CA2999280C - Compositions and methods for adjoining type i and type ii extracellular domains as heterologous chimeric proteins - Google Patents

Abstract

The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity. In part, the invention provides, in various embodiments, fusions of extracellular domains of transmembrane proteins that can have stimulatory or inhibitory effects.

Description

DEMANDE OU BREVET VOLUMINEUX LA PRESENTE PARTIE DE CETTE DEMANDE OU CE BREVET COMPREND PLUS D’UN TOME.

CECI EST LE TOME 1 DE 2 CONTENANT LES PAGES 1 A 143 NOTE : Pour les tomes additionels, veuillez contacter le Bureau canadien des brevets JUMBO APPLICATIONS/PATENTS THIS SECTION OF THE APPLICATION/PATENT CONTAINS MORE THAN ONE VOLUME THIS IS VOLUME 1 OF 2 CONTAINING PAGES 1 TO 143 NOTE: For additional volumes, please contact the Canadian Patent Office NOM DU FICHIER / FILE NAME : NOTE POUR LE TOME / VOLUME NOTE:5 Date ReQue/Date Received 2023-02-27 COMPOSITIONS AND METHODS FOR ADJOINING TYPE I AND TYPE II EXTRACELLULAR DOMAINS AS HETEROLOGOUS CHIMERIC PROTEINS PRIORITY This application claims the benefit of, and priority to, U.S. Provisional Application No. 62/235,727, filed October 1, 2015, U.S. Provisional Application No. 62/263,313, filed December 4, 2015, and U.S.

Provisional Application No. 62/372,574, filed August 9, 2016.

TECHNICAL FIELD The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity.

DESCRIPTION OF THE TEXT FILE SUBMITTED ELECTRONICALLY The contents of the text file submitted electronically herewith: A computer readable format copy of the Sequence Listing (filename: HTB-023PCSequenceListing.txt; date recorded: September 29, 2016; file size: 140KB).

BACKGROUND The interaction between cancer and the immune system is complex and multifaceted. See de Visser et al., Net. Rev. Cancer (2006) 6:24-37. While many cancer patients appear to develop an anti-tumor immune response, cancers also develop strategies to evade immune detection and destruction.

Recently, immunotherapies have been developed for the treatment and prevention of cancer and other disorders. Immunotherapy provides the advantage of cell specificity that other treatment modalities lack.

As such, methods for enhancing the efficacy of immune based therapies can be clinically beneficial.

Advances in defining the mechanisms and molecules that regulate immune responses have provided novel therapeutic targets for treating cancer. For example, costimulatory and coinhibitory molecules play a central role in the regulation of T cell immune responses. However, despite impressive patient responses to antibody agents targeting these costimulatory and coinhibitory molecules, including for example anti-PD-1/PD-L1, checkpoint inhibition therapy still fails in many patients. Therefore, as with most cancer therapies, there remains a need for new compositions and methods that can improve the effectiveness of these agents.

SUMMARY According in various aspects, the present invention provides for compositions and methods that are useful for cancer immunotherapy, e.g. to manipulate or modify immune signals for therapeutic benefit. In various embodiments, the invention reverses or suppresses immune inhibitory signals while providing immune activating or co-stimulatory signals in a beneficial context. For instance, in one aspect, the Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 present invention provides chimeric protein comprising: (a) a first extracellular domain of a type I transmembrane protein at or near the N-terminus, (b) a second extracellular domain of a type II transmembrane protein at or near the C-terminus, and (c) a linker, wherein one of the first and second extracellular domains is an immune inhibitory signal and one of the first and second extracellular domains is an immune stimulatory signal. By linking these two molecules in a functional orientation, coordination between the positive and negative signals can be achieved. For example, the present invention provides, in various embodiments, masking of negative immune signals and stimulation of positive immune signals in a single construct. In various embodiments, provides for compositions that are not antibodies, or based upon antibody-derived antigen binding domains (e.g. complementarity determining regions, CDRs), but rather provide direct receptor/ligand interaction.

In cancer patients, an immune response can be stimulated against tumor antigens to activate a patient’s own immune system to kill tumor cells. However, some cancer cells devise strategies to evade an immune response in a process known as immuno-editing. This can include down-regulation of specific antigens, down-regulation of MHO I, up-regulation of immune regulatory surface molecules (PD-L1, PDL2, CEACAM1, galectin-9, B7-H3, B7-H4, VISTA, CD47, efc.) or up-regulation of soluble immune inhibitory molecules (IDO, TGF-p, MICA, etc). In general, these strategies are co-opted by tumor cells so that when tumor-infiltrating immune killer cells encounter a tumor cell, those cells become directly inhibited by immunosuppressive factors and therefore cannot kill the tumor cell. Many of the immunosuppressive ligands co-opted by tumor cells to suppress an immune response interact with receptors that are typeI membrane proteins. In some embodiments, the chimeric protein of the present invention comprises an extracellular domain of an immune inhibitory agent, including without limitation, one or more of TIM-3, BTLA, PD-1, CTLA-4, B7-H4, PD-L1, PD-L2, B7-H3, CD244, TIGIT, CD172a/SIRPa, VISTA/VSIG8, CD115, CD200, CD223, and TMIGD2. In some embodiments, the chimeric protein of the present invention comprises an extracellular domain of a type I membrane protein which has immune inhibitory properties. In various embodiments, the chimeric protein is engineered to disrupt, block, reduce, and/or inhibit the transmission of an immune inhibitory signal, by way of non-limiting example, the binding of PD-1 with PD-L1 or PD-L2 and/or the binding of CD172a with CD47 and/or the binding of TIM-3 with one or more of galectin-9 and/or phosphatidylserine.

Further, in addition to suppression of immune inhibitory signaling, it is often desirable to enhance immune stimulatory signal transmission to boost an immune response, for instance to enhance a patient's anti-tumor immune response. In some embodiments, the chimeric protein of the present invention comprises an extracellular domain of an immune stimulatory signal, which, without limitation, is one or more of OX-40 ligand, LIGHT (CD258), GITR ligand, CD70, CD30 ligand, CD40 ligand, CD137 ligand, TRAIL and TL1A. In some embodiments, the chimeric protein of the present invention comprises an extracellular domain of a type II membrane protein which has immune stimulatory properties. In various embodiments, the chimeric protein is engineered to enhance, increase, and/or stimulate the Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 transmission of an immune stimulatory signal, by way of non-limiting example, the binding of GITR with one or more of GITR ligand and/or the binding of 0X40 with OX40L and/or CD40 with CD40 ligand.

In various embodiments, the chimeric protein comprises an immune inhibitory receptor extracellular domain and an immune stimulatory ligand extracellular domain which can, without limitation, deliver an immune stimulation to a T cell while masking a tumor cell’s immune inhibitory signals. In various embodiments, the present chimeric proteins provide improved immunotherapeutic benefits by effectively causing the substitution of an immune inhibitory signal for an immune stimulatory signal. For example, a chimeric protein construct comprising (i) the extracellular domain of PD-1 and (ii) extracellular domain of OX40L, allows for the disruption of an inhibitory PD-L1/L2 signal and its replacement with a stimulating OX40L Accordingly, the present chimeric proteins, in some embodiments are capable of, or find use in methods involving, reducing or eliminating an inhibitory immune signal and/or increasing or activating an immune stimulatory signal. Such beneficial properties are enhanced by the single construct approach of the present chimeric proteins. For instance, the signal replacement can be effected nearly simultaneously and the signal replacement is tailored to be local at a site of clinical importance (e.g. the tumor microenvironment). Further embodiments apply the same principle to other chimeric protein constructs, such as, for example, (i) the extracellular domain of PD-1 and (ii) extracellular domain of GITRL; (i) the extracellular domain of BTLA and (ii) extracellular domain of OX40L; (i) the extracellular domain of TIGIT and (ii) extracellular domain of OX40L; (i) the extracellular domain of TMIGD2 and (ii) extracellular domain of OX40L;(i) the extracellular domain of TIM3 and (ii) extracellular domain of OX40L; and (i) the extracellular domain of CD172a or CD115 and (ii) extracellular domain of CD40L; among others.

Further still, in some embodiments, the present chimeric proteins are capable of, or find use in methods involving, shifting the balance of immune cells in favor of immune attack of a tumor. For instance, the present chimeric proteins can shift the ratio of immune cells at a site of clinical importance in favor of cells that can kill a tumor (e.g. T cells, cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-tumor macrophages (e.g. M1 macrophages), B cells, and dendritic cells and in opposition to cells that protect tumors (e.g. myeloid-derived suppressor cells (MDSCs), regulatory T cells (Tregs); tumor associated neutrophils (TANs), M2 macrophages, and tumor associated macrophages (TAMs)). In some embodiments, the present chimeric protein is capable of increasing a ratio of effector T cells to regulatory T cells.

In various embodiments, the present chimeric protein unexpectedly provides binding of the extracellular domain components to their respective binding partners with longer off rates (Kd or Koh) and therefore, inter alia, accords longer occupancy of the receptor to ligand and vice versa. For instance, in some embodiments, this provides a sustained negative signal masking effect. Further, in some embodiments, this delivers a longer positive signal effect, e.g. to allow an effector cell to be adequately stimulated (e.g. for proliferation and/or release of stimulatory signals like cytokines). Also, this stable synapse of cells Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 (e.g. a tumor cell bearing negative signals and a T cell which could attack the tumor) provides spatial orientation to favor tumor reduction - such as positioning the T cells to attack tumor cells and/or sterically preventing the tumor cell from delivering negative signals, including negative signsis beyond those masked by the chimeric protein of the invention. In still further embodiments, this provides longer on-target (e.g, intra-tumoral) half-life (tic) as compared to serum ti/2 of the chimeric proteins. Such properties could have the combined advantage of reducing off-target toxicities associated with systemic distribution of the chimeric proteins.

Also in vaious aspects, the present chimeric protein is used in a method for treating cancer comprising administering an effective amount of a pharmaceutical composition comprising the chimeric protein to a patient in need thereof. In further aspects, the present chimeric protein is used in a method for treating infections, inducting without limitation, viral infections or other intracellular pathogens. In still further aspects, the present chimeric protein is used in a method for treating autoimmune diseases.

BRIEF DESCRIPTION OF THE FIGURES Figure 1 shows illustrations of orientations of type I (left) and type II (right) membrane proteins in a cell membrane. In the typeI membrane protein of the left panel, the amino terminus (denoted “N”) faces the extracellular environment and the carboxy terminus (denoted “C”) is localized to the intracellular environment. In contrast, the type II membrane protein of the right panel is characterized by an extracellular facing carboxy terminus and an amino terminus in the intracellular space.

Figure 2 shows immune inhibitory and immune stimulatory signaling that is relevant to the present invention (from Mahoney, Nature Reviews Drug Discovery 2015:14;561-585).

Figure 3 shows a schematic illustration of how a type I and type II membrane protein (panel A) may be engineered with transmembrane and intracellular domains removed (panel B) and adjoined using a linker sequence (panel C) to generate a single fusion protein wherein the extracellular domains of the type I and type II membrane proteins each face outward in a single fusion protein (panel D). Panel C depicts the linkage of a type I and type II membrane protein by removal of the transmembrane and intracellular domains of each protein, and where the liberated extracellular domains (ECD) from each protein have been adjoined by a linker sequence. The ECD in this depiction may include the entire amino add sequence of a candidate type I or type II protein which is typically localized outside the cell membrane, or any portion thereof which retains binding to the intended receptor or ligand. Panel D depicts adjoined extracellular domains in a linear construct wherein the extracellular domain of the type I membrane protein faces the 'left' side of the construct and the extracellular domain of the type II membrane protein faces the “right" side of the construct.

Figure 4 shows that tumor cells may express PD-L1 on the cell surface (panel A), which can bind to PD-1 expressed by a T cell (panel B). This interaction suppresses activation of T cells. A fusion protein of the extracellular domain of PD-1, adjoined to the extracellular domain of OX40L may bind to PD-L1 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 on the surface of a tumor cell, preventing binding to PD-1 on the surface of a T cell (panel C). The fusion protein may then 'dangle' from the surface of the tumor cell, and the OX40L portion of the fusion protein may then bind to 0X40 expressed on the surface of the T cell. This would result in replacement of an inhibitory PD-L1 signal with a co-stimulatory OX40L signal to enhance the anti-tumor activity of T cells.

Figure 5 shows the expression of chimeric mouse (m) PD-1-Fc and PD-1-Fc-OX40 ligand (L) from CHO-K1 cells detected using a mouse IgG capture and anti-mlgG detection ELISA assay.

Figure 6 shows results from an ELISA assay confirming the binding of mPD-1-Fc-OX40L to mOX40.

Panel A shows a schematic representation of the ELISA method used to detect binding of mPD-1-FcOX40Lto mOX40. Recombinant mOX40 fused to human Fc (mOX40-hFc) was used to capture mPD-1- Fc-OX40L in the culture media. A rabbit polyclonal antibody to mPD-1 was used to detect the mPD-1 domain in the chimeric protein and subsequently detected using a horseradish peroxidase (HRP)- conjugated polyclonal antibody to rabbit IgG (H+L). Panel B shows results in which two-fold serial dilutions of the CHO-K1 culture media containing mPD-1-Fc-OX40L protein was incubated with plate¬ bound mOX40-hFc and binding was measured by absorbance at 450 nm. mPD-1-Fc protein (which is not predicted to bind recombinant mouse 0X40) containing culture media, as well as culture media alone, were used as negative controls.

Figure 7 shows results from an ELISA assay confirming binding of mPD-1-FC-OX40L to mPD-L1. Panel A shows a schematic representation of the ELISA method used to detect binding of mPD-1-Fc-OX40L to mPD-L1. Recombinant mPD-L1 fused to human Fc (mPD-L1-hFc) was used to capture the mPD-1-FcOX40L chimeric protein in the culture media. A horseradish peroxidase (HRP)-conjugated polyclonal antibody to mouse IgG (H+L) was used for the detection of the bound proteins. Panel B shows results in which two-fold serial dilutions of CHO-K1 culture media containing mPD-1-Fc-OX40L protein was incubated with plate-bound mPD-L1-hFc and binding was measured by absorbance at 450 nm. mPD-1- Fc protein containing culture media was used as a positive control and media alone was used as a negative control.

Figure 8 shows that the in vivo intratumoral delivery of plasmid DNA encoding mouse (m) PD-1-FcOX40L led to an expansion of antigen-specific CD8+ T-cells. “EP only” is an electroporation negative control. In this experiment, C57BU6 mice were adoptively transferred with ovalbumin-specific CD8+ T cells (OT-I) 2 days before tumor inoculation. B16-F10-ova tumors were then implanted on the hind flank of each mouse on day 0. 7-day established B16-F10-ova tumors were injected with the plasmid DNA encoding mPD1-Fc-OX40L and electroporated immediately thereafter on days 7 and 10, as compared to the EP only control. The frequency of OT-I cells was measured on the indicated days in the peripheral blood by flow cytometry. 55 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 Figure 9 shows that the in vivo intratumoral delivery of plasmid DNA encoding mPD-1-Fc-OX40L led to tumor regression in the B16.F10-ova melanoma tumor model. “EP only” is an electroporation negative control. Mice were treated as indicated in Figure 9, and the tumor diameter was measured on the indicated days.

Figure 10 shows results from additional characterization of mPD-1-Fc-OX40L. Panel A provides Western blot analysis probed with antibodies for mPD-1 (left gel), mFc (middle panel) and mOX40L (right panel), run in reducing or non-reducing condition and with or without the deglycosylase PNGase F (as indicated by the '+’ or marks above each blot). The murine protein has a predicted molecular weight of ~60 kDa as a monomeric protein. Panel B shows results from a functional ELISA assay demonstrating the binding of mPD-1-Fc-OX40L to mPD-L1 and mOX40. For each set of histograms, the bars represent, from left to right, a serial dilution of the purified mPD1-Fc-OX40L fusion protein. Panel C shows results from a functional ELISA assay demonstrating the binding of mPD-1-Fc-OX40L to mFc (for each concentration, OX40-His is the left bar and HVEM-His is the right bar). Panel D shows binding to mPD-1-Fc-OX40L to activated mouse splenocytes as detected on HLA l-A/l-E+PD-L1* (APOPD-Lr) and CD4OX40* cells (for each graph, the cell populations to the left represent APC PD-L1- or CD4- 0X40- cells and the cell populations to the right represent APOPD-L1* or CD4OX40* cells). Panel E shows identification of PD-L1iOw (4T1) and PD-L1high (B16.F10) cell lines. Panel F shows results from a splenocyte/tumor co-culture assay. IL2 ELISA was performed 5 days after initial harvest The line graphs from left to right represent +4T1 cells (-FP), +4T1 cells (+500 ng FP), +4T1 cells (+5 ug FP), +B16 cells (-FP), +B16 cells (+500 ng FP), and +B16 cells (+5 ug FP).

