion protein is (n)Hin47-linker-(n)HiD, (n)HiD-linker-(n)Hin47, -linker-HiD-(Hin47-1 inker-HiD)n -linker-Hi n47-, -linker-Hin47-(HiD-linker-Hin47)n-linker-HiD-, wherein n is 1-3, representing the number of copies of the genes for the monomers.
Preferably, in the above-mentioned Haemophilus influenzae fusion protein, the composition form of the gene for the fusion protein is -linker-(Hin47-linker-HiD-linker)n-Hin47-, -linker-(HiD-linker-Hin47-linker)n -HiD-, wherein n is 1-3, representing the number of copies of the genes for the monomers.
Preferably, the above-mentioned Haemophilus influenzae fusion protein Hin47-HiD, as a protein carrier of a conjugate vaccine, can effectively improve the immunogenicity of a polysaccharide antigen.
Preferably, the above-mentioned Haemophilus influenzae fusion protein 11in47-HiD, can be used as a protein carrier in the development of the conjugate vaccines in which polysaccharide antigens are active ingredients, wherein the conjugate vaccines include, but not limited to, vaccines against Haemophilus influenzae, pneumonia, meningitis, dysentery, typhoid, and the like.
The present invention provides a broad-spectrum vaccine of Haemophilus influenzae polysaccharide-protein conjugate which is prepared by using one or more capsular polysaccharide(s) in Haemophilus influenzae serotype a, b, c, d, e and f as antigen(s), and Hin47- HID as a protein carrier.
Preferably, in the above-mentioned broad-spectrum vaccine of Haemophilus influenzae polysaccharide-protein conjugate, the polysaccharide antigen component can effectively prevent the corresponding Haemophilus influenzae serotype(s), and the protein carrier component can prevent the nontypeable Haemophilus influenzae.
Preferably, the above-mentioned broad-spectrum vaccine of Haemophilus influenzae polysaccharide-protein conjugate, is a bivalent conjugate vaccine comprising a conjugate of Hia with the protein carrier Hin47-HiD and a conjugate of Hib with the protein carrier Hin47-HiD.
Preferably, in the above-mentioned broad-spectrum vaccine of Haemophilus influenzae polysaccharide-protein conjugate, the formulation of the bivalent conjugate vaccine is in a liquid form or a freeze-dried powder, each dose containing 8-15 1.1g of polysaccharide serotype a, 8-15 tg of polysaccharide serotype b and 20-80 g of Hin47-HiD.
Preferably, in the above-mentioned broad-spectrum conjugate of Haemophilus influenzae polysaccharide-protein conjugate, the formulation of the bivalent conjugate vaccine is in a liquid form, each 0.5 ml dose containing 8-15 lug of polysaccharide serotype a, 8-15 g of polysaccharide serotype b and 20-80 g of Hin47-HiD.
Preferably, in the above-mentioned broad-spectrum vaccine of Haemophilus influenzae polysaccharide-protein conjugate, the bivalent conjugate vaccine contains no preservatives and may contain adjuvants, including but not limited to aluminum phosphate, and the buffer solution which is PB and NaC1, with a final concentration of 0.45% NaCl + 10 mM PB.
In yet another aspect, the present invention provides a Haemophilus influenzae fusion protein Hin47-HiD obtainable by fusion of Haemophilus influenzae HiD protein and Haemophilus influenzae Hin47 protein, wherein the amino acid sequence of Hin47 is the sequence of SEQ ID NO: 1, and the amino acid sequence of HiD is the sequence of SEQ ID NO: 3; or the fusion protein is obtainable by fusion of Haemophilus influenzae HiD protein mutant and/or Haemophilus influenzae Hin47 protein mutant, each said mutant having 80% or more identity with the wild-type protein thereof, wherein the mutant is selected to maintain immunogenicity of not less than 70% of that of the wild-type protein.
The above-mentioned method for the construction of the fusion protein involves specific steps as follows:
(1) DNA synthesis:
a fusion gene comprising one copy of the Hin47 gene and one copy of the HiD gene, with Hin47 in the upstream of HiD, and the designed restriction site in the 5' of the fusion gene being Ndel and in the 3' being BamH1;
(2) Cloning of the fusion gene on the T-vectror:
subjecting the fusion gene to double-digestion with NdeI and BamHI, ligating with a T vector double-digested with the same endonucleases through T4 DNA ligase, transforming into a DH5a competent cell, extracting the plasmid and confirming by PCR and double-digestion;
(3) Construction of the expression vector:
subjecting the T clone to double-digestion with NdeI and BamHI to obtain the fusion gene, ligating with pET9a double-digested with the same endonucleases, transforming into a BL21 competent cell, then verifying the expression vector by double-digestion and PCR;
(4) Testing of the expression:
picking a positive monoclonal colony, culturing in LB medium, centrifuging, collecting the precipitate, redissolving the precipitate with PBS, breaking by 7a sonication, and subjecting the supernatant to SDS-PAGE electrophoresis.