Figure 11 shows the anti-tumor efficacy of mPD-1-Fc-0X40L. Panel A shows MC38 tumor growth kinetics following treatment with the indicated regimens. Balb.c mice were inoculated in the hind flank with 2.5x105 MC38-ova tumor cells. On days 5 and 8, mice were treated with the indicated treatment group. Anti-0X40 treated animals received 100 pg of 0X86 mAb on each of two days, anti-PD-L1 treated animals received 100 pg of 10F.9G2 mAb on each of two days, anti-OX40 and anti-PD-L1 combination treated animals received 100 pg each of 0X86 and 10F.9G2 on each of two days and mPD1-Fc-OX40L treated mice received 100 pg total of mPD1-Fc-OX40L on each of two days. Tumor area was calculated on the indicated days by taking perpendicular tumor diameter meaurements using electronic calipers. On day 40, mice which had completely rejected the prior tumor (no visible or palpable tumor remained), were challenged with 2.5x10s MC38 parental (not expressing ova) tumor cells, without any additional treatment, and tumor area was calculated as stated above. Panel B shows the overall survival for each treatment group over the course of the experiment as determined by overall tumor size exceeding 150 mm2 according to IACUC protocols (at day 65, the curves are, top to bottom, aOX4Q/aPD-L1, mPD1-Fc-OX40L, aOX40, aPD-L1, and untreated). Panel C shows peripheral blood analysis of CD4/CD8 ratio (top) and the percentage of FOXP3+ Treg cells (bottom) for each indicated treatment group (in both graphs, the treatment groups are, lefft to right, untreated, aOX40, <xPD-L1, 65 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 aOX40/aPD-L1,and mPD1-Fc-OX40L). Panel D shows serum cytokine analysis of IFNy, TNFa, IL4, and ILS. For each set of data, the line graphs from left to right represent untreated, O-OX40, a-PD-L1, a- 0X40/ a-PD-LI, and mPD-1-Fc-OX40L(ln the four graphs, the treatment groups are, lefft to right, untreated, aOX40, aPD-L1, aOX40/aPD-L1,and mPD1-Fc-OX40L). Panel E shows the mean tumor size for each treatment group on day 13 of the experiment (for each grapgh, the samples are, left to right: untreated, mPD1-Fc-OX40L, mPD1-Fc-GITRL, mCD172a-Fc-CD40L, aOX40, aPD-L1, and a GITR). Panel F shows the percentage of KSP Tetramer specific CD8+ T cells isolated from the tumor (TIL) for each treatment group on day 13 of the experiment (for each grapgh, the samples are, left to right: untreated, mPD1-Fc-OX40L, mPD1-Fc-GITRL, mCD172a-Fc-CD40L, aOX40, aPD-L1, and a GITR). Panel G shows the phenotype of CD8+ splenocytes according to well characterized ‘immune memory’ markers on day 13 of the experiment for each treatment group (for each grapgh, the samples are, left to right: untreated, mPD1-Fc-OX40L, mPD1-Fc-GITRL, mCD172a-Fc-CD40L, <xOX40, aPD-L1, and a GITR). Panel H shows the ratio of CD4 to CD8 cells in the peripheral blood (left panel), spleen (middle panel) and tumor (right panel) for each treatment group on day 13 of the experiment (for each grapgh, the samples are, left to right: untreated, mPD1-Fc-OX40L, mPD1-Fc-GITRL, mCD172a-FcCD40L, otOX40, aPD-L1, and a GITR). Panel I shows a schematic for how each animal was treated in each experiment using the CT26 colon tumor model. Panel J provides representative flow cytometry plots used to calculate the serum concentration of each indicated serum cytokine using the Legend Plex bead array kit from BioLegend. Each indicated cytokine included in the panel is indicated, and the mean-fluorescence intensity of each bead cluster is used to calculate the relative concentration of each cytokine in the serum. Panel K provides an example for how the Legend Plex assay can be used as a pharmacodynamic biomarker of dose response for the PD1-Fc-OX40L fusion protein. Using the concentration of IFNy as an example, increasing concentrations of this cytokine are shown to correspond with increasing treatment amounts of PD1-FC-OX40L (panel K shows, left to right, untreated, 40ug x1 , 40ug x 2, 100ug x 1, and 10Oug x 2). Panel L shows CT26 tumor growth kinetics for each treatment group.

Figure 12, panel A shows the predicted tertiary structure of human PD-1-Fc-DX40L as determined by RaptorX. Panel B shows immunogenicity assessment of human PD-1-Fc-OX40 using iTope, an in silico modeling algorithm (ANTITOPE/ABZENA), cross referenced to a proprietary T cell epitope database.

Figure 13 shows characterization of human PD-1-Fc-OX40L (also referred to as SL-279252). Panel A shows protein A elution peaks (OD450) from SL-279252 purified from stable (in-house) and or transient transfection (Thermo) preparations. ELISA results from each elution peak are overlayed on the absorbance readings to indicate that the SL279252 protein is contained within the first elution peak from the column. Panel B shows Western blot analysis of SL-279252, performed by probing purified protein with human anti-PD-1 (left gel), anti-Fc (middle gel), and anti-OX40L (right gel) antibodies, under non- 75 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 reducing and reducing conditions, and with or without the deglycosylase PNGase F. The predicted molecular weight of monomeric SL-279252 is 60.3 kDa. Panel C shows results from functional ELISAs using capturing with recombinant hOX40 and detection with Gt-hOX40L/Gt-HRP as compared to a recombinant human OX40L-Fc standard. Panel D shows results from functional ELISAs designed to test functional binding for each side of SL-279252 simultaneously. Specifically, recombinant human PDL1 was absorbed to a plate and used to capture SL-279252. Captured protein was then detected using recombinant hOX40-his/HRP rabbit anti-his versus HVEM-his as a negative control for specificity.

Figure 14 shows surface plasmon resonance (SPR) and half-life analysis of SL-279252. The ‘on-rate (Ka)’, ‘off-rate (Kd)', and binding affinity (Kd) were determined for SL-279252, when binding to human PD-L1 (panel A), human PD-L2 (panel B), human 0X40 (panel C), human FcyRIA (panel D), and FcRn (panel E), compared with the appropriate controls. Panel F summarizes the on-rate (Ka), off rate (Kd), and binding affinity (KD) for each condition tested. The binding of a modified SL-279252 construct containing a distinct leader peptide as well as mutations in the Fc region to increase binding to FcRn was also tested when binding to human PD-L1 (panel G), human PD-L2 (panel H), human 0X40 (panel I), human FcyRIA (panel J), and FcRn (panel K), compared with the appropriate controls. Panel L summarizes the on-rate (Ka), off rate (Kd), and binding affinity (KD) for each condition tested. Panel M shows the in vivo serum half-life of SL-279252 in C57BL/6 mice. Panel N shows the in vivo intra-tumoral half-life of SL-279252 in immunocompromised (NSG) mice that were implanted with human PD-L1 positive tumor on on flank (HeLa-PD-L1) and PD-L1 negative tumor on the opposite flank (HeLa). On the indicated days, the two tumors were excised and bi-sected. Half of the bisected tumor was disaggregated and tested for SL-279252 binding by flow cytometry using antibodies against human OX40L Panel 0 shows frozen sections from the other half of the bisected tumors 6 hours, 2 days and 5 days after treatment with a single injection of SL-279252. The figure indicates persistence of SL-279252 at least5 days following administration.

Figure 15 shows binding of SL-279252 to cells in vitro. In panel A, parental Jurkat (cell population to the left) and Jurkal/hOX40 (cell population to the right) cells were assessed by flow cytometry using a hOX40-APC antibody. In panel B, parental CHO-K1 cells (cell population to the left) and CHO-K1/hPDL1 (cell population to the right) were assessed by flow cytometry using a hPD-L1-APC antibody. In panel C, parental CHO-K1 cells (cell population to the left) and CHO-K1/hCD47 (cell population to the right) were assessed by flow cytometry using a hCD47-APC antibody. In panel D, increasing concentrations of SL-279252 were incubated with parental CH0-K1 cells (left panel) and CH0-K1/hPDL1 (middle panel) and detected with anti-human OX40L-APC antibody. The right panel shows the titration curve for increasing concentrations of SL-279252.In panel E, increasing concentrations of SL- 279252 were incubated with parental Jurkat cells (left panel) or Jurkat/hOX40 cells (middle panel) and detected with anti-human OX40L-APC antibody. The right panel shows the titration curve for increasing concentrations of SL-279252. In panel F, increasing concentrations of hCD172a-Fc-OX40L were 85 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 incubated with parental CH0-K1 cells (left panel) or CHO-K1-CD47 cells (middle panel) and detected with an anti-human OX40L-APC antibody. The right panel shows the titration curve for increasing concentrations of hCD172a-Fc-OX40L. Panel G shows binding of increasing concentrations of hCD172a-Fc-OX40L to parental Jurkat cells (left panel) or Jurkat-hOX40 cells (middle panel). The right panel shows the titration curve for increasing concentrations of hCD172a-Fc-OX40L. In panel H, human PD-L1iow (PC3 cells; cell population to the left) and PD-L1high (HCC827; cell population to the right) were identified by flow cytometry. In panel I, increasing concentrations of SL-279252 were incubated with PC3 cells. In panel J, increasing concentrations of SL-279252 were incubated with HCC827 cells for 2 hours. Cells were washed and analyzed by flow cytometry for SL-279252 binding (Fc-PE antibody).

Figure 16 shows the ex vivo functional characterization of SL-279252. In panel A, 0X40 expression was detected in human T cells isolated from PBMCs treated for 2 days with PMA/PHA/ lonomydn (Ion.).

In panel B, binding of SL-279252 was assessed in activated CD4+ and CD8+ cells (Fc-PE secondary).

Panel C provides a schematic representation of a T cell/tumor co-culture assay to detect T cell activation as well as a time-line for the experiment. In panel D, co-culture media was assessed by IL2 ELISA 6 days after initial T cell isolation. The line graphs, from left to right, represent +PC3 (-FP), +PC3 (+500 ng FP), +PC3 (+5 ug FP), +HCC827 (-FP), +HCC827 (+500 ng FP), and +HCC827 (+5 ug FP). In panel E, co-cultured T cells were analyzed by flow cytometry 5 days after initial isolation for proliferation of CD4+ and CD8+ cells (Ki67) and 7 days after isolation for cytokine expression in CD8+ cells. The line graphs, from left to right, represent +HCC827 (-FP), +HCC827 (+500 ng FP), and +HCC827 (+5 ug FP).

Figure 17, panel A shows Western blot analysis of various chimeric proteins including hCD172a-FcOX40L, hPD1-Fc-TL1A, hBTLA-Fc-OX40L, hTMIGD2-Fc-OX40L, hTIM3-Fc-OX40L, mPD1-FoCITRL, mPD1-Fo-4-1BBL, mPD1-Fc-TL1A, mCD172a-Fc-CD40L. Each chimeric protein was probed with antibodies specific for each binding end and the central Fc domain. ELISA assays were performed to confirm binding of various chimeric proteins to human OX40. Panel B shows a schematic representation of the ELISA method used to detect binding of chimeric proteins to human OX40. Panel C shows results of human PD1-Fc-OX40L binding to parental Jurkat cells (left panel, left curve) or to Jurkat/OX40 cells (left panel, right curve). Two negative controls were used to demonstrate specificity: human PD1-FcTL1A (middle panel) and canine PD1-Fc-OX40L (right panel). Panel D shows the predicted tertiary structure of a human CD172a-Fc-OX40L as determined by RaptorX. Panel E shows an example production and purification of human PD1-FC-OX40L (SL-279252) including the Coomassie-Gel (upper left), anti-IgG Western blot (upper right), eluted protein concentration (lower left) and elution profile from affinity chromatography (lower right). Panel F shows an example production and purification of human CD172a-Fc-OX40L including the Coomassie-Gel (upper left), anti-IgG Western blot (upper right), eluted protein concentration (lower left) and elution profile from affinity chromatography (lower right). Panel G shows an example production and purification of mouse CD172a-Fc-CD40L including the purification parameters (upper table) and the LabChip purified protein analysis (lower panel). Panel H shows an 95 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 example production and purification of human TIGIT-Fc-OX40L including the Coomassie-Gel (upper left), anti-IgG Western blot (upper right), eluted protein concentration (lower left) and elution profile from affinity chromatography (lower right). Panel I shows the binding affinity of human CD172a-Fc-OX40L to immobilized recombinant CD47. Panel J shows the binding affinity of human CD172a-Fc-OX40L to immobilized recombinant human 0X40. Panel K shows the binding affinity of human CD172a-Fc- 0X4OL to immobilized recombinant human FcyRIA. Panel L shows the binding affinity of human CD172a-Fc-OX40L to immobilized recombinant human FcRn. Panel M shows a summary of the onrate (Ka), off-rate (Kd), and binding affinity (KD) for each condition tested. Panel N shows an example production and purification of canine PD1-Fc-OX40L including the Coomassie-Gel (upper left), anti-IgG Western blot (upper right), eluted protein concentration (lower left) and elution profile from affinity chromatography (lower right). Panel 0 shows an example production and purification of mouse PD1-FcOX40L including the Coomassie-Gel (upper left), anti-IgG Western blot (upper right), eluted protein concentration (lower left) and elution profile from affinity chromatography (lower right). Panel P shows an example production and purification of mouse PD1-Fc-GITRL including the Coomassie-Gel (upper left), anti-IgG Western blot (upper right), eluted protein concentration (lower left) and elution profile from affinity chromatography (lower right). Panel Q shows an example production and purification of mouse PD1-Fc-41BBL including the Coomassie-Gel (upper left), anti-IgG Western blot (upper right), eluted protein concentration (lower left) and elution profile from affinity chromatography (lower right). Panel R shows an example production and purification of mouse PD1-Fc-TL1A including the Coomassie-Gel (upper left), anti-IgG Western blot (upper right), eluted protein concentration (lower left) and elution profile from affinity chromatography (lower right). Panel S shows an example production and purification of mouse CD115-Fc-CD40L including the Coomassie-Gel (upper left), anti-IgG Western Wot (upper right), eluted protein concentration (lower left) and elution profile from affinity chromatography (lower right). Panel T shows an example production and purification of human PD1-Fc-GITRL including the Coomassie-Gel (upper left), anti-IgG Western blot (upper right), eluted protein concentration (lower left) and elution profile from affinity chromatography (lower right).

DETAILED DESCRIPTION The present invention is based, in part, on the discovery that chimeric proteins can be engineered from the extracellular, or effector, regions of immune-modulating transmembrane proteins in a manner that exploits the orientations of these proteins (e.g. type I versus type II) and therefore allows the delivery of immune stimulatory and/or immune inhibitory signals, including, for example, masking an immune inhibitory signal and replacing it with an immune stimulatory signal in the treatment of cancer.

Chimeric Proteins In one aspect, the present invention relates to a chimeric protein comprising: (a) a first extracellular domain of a type I transmembrane protein at or near the N-terminus, (b) a second extracellular domain 105 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 of a type II transmembrane protein at or near the C-terminus, and (c) a linker, wherein one of the first and second extracellular domains is an immune inhibitory signal and one of the first and second extracellular domains is an immune stimulatory signal.

In some embodiments, chimeric protein refers to a recombinant fusion protein, e.g. a single polypeptide having the extracellular domains described herein (and, optionally a linker). For example, in various embodiments, the chimeric protein is translated as a single unit in a cell. In some embodiments, chimeric protein refers to a recombinant protein of multiple polypeptides, e.g. multiple extracellular domains described herein, that are linked to yield a single unit, e.g. in vitro (e.g. with one or more synthetic linkers described herein).

In some embodiments, an extracellular domain refers to a portion of a transmembrane protein which is capable of interacting with the extracellular environment. In various embodiments, an extracellular domain refers to a portion of a transmembrane protein which is sufficient to bind to a ligand or receptor and effective transmit a signal to a cell. In various embodiments, an extracellular domain is the entire amino add sequence of a transmembrane protein which is external of a cell or the cell membrane. In various embodiments, an extracellular domain is the that portion of an amino acid sequence of a transmembrane protein which is external of a cell or the cell membrane and is needed for signal transduction and/or ligand binding as may be assayed using methods know in the art (e.g. in wfro ligand binding and/or cellular activation assays).

In some embodiments, an immune inhibitory signal refers to a signal that diminishes or eliminates an immune response. For example, in the context of oncology, such signals may diminish or eliminate antitumor immunity. Under normal physiological conditions, inhibitory signal are useful in the maintenance of self-tolerance (e.g. prevention of autoimmunity) and also to protect tissues from damage when the immune system is responding to pathogenic infection. For instance, without limitation, immune inhibitory signal may be identified by detecting an increase in cellular proliferation, cytokine production, cell killing activity or phagocytic activity when such an inhibitory signal is blocked. Specific examples such inhibitory signals include blockade of PD-1 of PD-L1/L2 using antibody mediated blockade or through competitive inhibition of PD-L1/L2 using PD-1 containing fusion proteins. When such an inhibitory signal is blocked through inhibition of PD-L1/L2, it leads to enhance tumor killing activity by T cells because they are no longer being inhibited by PD-L1 or PD-L2. In another example, and inhibitory signal may be provided by CD47 to macrophages expressing CD172a, Binding of CD47 to CD172a typically inhibits the ability of a macrophage to phagocytose a target cell, which can be restored through blockade of CD47 with blocking antibodies or through competitive inhibition of CD47 usingCD172a containing fusion proteins.

In some embodiments, an immune stimulatory signal refers to a signal that enhances an immune response. For example, in the context of oncology, such signals may enhance antitumor immunity. For 115 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 instance, without limitation, immune stimulatory signal may be identified by directly stimulating proliferation, cytokine production, killing activity or phagocytic activity of leukocytes. Specific examples include direct stimulation of TNF superfamily receptors such as 0X40, 4-1BB or TNFRSF25 using either receptor agonist antibodies or using fusion proteins encoding the ligands for such receptors (OX40L, 4- 1BBL, TL1A, respectively). Stimulation from any one of these receptors may directly stimulate the proliferation and cytokine production of individual T cell subsets. Another example includes direct stimulation of an immune inhibitory cell with through a receptor that inhibits the activity of such an immune suppressor cell. This would include, for example, stimulation of CD4+FoxP3+ regulatory T cells with a GITR agonist antibody or GITRL containing fusion protein, which would reduce the abiIity of those regulatory T cells to suppress the proliferation of conventional CD4+ or CD8+ T cells. In another example, this would include stimulation of CD40 on the surface of an antigen presenting cell using a CD40 agonist antibody or a fusion protein containing CD40L, causing activation of antigen presenting cells including enhanced ability of those cells to present antigen in the context of appropriate native costimulatory molecules, including those in the B7 or TNF superfamily.

Membrane proteins typically consist of an extracellular domain, one or a series of trans-membrane domains, and an intracellular domain. Without wishing to be bound by theory, the extracellular domain of a membrane protein is responsible for interacting with a soluble or membrane bound receptor or ligand. Without wishing to be bound by theory, the trans-membrane domain(s) are responsible for localizing a protein to the plasma membrane. Without wishing to be bound by theory, the intracellular domain of a membrane protein is responsible for coordinating interactions with cellular signaling molecules to coordinate intracellular responses with the extracellular environment (or visa-versa). There are two types of single-pass membrane proteins, those with an extracellular amino terminus and intracellular carboxy terminus (type I) and those with an extracellular carboxy terminus and intracellular amino terminus (type II). Both type I and type II membrane proteins can be either receptors or ligands.

For type I membrane proteins, the amino terminus of the protein faces outside the cell, and therefore contains the functional domains that are responsible for interacting with other binding partners (either ligands or receptors) in the extracellular environment (FIG. 1, left image). For type II membrane proteins, the carboxy terminus of the protein faces outside the cell, and therefore contains the functional domains that are responsible for interacting with other binding partners (either ligands or receptors) in the extracellular environment (FIG. 1, right image). Thus, these two types of proteins have opposite orientations to each other.

Because the outward facing domains of type I and type II membrane proteins are opposite (FIG. 1), it is possible to link the extracellular domains of a type I and type II membrane protein such that the ‘outward facing’ domains of the molecules are also in opposing orientation to each other (FIG. 3). The resulting construct would therefore consist of the extracellular domain of a type I membrane protein on the 'left' side of the molecule, connected to the extracellular domain of a type II membrane protein on the ‘right’ 125 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 side of the molecule using a linker sequence. This construct could be produced by cloning of these three fragments (the extracellular domain of a type I protein, followed by a linker sequence, followed by the extracellular domain of a type II protein) into a vector (plasmid, viral or other) wherein the amino terminus of the complete sequence corresponded to the ‘left’ side of the molecule containing the type I protein and the carboxy terminus of the complete sequence corresponded to the ‘right’ side of the molecule containing the type II protein. Accordingly, in various embodiments, the present chimeric proteins are engineered as such.

In some embodiments, the extracellular domain may be used to produce a soluble protein to competitively inhibit signaling by that receptor’s ligand. In some embodiments, the extracellular domain may be used to provide artificial signaling.

In some embodiments, the extracellular domain of a type I transmembrane protein is an immune inhibitory signal. In some embodiments, the extracellular domain of a type II transmembrane protein is an immune stimulatory signal.

In some embodiments, the present chimeric proteins comprise an extracellular domain of a type I transmembrane protein, or a functional fragment thereof. In some embodiments, the present chimeric proteins comprise an extracellular domain of a type II transmembrane protein, or a functional fragment thereof. In some embodiments, the present chimeric proteins comprise an extracellular domain of a type I transmembrane protein, or a functional fragment thereof, and an extracellular domain of a type II transmembrane protein, or a functional fragment thereof.

In various embodiments, the present chimeric proteins comprise an extracellular domain of a human type I transmembrane protein as recited in TABLE 1, or a functional fragment thereof. In various embodiments, the present chimeric proteins comprise an extracellular domain of a human type II transmembrane protein as recited in TABLE 2, or a functional fragment thereof. In some embodiments, the present chimeric proteins comprise an extracellular domain of a type I transmembrane protein as recited in TABLE 1, or a functional fragment thereof, and an extracellular domain of a type II transmembrane protein as recited in TABLE 2, or a functional fragment thereof. TABLES 1 and 2 are provided elsewhere herein.

In various embodiments, the present chimeric proteins may be engineered to target one or more molecules that reside on human leukocytes including, without limitation, the extracellular domains (where applicable) of SLAMF4, IL-2 R a, 4-1BB/TNFRSF9, IL-2 R p, ALCAM, B7-1, IL-4 R, B7-H3, BLAME/SLAMFS, CEACAM1, IL-6 R, IL-7 Ra, IL-10R a, IL-1 0 R p, IL-12 R p 1, IL-12 R p 2, CD2, IL-13 R a 1, IL-13, CD3, CD4, ILT2/CDS5), ILT3/CDS5k, ILT4/CDS5d, ILT5/CDS5a, lutegrin a 4/CD49d, CDS, Integrin a E/CD103, CD6, Integrin a M/CD 11 b, CDS, Integrin a X/CD11c, Integrin p 2/CDIS, KIR/CD15S, CD27/TNFRSF7, KIR2DL1, CD2S, KIR2DL3, CD30/TNFRSFS, KIR2DL4/CD15Sd, CD31/PECAM-1, KIR2DS4, CD40 Ugand/TNFSF5, LAG-3, CD43, LAIR1, CD45, LAIR2, CDS3, 135 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 Leukotriene B4-R1, CDS4/SLAMF5, NCAM-L1, CD94, NKG2A, CD97, NKG2C, CD229/SLAMF3, NKG2D, CD2F-10/SLAMF9, NT-4, CD69, NTB-A/SLAMF6, Common y Chain/IL-2 R y, Osteopontin, CRACC/SLAMF7, PD-1, CRTAM, PSGL-1, CTLA-4, RANK/TNFRSF11A, CX3CR1, CX3CL1, LSelectin, SIRP 0 1, SLAM, TCCR/WSX-1, DNAM-1, Thymopoietin, EMMPRIN/CD147, TIM-1, EphB6, TIM-2, Fas/TNFRSF6, TIM-3, Fas Ligand/TNFSF6, TIM-4, Fey RIII/CD16, TIM-6, TNFR1/TNFRSF1A, Granulysin, TNF RIII/TNFRSF1B, TRAIL RI/TNFRSFIOA, ICAM-1/CD54, TRAIL R2/TNFRSF10B, ICAM-2/CD102, TRAILR3/TNFRSF10C,IFN-yR1, TRAILR4/TNFRSF10D, IFN-y R2, TSLP, IL-1 R1 and TSLPR.

The activation of regulatory T cells is critically influenced by costimulatory and coinhibitory signals. Two major families of costimulatory molecules include the B7 and the tumor necrosis factor (TNF) families.

These molecules bind to receptors on T cells belonging to the CD28 or TNF receptor fanilies, respectively. Many well-defined coinhibitors and their receptors belong to the B7 and CD28 families.

In various embodiments, the present chimeric proteins may be engineered to target one or more molecules involved in immune inhibition, including for example: CTLA-4, PD-L1, PD-L2, PD-1, BTLA, HVEM, TIM3, GAL9, LAG3, VISTAA/SIG8, KIR, 2B4, TIGIT, CD160 (also referred to as BY55), CHK 1 and CHK2 kinases, A2aR, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), and various B- 7 family ligands (including, but are not limited to, B7-1, B7-2, B7-DC, B7-H1, B7-H2, B7-H3, B7-H4, B7- H5, B7-H6and B7-H7).

In various embodiments, the chimeric protein of the present invention comprises an extracellular domain of an immune inhibitory agent, including without limitation, one or more of TIM-3, BTLA, PD-1, CTLA-4, CD244, CD160, TIGIT, SIRPa/CD172a, 2B4, VISTA, VSIG8, LAG3, CD200 and TMIGD2.

In some embodiments, the chimeric protein of the present invention comprises an extracellular domain of a type I membrane protein which has immune inhibitory properties. In various embodiments, the chimeric protein is engineered to disrupt, block, reduce, and/or inhibit the transmission of an immune inhibitory signal, by way of non-limiting example, the binding of PD-1 with PD-L1 or PD-L2 and/or the binding of CD172a with CD47 and/or the binding of TIM-3 with galectin-9 and/or phosphatidyserine.

In some embodiments, the chimeric protein of the present invention comprises an extracellular domain of an immune stimulatory signal is one or more of OX-40 ligand (OX-40L), LIGHT (CD258), GITR ligand (GITRL), CD70, CD30 ligand, CD40 ligand (CD40L), CD137 ligand, TRAIL, and TL1A.

In various embodiments, the chimeric protein simulates binding of an inhibitory signal ligand to its cognate receptor (e.g. PD-1 to PD-L1 or PD-L2; e.g. CD172a to CD47; e.g. CD115 to CSF1; e.g. TIM-3 to galedin-9 or phosphatidylserine) but inhibits the inhibitory signal transmission to an immune cell (e.g. a T cell, macrophage or other leukocyte). 145 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 In various embodiments, the chimeric protein comprises an immune inhibitory receptor extracellular domain and an immune stimulatory ligand extracellular domain which can, without limitation, deliver an immune stimulation to a T cell while masking a tumor cell’s immune inhibitory signals. In various embodiments, the chimeric protein delivers a signal that has the net result of T cell activation.

In some embodiments, the chimeric protein comprises an immune inhibitory signal which is an ECD of a receptor of an immune inhibitory signal and this acts on a tumor cell that bears a cognate ligand of the immune inhibitory signal. In some embodiments, the chimeric protein comprises an immune stimulatory signal which is an ECD of a ligand of an immune stimulatory signal and this acts on a T cell that bears a cognate receptor of the immune stimulatory signal. In some embodiments, the chimeric protein comprises both (i) an immune inhibitory signal which is a receptor of an immune inhibitory signal and this acts on a tumor cell that bears a cognate ligand of the immune inhibitory signal and (ii) an immune stimulatory signal which is a ligand of an immune stimulatory signal and this acts on a T cell that bears a cognate receptor of the immune stimulatory signal.

In some embodiments, the chimeric protein of the present invention comprises an extracellular domain of one or more of the immune-modulating agents described in Mahoney, Nature Reviews Drug Discovery 2015:14;561-585. For example, with reference to present FIG. 2, the chimeric protein bears an immune inhibitory signal (denoted by “-”) which is a receptor of the pair (i.e. right side of the figure) and the tumor cell bears a ligand selected from the left side of the figure. By way of further example, with reference to present FIG. 2, the chimeric protein bears an immune stimulatory signal (denoted by “+”) which is a ligand of the pair (i.e. left side of the figure) and the tumor cell bears a receptor selected from the right side of the figure.

In some embodiments, the chimeric protein of the present invention comprises an extracellular domain of a type II membrane protein which has immune stimulatory properties. In various embodiments, the chimeric protein is engineered to enhance, increase, and/or stimulate the transmission of an immune stimulatory signal, by way of non-limiting example, the binding of GITR with one or more of GITR ligand and/or the binding of 0X40 with OX40L and/or the binding of CD40 with CD40 ligand.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent PD-1 and is paired with an immune stimulatory agent as follows: PD-1/4-1BBL; PD-1/OX-40L; PD-1/UGHT; PD-1/GITRL; PD-1/CD70; PD-1/CD30L; PD-1/CD40L; and PD-1/TL1A.

In an embodiment, the chimeric protein comprises the extracellular domain of the immune inhibitory agent PD-1 and is paired with the immune stimulatory agent OX-40L. In an embodiment, the chimeric protein comprises the amino acid sequence of SEQ ID NO: 22. In various embodiments, the chimeric protein binds to human PD-L1 or PD-L2 with a Ko of about 1 nM to about 5 nM, for example, about 1 nM, about 1.5 nM, about 2 nM, about 2.5 nM, about 3 nM, about 3.5 nM, about 4 nM, about 4.5 nM, or about 5 nM. In various embodiments, the chimeric protein binds to human PD-L1 with a Kd of about 5 155 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 nM to about 15 nM, for example, about 5 nM, about 5.5 nM, about 6 nM, about 6.5 nM, about 7 nM, about 7.5 nM, about 8 nM, about 8.5 nM, about 9 nM, about 9.5 nM, about 10 nM, about 10.5 nM, about 11 nM, about 11.5 nM, about 12 nM, about 12.5 nM, about 13 nM, about 13.5 nM, about 14 nM, about 14.5 nM, orabout15nM.

In various embodiments, the chimeric protein exhibits enhanced stability and protein half-life. In some embodiments, the chimeric protein binds to FcRn with high affinity. In various embodiments, the chimeric protein may bind to FcRn with a Kd of about 70 nM to about 80 nM. For example, the chimeric protein may bind to FcRn with a Kd of about 70 nM, about 71 nM, about 72 nM, about 73 nM, about 74 nM, about 75 nM, about 76 nM, about 77 nM, about 78 nM, about 79 nM, or about 80 nM. In some embodiments, the chimeric protein does not substantially bind to other Fc receptors (i.e. other than FcRn) with effector function.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent PD-L1 or PD-L2 and is paired with an immune stimulatory receptor as follows: PD-L1/4-1BB; PDL1/OX-40; PD-L1/HVEM; PD-L1/GITR; PD-L1/CD27; PD-L1/CD28; PD-L1/CD30; PD-L1/CD40 and PDL1/CD137.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent PD-L2 and is paired with an immune stimulatory receptor as follows: PD-L2/4-1BB; PD-L2/OX-40; PD-L2/HVEM; PD-L2/GITR; PD-L2/CD27; PD-L2/CD28; PD-L2/CD30; PD-L2/CD40 and PD-L2/CD137.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent TIM-3 and is paired with an immune stimulatory agent as follows: TIM-3/OX-40L; TIM-3AJGHT; TIM-3/GITRL; TIM-3/CD70; TIM-3/CD30L; TIM-3/CD40L; TIM-3/CD137L; TIM-3/TL1A; aid TIM- 3/OX40L.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent BTLA and is paired with an immune stimulatory agent as follows: BTLA/OX-40L; BTLA/LIGHT; BTLA/GITRL; BTLA/CD70; BTLA/CD30L; BTLA/CD40L; BTLA/CD137L; BTLA/TL1A; and BTLA/OX40L.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent CD172a/SIRPa and is paired with an immune stimulatory agent as follows: CD172a/OX-40L; CD172a/LIGHT; CD172a/CD70; CD172a/CD30L; CD172a/CD40L; CD172a/CD137L; CD172a/TL1A; and CD172a/OX40L.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent CD115 and is paired with an immune stimulatory agent as follows: CD115/OX-40L; CD115/UGHT; CD115/CD70; CD115/CD30L; CD115/CD40L; CD115/CD137L; CD115/TL1A; and CD115/OX40L. 165 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent TIGIT and is paired with an immune stimulatory agent as follows: TIGIT/0X-4OL; TIGIT/LIGHT; TIGIT/GITRL; TIGIT/CD70; TIGIT/CD30L; TIGIT/CD40L; TIGIT/CD137L; TIGIT/TL1A; and TIGIT/OX40L.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent TMIGD2 and is paired with an immune stimulatory agent as follows: TMIGD2/OX-40L; TMIGD2/UGHT; TMIGD2/GITRL; TMIGD2/CD70; TMIGD2/CD30L; TMIGD2/CD40L; TMIGD2/CD137L; TMIGD2/TL1A; and TMIGD2/OX40L.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent LAG3 and is paired with an immune stimulatory agent as follows: LAG3/OX-40L; LAG3/UGHT; LAG3/GITRL; LAG3/CD70; LAG3/CD30L; LAG3/CD40L; LAG3/CD137L; LAG3/TL1A; and LAG3/OX40L.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent VSIG8 and is paired with an immune stimulatory agent as follows: VSIG8/OX-40L; VSIG8AJGHT; VSIG8/GITRL; VSIG8/CD70; VSIG8/CD30L; VSIG8/CD40L; VSIG8/CD137L; VSIG8/TL1A; and VSIG8/OX40L.

In some embodiments, the chimeric protein comprises the extracellular domain of the immune inhibitory agent CD200 and is paired with an immune stimulatory agent as follows: CD20Q/OX-40L; CD20Q/UGHT; CD200/GITRL; CD200/CD70; CD200/CD30L; CD200/CD40L; CD200/CD137L; CD20Qn"L1A; and CD200/OX40L.

In various embodiments, the present chimeric proteins may comprises variants of the extracellular domains described herein, for instance, a sequence having at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99%) sequence identity with the known amino acid or nucleic acid sequence of the extracellular domains, e.g. human extracellular domains, e.g. one or more of SEQ IDs NOs: 1-15 as a whole or relative to indicated domains therein. Included herein are various illustrative sequences, as SEQ IDs NOs: 1-15, which show extracellular domains as underlined or in 175 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 bold and a linker in normal text. In various embodiments, the linker can be swapped for another described herein.

In an illustrative embodiment, the chimeric protein of the present invention comprises an extracellular domain of PD-1 and the extracellular domain of OX40L using the hinge-CH2-CH3 domain from a human lgG4 antibody sequence. In this embodiment, the extracellular domain of PD-1 is underlined, followed by the hinge-CH2-CH3 domain of human lgG4 and short linker (normal text), followed by the extracellular domain of OX40L (bold text): ATGCAGATCCCACAGGCGCCCTGGCCAGTCGTCTGGGCGGTG CTACAACTGGGCTGGCGGCCAGGATGGTTCTTAGACTCCCCA GACAGGCCCTGGAACCCCCCCACCTTCTCCCCAGCCCTGCTC GTGGTGACCGAAGGGGACAACGCCACCTTCACCTGCAGCTTC TCCAACACATCGGAGAGCTTCGTGCTAAACTGGTACCGCATGA GCCCCAGCAACCAGACGGACAAGCTGGCCGCCTTCCCCGAG GACCGCAGCCAGCCCGGCCAGGACTGCCGCTTCCGTGTCACA CAACTGCCCAACGGGCGTGACTTCCACATGAGCGTGGTCAGG GCCCGGCGCAATGACAGCGGCACCTACCTCTGTGGGGCCATC TCCCTGGCCCCCAAGGCGCAGATCAAAGAGAGCCTGCGGGCA GAGCTCAGGGTGACAGAGAGAAGGGCAGAAGTGCCCACAGC CCACCCCAGCCCCTCACCCAGGCCAGCCGGCCAGTTCCAATC TAAGTACGGCCCTCCCTGCCCTAGCTGTCCCGCCCCTGAATTT CTGGGCGGACCCTCCGTGTTTCTGTTCCCCCCAAAGCCCAAG GACACCCTGATGATCAGCCGGACCCCCGAAGTGACCTGTGTG GTGGTGGATGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAAT TGGTACGTGGACGGGGTGGAAGTGCACAACGCCAAGACCAAG CCCAGAGAGGAACAGTTCAACAGCACCTACCGGGTGGTGTCT GTGCTGACCGTGCTGCACCAGGATTGGCTGAGCGGCAAAGAG TACAAGTGCAAGGTGTCCAGCAAGGGCCTGCCCAGCAGCATC GAAAAGACCATCAGCAACGCCACCGGCCAGCCCAGGGAACCC CAGGTGTACACACTGCCCCCTAGCCAGGAAGAGATGACCAAG AACCAGGTGTCCCTGACATGCCTCGTGAAGGGCTTCTACCCCT CCGATATCGCCGTGGAATGGGAGAGCAACGGCCAGCCAGAGA ACAACTACAAGACCACCCCCCCAGTGCTGGACAGCGACGGCT CATTCTTCCTGTACTCCCGGCTGACAGTGGACAAGAGCAGCTG GCAGGAAGGCAACGTGTTCAGCTGCAGCGTGATGCACGAAGC CCTGCACAACCACTACACCCAGAAGTCCCTGAGCCTGTCCCT GGGCAAAATAGAGGGACGAATGGACCAGGTATCACATCGGTA 185 Date ReQue/Date Received 2023-02-27 C& 02999280 20X8-03-20 TCCTCGAATTCAAAGTATCAAAGTACAATTTACCGAATATAAG AAGGAGAAAGGTTTCATCCTCACTTCCCAAAAGGAGGATGAA ATCATGAAGGTGCAGAACAACTCAGTCATCATCAACTGTGAT GGGTTTTATCTCATCTCCCTGAAGGGCTACTTCTCCCAGGAA GTCAACATTAGCCTTCATTACCAGAAGGATGAGGAGCCCCTC TTCCAACTGAAGAAGGTCAGGTCTGTCAACTCCTTGATGGTG GCCTCTCTGACTTACAAAGACAAAGTCTACTTGAATGTGACC ACTGACAATACCTCCCTGGATGACTTCCATGTGAATGGCGGA GAACTGATTCTTATCCATCAAAATCCTGGTGAATTCTGTGTCC TTTGA(SEQID NO: 1).