Preferably, the above-mentioned method for the construction of the fusion protein has the specific steps as follows:
(1) DNA synthesis:
synthesizing the Hin47-HiD fusion gene by Life Technologies Corporation, wherein the selected linker being G4S (GGGGS), the fusion gene comprising one copy of the gene for Hin47 and one copy of the gene for HiD, with Hin47 in the upstream of HiD, and the designed restriction site in the 5' of the fusion gene being Ndel and in the 3' being BamHI, wherein, the amino acid sequence of Hin47 being the sequence shown in Sequence Listing <400> 1, the amino acid sequence of the Linker being the sequence shown in Sequence Listing <400> 2, and the amino acid sequence of HiD being the sequence shown in Sequence Listing <400> 3, from which it can be seen that the Hin47-HiD fusion protein contains 790 aa and has a molecular weight of 87 I(Da;
The amino acid sequence of the Hin47-HiD fusion protein Amino acid sequence Hin47 MTLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPFLDDIPEEFKFFFGDRFAEQ
FGGRGESKRNFRGLGSGVIINASKGYVLTNNAVIDEADKITVQLQDGREFKAKLVGKDEL
SDIALVQLEKPSNLTEIKFADSDKLRVGDFTVAIGNPFGLGQTVTSGIVSALGRSTGSDS
GTYENYIQTDAAVNRGNSGGALVNLNGELIGINTAIISPSGGNAGIAFAIPSNQASNLVQ
QILEFGQVRIZGLLGIKGGELNADLAKAFNVSAQQGAFVSEVLPKSAAEKAGLKAGDIITA
MNGQKISSFAEIRAKIATTGAGKEISLTYLRDGKSHDVKMKLQADDSSQLSSKTELPALD
GATLKDYDAKGVKGIEITKIQPNSLAAQRGLKSGDIIIGINRQMIENIRELNKVLETEPS
AVALNILRGDSNFYLLVQ
Linker GGGGS
HiD DPSSHSSNIVIANTQMKSDKIIIAHRGASGYLPEHTLESKALAFAQQADYLEQDLAMTKDGR
LVVIHDHFLDGLTDVAKKFPHRHRKDGRYYVIDFTLICEIQSLEMTENFETKDGKQAQVYP
NRFPLWKSHFRIHTFEDEIEFIQGLEKSTGKKVGIYPEIKAPWFHHQNGKDIAAETLKVLKK
YGYDKKTDMVYLQTFDFNELKRIKTELLPQMGMDLKLVQLIAYTDWKETQEKDPKGYW
VNYNYDWMFKPGAMAEVVKYADGVGPGWYMLVNKEESKPDNIVYTPLVKELAQYNVE
VHPYTVRKDALPEFFTDVNQMYDALLNKSGATGVFTDFPDTGVEFLKGIK
(2) Cloning of the fusion gene on the T vector:
subjecting the fusion gene to double-digestion with NdeI and BamHI, ligating with a T vector double-digested with the same endonuclease through T4 DNA
ligase, transforming into a DH5a competent cell extracting the plasmid and identifying by PCR and double-digestion;
(3) Construction of the expression vector:
subjecting the T clone to double-digestion with NdeI and BamHI to obtain the fusion gene, ligating with pET9a double-digested with the same endonucleases, transforming into a BL21 competent cell, then confirming the expression vector by double-digestion and PCR;
(4) Testing of the expression:
picking a positive monoclonal colony, transferring to LB medium, culturing at 37 C while shaking at 200 rpm overnight, transferring to 50 ml fresh LB
medium, when 0D600=0.6-0.7, adding IPTG to a final concentration of 1 mM, inducing at 37 C for 4 hours, centrifuging and collecting the precipitate, redissolving the precipitate with PBS, breaking by sonication, subjecting the supernatant to SDS-PAGE electrophoresis. The results show that the constructed expression strain, when induced by IPTG, successfully expresses the target protein.
It should be noted that the techniques used in the above-mentioned construction and induction of the expression of the fusion protein Hin47-HiD are routine experimental procedures known to those skilled in the art and are available in published literature and in books.
The above-mentioned purification method of the fusion protein Hin47-HiD has the specific steps as follows:
(1) Bacterial fermentation fermenting bacteria by conventional methods, which can be found in the published literature or known to those skilled in the art; inoculating the bacterial cells in LB medium, shaking at 250 rpm overnight at 37 C; transferring the overnight culture to a 2L flask containing IL medium, when 0D600=0.6-0.7, adding IPTG to a final concentration of 1 mM, inducing expression for 4 hours, centrifuging at 8000rpm for 30 minutes and collecting the bacterial precipitate;
(2) Protein purification after the fermentation is completed, centrifuging and collecting the bacterial precipitate, redissolving the precipitate with PBS, breaking by sonication, centrifuging and collecting the supernatant, passing the supernatant through a Q
column, collecting the flowthrough liquid (the target protein flows through);
passing the Q column flowthrough liquid through a CHT column, using 150 mM PB + 170 mM NaC1 to wash the column, and 175 mM PB + 1 M NaC1 to elute the target protein.
The target protein with a purity of 80% or higher can be obtained by the two-step column purification and can be used in the subsequent development of the conjugate vaccine.
A preparation method of Hia and Hib bivalent conjugate vaccine has the specific steps as follows:
(1) Capsular polysaccharides purification and testing preparing the polysaccharide antigen by common methods, specifically including culturing Haemophilus influenzae by fermentation, subjecting the crude product to fractional precipitation with CTAB or ethanol, further recovering the capsular polysaccharide antigen by CL-4B gel separation, then dialyzing and freeze-drying;
the methods for the purification and identification of capsular polysaccharides of Haemophilus influenzae serotype a and serotype b can be found in the published literature;
(2) Preparation of the conjugate bulks of Hia and Hib preparation of the Hia conjugate vaccine: after adding serotype a capsular polysaccharide to CDAP (which is cyano-4-dimethylaminopyridine tetrafluoroborate) for 30s, adding 0.2 M TEA to adjust the pH to 9.5 to activate the polysaccharide for 2.5min; adjusting the pH to 9.0 and then adding the carrier protein according to the ratio of polysaccharide to protein of 1: 1, reacting at room temperature for lh, keeping the resulting mixture at 4 C overnight, then adding 2 M glycine to terminate the reaction; dialyzing to remove the reaction reagents, separating and purifying the conjugate by CL-4B gel; or preparation of the Hib conjugate vaccine: after adding serotype b capsular polysaccharide to CDAP for 30 s, adding 0.2 M TEA to adjust the pH to 9.5 to activate the polysaccharide for 2.5min, adjusting the pH to 9.0 and then adding the carrier protein according to the ratio of polysaccharide to protein of 1:1, reacting at room temperature for lh, keeping the resulting mixture at 4 C overnight, adding 2 M
glycine to terminate the reaction; dialyzing to remove the reaction reagents, separating and purifying the conjugate by CL-4B gel;
(3) Preparation of Hia and Hib bivalent conjugate vaccine the recommended final lot preparation contains 10 ug (polysaccharide content) of Hia and Hib conjugate, 0.45% NaC1 and 10 mM PB per dose; the product prepared based on above mentioned formulation can provide sufficient protection for the immunized population;
according to the final formulation and the concentration of the conjugate bulk, calculating the required amount of the conjugate bulk; taking the predetermined amount of conjugate bulk, adding PB and NaCl and then supplementing WFI so that the final concentration of Hia and Hib in the conjugate is 20 ug/ml (polysaccharide content), the final concentration of NaC1 is 0.9%, and the final concentration of PB is 20 mM; distributingto obtain the final lot;
(4) Immunogenicity study of bivalent conjugate vaccine of Hia and Hib the animals can produce antibody reactions against Hia capsular polysaccharide and Hib capsular polysaccharide, and antibody reaction against the carrier protein can also be generated after being immunized with the above-mentioned Hia and Hib bivalent conjugate vaccine in a 1/4 dose (125 I); wherein the antibody against Hia capsular polysaccharide can effectively prevent Haemophilus influenzae serotype a, the antibody against Hib capsular polysaccharide can effectively prevent Haemophilus influenzae serotype b, and the antibody against the carrier protein (Hin47, HiD) can effectively prevent non-typeable Haemophilus influenzae.