This sequence encodes a protein with an amino acid sequence: MQIPQAPWPVVWAVLQLGWRPGWFLDSPDR P WN P P T FS P ALLVVTEGD N AT FTC S FS N TS ES FVLNWYRMSPSNQTDKLAAFPEDRSQPGQDC RFRVTQLPNGRDFHMSVVRARRNDSGTYLCG A I S LAP K AQ I K ES LRAE LRVT ER RAE VPT AH PS PSPRPAGQFQS KYGPPCPSCPAPEFLGGPSV F L F P P K P K D T LM I S RT P E VT C VVVD VS Q ED P E VQFNWYVDGVEVHNAKTKPREEQFNSTYRVV SVLTVLHQDWLSGKEYKCKVSSKGLPSSIEKT I S N ATG Q PR E PQ VYT L P PS Q E EM T K N Q VS LTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLD S DG S F F LYS RLT VD KS S WQ EG N V FSC S V M H E A L H N H YTQ K S LS LS LG K I EG R M D QVS H RYP RI QSI KVQFTEYKKE KG Fl LT S Q KE D E I M K VQ N N SVIINCDGFYLISLKGYFSQEVNISLHYQKDEE P L FQ L K KVRS VN S L M V AS LT YKD KVY L N VT T D N T S L D D F H V N G G E L I L I H Q N P G E F C V L Stop (SEQ ID NO: 2) Further, this amino acid sequence, as well as the amino acid sequences of any of the extracellular domains described herein (whether or not explicitly listed) could also be achieved with codon-optimized nucleic acid sequences, such as the following sequence which is optimized for expression by Chinese Hamster (CHO) cells: ATGCAGATTCCTCAGGCCCCTTGGCCTGTCGTGTGGGCTGTG CTGCAGCTGGGATGGCGGCCTGGCTGGTTTCTGGACAGCCCC 195 Date ReQue/Date Received 2023-02-27 O& 02999280 20X8-03-20 GACAGACCCTGGAACCCCCCTACATTTTCCCCTGCCCTGCTG GTCGTGACCGAGGGCGACAATGCCACCTTCACCTGTAGCTTC AGCAACACCAGCGAGAGCTTCGTGCTGAACTGGTACAGAATG AGCCCCAGCAACCAGACCGACAAGCTGGCCGCCTTCCCCGAG GATAGATCTCAGCCCGGCCAGGACTGCCGGTTCAGAGTGACC CAGCTGCCCAACGGCCGGGACTTCCACATGTCTGTCGTGCGG GCCAGACGGAACGACAGCGGCACATATCTGTGCGGCGCCATC AGCCTGGCCCCCAAGGCCCAGATCAAAGAGAGCCTGAGAGCC GAGCTGAGAGTGACCGAGAGAAGGGCCGAAGTGCCTACCGC CCACCCTAGCCCATCTCCAAGACCTGCCGGCCAGTTCCAGTC TAAGTACGGCCCTCCTTGCCCCAGCTGTCCCGCCCCTGAATTT CTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCAAAGCCCAAG GACACCCTGATGATCAGCCGGACCCCCGAAGTGACCTGCGTG GTGGTGGATGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAAT TGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAG CCCAGAGAGGAACAGTTCAACAGCACCTACCGGGTGGTGTCC GTGCTGACCGTGCTGCACCAGGATTGGCTGAGCGGCAAAGAG TACAAGTGCAAGGTGTCCAGCAAGGGCCTGCCCAGCAGCATC GAGAAAACCATCAGCAACGCCACCGGCCAGCCCAGGGAACCC CAGGTGTACACACTGCCCCCTAGCCAGGAAGAGATGACCAAG AACCAGGTGTCCCTGACCTGTCTCGTGAAGGGCTTCTACCCCT CCGATATCGCCGTGGAATGGGAGAGCAACGGCCAGCCTGAGA ACAACTACAAGACCACCCCCCCAGTGCTGGACAGCGACGGCT CATTTTTCCTGTACTCCAGACTGACCGTGGACAAGAGCAGCTG GCAGGAAGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGC CCTGCACAACCACTACACCCAGAAGTCCCTGTCTCTGAGCCTG GGCAAGATCGAGGGCCGGATGGATAGAGCCCAGGGCGAAGC CTGCGTGCAGTTCCAGGCTCTGAAGGGCCAGGAATTCGCCC CCAGCCACCAGCAGGTGTACGCCCCTCTGAGAGCTGACGGC GACAAGCCTAGAGCCCACCTGACAGTCGTGCGGCAGACCCC TACCCAGCACTTCAAGAATCAGTTCCCAGCCCTGCACTGGGA GCACGAGCTGGGCCTGGCCTTCACCAAGAACAGAATGAACT ACACCAACAAGTTTCTGCTGATCCCCGAGAGCGGCGACTACT TCATCTACAGCCAAGTGACCTTCCGGGGCATGACCAGCGAGT GCAGCGAGATCAGACAGGCCGGCAGACCTAACAAGCCCGAC AGCATCACCGTCGTGATCACCAAAGTGACCGACAGCTACCC CGAGCCCACACAGCTGCTGATGGGCACCAAGAGCGTGTGCG 205 Date ReQue/Date Received 2023-02-27 C& 02999280 20X8-03-20 AAGTGGGCAGCAACTGGTTCCAGCCCATCTACCTGGGCGCC ATGTTCAGTCTGCAAGAGGGCGATAAGCTGATGGTCAACGTG TCCGACATCTCCCTGGTGGATTACACCAAAGAGGACAAGACC TTCTTCGGCGCCTTTCTGCTCTGA (SEQ ID NO: 3) Another embodiment of the present chimeric protein comprises the extracellular domain of PD-1 and the extracellular domain of costimulatory ligand, such as TL1A, 4-1BBL, ICOSL, GITRL, CD27 or CD40L.

An example sequence encoding the extracellular domain of PD-1 (underlined) -Fc (normal text)- the extracellular domain of TL1A (bold text) is: ATGCAGATCCCACAGGCGCCCTGGCCAGTCGTCTGGGCGGTG CTACAACTGGGCTGGCGGCCAGGATGGTTCTTAGACTCCCCA GACAGGCCCTGGAACCCCCCCACCTTCTCCCCAGCCCTGCTC GTGGTGACCGAAGGGGACAACGCCACCTTCACCTGCAGCTTC TCCAACACATCGGAGAGCTTCGTGCTAAACTGGTACCGCATGA GCCCCAGCAACCAGACGGACAAGCTGGCCGCCTTCCCCGAG GACCGCAGCCAGCCCGGCCAGGACTGCCGCTTCCGTGTCACA CAACTGCCCAACGGGCGTGACTTCCACATGAGCGTGGTCAGG GCCCGGCGCAATGACAGCGGCACCTACCTCTGTGGGGCCATC TCCCTGGCCCCCAAGGCGCAGATCAAAGAGAGCCTGCGGGCA GAGCTCAGGGTGACAGAGAGAAGGGCAGAAGTGCCCACAGC CCACCCCAGCCCCTCACCCAGGCCAGCCGGCCAGTTCCAATC TAAGTACGGCCCTCCCTGCCCTAGCTGTCCCGCCCCTGAATTT CTGGGCGGACCCTCCGTGTTTCTGTTCCCCCCAAAGCCCAAG GACACCCTGATGATCAGCCGGACCCCCGAAGTGACCTGTGTG GTGGTGGATGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAAT TGGTACGTGGACGGGGTGGAAGTGCACAACGCCAAGACCAAG CCCAGAGAGGAACAGTTCAACAGCACCTACCGGGTGGTGTCT GTGCTGACCGTGCTGCACCAGGATTGGCTGAGCGGCAAAGAG TACAAGTGCAAGGTGTCCAGCAAGGGCCTGCCCAGCAGCATC GAAAAGACCATCAGCAACGCCACCGGCCAGCCCAGGGAACCC CAGGTGTACACACTGCCCCCTAGCCAGGAAGAGATGACCAAG AACCAGGTGTCCCTGACATGCCTCGTGAAGGGCTTCTACCCCT CCGATATCGCCGTGGAATGGGAGAGCAACGGCCAGCCAGAGA ACAACTACAAGACCACCCCCCCAGTGCTGGACAGCGACGGCT CATTCTTCCTGTACTCCCGGCTGACAGTGGACAAGAGCAGCTG GCAGGAAGGCAACGTGTTCAGCTGCAGCGTGATGCACGAAGC CCTGCACAACCACTACACCCAGAAGTCCCTGAGCCTGTCCCT 215 Date ReQue/Date Received 2023-02-27 WO 2017/059168 O& 02999280 20X8-03-20 PCT/US2016/054598 GGGCAAAATAGAGGGACGAATGGACCGGGCCCAGGGAGAGG CCTGTGTGCAGTTCCAGGCTCTAAAAGGACAGGAGTTTGCAC CTTCACATCAGCAAGTTTATGCACCTCTTAGAGCAGACGGAG ATAAGCCAAGGGCACACCTGACAGTTGTGAGACAAACTCCC ACACAGCACTTTAAAAATCAGTTCCCAGCTCTGCACTGGGAA CATGAACTAGGCCTGGCCTTCAGCAAGAACCGAATGAACTAT ACCAACAAATTCCTGCTGATCCCAGAGTCGGGAGACTACTTC ATTTACTCCCAGGTCACATTCCGTGGGATGACCTCTGAGTGC AGTGAAATCAGACAAGCAGGCCGACCAAACAAGCCAGACTC CATCACTGTGGTCATCACCAAGGTAACAGACAGCTACCCTGA GCCAACCCAGCTCCTCATGGGGACCAAGTCTGTATGCGAAGT AGGTAGCAACTGGTTCCAGCCCATCTACCTCGGAGCCATGTT CTCCTTGCAAGAAGGGGACAAGCTAATGGTGAACGTCAGTG ACATCTCTTTGGTGGATTACACAAAAGAAGATAAAACCTTCTT TGGAGCCTTCTTACTATAG (SEQ ID NO: 4) This nucleotide sequence of SEQ ID NO: 4 may be codon optimized, to encode a protein with an amino acid sequence: MQIPQAPWPVVWAVLQLGWRPGWFLDSPDR P WN P P T FS P ALLVVTEGD N AT FTC S FS N TS ES F VL N W Y RM S P S N QT D K LAA F P E D RS Q PG Q D C RFRVTQLPNGRDFHMSVVRARRNDSGTYLCG A I S LAP K AQ I K ES LR AE LRVT E R RAE VPT AH PS PSPRPAGQFQS KYGPPCPSCPAPEFLGGPSV F L F P P K P K D T LM I S RT P E VT C VVVD VS Q ED P E VQFNWYVDGVEVHNAKTKPREEQFNSTYRVV SVLTVLHQDWLSGKEYKCKVSSKGLPSSIEKT I S N ATG Q PR E PQ VYT L P PS Q E EM T K N Q VS LTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSRLTVDKSSWQEGNVFSCSVMHE A LH N H YTQ KS LS LS LG K I EG R M D R AQ G E AC V QFQALKGQEFAPSHQQVYAPLRADGDKPRA HLTVVRQTPTQHFKNQFPALHWEHELGLAFT KNRMNYTNKFLLIPESGDYFIYSQVTFRGMTS ECSEIRQAGRPNKPDSITVVITKVTDSYPEPT QLLMGTKSVCEVGSNWFQPIYLGAMFSLQEG 225 Date ReQue/Date Received 2023-02-27 WO 2017/059168 C& 02999280 20X8-03-20 PCT/US2016/054598 D K L M V N V S D I S L VD Y T KE D K T F F G A F L LStop (SEQ ID NO: 5) There are many type I membrane proteins expressed by tumor cells that could be masked by a fusion protein encoding the extracellular domain of a cognate receptor. Additional examples would indude a fusion protein encoding the extracellular domain of BTLA, linked through an Fc to OX40L. Such a construct could be encoded by the nucleic acid sequence: ATGAAGACATTGCCTGCCATGCTTGGAACTGGGAAATTATTTT GGGTCTTCTTCTTAATCCCATATCTGGACATCTGGAACATCCAT GGGAAAGAATCATGTGATGTACAGCTTTATATAAAGAGACAAT CTGAACACTCCATCTTAGCAGGAGATCCCTTTGAACTAGAATG CCCTGTGAAATACTGTGCTAACAGGCCTCATGTGACTTGGTGC AAGCTCAATGGAACAACATGTGTAAAACTTGAAGATAGACAAA CAAGTTGGAAGGAAGAGAAGAACATTTCATTTTTCATTCTACAT TTTGAACCAGTGCTTCCTAATGACAATGGGTCATACCGCTGTT CTGCAAATTTTCAGTCTAATCTCATTGAAAGCCACTCAACAACT CTTTATGTGACAGATGTAAAAAGTGCCTCAGAACGACCCTCCA AGGACGAAATGGCAAGCTCTAAGTACGGCCCTCCCTGCCCTA GCTGTCCCGCCCCTGAATTTCTGGGCGGACCCTCCGTGTTTCT GTTCCCCCCAAAGCCCAAGGACACCCTGATGATCAGCCGGAC CCCCGAAGTGACCTGTGTGGTGGTGGATGTGTCCCAGGAAGA TCCCGAGGTGCAGTTCAATTGGTACGTGGACGGGGTGGAAGT GCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCAACAG CACCTACCGGGTGGTGTCTGTGCTGACCGTGCTGCACCAGGA TTGGCTGAGCGGCAAAGAGTACAAGTGCAAGGTGTCCAGCAA GGGCCTGCCCAGCAGCATCGAAAAGACCATCAGCAACGCCAC CGGCCAGCCCAGGGAACCCCAGGTGTACACACTGCCCCCTAG CCAGGAAGAGATGACCAAGAACCAGGTGTCCCTGACATGCCT CGTGAAGGGCTTCTACCCCTCCGATATCGCCGTGGAATGGGA GAGCAACGGCCAGCCAGAGAACAACTACAAGACCACCCCCCC AGTGCTGGACAGCGACGGCTCATTCTTCCTGTACTCCCGGCT GACAGTGGACAAGAGCAGCTGGCAGGAAGGCAACGTGTTCAG CTGCAGCGTGATGCACGAAGCCCTGCACAACCACTACACCCA GAAGTCCCTGAGCCTGTCCCTGGGCAAAATAGAGGGACGAAT GGACCAGGTATCACATCGGTATCCTCGAATTCAAAGTATCAA AGTACAATTTACCGAATATAAGAAGGAGAAAGGTTTCATCCT CACTTCCCAAAAGGAGGATGAAATCATGAAGGTGCAGAACA 235 Date ReQue/Date Received 2023-02-27 O& 02999280 20X8-03-20 ACTCAGTCATCATCAACTGTGATGGGTTTTATCTCATCTCCCT GAAGGGCTACTTCTCCCAGGAAGTCAACATTAGCCTTCATTA CCAGAAGGATGAGGAGCCCCTCTTCCAACTGAAGAAGGTCA GGTCTGTCAACTCCTTGATGGTGGCCTCTCTGACTTACAAAG ACAAAGTCTACTTGAATGTGACCACTGACAATACCTCCCTGG ATGACTTCCATGTGAATGGCGGAGAACTGATTCTTATCCATC AAAATCCTGGTGAATTCTGTGTCCTTTGA (SEQ ID NO: 6) This nucleotide sequence encodes a protein with an amino acid sequence: MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKE SCDVQLYIKRQSEHSILAGDPFELECPVKYCA NRPHVTWCKLNGTTCVKLEDRQTSWKEEKNI SFFILHFEPVLPNDNGSYRCSANFQSNLIESH STTLYVTDVKSASERPSKDEMAS SKYGPPCP SCPAPEFLGGPSVFLFPPKPKDTLMISRTPEV T C VVVD VSQ ED P E VQ F N WY VDG VE VH N A K T K PREEQ FNSTYRVVSVLTVLHQDWLSGKEYKC KVSSKGLPSSIEKTISNATGQPREPQVYTLPP SQEEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSRLTVDKSS WQEGNVFSCSVMHEALHNHYTQKSLSLSLGK IEGRMDQVSHRYPRIQSIKVQFTEYKKEKGFI LTSQKEDEIMKVQNNSVIINCDGFYLISLKGY FSQEVNISLHYQKDEEPLFQLKKVRSVNSLM VASLTYKDKVYLNVTTDNTSLDDFHVNGGELI LIHQN PGEFCVLStop(SEQ ID NO: 7) Another example would include a fusion protein incorporating the extracellular domain of TIGIT, linked via an Fc linker to 0X4OL: ATGCGCTGGTGTCTCCTCCTGATCTGGGCCCAGGGGCTGAGG CAGGCTCCCCTCGCCTCAGGAATGATGACAGGCACAATAGAA ACAACGGGGAACATTTCTGCAGAGAAAGGTGGCTCTATCATCT TACAATGTCACCTCTCCTCCACCACGGCACAAGTGACCCAGGT CAACTGGGAGCAGCAGGACCAGCTTCTGGCCATTTGTAATGCT GACTTGGGGTGGCACATCTCCCCATCCTTCAAGGATCGAGTG GCCCCAGGTCCCGGCCTGGGCCTCACCCTCCAGTCGCTGACC GTGAACGATACAGGGGAGTACTTCTGCATCTATCACACCTACC 245 Date ReQue/Date Received 2023-02-27 O& 02999280 20X8-03-20 CTGATGGGACGTACACTGGGAGAATCTTCCTGGAGGTCCTAG AAAGCTCAGTGGCTGAGCACGGTGCCAGGTTCCAGATTCCAT CTAAGTACGGCCCTCCCTGCCCTAGCTGTCCCGCCCCTGAATT TCTGGGCGGACCCTCCGTGTTTCTGTTCCCCCCAAAGCCCAA GGACACCCTGATGATCAGCCGGACCCCCGAAGTGACCTGTGT GGTGGTGGATGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAA TTGGTACGTGGACGGGGTGGAAGTGCACAACGCCAAGACCAA GCCCAGAGAGGAACAGTTCAACAGCACCTACCGGGTGGTGTC TGTGCTGACCGTGCTGCACCAGGATTGGCTGAGCGGCAAAGA GTACAAGTGCAAGGTGTCCAGCAAGGGCCTGCCCAGCAGCAT CGAAAAGACCATCAGCAACGCCACCGGCCAGCCCAGGGAACC CCAGGTGTACACACTGCCCCCTAGCCAGGAAGAGATGACCAA GAACCAGGTGTCCCTGACATGCCTCGTGAAGGGCTTCTACCC CTCCGATATCGCCGTGGAATGGGAGAGCAACGGCCAGCCAGA GAACAACTACAAGACCACCCCCCCAGTGCTGGACAGCGACGG CTCATTCTTCCTGTACTCCCGGCTGACAGTGGACAAGAGCAGC TGGCAGGAAGGCAACGTGTTCAGCTGCAGCGTGATGCACGAA GCCCTGCACAACCACTACACCCAGAAGTCCCTGAGCCTGTCC CTGGGCAAAATAGAGGGACGAATGGACCAGGTATCACATCGG TATCCTCGAATTCAAAGTATCAAAGTACAATTTACCGAATATA AGAAGGAGAAAGGTTTCATCCTCACTTCCCAAAAGGAGGATG AAATCATGAAGGTGCAGAACAACTCAGTCATCATCAACTGTG ATGGGTTTTATCTCATCTCCCTGAAGGGCTACTTCTCCCAGGA AGTCAACATTAGCCTTCATTACCAGAAGGATGAGGAGCCCCT CTTCCAACTGAAGAAGGTCAGGTCTGTCAACTCCTTGATGGT GGCCTCTCTGACTTACAAAGACAAAGTCTACTTGAATGTGAC CACTGACAATACCTCCCTGGATGACTTCCATGTGAATGGCGG AGAACTGATTCTTATCCATCAAAATCCTGGTGAATTCTGTGTC CTTTGA (SEQ ID NO: 8).

This sequence could be codon optimized to encode a protein with an amino acid sequence: MRWCLLLIWAQGLRQAPLASGMMTGTIETTG NISAEKGGSIILQCHLSSTTAQVTQVNWEQQD Q LLAIC N AD LG WH IS PS F KD RVA PG PG LG LT L QSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVL ESSVAEHGARFQIPSKYGP PCPSCPAPEFLG G PS V F L F P P K P K DT L M I S RT P E VT C V V V D VS Q 255 Date ReQue/Date Received 2023-02-27 O& 02999280 20X8-03-20 E D P EVQ F N WYV DGV E V H N A K T K P R E E Q F N S T Y R VVS V LTV L H Q D W LSG K E YK C K VS S KG LPS SIEKTISNATGQPREPQVYTLPPSQEEMTKNQ VS LTC LVK G F YPS D I AVEW ES N GQ PE N N YK TT PPVLDSDGSFFLYSRLTVDKSSWQEGNVFSC SVMHEALHNHYTQKSLSLSLGKIEGRMDQVS HRYPRIQSIKVQFTEYKKEKGFILTSQKEDEI MKVQNNSVIINCDGFYLISLKGYFSQEVNISL HYQKDEEPLFQLKKVRSVNSLMVASLTYKDK VYLNVTTDNTSLDDFHVNGGELILIHQNPGEF C V L Stop (SEQ ID NO: 9).

Another example would include a fusion protein incorporating the extracellular domain of TIM3, linked through an Fc region to human OX40L: ATGTTTTCACATCTTCCCTTTGACTGTGTCCTGCTGCTGCTGCT GCTACTACTTACAAGGTCCTCAGAAGTGGAATACAGAGCGGAG GTCGGTCAGAATGCCTATCTGCCCTGCTTCTACACCCCAGCCG CCCCAGGGAACCTCGTGCCCGTCTGCTGGGGCAAAGGAGCCT GTCCTGTGTTTGAATGTGGCAACGTGGTGCTCAGGACTGATGA AAGGGATGTGAATTATTGGACATCCAGATACTGGCTAAATGGG GATTTCCGCAAAGGAGATGTGTCCCTGACCATAGAGAATGTGA CTCTAGCAGACAGTGGGATCTACTGCTGCCGGATCCAAATCCC AGGCATAATGAATGATGAAAAATTTAACCTGAAGTTGGTCATCA AACCAGCCAAGGTCACCCCTGCACCGACTCGGCAGAGAGACT TCACTGCAGCCTTTCCAAGGATGCTTACCACCAGGGGACATG GCCCAGCAGAGACACAGACACTGGGGAGCCTCCCTGATATAA ATCTAACACAAATATCCACATTGGCCAATGAGTTACGGGACTC TAGATTGGCCAATGACTTACGGGACTCTGGAGCAACCATCAGA ATAGGCTCTAAGTACGGCCCTCCCTGCCCTAGCTGTCCCGCC CCTGAATTTCTGGGCGGACCCTCCGTGTTTCTGTTCCCCCCAA AGCCCAAGGACACCCTGATGATCAGCCGGACCCCCGAAGTGA CCTGTGTGGTGGTGGATGTGTCCCAGGAAGATCCCGAGGTGC AGTTCAATTGGTACGTGGACGGGGTGGAAGTGCACAACGCCA AGACCAAGCCCAGAGAGGAACAGTTCAACAGCACCTACCGGG TGGTGTCTGTGCTGACCGTGCTGCACCAGGATTGGCTGAGCG GCAAAGAGTACAAGTGCAAGGTGTCCAGCAAGGGCCTGCCCA GCAGCATCGAAAAGACCATCAGCAACGCCACCGGCCAGCCCA 265 Date ReQue/Date Received 2023-02-27 O& 02999280 20X8-03-20 GGGAACCCCAGGTGTACACACTGCCCCCTAGCCAGGAAGAGA TGACCAAGAACCAGGTGTCCCTGACATGCCTCGTGAAGGGCT TCTACCCCTCCGATATCGCCGTGGAATGGGAGAGCAACGGCC AGCCAGAGAACAACTACAAGACCACCCCCCCAGTGCTGGACA GCGACGGCTCATTCTTCCTGTACTCCCGGCTGACAGTGGACA AGAGCAGCTGGCAGGAAGGCAACGTGTTCAGCTGCAGCGTGA TGCACGAAGCCCTGCACAACCACTACACCCAGAAGTCCCTGA GCCTGTCCCTGGGCAAAATAGAGGGACGAATGGACCAGGTAT CACATCGGTATCCTCGAATTCAAAGTATCAAAGTACAATTTAC CGAATATAAGAAGGAGAAAGGTTTCATCCTCACTTCCCAAAA GGAGGATGAAATCATGAAGGTGCAGAACAACTCAGTCATCAT CAACTGTGATGGGTTTTATCTCATCTCCCTGAAGGGCTACTTC TCCCAGGAAGTCAACATTAGCCTTCATTACCAGAAGGATGAG GAGCCCCTCTTCCAACTGAAGAAGGTCAGGTCTGTCAACTCC TTGATGGTGGCCTCTCTGACTTACAAAGACAAAGTCTACTTG AATGTGACCACTGACAATACCTCCCTGGATGACTTCCATGTG AATGGCGGAGAACTGATTCTTATCCATCAAAATCCTGGTGAA TTCTGTGTCCTTTGA (SEQ ID NO: 10).

Such a sequence could be codon optimized to encode a protein with an amino acid sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQ NAYLPCFYTPAAPGNLVPVCWGKGACPVFEC GNVVLRTDERDVNYWTSRYWLNGDFRKGDV SLTIENVTLADSGIYCCRIQIPGIMNDEKFNLK LVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHG PAETQTLGSLPDINLTQISTLANELRDSRLAND LRDSGATIRIGS KYGPPCPSCPAPEFLGGPSV F L F P P K P K D T LM I S RT P E VT C VVVD VS Q ED P E VQ F N WYVD G VEV H N A K T K P RE EQ F N ST YRV V SVLTVLHQDWLSGKEYKCKVSSKGLPSSIEKT I S N ATG Q PRE PQ VYT L P PS Q E EM T K N Q VS LTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSRLTVDKSSWQEGNVFSCSVMHE ALHNHYTQKSLSLSLGKIEGRMDQVSHRYPRI QSI KVQFTE YKKE KGFl LT S Q K E D E I M K VQ N N SVIINCDGFYLISLKGYFSQEVNISLHYQKDEE P L FQ L K KVRS VN S L M V AS LT YKD KVY L N VT T 275 Date ReQue/Date Received 2023-02-27 O& 02999280 20X8-03-20 D N T S L D D F H V N G G E L I L I H Q N P G E F C V L Stop (SEQID NO: 11).

Another example could include the extracellular domain of CD172a adjoined with an Fc linker sequence to the extracellular domain of human OX40L: ATGGAGCCCGCCGGCCCGGCCCCCGGCCGCCTCGGGCCGCT GCTCTGCCTGCTGCTCGCCGCGTCCTGCGCCTGGTCAGGAGT GGCGGGTGAGGAGGAGCTGCAGGTGATTCAGCCTGACAAGTC CGTGTTGGTTGCAGCTGGAGAGACAGCCACTCTGCGCTGCAC TGCGACCTCTCTGATCCCTGTGGGGCCCATCCAGTGGTTCAG AGGAGCTGGACCAGGCCGGGAATTAATCTACAATCAAAAAGAA GGCCACTTCCCCCGGGTAACAACTGTTTCAGACCTCACAAAGA GAAACAACATGGACTTTTCCATCCGCATCGGTAACATCACCCC AGCAGATGCCGGCACCTACTACTGTGTGAAGTTCCGGAAAGG GAGCCCCGATGACGTGGAGTTTAAGTCTGGAGCAGGCACTGA GCTGTCTGTGCGCGCCAAACCCTCTGCCCCCGTGGTATCGGG CCCTGCGGCGAGGGCCACACCTCAGCACACAGTGAGCTTCAC CTGCGAGTCCCACGGCTTCTCACCCAGAGACATCACCCTGAA ATGGTTCAAAAATGGGAATGAGCTCTCAGACTTCCAGACCAAC GTGGACCCCGTAGGAGAGAGCGTGTCCTACAGCATCCACAGC ACAGCCAAGGTGGTGCTGACCCGCGAGGACGTTCACTCTCAA GTCATCTGCGAGGTGGCCCACGTCACCTTGCAGGGGGACCCT CTTCGTGGGACTGCCAACTTGTCTGAGACCATCCGAGTTCCAC CCACCTTGGAGGTTACTCAACAGCCCGTGAGGGCAGAGAACC AGGTGAATGTCACCTGCCAGGTGAGGAAGTTCTACCCCCAGA GACTACAGCTGACCTGGTTGGAGAATGGAAACGTGTCCCGGA CAGAAACGGCCTCAACCGTTACAGAGAACAAGGATGGTACCTA CAACTGGATGAGCTGGCTCCTGGTGAATGTATCTGCCCACAG GGATGATGTGAAGCTCACCTGCCAGGTGGAGCATGACGGGCA GCCAGCGGTCAGCAAAAGCCATGACCTGAAGGTCTCAGCCCA CCCGAAGGAGCAGGGCTCAAATACCGCCGCTGAGAACACTGG ATCTAATGAACGGAACATCTATTCTAAGTACGGCCCTCCCTGC CCTAGCTGTCCCGCCCCTGAATTTCTGGGCGGACCCTCCGTG TTTCTGTTCCCCCCAAAGCCCAAGGACACCCTGATGATCAGCC GGACCCCCGAAGTGACCTGTGTGGTGGTGGATGTGTCCCAGG AAGATCCCGAGGTGCAGTTCAATTGGTACGTGGACGGGGTGG AAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCA 285 Date ReQue/Date Received 2023-02-27 O& 02999280 20X8-03-20 ACAGCACCTACCGGGTGGTGTCTGTGCTGACCGTGCTGCACC AGGATTGGCTGAGCGGCAAAGAGTACAAGTGCAAGGTGTCCA GCAAGGGCCTGCCCAGCAGCATCGAAAAGACCATCAGCAACG CCACCGGCCAGCCCAGGGAACCCCAGGTGTACACACTGCCCC CTAGCCAGGAAGAGATGACCAAGAACCAGGTGTCCCTGACAT GCCTCGTGAAGGGCTTCTACCCCTCCGATATCGCCGTGGAAT GGGAGAGCAACGGCCAGCCAGAGAACAACTACAAGACCACCC CCCCAGTGCTGGACAGCGACGGCTCATTCTTCCTGTACTCCC GGCTGACAGTGGACAAGAGCAGCTGGCAGGAAGGCAACGTGT TCAGCTGCAGCGTGATGCACGAAGCCCTGCACAACCACTACA CCCAGAAGTCCCTGAGCCTGTCCCTGGGCAAAATAGAGGGAC GAATGGACCAGGTATCACATCGGTATCCTCGAATTCAAAGTA TCAAAGTACAATTTACCGAATATAAGAAGGAGAAAGGTTTCA TCCTCACTTCCCAAAAGGAGGATGAAATCATGAAGGTGCAGA ACAACTCAGTCATCATCAACTGTGATGGGTTTTATCTCATCTC CCTGAAGGGCTACTTCTCCCAGGAAGTCAACATTAGCCTTCA TTACCAGAAGGATGAGGAGCCCCTCTTCCAACTGAAGAAGGT CAGGTCTGTCAACTCCTTGATGGTGGCCTCTCTGACTTACAA AGACAAAGTCTACTTGAATGTGACCACTGACAATACCTCCCT GGATGACTTCCATGTGAATGGCGGAGAACTGATTCTTATCCA TCAAAATCCTGGTGAATTCTGTGTCCTTTGA(SEQ ID NO: 12).

Such a sequence could be codon optimized to encode a protein with an amino acid sequence: M E P AG P APG R LG P LLC LLLAASC A WSG V AG E EELQVIQPDKSVLVAAGETATLRCTATSLIPVG PIQWFRGAGPGRELIYNQKEGHFPRVTTVSDL TKRNNMDFSIRIGNITPADAGTYYCVKFRKGS PDDVEFKSGAGTELSVRAKPSAPVVSGPAAR ATPQHTVSFTCESHGFSPRDITLKWFKNGNEL SDFQTNVDPVGESVSYSIHSTAKVVLTREDVH S Q V I C EVA H VT LQ GD P L RG TAN LS ET I RVP P T LEVTQQPVRAENQVNVTCQVRKFYPQRLQLT WLENGNVSRTETASTVTENKDGTYNWMSWLL VNVSAHRDDVKLTCQVEHDGQPAVSKSHDLK VSAHPKEQGSNTAAENTGSNERNIYS K Y G P P CPSCPAPEFLGGPSVFLFPPKPKDTLMISRTP E VTCVVVD VS Q E D P EVQ F N WYVDG VE VH N A K 295 Date ReQue/Date Received 2023-02-27 O& 02999280 20X8-03-20 T K PR E EQ F N ST Y RVVS VLT V LH Q D W LS G K E Y KCKVSSKGLPSSIEKTISNATGQPREPQVYTL PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE S N GQ P E N N Y KTT P P VLD S DGS F F LYS R LTVD K SSWQEGNVFSCSVMHEALHNHYTQKSLSLSL G K I EG RM DQ VSH RY PRIQ SI KVQ FTEY KKE KG FILTSQKEDEIMKVQNNSVIINCDGFYLISLKG YFSQEVNISLHYQKDEEPLFQLKKVRSVNSL MVASLTYKDKVYLNVTTDNTSLDDFHVNGGE L I L I H Q N PG E F C V L Stop (SEQ ID NO: 13).

Another example could include the extracellular domain of TMIGD2 adjoined with an Fc linker sequence to the extracellular domain of human OX40L: ATGGGGTCCCCGGGCATGGTGCTGGGCCTCCTGGTGCAGATC TGGGCCCTGCAAGAAGCCTCAAGCCTGAGCGTGCAGCAGGG GCCCAACTTGCTGCAGGTGAGGCAGGGCAGTCAGGCGACCCT GGTCTGCCAGGTGGACCAGGCCACAGCCTGGGAACGGCTCC GTGTTAAGTGGACAAAGGATGGGGCCATCCTGTGTCAACCGT ACATCACCAACGGCAGCCTCAGCCTGGGGGTCTGCGGGCCC CAGGGACGGCTCTCCTGGCAGGCACCCAGCCATCTCACCCTG CAGCTGGACCCTGTGAGCCTCAACCACAGCGGGGCGTACGTG TGCTGGGCGGCCGTAGAGATTCCTGAGTTGGAGGAGGCTGAG GGCAACATAACAAGGCTCTTTGTGGACCCAGATGACCCCACAC AGAACAGAAACCGGATCGCAAGCTTCCCAGGATCTAAGTACG GCCCTCCCTGCCCTAGCTGTCCCGCCCCTGAATTTCTGGGCG GACCCTCCGTGTTTCTGTTCCCCCCAAAGCCCAAGGACACCCT GATGATCAGCCGGACCCCCGAAGTGACCTGTGTGGTGGTGGA TGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAATTGGTACGT GGACGGGGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAG AGGAACAGTTCAACAGCACCTACCGGGTGGTGTCTGTGCTGA CCGTGCTGCACCAGGATTGGCTGAGCGGCAAAGAGTACAAGT GCAAGGTGTCCAGCAAGGGCCTGCCCAGCAGCATCGAAAAGA CCATCAGCAACGCCACCGGCCAGCCCAGGGAACCCCAGGTGT ACACACTGCCCCCTAGCCAGGAAGAGATGACCAAGAACCAGG TGTCCCTGACATGCCTCGTGAAGGGCTTCTACCCCTCCGATAT CGCCGTGGAATGGGAGAGCAACGGCCAGCCAGAGAACAACTA CAAGACCACCCCCCCAGTGCTGGACAGCGACGGCTCATTCTT 305 Date ReQue/Date Received 2023-02-27 C& 02999280 20X8-03-20 CCTGTACTCCCGGCTGACAGTGGACAAGAGCAGCTGGCAGGA AGGCAACGTGTTCAGCTGCAGCGTGATGCACGAAGCCCTGCA CAACCACTACACCCAGAAGTCCCTGAGCCTGTCCCTGGGCAA AATAGAGGGACGAATGGACCAGGTATCACATCGGTATCCTCG AATTCAAAGTATCAAAGTACAATTTACCGAATATAAGAAGGA GAAAGGTTTCATCCTCACTTCCCAAAAGGAGGATGAAATCAT GAAGGTGCAGAACAACTCAGTCATCATCAACTGTGATGGGTT TTATCTCATCTCCCTGAAGGGCTACTTCTCCCAGGAAGTCAA CATTAGCCTTCATTACCAGAAGGATGAGGAGCCCCTCTTCCA ACTGAAGAAGGTCAGGTCTGTCAACTCCTTGATGGTGGCCTC TCTGACTTACAAAGACAAAGTCTACTTGAATGTGACCACTGA CAATACCTCCCTGGATGACTTCCATGTGAATGGCGGAGAACT GATTCTTATCCATCAAAATCCTGGTGAATTCTGTGTCCTTTGA (SEQ ID NO: 14).