The beneficial effects of the present invention are as follows:
the Hin47-HiD fusion protein can effectively enhance the immunogenicity of individual protein antigen of Hin47 and HiD; furthermore, the fusion protein Hin47-HiD can effectively enhance the immunogenicity of the polysaccharide antigens as a protein carrier of the conjugate vaccine; the fusion protein Hin47-HiD
can be used as a protein carrier of the conjugate vaccine to develop a Hia conjugate vaccine, a Hib conjugate vaccine, and a bivalent vaccine containing the Hia conjugate vaccine and Hib conjugate vaccine.
BRIEF DESCRIPTION OF TIM DRAWINGS
FIG1 illustrates the testing of the expression of the fusion protein;
FIG.2 illustrates the purification process of the fusion protein Ilin47-HiD;
FIG.3 illustrates the comparison between immunogenicity of Hin47 and HiD
FIG.4 illustrates the comparison of anti-11in47 immunogenicity between Hin47 and Hin47-HiD, wherein, the immunization dose of the Hin47 monomer in the fusion protein Hin47-HiD is the same as that of the Hin47 antigen in the control group, wherein L, M and H indicate that the dose of the Hin47 monomer antigen (including Hin47 in control group) in fusion protein Hin47-HiD is 1 lag, 5 g and 10 1.1g, respectively;
FIG.5 illustrates the comparison of anti-HiD immunogenicity between HiD and Hin47-HiD, wherein the immunization dose of the HiD monomer in the fusion protein Hin47-HiD is the same as that of the HiD antigen in the control group, wherein L, M and H indicate that the dose of the HiD monomer antigen (including HiD in the control group) in the fusion protein Hin47-HiD is 1 ttg, 5 fig and 10 ug, respectively;
FIG.6 illustrates the purification process ofFlia conjugate;
FIG.7 illustrates the purification process of Hib conjugate.
DETAILED DESCRIPTION OF THE INVENTION
The technical solution of the present invention is further described below with reference to specific examples.
Example 1: Preparation of the fusion protein Hin47-HiD
(1) Construction of the Hin47-HiD expression vector The Hin47-HiD fusion gene was synthesized by Life Technologies Corporation, wherein the selected linker was G4S (GGGGS), the fusion gene comprised one copy of the gene for Hin47 and one copy of the gene for HiD, with Hin47 in the upstream of HiD, and the designed restriction site in the 5' of the fusion gene being NdeI and in the 3' being BamHI, wherein the amino acid sequence of Hin47 was the sequence shown in Sequence Listing <400> 1, the amino acid sequence of the Linker was the sequence shown in Sequence Listing <400> 2, and the amino acid sequence of the HiD was the sequence shown in Sequence Listing <400> 3, see Table 1 below for details.
Table 1 Amino acid sequence of fusion protein Hin47-HiD
Amino acid sequence Hifl47 MTLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPFLDDIPEEFKFFFGDR
FAEQ
FGGRGESKRNFRGLGSGVIINASKGYVLTNNAVIDEADKITVQLQDGREFKAKIN
GKDEL
SDIALVQLEKPSNLTEIKFADSDKLRVGDFTVAIGNPFGLGQTVTSGIVSALGRSTG
SDS
GTYENYIQTDAAVNRGNSGGALVNLNGELIGINTAIISPSGGNAGIAFAIPSNQASN
LVQ
QILEFGQVRROLLGIKGGELNADLAKAFNVSAQQGAFVSEVLPKSAAEKAGLKA
GDIITA
MNGQKISSFAEIRAKIATTGAGKEISLTYLRDGKSHDVKMKLQADDS SQLSSKTEL
PALD
GATLKDYDAKGVKGIEITKIQPNSLAAQRGLKSGDIIIGINRQMIENIRELNKVLET
EPS
AVALNILRGDSNFYLLVQ
Linker GGGGS
HiD DPSSHSSNMANTQMKSDKIIIAHRGASGYLPEHTLESKALAFAQQADYLEQDLAM
TKDGR
INVINTITTPLDGLTDVAKKFPHRHRKDGRYYVIDFTLKEIQSLEMTENFETKDGKQ
AQVYPNRFPLWKSHFRIHTFEDEIEFIQGLEKSTGKKVGIYPEIKAPWFHHQNGKD
IAAETLKVLKKYGYDKKTDMVYLQTEDFNELKRIKTELLPQMGMDLKLVQLIAY
TDWKETQEKDPKGYWYNYNYDWMFKPGAMAEVVKYADGVGPGWYMLVNKE
ESKPDNIVYTPLVKELAQYNVEVHPYTVRKDALPEFFTDVNQMYDALLNKSGAT
GVFTDFPDTGVEFLKGIK
As can be seen from Table 1, the Hin47-HiD fusion protein contains 790 aa and has a molecular weight of 87 lcD.
The fusion gene was double-digested with NdeI and RamHI, ligated with a T
vector double-digested with the same endonucleases using T4 DNA ligase, the resulting plasmid was transformed into DH5a competent cells, and extracted and verified by PCR and double-digestion.
The T clone was double-digested with Ndel and BamHI to obtain the fusion gene, which was ligated with pET9a double-digested with the same endonucleases, the fusion gene on the expression plasmid was transformed into BL2 1 competent cells, and the expression vector was confirmed by double-digestion and PCR.
The positive monoclonal colonies were picked, transferred to LB medium, cultured at 37 C and shaken at 200 rpm overnight, transferred to 50 ml fresh LB
medium, when 0D600=0.6-0.7, IPTG at a final concentration of 1 mM was added, and after induction at 37 C for 4 hours, the cell pellet was collected by centrifugation.
The precipitate was redissolved with PBS and sonicated, and the supernatant was subjected to SDS-PAGE electrophoresis to analyze whether the protein was expressed, the result is shown in FIG1:
FIG.1 shows that the fusion protein was highly expressed in the supernatant.
It should be noted that the techniques used in the construction of the expression vector for the fusion protein Hin47-HiD and the induced expression are routine experimental procedures known to those skilled in the art and are available in published literature and in books.
(2) Purification of the fusion protein Hin47-HiD
The bacterial cells expressing Hin47-HiD were grown overnight, and then transferred to fermentation medium. When 0D600=0.6-0.7, IPTG was added to a final concentration of 1 mM, and after induction at 37 C for 4 hours, the bacteria was subjected to centrifugation to collect precipitate.
The precipitate was redissolved with PBS, sonicated, and centrifuged to collect the supernatant. The supernatant was passed through a Q column to collect the flowthrough liquid (the target protein flowed through), then the Q column flowthrough liquid was passed through a CHT column, and 150 mM PB + 170 mM
NaCl was used to wash the column, and 175 mM PB + 1 M NaC1 was used to elute the target protein. The purification process is advantageous since it has simple steps, can make use of conventional fillers, and can produce the target protein with the purity of 80% or higher with only two steps. The result is shown in FIG. 2.
As can be seen from FIG 2, the target protein with a purity of 80% or higher can be obtained by the two-step column purification.
Example 2: Study on immunogenicity of the fusion protein Hin47-HiD
BALB/C mouse was immunized with the fusion protein Hin47-HiD three times at intervals of two weeks to study its immunogenicity, with Hin47 and HiD as controls.
Whole blood was collected 14 days after the last immunization, and serum antibody levels were tested.
In the control groups, the immunization doses of the Hin47 or HiD protein antigen were 1 g, 5 g and 10 pg, respectively, while in the immunization group of the fusion protein, the doses of the protein monomer were 1 pg, 5 g and 10 g, respectively.
The mice were immunized with Hin47 and HiD antigens in three doses of 1 pg, lAg and 10 pg, respectively, and the antibody titers of the three immune sera were tested with the corresponding antigens, the results are shown in FIG 3.
Statistical analysis:
P(Hin47 1 HiD 1 pg)=-0.000<0.01 P(Hin47 5 pg: HiD 5 .i.g)=---0.000<0.01 P(Hin47 10 pg: HiD 10 pg)=0.000<0.01 The results showed that Hin47 generates a stronger immune response than HiD
at the same dose.
The immunogenicity of the fusion protein Hin47-HiD was studied in three doses, and the actual immunization dose of the protein monomer in the fusion protein was the same as that of the control antigen (Hin47 or HiD). In the comparison experiment for the immunogenicity between Hin47-HiD and Hin47, the three groups L, M and H
represented the doses of Hin47 monomer antigen in the fusion protein of 1 [tg,
5 lig and 10 lig, respectively.
The comparison of the immunogenicity between Hin47 and Hin47-HiD is shown in FIG 4.
Statistical analysis:
P(L group Hin47: Hin47-HiD)= 0.2820 >0.05 P(M group Hin47: Hin47-HiD)= 0.2820 > 0.05 P(H group Hin47: Hin47-HiD)= 0.350 >0.05 The results show that the fusion protein Hin47-HiD does not affect the immunogenicity of Hin47.
The immunogenicity of the fusion protein Hin47-HiD was studied in three doses, and the actual immunization dose of the protein monomer in the fusion protein was the same as that of the control antigen (Hin47 or HiD). In the comparison experiment for the immunogenicity between Hin47-HiD and HiD, the three groups L, M and H
represented the doses of HiD monomer antigen in the fusion protein of 1 lag, 51..ig and pig, respectively.
The comparison of the immunogenicity between HiD and Hin47-HiD is shown in FIG 5.
Statistical analysis:
P(L group HiD: Hin47-HiD)=0.000<0.01 P(M group HiD: Hin47-HiD)=0.000<0.01 P(H group HiD: Hin47-HiD)=0.000<0.01 The results show that the Hin47-HiD fusion protein can effectively enhance the immunogenicity of HiD.
Example 3: Preparation of Hia and Hib conjugate bulks Polysaccharide-protein conjugates of polysaccharide Hia and Hib were prepared by using the same method. Specifically, after adding the capsular polysaccharide to CDAP for 30 seconds, 0.2 M TEA was added to adjust the pH to 9.5 for polysaccharide activation, and the activation was continued for 2.5min, after the activation, the pH was adjusted to 9.0, Hin47-HiD fusion protein was added according to a ratio of polysaccharide to protein of 1: 1, the reaction was carried out at room temperature for 1 hour, the resulting mixture was kept at 4 C
overnight, and then 2 M glycine was added to terminate the reaction; the resulting mixture was dialyzed to remove the reaction reagents, and the conjugate was separated and purified by CL-4B gel.
The CL-4B gel separation result of Hia conjugate is shown in FIG. 6.
The CL-4B gel separation result of Hib conjugate is shown in FIG 7.
Table 2 Testing results of Hia and Hib bivalent conjugate vaccine CA 03000549 2018-03-29 .
' Protein Name of Polysaccharide Polysaccharide Free content Free protein conjugate content mg/ml / protein polysaccharide mg/ml Hia conjugate 3,5 7.21 0.485 13% 4%
bulk I lib conjugate 2,8 8.47 0.33 10% 2%
bulk Example 4: Production of the finished product of Hia and Hib bivalent conjugate vaccine, it, conjugate vaccine against Haemophilus influenzae serotype a and serotype b Taking the production of 200 vials of the vaccine as an example, in theory, 100 ml of the final bulk was required to prepare 200 vials of the final lot.
According to the concentration of the conjugate bulk, 0.57 ml of Hia conjugate bulk, 0.72 ml of Hib conjugate bulk, 1 ml of 1 M PB, and 50 ml of NS were required, supplied with 47.7 ml of WFI, to obtain the final bulk, each vial was then filled with 0.5m1 to obtain the finished product.
The final lot contains 10 ug (polysaccharide content) of Hia conjugate and 10ug Hib conjugate, 0.45% NaC1, and 10 mM PB per dose.
Example 5: Study on the immunogenicity of the conjugate vaccine against Haemophilus influenzae serotype a and serotype b The immunogenicity of the conjugate vaccine against Haemophilus influenzae serotype a and serotype b (with Hin47-HiD as the carrier protein) was evaluated according to the protocol for the efficacy test of the conjugate vaccine against Haemophilus influenzae serotype b as described in the Chinese Pharmacopoeia.
Specifically, 10 BALB/C mice with weight of 12-14 g were immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b in human dose (containing Hia polysaccharide 2.5 jig and Hib polysaccharide 2.5 jig respectively), and 10 BALB/C mice were immunized with NS as the negative control, the immunization was performed 2 times at 2-week intervals, and eyeballs were removed to collect serum 14 days after the last immunization.