Such a sequence could be codon optimized to encode a protein with an amino acid sequence: MGSPGMVLGLLVQIWALQEASSLSVQQGPNL LQVRQGSQATLVCQVDQATAWERLRVKWTKD GAILCQPYITNGSLSLGVCGPQGRLSWQAPS HLTLQLDPVSLNHSGAYVCWAAVEIPELEEAE GNITRLFVDPDDPTQNRNRIASFPGS K Y G P P C PSCPAPEFLGGPSVFLFPPKPKDTLMISRTPE VTC VVVD VSQ ED P EVQ F N W YVDG V E VH N A K T KPREEQFNSTYRVVSVLTVLHQDWLSGKEYK CKVSSKGLPSSIEKTISNATGQPREPQVYTLP PSQEEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSRLTVDKS SWQEGNVFSCSVMHEALHNHYTQKSLSLSLG KIEGRMDQVSHRYPRIQSIKVQFTEYKKEKGF ILTSQKEDEIMKVQNNSVIINCDGFYLISLKGY FSQEVNISLHYQKDEEPLFQLKKVRSVNSLM VAS LT Y KD KVYL N VTTD NT S LD D F H VN G GE LI LIHQN PGEFCVLStop(SEQ ID NO:15) In various embodiments, the chimeric protein may comprise an amino acid sequence having one or more amino acid mutations relative to any of the protein sequences described herein. In some embodiments, the one or more amino acid mutations may be independently selected from substitutions, insertions, deletions, and truncations. 315 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 In some embodiments, the amino acid mutations are amino acid substitutions, and may include conservative and/or non-conservative substitutions. “Conservative substitutions” may be made, for instance, on the basis of similarity in polarity, charge, size, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the amino acid residues involved. The 20 naturally occurring amino acids can be grouped into the following six standard amino acid groups: (1) hydrophobic: Met, Ala, Vai, Leu, He; (2) neutral hydrophilic: Cys, Ser, Thr; Asn, Gin; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.

As used herein, “conservative substitutions” are defined as exchanges of an amino acid by another amino acid listed within the same group of the six standard amino acid groups shown strove. For example, the exchange of Asp by Glu retains one negative charge in the so modified polypeptide. In addition, glycine and proline may be substituted for one another based on their ability to disrupt ahelices.

As used herein, “non-conservative substitutions” are defined as exchanges of an amino acid by aiother amino add listed in a different group of the six standard amino acid groups (1) to (6) shown above.

In various embodiments, the substitutions may also include non-classical amino adds (e.g. selenocysteine, pyrrolysine, W-formylmethionine p-alanine, GABA and 6-Aminolevulinic add, 4- aminobenzoic add (PABA), D-isomers of the common amino acids, 2,4-diaminobutyric acid, a-amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, y-Abu, s-Ahx, 6-amino hexanoic add, Aib, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosme, citrulline, homocitrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, p-alanlne, fluoro-amino acids, designer amino acids such as p methyl amino acids, C a-methyl amino acids, N a-methyl amino acids, and amino acid analogs in general).

Mutations may also be made to the nucleotide sequences of the chimeric proteins by reference to the genetic code, including taking into account codon degeneracy.

In various embodiments, the chimeric protein comprises a linker. In various embodiments, the linker may be derived from naturally-occurring multi-domain proteins or are empirical linkers as described, for example, in Chichili ef a/., (2013), Protein Sci, 22(2):153-167, Chen et a/., (2013), Adv Drug Deliv Rev. 65(10):1357-1369. In some embodiments, the linker may be designed using linker designing databases and computer programs such as those described in Chen et al., (2013), Adv Drug Deliv Rev. 65(10):1357-1369 and Crasto et. al., (2000), Protein Eng. 13(5):309-312.

In some embodiments, the linker is a synthetic linker such as PEG. 325 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 In other embodiments, the linker is a polypeptide. In some embodiments, the linker is less than about 500 amino acids long, about 450 amino acids long, about 400 amino acids long, about 350 amino acids long, about 300 amino adds long, about 250 amino acids long, about 200 amino acids long, about 150 amino adds long, or about 100 amino acids long. For example, the linker may be less than about 100, about 95, about 90, about 85, about 80, about 75, about 70, about 65, about 60, about 55, about 50, about 45, about 40, about 35, about 30, about 25, about 20, about 19, about 18, about 17, about 16, about 15, about 14, about 13, about 12, about 11, about 10, about 9, about 8, about 7, about 6, about 5, about 4, about 3, or about 2 amino acids long. In some embodiments, the linker is flexible. In another embodiment, the linker is rigid.

In various embodiments, the linker is substantially comprised of glycine and serine residues (e.g. about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 80%, or about 90%, or about 95%, or about 97% glycines and serines).

In various embodiments, the linker is a hinge region of an antibody (e.g., of IgG, IgA, IgD, and IgE, inclusive of subclasses (e.g. IgG1, 1gG2, lgG3, and lgG4, and lgA1 and lgA2)). The hinge rejon, found in IgG, IgA, IgD, and IgE class antibodies, acts as a flexible spacer, allowing the Fab portion to move freely in space. In contrast to the constant regions, the hinge domains are structurally diverse, varying in both sequence and length among immunoglobulin classes and subclasses. For example, the length and flexibility of the hinge region varies among the IgG subdasses. The hinge region of lgG1 encompasses amino adds 216-231 and, because it is freely flexible, the Fab fragments can rotate about their axes of symmetry and move within a sphere centered at the first of two inter-heavy chain disulfide bridges. lgG2 has a shorter hinge than IgG1, with 12 amino acid residues and four disulfide bridges. The hinge region of lgG2 lacks a glycine residue, is relatively short, and contains a rigid poly-proline double helix, stabilized by extra inter-heavy chain disulfide bridges. These properties restrict the flexibility of the lgG2 molecule. lgG3 differs from the other subclasses by its unique extended hinge region (about four times as long as the IgG1 hinge), containing 62 amino acids (including 21 prolines and 11 cysteines), forming an inflexible poly-proline double helix. In lgG3, the Fab fragments are relatively far away from the Fc fragment, giving the molecule a greater flexibility. The elongated hinge in lgG3 is also responsible for its higher molecular weight compared to the other subclasses. The hinge region of lgG4 is shorter than that of lgG1 and its flexibility is intermediate between that of lgG1 and lgG2. The flexibility of Ihe hinge regions reportedly decreases in the order lgG3>lgG1>lgG4>lgG2. In other embodiments, the linker may be derived from human lgG4 and contain one or more mutations to enhance dimerization (including S228P) or FcRn binding.

According to crystallographic studies, the immunoglobulin hinge region can be further subdivided functionally into three regions: the upper hinge region, the core region, and the lower hinge region. See Shin ef af., 1992 Immunological Reviews 130:87. The upper hinge region includes amino acidsfrom the carboxyl end of Cm to the first residue in the hinge that restricts motion, generally the first cysteine 335 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 residue that forms an interchain disulfide bond between the two heavy chains. The length of the upper hinge region correlates with the segmental flexibility of the antibody. The core hinge region contains the inter-heavy chain disulfide bridges, and the lower hinge region joins the amino terminal end of the Ch2 domain and includes residues in Chz. Id. The core hinge region of wild-type human lgG1 contains the sequence Cys-Pro-Pro-Cys which, when dimerized by disulfide bond formation, results in a cyclic octapeptide believed to act as a pivot, thus conferring flexibility. In various embodiments, the present linker comprises, one, or two, or three of the upper hinge region, the core region, and the lower hinge region of any antibody (e.g., of IgG, IgA, IgD, and IgE, inclusive of subclasses (e.g. lgG1, lgG2, lgG3, and lgG4, and lgA1 and lgA2)). The hinge region may also contain one or more glycosylation sites, which include a number of structurally distinct types of sites for carbohydrate attachment. For example, lgA1 contains five glycosylation sites within a 17-amino-acid segment of the hinge region, conferring resistance of the hinge region polypeptide to intestinal proteases, considered an advantageous property for a secretory immunoglobulin. In various embodiments, the linker of the present invention comprises one or more glycosylation sites.

In various embodiments, the linker comprises an Fc domain of an antibody (e.g., of IgG, IgA, IgD, and IgE, inclusive of subclasses (e.g. lgG1, lgG2, lgG3, and lgG4, and lgA1 and lgA2)). In various embodiments, the linker comprises a hinge-CH2-CH3 Fc domain derived from a human lgG4 antibody.

In various embodiments, the linker comprises a hinge-CH2-CH3 Fc domain derived from a human IgG1 antibody. In some embodiments, the Fc domain exhibits increased affinity for and enhanced binding to the neonatal Fc receptor (FcRn). In some embodiments, the Fc domain includes one or more mutations that increases the affinity and enhances binding to FcRn. Without wishing to be bound by theory, it is believed that increased affinity and enhanced binding to FcRn increases the in vivo half-life of the present chimeric proteins.

In some embodiments, the Fc domain linker contains one or more amino acid substitutions at amino acid residue 250, 252, 254, 256, 308, 309, 311, 428, 433 or 434 (in accordance with Kabat numbering), or equivalents thereof. In an embodiment, the amino add substitution at amino acid residue 250 is a substitution with glutamine. In an embodiment, the amino acid substitution at amino add residue 252 is a substitution with tyrosine, phenylalanine, tryptophan or threonine. In an embodiment, the amino add substitution at amino acid residue 254 is a substitution with threonine. In an embodiment, the amino acid substitution at amino acid residue 256 is a substitution with serine, arginine, glutamine, glutamic acid, aspartic acid, or threonine. In an embodiment, the amino acid substitution at amino add residue 308 is a substitution with threonine. In an embodiment, the amino acid substitution at amino add residue 309 is a substitution with proline. In an embodiment, the amino acid substitution at amino acid residue 311 is a substitution with serine. In an embodiment, the amino acid substitution at amino add residue 385 is a substitution with arginine, aspartic acid, serine, threonine, histidine, lysine, alanine or glycine. In an embodiment, the amino add substitution at amino acid residue 386 is a substitution with 345 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 threonine, proline, aspartic acid, serine, lysine, arginine, isoleucine, or methionine. In an embodiment, the amino acid substitution at amino acid residue 387 is a substitution with arginine, proline, histidine, serine, threonine, or alanine. In an embodiment, the amino acid substitution at amino acid residue 389 is a substitution with proline, serine or asparagine. In an embodiment, the amino acid substitution at amino add residue 428 is a substitution with leucine. In an embodiment, the amino add substitution at amino acid residue 433 is a substitution with arginine, serine, isoleucine, proline, or glutamine. In an embodiment, the amino acid substitution at amino acid residue 434 is a substitution with histidine, phenylalanine, or tyrosine.

In some embodiments, the Fc domain linker (e.g., comprising an IgG constant region) comprises one or more mutations such as substitutions at amino add residue 252, 254, 256, 433, 434, or 436 (in accordance with Kabat numbering). In an embodiment, the IgG constant region includes a triple M252Y/S254T/T256E mutation or YTE mutation. In another embodiment, the IgG constant region includes a triple H433K/N434F/Y436H mutation or KFH mutation. In a further embodiment, the IgG constant region includes an YTE and KFH mutation in combination.

In some embodiments, the modified humanized antibodies of the invention comprise an IgG constant region that contains one or more mutations at amino add residues 250, 253, 307, 310, 380, 428, 433, 434, and 435. Illustrative mutations include T250Q, M428L, T307A, E380A, I253A, H310A, M428L, H433K, N434A, N434F, N434S, and H435A. In an embodiment, the IgG constant region comprises a M428L/N434S mutation or LS mutation. In another embodiment, the IgG constant region comprises a T250Q/M428L mutation or QL mutation. In another embodiment, the IgG constant region comprises an N434A mutation. In another embodiment, the IgG constant region comprises a T307A/E38QA/N434A mutation or AAA mutation. In another embodiment, the IgG constant region comprises an I253A/H310A/H435A mutation or IHH mutation. In another embodiment, the IgG constant region comprises a H433K/N434F mutation. In another embodiment, the IgG constant region comprises a M252Y/S254T/T256E and a H433K/N434F mutation in combination.

Additional exemplary mutations in the IgG constant region are described, for example, in Robbie, ef a/., Antimicrobial Agents and Chemotherapy (2013), 57(12):6147-6153, Dall'Acqua ef a/., JBC (2006), 281(33):23514-24, Dall’Acqua ef a/., Journal of Immunology (2002), 169:5171-80, Ko ef al. Nature (2014) 514:642-645, Grevys ef al. Journal of Immunology. (2015), 194(11):5497-508, and U.S. Patent No. 7,083,784.

In some embodiments, the linker has the amino acid sequence of SEQ ID NO: 70, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto. In various embodiments, mutations are made to SEQ ID No: 70 to increase stability and/or half-life. For instance, in some embodiments, the linker has the amino acid sequence of SEQ ID NO: 71 or 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto. An illustrative Fc stabilizing mutant is S228P. Illustrative Fc half-life extending 355 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 mutants are T250Q, M428L, V308T, L309P, and Q311S and the present linkers may comprise 1, or 2, or 3, or 4, or 5 of these mutants.

Further, one or more joining linkers may be employed to connect the present IgG linkers (e.g. one or SEQ ID NOs: 70, 71, or 71, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto) and the extracellular domains. For example, any one of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, or variants thereof may connect an extracellular domain as described herein and a linker as described herein. Optionally, any one of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, or variants thereof are displaced between an extracellular domain as described herein and a linker as described herein.

Additional illustrative linkers include, but are not limited to, linkers having the sequence LE, GGGGS (SEQ ID NO: 23), (GGGGS)n (n=1-4), (Gly)s, (Gly)6, (EAAAK)n (n=1-3) (SEQ ID NO: 24), A(EAAAK)„A (n = 2-5) (SEQ ID NO: 25), AEAAAKEAAAKA (SEQ ID NO: 26), A(EAAAK)4ALEA(EAAAK)<iA (SEQ ID NO: 27), PAPAP (SEQ ID NO: 28), KESGSVSSEQLAQFRSLD (SEQ ID NO: 29), EGKSSGSGSESKST (SEQ ID NO: 30), GSAGSAAGSGEF (SEQ ID NO:31), and (XP)n, with X designating any amino acid, e.g., Ala, Lys, orGlu.

In various embodiments, the linker may be functional. For example, without limitation, the linker may function to improve the folding and/or stability, improve the expression, improve the pharmacokinetics, and/or improve the bioactivity of the present chimeric protein. In another example, the linker may function to target the chimeric protein to a particular cell type or location.

In various embodiments, the present chimeric proteins are capable of, and can be used in methods comprising, promoting immune activation (e.g. against tumors). In various embodiments, the present chimeric proteins are capable of, and can be used in methods comprising, suppressing immune inhibition (e.g. that allows tumors to survive). In various embodiments, the present chimeric proteins provide improved immune activation and/or improved suppression of immune inhibition due to the proximity of signaling that is provided by the chimeric nature of the constructs.

In various embodiments, the present chimeric proteins are capable of, or can be used in methods comprising, modulating the amplitude of an immune response, e.g. modulating the level of effector output In some embodiments, e.g. when used for the treatment of cancer, the present chimeric proteins alter the extent of immune stimulation as compared to immune inhibition to increase the amplitude of a T cell response, including, without limitation, stimulating increased levels of cytokine production, proliferation or target killing potential.

In various embodiments the present chimeric proteins, in some embodiments are capable of, or find use in methods involving, masking an inhibitory ligand on the surface of a tumor cell and replacing that immune inhibitory ligand with an immune stimulatory ligand (see, e.g. FIG. 4). For example, a chimeric protein construct comprising (i) the extracellular domain of PD-1 and (ii) extracellular domain of OX40L, 365 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 allows for the disruption of an inhibitory PD-L1 signal and replacing it with a stimulating OX40L.

According, the present chimeric proteins, in some embodiments are capable of, or find use in methods involving, reducing or eliminating an inhibitory immune signal and/or increasing or activating an immune stimulatory signal. For example, a tumor cell bearing an inhibitory signal (and thus evading an immune response) may be substituted for a positive signal binding on a T cell that can then attack a tumor cell.

According, in some embodiments, an inhibitory immune signal is masked by the present constructs and a stimulatory immune signal is activated. Such beneficial properties are enhanced by the single construct approach of the present chimeric proteins. For instance, the signal replacement can be effected nearly simultaneously and the signal replacement is tailored to be local at a site of clinical importance (e.g. the tumor microenvironment). Further embodiments apply the same principle to other chimeric protein constructs, such as, for example, (i) the extracellular domain of PD-1 aid (ii) extracellular domain of GITRL; (i) the extracellular domain of BTLA and (ii) extracellular domain of OX40U (i) the extracellular domain of TIGIT and (ii) extracellular domain of OX40L; (i) the extracellular domain of TlM3 and (ii) extracellular domain of OX40L; and (i) the extracellular domain of CD172a and (ii) extracellular domain of CD40L; and (i) the extracellular domain of CD115 and (ii) extracellular domain of CD40L; and (i) the extracellular domain of TlM3 and (ii) extracellular domain of OX40L; and (i) the extracellular domain of TIGIT and (ii) extracellular domain of OX40L; among others.