The titers of antibodies in serum against both capsular polysaccharide serotype-a and serotype-b were measured by ELISA, and the measurement of the serum samples of NS-immunized mice was used as the CUT off value to calculate the rate of positive immune response in the vaccine group. The results are shown in Table 3.
Table 3 Test results of immune responses with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b Immune Name of' conjugate vaccine Coating antigen Dilution response rate capsular polysaccharide conjugate vaccine against 100 100%
serotype a Haemophilus influenzae serotype a capsular polysaccharide and serotype b 100 100%
serotype b The results show that: the fusion protein Hin47-HiD, as a protein carrier, can effectively stimulate the body to produce immune response to the polysaccharide antigens. In this example, the mice were immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b in 1/4 human dose, and the response rate after two immunizations was 100%, which reached the release standard =
of Chinese Pharmacopoeia for the immunization efficacy of the Hib conjugate vaccine product.
Example 6: Study on the protection of the conjugate vaccine against Haemophilus influenzae serotype a and serotype b The content of specific antibodies in serum can be effectively measured by ELISA, however, not all antibodies have bactericidal protection function, and serum bactericidal antibodies (SBA) can reflect the functional activity of antibodies, which directly reflects the protective effects of the vaccine.
The test results of SBA in sera of mice immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b are shown in Table 4.
Table 4 Test results of SBA of the conjugate vaccine against Haemophilus influenzae serotype a and serotype b Name of conjugate vaccine Bacterial strain SBA
conjugate vaccine against Haemophilus influenzae serotype a 1341 Haemophilus influenzae serotype a Haemophilus influenzae serotype b 1560 and serotype b In this example, the SBA in sera of mice immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b was as high as 1300, which can effectively prevent infection from Haemophilus influenzae serotype a and Haemophilus influenzae serotype b.
Table 5 Antibody titers against the carrier protein in the conjugate vaccine against Haemophilus influenzae serotype a and serotype b Name of conjugate vaccine Titer of anti-Hin47 antigen Titer of anti-HiD
antigen CA 03000549 2018-03-29 , antibody antibody (GMT/1g0D) (GMT/1g0D) conjugate vaccine against Haemophilus influenzae serotype a 6.34 5.65 and serotype b As can be seen from Table 5, the mice simultaneously produced antibodies to the carrier protein after being immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b, wherein the titer of anti-HiD
antigen antibody was 5.65 and that of anti-Hin47 antigen antibody was up to
The comparison of the immunogenicity between Hin47 and Hin47-HiD is shown in FIG 4.
Statistical analysis:
P(L group Hin47: Hin47-HiD)= 0.2820 >0.05 P(M group Hin47: Hin47-HiD)= 0.2820 > 0.05 P(H group Hin47: Hin47-HiD)= 0.350 >0.05 The results show that the fusion protein Hin47-HiD does not affect the immunogenicity of Hin47.
The immunogenicity of the fusion protein Hin47-HiD was studied in three doses, and the actual immunization dose of the protein monomer in the fusion protein was the same as that of the control antigen (Hin47 or HiD). In the comparison experiment for the immunogenicity between Hin47-HiD and HiD, the three groups L, M and H
represented the doses of HiD monomer antigen in the fusion protein of 1 lag, 51..ig and pig, respectively.
The comparison of the immunogenicity between HiD and Hin47-HiD is shown in FIG 5.
Statistical analysis:
P(L group HiD: Hin47-HiD)=0.000<0.01 P(M group HiD: Hin47-HiD)=0.000<0.01 P(H group HiD: Hin47-HiD)=0.000<0.01 The results show that the Hin47-HiD fusion protein can effectively enhance the immunogenicity of HiD.
Example 3: Preparation of Hia and Hib conjugate bulks Polysaccharide-protein conjugates of polysaccharide Hia and Hib were prepared by using the same method. Specifically, after adding the capsular polysaccharide to CDAP for 30 seconds, 0.2 M TEA was added to adjust the pH to 9.5 for polysaccharide activation, and the activation was continued for 2.5min, after the activation, the pH was adjusted to 9.0, Hin47-HiD fusion protein was added according to a ratio of polysaccharide to protein of 1: 1, the reaction was carried out at room temperature for 1 hour, the resulting mixture was kept at 4 C
overnight, and then 2 M glycine was added to terminate the reaction; the resulting mixture was dialyzed to remove the reaction reagents, and the conjugate was separated and purified by CL-4B gel.
The CL-4B gel separation result of Hia conjugate is shown in FIG. 6.
The CL-4B gel separation result of Hib conjugate is shown in FIG 7.
Table 2 Testing results of Hia and Hib bivalent conjugate vaccine CA 03000549 2018-03-29 .
' Protein Name of Polysaccharide Polysaccharide Free content Free protein conjugate content mg/ml / protein polysaccharide mg/ml Hia conjugate 3,5 7.21 0.485 13% 4%
bulk I lib conjugate 2,8 8.47 0.33 10% 2%
bulk Example 4: Production of the finished product of Hia and Hib bivalent conjugate vaccine, it, conjugate vaccine against Haemophilus influenzae serotype a and serotype b Taking the production of 200 vials of the vaccine as an example, in theory, 100 ml of the final bulk was required to prepare 200 vials of the final lot.
According to the concentration of the conjugate bulk, 0.57 ml of Hia conjugate bulk, 0.72 ml of Hib conjugate bulk, 1 ml of 1 M PB, and 50 ml of NS were required, supplied with 47.7 ml of WFI, to obtain the final bulk, each vial was then filled with 0.5m1 to obtain the finished product.
The final lot contains 10 ug (polysaccharide content) of Hia conjugate and 10ug Hib conjugate, 0.45% NaC1, and 10 mM PB per dose.
Example 5: Study on the immunogenicity of the conjugate vaccine against Haemophilus influenzae serotype a and serotype b The immunogenicity of the conjugate vaccine against Haemophilus influenzae serotype a and serotype b (with Hin47-HiD as the carrier protein) was evaluated according to the protocol for the efficacy test of the conjugate vaccine against Haemophilus influenzae serotype b as described in the Chinese Pharmacopoeia.
Specifically, 10 BALB/C mice with weight of 12-14 g were immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b in human dose (containing Hia polysaccharide 2.5 jig and Hib polysaccharide 2.5 jig respectively), and 10 BALB/C mice were immunized with NS as the negative control, the immunization was performed 2 times at 2-week intervals, and eyeballs were removed to collect serum 14 days after the last immunization.
The titers of antibodies in serum against both capsular polysaccharide serotype-a and serotype-b were measured by ELISA, and the measurement of the serum samples of NS-immunized mice was used as the CUT off value to calculate the rate of positive immune response in the vaccine group. The results are shown in Table 3.
Table 3 Test results of immune responses with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b Immune Name of' conjugate vaccine Coating antigen Dilution response rate capsular polysaccharide conjugate vaccine against 100 100%
serotype a Haemophilus influenzae serotype a capsular polysaccharide and serotype b 100 100%
serotype b The results show that: the fusion protein Hin47-HiD, as a protein carrier, can effectively stimulate the body to produce immune response to the polysaccharide antigens. In this example, the mice were immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b in 1/4 human dose, and the response rate after two immunizations was 100%, which reached the release standard =
of Chinese Pharmacopoeia for the immunization efficacy of the Hib conjugate vaccine product.
Example 6: Study on the protection of the conjugate vaccine against Haemophilus influenzae serotype a and serotype b The content of specific antibodies in serum can be effectively measured by ELISA, however, not all antibodies have bactericidal protection function, and serum bactericidal antibodies (SBA) can reflect the functional activity of antibodies, which directly reflects the protective effects of the vaccine.
The test results of SBA in sera of mice immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b are shown in Table 4.
Table 4 Test results of SBA of the conjugate vaccine against Haemophilus influenzae serotype a and serotype b Name of conjugate vaccine Bacterial strain SBA
conjugate vaccine against Haemophilus influenzae serotype a 1341 Haemophilus influenzae serotype a Haemophilus influenzae serotype b 1560 and serotype b In this example, the SBA in sera of mice immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b was as high as 1300, which can effectively prevent infection from Haemophilus influenzae serotype a and Haemophilus influenzae serotype b.
Table 5 Antibody titers against the carrier protein in the conjugate vaccine against Haemophilus influenzae serotype a and serotype b Name of conjugate vaccine Titer of anti-Hin47 antigen Titer of anti-HiD
antigen CA 03000549 2018-03-29 , antibody antibody (GMT/1g0D) (GMT/1g0D) conjugate vaccine against Haemophilus influenzae serotype a 6.34 5.65 and serotype b As can be seen from Table 5, the mice simultaneously produced antibodies to the carrier protein after being immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b, wherein the titer of anti-HiD
antigen antibody was 5.65 and that of anti-Hin47 antigen antibody was up to
6.34.
These antibodies could effectively prevent infection of non-typeable Haemophilus influenzae.
Protective results show that: after the mice are immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b, anti-Hia and anti-Hib polysaccharide antibodies can effectively prevent Haemophilus influenzae serotype a and Haemophilus influenzae serotype b, while antibodies against the carrier protein Hin47-HiD can effectively prevent non-typeable Haemophilus influenzae.
The application principle of the present invention may be as follows: the polysaccharide-protein conjugate vaccine can promote the thymus-independent polysaccharide antigen to become thymus-dependent, thereby making the polysaccharide antigen suitable for immunoprophylaxis in populations such as infants and children. The first generation of the conjugate vaccine protein carrier is tetanus toxoid TT and diphtheria toxoid DT, the second generation of the conjugate vaccine protein carrier is a non-toxic protein such as diphtheria toxin mutants CRM;
the CA 03000549 2018-03-29 , present invention belongs to a new generation of conjugate vaccine protein carrier, which is characterized in that in addition to effectively improving the immunogenicity of the polysaccharide antigens, antibodies against the carrier protein itself can also resist certain diseases. Hin47 and HiD have been shown to prevent non-typeable Haernophilus influenzae, whereas the Hin47-HiD fusion protein developed by the present invention can significantly improve the immunogenicity of the weak antigen HiD without affecting the immunogenicity of Hin47, and more importantly, the Hin47-HiD fusion protein can be effective as a conjugate vaccine protein carrier. Therefore, in the present invention, a novel conjugate vaccine protein carrier is developed, the conjugate vaccine developed by using it as a carrier can prevent the bacterial infection corresponding to polysaccharide antigen, in addition, antibodies against the carrier protein itself can prevent non-typeable Haemophilus influenzae.
The above detailed description of the Haernophilus influenzae fusion protein, the construction method and use thereof with reference to the above examples are intended to be illustrative and not limitative, and certain embodiments may be extended within the scope of the present invention. Therefore, any changes and modifications without departing from the general concept of the present invention should fall within the protection scope of the present invention.
These antibodies could effectively prevent infection of non-typeable Haemophilus influenzae.
Protective results show that: after the mice are immunized with the conjugate vaccine against Haemophilus influenzae serotype a and serotype b, anti-Hia and anti-Hib polysaccharide antibodies can effectively prevent Haemophilus influenzae serotype a and Haemophilus influenzae serotype b, while antibodies against the carrier protein Hin47-HiD can effectively prevent non-typeable Haemophilus influenzae.
The application principle of the present invention may be as follows: the polysaccharide-protein conjugate vaccine can promote the thymus-independent polysaccharide antigen to become thymus-dependent, thereby making the polysaccharide antigen suitable for immunoprophylaxis in populations such as infants and children. The first generation of the conjugate vaccine protein carrier is tetanus toxoid TT and diphtheria toxoid DT, the second generation of the conjugate vaccine protein carrier is a non-toxic protein such as diphtheria toxin mutants CRM;
the CA 03000549 2018-03-29 , present invention belongs to a new generation of conjugate vaccine protein carrier, which is characterized in that in addition to effectively improving the immunogenicity of the polysaccharide antigens, antibodies against the carrier protein itself can also resist certain diseases. Hin47 and HiD have been shown to prevent non-typeable Haernophilus influenzae, whereas the Hin47-HiD fusion protein developed by the present invention can significantly improve the immunogenicity of the weak antigen HiD without affecting the immunogenicity of Hin47, and more importantly, the Hin47-HiD fusion protein can be effective as a conjugate vaccine protein carrier. Therefore, in the present invention, a novel conjugate vaccine protein carrier is developed, the conjugate vaccine developed by using it as a carrier can prevent the bacterial infection corresponding to polysaccharide antigen, in addition, antibodies against the carrier protein itself can prevent non-typeable Haemophilus influenzae.
The above detailed description of the Haernophilus influenzae fusion protein, the construction method and use thereof with reference to the above examples are intended to be illustrative and not limitative, and certain embodiments may be extended within the scope of the present invention. Therefore, any changes and modifications without departing from the general concept of the present invention should fall within the protection scope of the present invention.