In various embodiments, the present chimeric proteins are capable of, or find use in methods comprising, stimulating or enhancing the binding of immune stimulatory receptor/ligand pairs. Illustrative T cell costimulatory receptors and their ligands include OX-40:OX40-L, CD27:CD70, CD30:CD30-L, CD40:CD40-L; CD137:CD137-L, HVEM1IGHT, GITR:GITR-L, TNFRSF25:TL1A, DR5:TRAIL, and BTLA:HVEM. In various embodiments, the present chimeric proteins are capable of, or find use in methods comprising, inhibiting or reducing the binding of immune inhibitory receptor/ligand pairs.

Illustrative T cell coinhibitory receptors and their ligands include, for example, CTLA-4:CD80/CD86, PD- 1:PD-L1/PD-L2, BTLA:HVEM, TIM-3:galectin-9/phosphatidylserine, TIGIT/CD155 or CD112, VISTA/VSIG8, CD172a/CD47, B7H3R/B7H3, B7H4R/B7H4, CD244/CD48, TMIGD2/HHLA2, among others.

In various embodiments, the present chimeric protein blocks, reduces and/or inhibits PD-1 and PD-L1 or PD-L2 and/or the binding of PD-1 with PD-L1 or PD-L2. In various embodiments, the present chimeric protein blocks, reduces and/or inhibits the activity of CTLA-4 and/or the binding of CTLA-4 with one or more of AP2M1, CD80, CD86, SHP-2, and PPP2R5A. In various embodiments, the presentchimeric protein increases and/or stimulates GITR and/or the binding of GITR with one or more of GITR ligand.

In various embodiments, the present chimeric protein increases and/or stimulates 0X40 and/or the binding of 0X40 with one or more of 0X40 ligand.

In other embodiments, the present chimeric proteins are capable of, or find use in methods involving, enhancing, restoring, promoting and/or stimulating immune modulation. In some embodiments, the 375 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 present chimeric proteins described herein, restore, promote and/or stimulate the activity or activation of one or more immune cells against tumor cells including, but not limited to: T cells, cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-tumor macrophages (e.g. M1 macrophages), B cells, and dendritic cells. In some embodiments, the present chimeric proteins enhance, restore, promote and/or stimulate the activity and/or activation of T cells, including, by way of a non-limiting example, activating and/or stimulating one or more T- cell intrinsic signals, including a pro-survival signal; an autocrine or paracrine growth signal; a p38 MAPK-, ERK-, STAT-, JAK-, AKT- or PI3K-mediated signal; an anti-apoptotic signal; and/or a signal promoting and/or necessary for one or more of: proinflammatory cytokine production or T cell migration or T cell tumor infiltration.

In some embodiments, the present chimeric proteins are capable of, or find use in methods involving, causing an increase of one or more of T cells (including without limitation cytotoxic T lymphocytes, T helper cells, natural killer T (NKT) cells), B cells, natural killer (NK) cells, natural killer T (NKT) cells, dendritic cells, monocytes, and macrophages (e.g. one or more of M1 and M2) into a tumor or the tumor microenvironment. In some embodiments, the present chimeric proteins are capable of, or find use in methods involving, inhibiting and/or causing a decrease in recruitment of immunosuppressive cells (e.g. myeloid-derived suppressor cells (MDSCs), regulatory T cells (Tregs), tumor associated neutrophils (TANs), M2 macrophages, and tumor associated macrophages (TAMs)) to the tumor and/or tumor microenvironment (TME). In some embodiments, the present therapies may alter the ratio of M1 versus M2 macrophages in the tumor site and/or TME to favor M1 macrophages.

In various embodiments, the present chimeric proteins are capable of, and can be used in methods comprising, inhibiting and/or reducing T cell inactivation and/or immune tolerance to a tumor, comprising administering an effective amount of a chimeric protein described herein to a subject. In some embodiments, the present chimeric proteins are able to increase the serum levels of various cytokines including, but not limited to, one or more of IFNy, TNFa, IL-2, IL-4, IL-5, IL-6, IL-9, IL-10, IL-13, IL-17A, IL-17F, and IL-22. In some embodiments, the present chimeric proteins are capable of enhancing IL-2, IL-4, IL-5, IL-10, IL-13, IL-17A, IL-22, TNFa or IFNy in the serum of a treated subject (see, e.g. Figure 11, panel J). Detection of such a cytokine response may provide a method to determine the optimal dosing regimen for the indicated chimeric fusion protein (see, e.g. Figure 11, panel K).

In various embodiments, the present chimeric proteins inhibit, block and/or reduce cell death of an anti¬ tumor CD8+ and/or CD4+ T cell; or stimulate, induce, and/or increase cell death of a pro-tumor T cell. T cell exhaustion is a state of T cell dysfunction characterized by progressive loss of proliferative and effector functions, culminating in clonal deletion. Accordingly, a pro-tumor T cell refers to a state of T cell dysfunction that arises during many chronic infections and cancer. This dysfunction is defined by poor proliferative and/or effector functions, sustained expression of inhibitory receptors and a transcriptional state distinct from that of functional effector or memory T cells. Exhaustion prevents 385 Date ReQue/Date Received 2023-02-27 WO 2017/059168 CA 02999280 20X8-03-20 PCT/US2016/054598 optimal control of infection and tumors. In addition, an anti-tumor CD8+ and/or CD4+ T cell refers to T cells that can mount an immune response to a tumor. Illustrative pro-tumor T cells include, but are not limited to, Tregs, CD4+ and/or CD8+ T cells expressing one or more checkpoint inhibitory receptors, Th2 cells and Th17 cells. Checkpoint inhibitory receptors refers to receptors (e.g. CTLA-4, B7-H3, B7- H4, TIM-3) expressed on immune cells that prevent or inhibit uncontrolled immune responses.

In various embodiments, the present chimeric proteins are capable of, and can be used in methods comprising, increasing a ratio of effector T cells to regulatory T cells. Illustrative effector T cells include ICOS+ effector T cells; cytotoxic T cells (e.g. ap TCR, CD3+, CD8+, CD45RO+); CD4* effector T cells (e.g. ap TCR, CD3+, CD4+, CCR7+, CD62Lhi, IL7R/CD127*); CD8* effector T cells (e.g. ap TCR, CD3*, CD8+, CCR7+, CD62Lhi, IL 7R/CD127*); effector memory T cells (e.g. CD62Llow, CD44+, TCR, CD3+, IL7R/CD127; IL-15R; CCR7low); central memory T cells (e.g. CCR7* CD62L+, CD27* orCCR7hi, CD44+, CD62Lhi, TCR, CD3+, IL-7R/CD127*, IL-15R*); CD62L effector T cells; CD8+ effector memory T cells (TEM) including early effector memory T cells (CD27+ CD62L-) and late effector memory T cells (CD27- CD62L-) (TemE and TemL, respectively); CD127(*)CD25(low/-) effector T cells; CD127(- )CD25(-) effector T cells; CD8* stem cell memory effector cells (TSCM) (e.g.

CD44(low)CD62L(high)CD122(high)sca(*)); TH1 effector T-cells (e.g. CXCR3\ CXCR6* and CCR5* or ap TCR, CD3* CD4+, IL-12R*, IFNyR* CXCR3"), TH2 effector T cells (e.g. CCR3+, CCR4+ and CCR8* or ap TCR, CD3+, CD4+, IL-4R*, IL-33R*. CCR4+, IL-17RB*, CRTH2+); TH9 effector T cells (e.g. ap TCR, CD3+, CD4+); TH17 effector T cells (e.g. ap TCR, CD3+, CD4+, IL-23R*, CCR6*, IL-1R*); CD4+CD45RO+CCR7+ effector T cells, CD4+CD45RO+CCR7( ) effector T cells; and effector T cells secreting IL-2, IL-4 and/or IFN-y. Illustrative regulatory T cells indude ICOS regulatory T cells, CD4+CD25+FOXP3+ regulatory T cells, CD4+CD25+ regulatory T cells, CD4+CD25- regulatory T cells, CD4+CD25high regulatory T cells, TIM-3*PD-1* regulatory T cells, lymphocyte activation gene-3 (LAG- 3)+ regulatory T cells, CTLA-4/CD152* regulatory T cells, neuropilin-1 (Nrp-1)* regulatory T cells, CCR4*CCR8* regulatory T cells, CD62L (L-selectin)* regulatory T cells, CD45RBIow regulatory T cells, CD127low regulatory T cells, LRRC32/GARP+ regulatory T cells, CD39+ regulatory T cells, GITR+ regulatory T cells, LAP* regulatory T cells, 1B11* regulatory T cells, BTLA+ regulatory T cells, type 1 regulatory T cells (Tr1 cells),T helper type 3 (Th3) cells, regulatory cell of natural killer T cell phenotype (NKTregs), CD8+ regulatory T cells, CD8CD28 regulatory T cells and/or regulatory T-cells secreting IL- 10, IL-35, TGF-p, TNF-a, Galectin-1, IFN-y and/or MCP1.

In various embodiments, the present chimeric proteins are capable of, and can be used in methods comprising, transiently stimulating effector T cells for no longer than about 12 hours, about 24 hours, about 48 hours, about 72 hours or about 96 hours or about 1 week or about 2 weeks. In various embodiments, the present chimeric proteins are capable of, and can be used in methods comprising, transiently depleting or inhibiting regulatory T cells for no longer than about 12 hours, about 24 hours, about 48 hours, about 72 hours or about 96 hours or about 1 week or about 2 weeks. In various 395 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 embodiments, the transient stimulation of effector T cells and/or transient depletion or inhibition of regulatory T cells occurs substantially in a patient’s bloodstream or in a particular tissue/location including lymphoid tissues such as for example, the bone marrow, lymph-node, spleen, thymus, mucosa-associated lymphoid tissue (MALT), non-lymphoid tissues, or in the tumor microenvironment.

In various embodiments, the present chimeric proteins provide advantages including, without limitation, ease of use and ease of production. This is because two distinct immunotherapy agents are combined into a single product which allows for a single manufacturing process instead of two independent manufacturing processes. In addition, administration of a single agent instead of two separate agents allows for easier administration and greater patient compliance. Further, in contrast to , for example, monoclonal antibodies, which are large multimeric proteins containing numerous disulfide bonds and post-translational modifications such as glycosylation, the present chimeric proteins are easier and more cost effective to manufacture.

In various embodiments, the present chimeric protein is produceable in a mammalian host cell as a secretable and fully functional single polypeptide chain (see, e.g., Figure 13, panel A, Figure 17, panels E-H, Figure 17, panels N-S).

In various embodiments, the present chimeric protein unexpectedly provides binding of the extracellular domain components to their respective binding partners with slow off rates (Kd or Kofr). In some embodiments, this provides an unexpectedly long interaction of the receptor to ligand and vice versa.

Such an effect allows for a sustained negative signal masking effect (see, e.g., Figure 14, Figure 17, panels l-M). Further, in some embodiments, this delivers a longer positive signal effect, e.g. to allow an effector cell to be adequately stimulated for an anti-tumor effect. For example, the present chimeric protein, e.g. via the long off rate binding allows sufficient signal transmission to provide T cell proliferation and allow for anti-tumor attack. By way of further example, the present chimeric protein, e.g. via the long off rate binding allows sufficient signal transmission to provide release of stimulatory signals, such as, for example, cytokines Also. The stable synapse of cells promoted by the present agents (e.g. a tumor cell bearing negative signals and a T cell which could attack the tumor) provides spatial orientation to favor tumor reduction - such as positioning the T cells to attack tumor cells and/or sterically preventing the tumor cell from delivering negative signals, including negative signals beyond those masked by the chimeric protein of the invention.

In some embodiments, this provides longer on-target (e.g. intra-tumoral) half-life (tie) as compared to serum ti« of the chimeric proteins. Such properties could have the combined advantage of reducing offtarget toxicities associated with systemic distrubition of the chimeric proteins (see, e.g., Figure 14, panels M-O). 405 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 Further, in various embodiments, the present chimeric proteins provide synergistic therapeutic effects as it allows for improved site-specific interplay of two immunotherapy agents. In some embodiments, the present chimeric proteins provide the potential for reducing off-site and/or systemic toxicity.

Diseases; Methods of Treatment, and Patient Selections In various embodiments, the present invention pertains to cancers and/or tumors; for example, the treatment or prevention of cancers and/or tumors. As described elsewhere herein, the treatment of cancer may involve in various embodiments, modulating the immune system with the present chimeric proteins to favor immune stimulation over immune inhibition.

Cancers or tumors refer to an uncontrolled growth of cells and/or abnormal increased cell survival and/or inhibition of apoptosis which interferes with the normal functioning of the bodily organs and systems. Included are benign and malignant cancers, polyps, hyperplasia, as well as dormant tumors or micrometastases. Also, included are cells having abnormal proliferation that is not impeded by the immune system (e.g. virus infected cells). The cancer may be a primary cancer or a metastatic cancer.

The primary cancer may be an area of cancer cells at an originating site that becomes clinically detectable, and may be a primary tumor. In contrast, the metastatic cancer may be the spread of a disease from one organ or part to another non-adjacent organ or part. The metastatic cancer may be caused by a cancer cell that acquires the ability to penetrate and infiltrate surrounding normal tissues in a local area, forming a new tumor, which may be a local metastasis. The cancer may also be caused by a cancer cell that acquires the ability to penetrate the walls of lymphatic and/or blood vessels, after which the cancer cell is able to circulate through the bloodstream (thereby being a circulating tumor cell) to other sites and tissues in the body. The cancer may be due to a process such as lymphatic or hematogeneous spread. The cancer may also be caused by a tumor cell that comes to rest at another site, re-penetrates through the vessel or walls, continues to multiply, and eventually forms another clinically detectable tumor. The cancer may be this new tumor, which may be a metastatic (or secondary) tumor.

The cancer may be caused by tumor cells that have metastasized, which may be a secondary or metastatic tumor. The cells of the tumor may be like those in the original tumor. As an example, if a breast cancer or colon cancer metastasizes to the liver, the secondary tumor, while present in the liver, is made up of abnormal breast or colon cells, not of abnormal liver cells. The tumor in the liver may thus be a metastatic breast cancer or a metastatic colon cancer, not liver cancer.

The cancer may have an origin from any tissue. The cancer may originate from melanoma, colon, breast, or prostate, and thus may be made up of cells that were originally skin, colon, breast, or prostate, respectively. The cancer may also be a hematological malignancy, which may be leukemia or lymphoma. The cancer may invade a tissue such as liver, lung, bladder, or intestinal. 415 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 Representative cancers and/or tumors of the present invention include, but are not limited to, a basal cell carcinoma, biliary tract cancer; bladder cancer; bone cancer; brain and central nervous system cancer; breast cancer; cancer of the peritoneum; cervical cancer; choriocarcinoma; colon and rectum cancer; connective tissue cancer; cancer of the digestive system; endometrial cancer; esophageal cancer; eye cancer; cancer of the head and neck; gastric cancer (including gastrointestinal cancer); glioblastoma; hepatic carcinoma; hepatoma; intra-epithelial neoplasm; kidney or renal cancer; larynx cancer; leukemia; liver cancer; lung cancer (e.g., small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung); melanoma; myeloma; neuroblastoma; oral cavity cancer (lip, tongue, mouth, and pharynx); ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma; rhabdomyosarcoma; rectal cancer; cancer of the respiratory system; salivary gland carcinoma; sarcoma; skin cancer; squamous cell cancer; stomach cancer; testicular cancer; thyroid cancer; uterine or endometrial cancer; cancer of the urinary system; vulval cancer; lymphoma including Hodgkin's and non-Hodgkin's lymphoma, as well as B-cell lymphoma (including low grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic (SL) NHL; intermediate grade/follicular NHL; intermediate grade diffuse NHL; high grade immunoblastic NHL; high grade lymphoblastic NHL; high grade small non-cleaved cell NHL; bulky disease NHL; mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's Macroglobulinemia; chronic lymphocytic leukemia (CLL); acute lymphoblastic leukemia (ALL); Hairy cell leukemia; chronic myeloblastic leukemia; as well as other carcinomas and sarcomas; and post-transplant lymphoproliferative disorder (PTLD), as well as abnormal vascular proliferation associated with phakomatoses, edema (such as that associated with brain tumors), and Meigs’ syndrome.

In some embodiments, the chimeric protein is used to treat a subject that has a treatment-refractory cancer. In some embodiments, the chimeric protein is used to treat a subject that is refractory to one or more immune-modulating agents. For example, in some embodiments, the chimeric protein is used to treat a subject that presents no response to treatment, or even progress, after 12 weeks or so of treatment For instance, in some embodiments, the subject is refractory to a PD-1 and/or PD-L1 and/or PD-L2 agent, including, for example, nivolumab (ONO-4538/BMS-936558, MDX1106, OPDIVO, BRISTOL MYERS SQUIBB), pembrolizumab (KEYTRUDA, MERCK), pidilizumab (CT-011, CURE TECH), MK-3475 (MERCK), BMS 936559 (BRISTOL MYERS SQUIBB), Ibrutinib (PHARMACYCLICS/ABBVIE), atezolizumab (TECENTRIQ, GENENTECH), and/or MPDL328OA (ROCHE)-refractory patients. For instance, in some embodiments, the subject is refractory to an antiCTLA-4 agent, e.g. ipilimumab (YERVOY)-refractory patients (e.g. melanoma patients). Accordingly, in various embodiments the present invention provides methods of cancer treatment that rescue patients that are non-responsive to various therapies, including monotherapy of one or more immune-modulating agents. 425 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 In some embodiments, the present methods provide treatment with the chimeric protein in a patient who is refractory to an additional agent, such “additional agents" being described elsewhere herein, inclusive, without limitation, of the various chemotherapeutic agents described herein.

In some aspects, the present chimeric agents are used to eliminate intracellular pathogens. In some aspects, the present chimeric agents are used to treat one or more infections. In some embodiments, the present chimeric proteins are used in methods of treating viral infections (including, for example, HIV and HCV), parasitic infections (including, for example, malaria), and bacterial infections. In various embodiments, the infections induce immunosuppression. For example, HIV infections often result in immunosuppression in the infected subjects. Accordingly, as described elsewhere herein, the treatment of such infections may involve, in various embodiments, modulating the immune system with the present chimeric proteins to favor immune stimulation over immune inhibition. Alternatively, the present invention provides methods for treating infections that induce immunoactivation. For example, intestinal helminth infections have been associated with chronic immune activation. In these embodiments, the treatment of such infections may involve modulating the immune system with the present chimeric proteins to favor immune inhibition over immune stimulation.