Claims (16)
1. A Haemophilus influenzae fusion protein Hin47-HiD obtainable by fusion of Haemophilus influenzae HiD protein and Haemophilus influenzae Hin47 protein, wherein the amino acid sequence of Hin47 is the sequence of SEQ ID NO: 1, and the amino acid sequence of HiD is the sequence of SEQ
ID NO: 3.
ID NO: 3.
2. The fusion protein of Claim 1, wherein the fusion protein is obtainable by fusion of Hin47 and HiD in a 1:1 ratio through a linker, the linker enables the monomers of Hin47 protein and HiD protein to maintain their own unique conformations.
3. The fusion protein of Claim 2, wherein the linker is G4S with the sequence of SEQ ID NO: 2.
4. The fusion protein of any one of Claims 1 to 3, wherein the composition form of a gene for the fusion protein is (n)Hin47-linker-(n)HiD, (n)HiD-linker-(n)Hin47, -linker-HiD-(Hin47-linker-HiD)n-linker-Hin47- or -linker-Hin47-(HiD-linker-Hin47)n-linker-HiD-, wherein n is 1-3, representing the number of copies of the genes for the monomers.
5. The fusion protein of any one of Claims 1 to 3, wherein the composition form of the gene for the fusion protein is -linker-(Hin47-linker-HiD-linker)n-Hin47- or -linker-(HiD-linker-Hin47-linker)n-HiD-, wherein n is 1-3, representing the number of copies of the genes for the monomers.
6. The fusion protein of any one of Claims 1 to 5 for use as a protein carrier in the preparation of a conjugate vaccine using a polysaccharide antigen as an active ingredient.
7. The fusion protein of Claim 6, wherein the conjugate vaccine is against Haemophilus influenzae, pneumonia, meningitis, dysentery or typhoid.
8. The fusion protein of any one of Claims 1 to 5 for use as a protein carrier for a Hia and Hib conjugate vaccine.
9. A Haemophilus influenzae polysaccharide-protein conjugate vaccine preparation prepared by using one or more capsular polysaccharide(s) in Haemophilus influenzae serotype a, b, c, d, e and f as antigen(s), and the fusion protein of any one of Claims 1 to 5 as a protein carrier.
10. The vaccine preparation of Claim 9, wherein the polysaccharide antigen component in the preparation can effectively prevent the corresponding Haemophilus influenzae serotype(s), and the protein carrier component can prevent the non-typeable Haemophilus influenzae.
11. The vaccine preparation of Claim 9, wherein the vaccine preparation is a bivalent conjugate vaccine comprising a conjugate of Hia with the protein carrier Hin47-HiD and a conjugate of Hib with the protein carrier Hin47-HiD.
12. The vaccine preparation of Claim 11, wherein the formulation of the bivalent conjugate vaccine is in a liquid form or a freeze-dried powder, each dose containing 8-15 [tg of polysaccharide serotype a, 8-15 g of polysaccharide serotype b and 20-80 i.tg of Hin47-HiD.
13. The vaccine preparation of Claim 11, wherein the formulation of the bivalent conjugate vaccine is in a liquid form, each 0.5 ml dose containing 8-15 jig of polysaccharide serotype a, 8-15 pg of polysaccharide serotype b and 20-80 lig of Hin47-HiD.
14. The vaccine preparation of Claim 13, wherein the bivalent conjugate vaccine contains no preservatives, and the buffer solution in the preparation is PB and NaC1, with a final concentration of 0.45% NaC1+ 10 mM PB.
15. A method for the construction of the fusion protein of any one of Claims 1 to 8 comprising the following steps:
(1) synthesizing gene:
a fusion gene comprising one copy of the Hin47 gene and one copy of the HiD gene, with Hin47 in the upstream of HiD, and a designed restriction site in the 5' of the fusion gene being N del and in the 3' being BamHI;
(2) constructing cloning of the fusion gene on a T-vector:
subjecting the fusion gene to double-digestion with N del and BamHI, ligating with a T vector double-digested with the same endonucleases through T4 DNA ligase, transforming into a DH5a competent cell, extracting the plasmid and confirming by PCR and double-digestion;
(3) constructing an expression vector:
subjecting the T clone to double-digestion with Ndel and BamHI to obtain the fusion gene, ligating with pET9a double-digested with the same endonucleases, transforming into a BL21 competent cell, then verifying the expression vector by double-digestion and PCR; and (4) testing the expression:
picking a positive monoclonal colony, culturing in LB medium, centrifuging, collecting the precipitate, redissolving the precipitate with PBS, breaking by sonication, and subjecting the supernatant to SDS-PAGE
electrophoresis.
(1) synthesizing gene:
a fusion gene comprising one copy of the Hin47 gene and one copy of the HiD gene, with Hin47 in the upstream of HiD, and a designed restriction site in the 5' of the fusion gene being N del and in the 3' being BamHI;
(2) constructing cloning of the fusion gene on a T-vector:
subjecting the fusion gene to double-digestion with N del and BamHI, ligating with a T vector double-digested with the same endonucleases through T4 DNA ligase, transforming into a DH5a competent cell, extracting the plasmid and confirming by PCR and double-digestion;
(3) constructing an expression vector:
subjecting the T clone to double-digestion with Ndel and BamHI to obtain the fusion gene, ligating with pET9a double-digested with the same endonucleases, transforming into a BL21 competent cell, then verifying the expression vector by double-digestion and PCR; and (4) testing the expression:
picking a positive monoclonal colony, culturing in LB medium, centrifuging, collecting the precipitate, redissolving the precipitate with PBS, breaking by sonication, and subjecting the supernatant to SDS-PAGE
electrophoresis.
16. Use of the fusion protein of any one of Claims 1 to 5 as a protein carrier in the conjugate vaccine of Hia and Hib.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201510638297.9A CN105175549B (en) | 2015-09-30 | 2015-09-30 | A kind of haemophilus influenzae fusion protein and its construction method and application |
CN201510638297.9 | 2015-09-30 | ||
PCT/CN2016/098520 WO2017054635A1 (en) | 2015-09-30 | 2016-09-09 | Haemophilus influenzae fusion protein and construction method and use thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CA3000549A1 CA3000549A1 (en) | 2017-04-06 |
CA3000549C true CA3000549C (en) | 2022-09-20 |
Family
ID=54898048
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA3000549A Active CA3000549C (en) | 2015-09-30 | 2016-09-09 | Haemophilus influenzae fusion protein and construction method and use thereof |
Country Status (6)
Country | Link |
---|---|
US (1) | US10716847B2 (en) |
EP (1) | EP3357933B1 (en) |
CN (1) | CN105175549B (en) |
CA (1) | CA3000549C (en) |
ES (1) | ES2784428T3 (en) |
WO (1) | WO2017054635A1 (en) |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105175549B (en) * | 2015-09-30 | 2019-08-16 | 康希诺生物股份公司 | A kind of haemophilus influenzae fusion protein and its construction method and application |
CN106432512B (en) * | 2016-09-30 | 2022-03-01 | 康希诺生物股份公司 | Protein carrier for enhancing polysaccharide antigen immunogenicity and preparation method and application thereof |
CN110845587B (en) * | 2019-10-15 | 2021-06-29 | 康希诺生物股份公司 | Site-directed mutagenesis carrier protein and application thereof in preparation of vaccine |
CN116920083A (en) * | 2023-07-27 | 2023-10-24 | 北京百晖生物科技有限公司 | Hib conjugate vaccine |
Family Cites Families (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5939297A (en) * | 1994-07-21 | 1999-08-17 | Connaught Laboratories Limited | Analog of haemophilus HIN47 with reduced protease activity |
US6391313B1 (en) * | 1999-07-15 | 2002-05-21 | Aventis Pasteur Limited | Multi-component vaccine to protect against disease caused by Haemophilus influenzae and Moraxella catarrhalis |
WO2002100891A2 (en) * | 2001-06-12 | 2002-12-19 | Glaxosmithkline Biologicals S.A. | Proteins derived from non-typable haemophilus influenzae (nthi) strain |
EA015561B1 (en) * | 2006-01-17 | 2011-08-30 | Арне Форсгрен | A NOVEL SURFACE EXPOSED HAEMOPHILUS INFLUENZAE PROTEIN (PROTEIN E; pE) |
TW201302779A (en) * | 2011-04-13 | 2013-01-16 | Glaxosmithkline Biolog Sa | Fusion proteins & combination vaccines |
RU2727476C2 (en) * | 2012-04-26 | 2020-07-21 | Новартис Аг | Antigens and antigen compositions |
CN103893751B (en) * | 2014-03-26 | 2016-04-20 | 天津康希诺生物技术有限公司 | A kind of pneumococal polysaccharide Protein Conjugation vaccine and preparation method thereof |
CN105175549B (en) * | 2015-09-30 | 2019-08-16 | 康希诺生物股份公司 | A kind of haemophilus influenzae fusion protein and its construction method and application |
-
2015
- 2015-09-30 CN CN201510638297.9A patent/CN105175549B/en active Active
-
2016
- 2016-09-09 CA CA3000549A patent/CA3000549C/en active Active
- 2016-09-09 WO PCT/CN2016/098520 patent/WO2017054635A1/en active Application Filing
- 2016-09-09 ES ES16850259T patent/ES2784428T3/en active Active
- 2016-09-09 EP EP16850259.9A patent/EP3357933B1/en active Active
-
2018
- 2018-03-29 US US15/940,871 patent/US10716847B2/en active Active
Also Published As
Publication number | Publication date |
---|---|
CN105175549A (en) | 2015-12-23 |
ES2784428T3 (en) | 2020-09-25 |
US10716847B2 (en) | 2020-07-21 |
CN105175549B (en) | 2019-08-16 |
EP3357933A4 (en) | 2018-08-29 |
CA3000549A1 (en) | 2017-04-06 |
WO2017054635A1 (en) | 2017-04-06 |
US20180214541A1 (en) | 2018-08-02 |
EP3357933A1 (en) | 2018-08-08 |
EP3357933B1 (en) | 2020-02-12 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10716847B2 (en) | Haemophilus influenzae fusion protein and construction method and use thereof | |
DK171421B1 (en) | Polysaccharide Compound and Process for Preparation thereof | |
DK171420B1 (en) | Covalently Modified Bacterial Polysaccharide / Protein Conjugate, Process for Preparation thereof and Preparation comprising a Polysaccharide / Protein Conjugate | |
JP5327873B2 (en) | Recombinant Helicobacter pylori oral vaccine and preparation method thereof | |
US20180140666A1 (en) | Flagellin fusion proteins and conjugates comprising pneumococcus antigens and methods of using the same | |
CN102068690A (en) | Polyvalent pneumococcal capsular polysaccharide conjugate vaccine and preparation method thereof | |
Zhang et al. | Immune responses to novel pneumococcal proteins pneumolysin, PspA, PsaA, and CbpA in adenoidal B cells from children | |
KR0177510B1 (en) | Escherichia coli vaccine | |
US4644059A (en) | Haemophilus influenzae B polysaccharide-diptheria toxoid conjugate vaccine | |
CA2931110A1 (en) | Mutant fragments of ospa and methods and uses relating thereto | |
AU669360B2 (en) | High molecular weight surface proteines of non-typeable haemophilus | |
CN113173977A (en) | Bifunctional antigen, preparation method and application thereof | |
JPH10508595A (en) | Carrier protein having adjuvant effect, immunogenic complex containing the same, method for producing the same, nucleotide sequence and vaccine | |
CN107961368B (en) | Combined vaccine of epidemic encephalitis and pneumococcus for human and preparation method thereof | |
CN108939061A (en) | A kind of multicomponent B group meningitis cocci vaccine and preparation method thereof | |
CA2990312A1 (en) | Immunogenic compositions | |
JP6401148B2 (en) | Antigens and antigen combinations | |
Majidi et al. | Expression and Purification of Brucella spp. Lumazine Synthase Decameric Carrier in Fusion to Extracellular Domain of Influenza M2E Protein | |
JP2022064869A (en) | Polyvalent vaccine antigen and polyclonal antibody | |
CN110483624B (en) | Borrelia garinii OspA protein C-terminal peptide segment and application thereof | |
JPH11501003A (en) | High molecular weight surface protein of non-typeable hemophilus | |
CN112501096A (en) | Construction and application of genetically engineered escherichia coli of a group of parenteral pathogenic escherichia coli glycoprotein conjugate vaccines | |
CN107033224B (en) | A kind of foot and mouth disease virus inactivation antigen purifying method for concentration | |
CN110898217B (en) | Streptococcus pneumoniae vaccine and preparation method thereof | |
CN106432512B (en) | Protein carrier for enhancing polysaccharide antigen immunogenicity and preparation method and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request |
Effective date: 20180329 |
|
EEER | Examination request |
Effective date: 20180329 |
|
EEER | Examination request |
Effective date: 20180329 |