In various embodiments, the present invention provides methods of treating viral infections including, without limitation, acute or chronic viral infections, for example, of the respiratory tract, of papilloma virus infections, of herpes simplex virus (HSV) infection, of human immunodeficiency virus (HIV) infection, and of viral infection of internal organs such as infection with hepatitis viruses. In some embodiments, the viral infection is caused by a virus of family Flaviviridae. In some embodiments, the virus of family Flaviviridae is selected from Yellow Fever Virus, West Nile virus, Dengue virus, Japanese Encephalitis Virus, St. Louis Encephalitis Virus, and Hepatitis C Virus. In other embodiments, the viral infection is caused by a virus of family Picomaviridae, e.g., poliovirus, rhinovirus, coxsackievirus. In other embodiments, the viral infection is caused by a member of Orthomyxoviridae, e.g., an influenza virus. In other embodiments, the viral infection is caused by a member of Retroviridae, e.g., a lentivirus.

In other embodiments, the viral infection is caused by a member of Paramyxoviridae, e.g., respiratory syncytial virus, a human parainfluenza virus, rubulavirus {e.g., mumps virus), measles virus, and human metapneumovirus. In other embodiments, the viral infection is caused by a member of Bunyaviridae, e.g., hantavirus. In other embodiments, the viral infection is caused by a member of Reoviridae, e.g., a rotavirus.

In various embodiments, the present invention provides methods of treating parasitic infections such as protozoan or helminths infections. In some embodiments, the parasitic infection is by a protozoan parasite. In some embodiments, theoritiziab parasite is selected from intestinal protozoa, tissue protozoa, or blood protozoa. Illustrative protozoan parasites include, but are not limited to, Entamoeba hystolytica, Giardia lamblia, Cryptosporidium muris, Trypanosomatida gambiense, Trypanosomatida thodesiense, Trypanosomatida crusi, Leishmania mexicana, Leishmania braziliensis, 435 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 Leishmania tropica, Leishmania donovani, Toxoplasma gondii, Plasmodium wax, Plasmodium ovale, Plasmodium malariae, Plasmodium falciparum, Trichomonas vaginalis, and Histomonas meleagridis. In some embodiments, the parasitic infection is by a helminthic parasite such as nematodes (e.g., Adenophorea). In some embodiments, the parasite is selected from Secementea (e.g., Trichuris trichiura, Ascaris lumbricoides, Enterobius vermicularis, Ancylostoma duodenale, Necator americanus, Strongyloides stercoralis, Wuchereria bancrofti, Dracunculus medinensis). In some embodiments, the parasite is selected from trematodes (e.g. blood flukes, liver flukes, intestinal flukes, and lung flukes). In some embodiments, the parasite is selected from: Schistosoma mansoni, Schistosoma haematobium, Schistosoma japonicum, Fasciola hepatica, Fasciola gigantica, Heterophyes heterophyes, Paragonimus westermani. In some embodiments, the parasite is selected from cestodes (e.g., Taenia solium, Taenia saginata, Hymenolepis nana, Echinococcus granulosus).

In various embodiments, the present invention provides methods of treating bacterial infections. In various embodiments, the bacterial infection is by a gram-positive bacteria, gram-negative bacteria, aerobic and/or anaerobic bacteria. In various embodiments, the bacteria is selected from, but not limited to, Staphylococcus, Lactobacillus, Streptococcus, Sarcina, Escherichia, Enterobacter, Klebsiella, Pseudomonas, Acinetobacter, Mycobacterium, Proteus, Campylobacter, Citrobacter, Nisseria, Bacciflus, Bacteroides, Peptococcus, Clostridium, Salmonella, Shigella, Serratia, Haemophilus, Brucella and other organisms. In some embodiments, the bacteria is selected from, but not limited to, Pseudomonas aeruginosa, Pseudomonas fluorescens, Pseudomonas acidovorans, Pseudomonas alcaligenes, Pseudomonas putida, Stenotrophomonas maltophilia, Burkholderia cepacia, Aeromonas hydrophilia, Escherichia coli, Citrobacter freundii, Salmonella typhimurium, Salmonella typhi, Salmonella paratyphi, Salmonella enteritidis, Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Enterobacter cloacae, Enterobacter aerogenes, Klebsiella pneumoniae, Klebsiella oxytoca, Serratia marcescens, Frandsella tularensis, Morganella morganii, Proteus mirabilis, Proteus vulgaris, Providencia alcalifaciens, Providencia rettgeri, Providencia stuartii, Acinetobacter baumannii, Acinetobacter calcoaceticus, Acinetobacter haemolyticus, Yersinia enterocolitica, Yersinia pestis, Yersinia pseudotuberculosis, Yersinia intermedia, Bordetella pertussis, Bordetella parapertussis, Bordetella bronchiseptica, Haemophilus influenzae, Haemophilus parainfluenzae, Haemophilus haemolyticus, Haemophilus parahaemolyticus, Haemophilus ducreyi, Pasteurella multocida, Pasteurella haemolytica, Branhamella catarrhalis, Helicobacter pylori, Campylobacter fetus, Campylobacter jejuni, Campylobacter coli, Borrelia burgdorferi, Vibrio cholerae, Vibrio parahaemolyticus, Legionella pneumophila, Listeria monocytogenes, Neisseria gonorrhoeae, Neisseria meningitidis, Kingella, Moraxella, Gardnerella vaginalis, Bacteroides fragilis, Bacteroides distasonis, Bacteroides 3452A homology group, Bacteroides vulgatus, Bacteroides ovalus, Bacteroides thetaiotaomicron, Bacteroides uniformis, Bacteroides eggerthii, Bacteroides splanchnicus, Clostridium difficile, Mycobacterium tuberculosis, Mycobacterium avium, Mycobacterium intracellulare, Mycobacterium leprae, 445 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 Corynebacterium diphtherias, Corynebacterium ulcerans, Streptococcus pneumoniae, Streptococcus agalactiae, Streptococcus pyogenes, Enterococcus faecalis, Enterococcus faecium, Staphylococcus aureus, Staphylococcus epidemidis, Staphylococcus saprophyticus, Staphylococcus intemedius, Staphylococcus hyicus subsp. hyicus, Staphylococcus haemolyticus, Staphylococcus hominis, or Staphylococcus saccharolyticus.

In some aspects, the present chimeric agents are used to treat one or more autoimmune diseases or disorders. In various embodiments, the treatment of an autoimmune disease or disorder may involve modulating the immune system with the present chimeric proteins to favor immune inhibition over immune stimulation. Illustrative autoimmune diseases or disorders treatable with the present chimeric proteins include those in which the body’s own antigens become targets for an immune response, such as, for example, rheumatoid arthritis, systemic lupus erythematosus, diabetes mellitus, ankylosing spondylitis, Sjogren's syndrome, inflammatory bowel diseases (e.g. colitis ulcerosa, Crohn's disease), multiple sclerosis, sarcoidosis, psoriasis, Grave's disease, Hashimoto's thyroiditis, , psoriasis, hypersensitivity reactions (e.g., allergies, hay fever, asthma, and acute edema cause type I hypersensitivity reactions), and vasculitis.

In still another other aspect, the present invention is directed toward methods of treating and preventing T cell-mediated diseases and disorders, such as, but not limited to diseases or disorders described elsewhere herein and inflammatory disease or disorder, graft-versus-host disease (GVHD), transplant rejection, and T cell proliferative disorder. Specific examples of type I ECD domains with utility in this method of use include but are not limited to: TNFRSFIb, BTNL2, PD-L1, PD-L2, CTLA-4, B7-H3, B7- H4, CD40, 0X40, CD137, among others.

In some aspects, the present chimeric agents are used in methods of activating a T cell, e.g. via the extracellular domain having an immune stimulatory signal.

In some aspects, the present chimeric agents are used in methods of preventing the cellular transmission of an immunosuppressive signal.

Combination Therapies and Conjugation In some embodiments, the invention provides for chimeric proteins and methods that further comprise administering an additional agent to a subject. In some embodiments, the invention pertains to co¬ administration and/or co-formulation. Any of the compositions described herein may be co-formulated and/or co-administered.

In some embodiments, any chimeric protein described herein acts synergistically when co-administered with another agent and is administered at doses that are lower than the doses commonly employed when such agents are used as monotherapy. In various embodiments, any agent referenced herein may be used in combination with any of the chimeric proteins described herein. 455 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 In some embodiments, inclusive of, without limitation, cancer applications, the present invention pertains to chemotherapeutic agents as additional agents. Examples of chemotherapeutic agents include, but are not limited to, alkylating agents such as thiotepa and CYTOXAN cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (e.g., bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; cally statin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (e.g., cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB 1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew, Chern. Inti. Ed. Engl., 33: 183-186 (1994)); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authranydn, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN doxorubicin (including morpholino- doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxy doxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamydn, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubidn, streptonigrin, streptozocin, tuberddin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as andtabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as minoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic add; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic add; 2- ethylhydrazide; procarbazine; PSK polysaccharide complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin; sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2,2',2"- trichlorotriethylamine; trichothecenes (e.g., T-2 toxin, verracurin A, roridin A and anguidine); urethan; 465 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside fAra-C"); cyclophosphamide; thiotepa; taxoids, e.g., TAXOL paclitaxel (Bristol-Myers Squibb Oncology, Princeton, N.J.), ABRAXANE Cremophor-free, albumin-engineered nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, 111.), and TAXOTERE doxetaxel (RhonePoulenc Rorer, Antony, France); chloranbucil; GEMZAR gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin, oxaliplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; NAVELBINE, vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (Camptosar, CPT-11) (including the treatment regimen of irinotecan with 5-FU and leucovorin); topoisomerase inhibitor RFS 2000; difluoromethylomithine (DMFO); retinoids such as retinoic acid; capecitabine; combretastatin; leucovorin (LV); oxaliplatin, including the oxaliplatin treatment regimen (FOLFOX); lapatinib (TYKERB); inhibitors of PKC-a, Raf, H-Ras, EGFR (e.g., erlotinib (Tarceva)) and VEGF-A that reduce cell proliferation and pharmaceutically acceptable salts, acids or derivatives of any of the above. In addition, the methods of treatment can further include the use of radiation. In addition, the methods of treatment can further include the use of photodynamic therapy.

In various embodiments, inclusive of, without limitation, cancer applications, the present additional agent is one or more immune-modulating agents selected from an agent that blocks, reduces and/or inhibits PD-1 and PD-L1 or PD-L2 and/or the binding of PD-1 with PD-L1 or PD-L2 (by way of non¬ limiting example, one or more of nivolumab (ONO-4538/BMS-936558, MDX1106, OPDIVO, BRISTOL MYERS SQUIBB), pembrolizumab (KEYTRUDA, Merck), pidilizumab (CT-011, CURE TECH), MK-3475 (MERCK), BMS 936559 (BRISTOL MYERS SQUIBB), atezolizumab (TECENTRIQ, GENENTECH), MPDL328OA (ROCHE)), an agent that increases and/or stimulates CD137 (4-1BB) and/or the binding of CD137 (4-1BB) with one or more of 4-1BB ligand (by way of non-limiting example, urelumab (BMS- 663513 and anti-4-1BB antibody), and an agent that blocks, reduces and/or inhibits the activity of CTLA- 4 and/or the binding of CTLA-4 with one or more of AP2M1, CD80, CD86, SHP-2, and PPP2R5A and/or the binding of 0X40 with OX40L (by way of non-limiting example GBR 830 (GLENMARK), MEDI6469 (MEDIMMUNE).

In some embodiments, inclusive of, without limitation, infectious disease applications, the present invention pertains to anti-infectives as additional agents. In some embodiments, the anti-infective is an anti-viral agent including, but not limited to, Abacavir, Acyclovir, Adefovir, Amprenavir, Atazanavir, Cidofovir, Darunavir, Delavirdine, Didanosine, Docosanol, Efavirenz, Elvitegravir, Emtridtabine, Enfuvirtide, Etravirine, Famciclovir, and Foscamet. In some embodiments, the anti-infective is an anti¬ bacterial agent including, but not limited to, cephalosporin antibiotics (cephalexin, cefuroxime, cefadroxil, cefazolin, cephalothin, cefaclor, cefamandole, cefoxitin, cefprozil, and ceftobiprole); fluoroquinolone antibiotics (cipro, Levaquin, floxin, tequin, avelox, and norflox); tetracycline antibiotics (tetracydine, minocycline, oxytetracycline, and doxycydine); penicillin antibiotics (amoxidllin, ampicillin, 475 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 penicillin V, dicloxacillin, carbenicillin, vancomycin, and methicillin); monobactam antibiotics (aztreonam); and carbapenem antibiotics (ertapenem, doripenem, imipenem/cilastatin, and meropenem). In some embodiments, the anti-infectives include anti-malarial agents (e.g., chloroquine, quinine, mefloquine, primaquine, doxycycline, artemether/lumefantrine, atovaquone/proguanil and sulfadoxine/pyrimethamine), metronidazole, tinidazole, ivermectin, pyrantel pamoate, and albendazole.

In some embodiments, inclusive, without limitation, of autoimmune applications, the additional agent is an immunosuppressive agent. In some embodiments, the immunosuppressive agent is an anti¬ inflammatory agent such as a steroidal anti-inflammatory agent or a non-steroidal anti-inflammatory agent (NSAID). Steroids, particularly the adrenal corticosteroids and their synthetic analogues, are well known in the art Examples of corticosteroids useful in the present invention include, without limitation, hydroxyltriamcinolone, alpha-methyl dexamethasone, beta-methyl betamethasone, beclomethasone dipropionate, betamethasone benzoate, betamethasone dipropionate, betamethasone valerate, clobetasol valerate, desonide, desoxymethasone, dexamethasone, diflorasone diacetate, diflucortolone valerate, fluadrenolone, fluclorolone acetonide, flumethasone pivalate, fluosinolone acetonide, fluocinonide, flucortine butylester, fluocortolone, fluprednidene (fluprednylidene) acetate, flurandrenolone, halcinonide, hydrocortisone acetate, hydrocortisone butyrate, methylprednisolone, triamcinolone acetonide, cortisone, cortodoxone, flucetonide, fludrocortisone, difluorosone diacetate, fluradrenolone acetonide, medrysone, amcinafel, amcinafide, betamethasone and the balance of its esters, chloroprednisone, clocortelone, clescinolone, dichlorisone, difluprednate, fludoronide, flunisolide, fluoromethalone, fluperolone, fluprednisolone, hydrocortisone, meprednisone, paramethasone, prednisolone, prednisone, beclomethasone dipropionate. (NSAIDS) that may be used in the present invention, include but are not limited to, salicylic acid, acetyl salicylic acid, methyl salicylate, glycol salicylate, salicylmides, benzyl-2,5-diacetoxybenzoic acid, ibuprofen, fulindac, naproxen, ketoprofen, etofenamate, phenylbutazone, and indomethacin. In some embodiments, the immunosupressive agent may be cytostatics such as alkylating agents, antimetabolites (e.g., azathioprine, methotrexate), cytotoxic antibiotics, antibodies (e.g., basiliximab, daclizumab, and muromonab), anti-immunophilins (e.g., cyclosporine, tacrolimus, sirolimus), inteferons, opioids, TNF binding proteins, mycophenolates, and small biological agents (e.g., fingolimod, myriocin).

In some embodiments, the chimeric proteins (and/or additional agents) described herein, include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the composition such that covalent attachment does not prevent the activity of the composition. For example, but not by way of limitation, derivatives include composition that have been modified by, inter alia, glycosylation, lipidation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. fay of numerous chemical modifications can be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of turicamycin, etc. 485 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 Additionally, the derivative can contain one or more non-classical amino acids. In still other embodiments, the chimeric proteins (and/or additional agents) described herein further comprise a cytotoxic agent, comprising, in illustrative embodiments, a toxin, a chemotherapeutic agent, a radioisotope, and an agent that causes apoptosis or cell death. Such agents may be conjugated to a composition described herein.

The chimeric proteins (and/or additional agents) described herein may thus be modified posttranslationally to add effector moieties such as chemical linkers, detectable moieties such as for example fluorescent dyes, enzymes, substrates, bioluminescent materials, radioactive materials, and chemiluminescent moieties, or functional moieties such as for example streptavidin, avidin, biotin, a cytotoxin, a cytotoxic agent, and radioactive materials.

Formulations The chimeric proteins (and/or additional agents) described herein can possess a sufficiently basic functional group, which can react with an inorganic or organic acid, or a carboxyl group, which can react with an inorganic or organic base, to form a pharmaceutically acceptable salt. A pharmaceutically acceptable acid addition salt is formed from a pharmaceutically acceptable acid, as is well known in the art. Such salts include the pharmaceutically acceptable salts listed in, for example, Journal of Pharmaceutical Science, 66, 2-19 (1977) and The Handbook of Pharmaceutical Salts; Properties, Selection, and Use. P. H. Stahl and C. G. Wermuth (eds.), Verlag, Zurich (Switzerland) 2002.

In some embodiments, the compositions described herein are in the form of a pharmaceutically acceptable salt.

Further, any chimeric protein (and/or additional agents) described herein can be administered to a subject as a component of a composition that comprises a pharmaceutically acceptable carrier or vehicle. Such compositions can optionally comprise a suitable amount of a pharmaceutically acceptable excipient so as to provide the form for proper administration. Pharmaceutical excipients can be liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. The pharmaceutical excipients can be, for example, saline, gum acacia, gelatin, starch paste, talc, keratin, colloidal silica, urea and the like. In addition, auxiliary, stabilizing, thickening, lubricating, and coloring agents can be used. In one embodiment, the pharmaceutically acceptable excipients are sterile when administered to a subject.

Water is a useful excipient when any agent described herein is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid excipients, specifically for injectable solutions. Suitable pharmaceutical excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. Any agent 495 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 described herein, if desired, can also comprise minor amounts of wetting or emulsifying agents, or pH buffering agents.

In some embodiments, the compositions described herein are resuspended in a saline buffer (including, without limitation TBS, PBS, and the like).

In various embodiments, the chimeric proteins may by conjugated and/or fused with another agent to extend half-life or otherwise improve pharmacodynamic and pharmacokinetic properties. In some embodiments, the chimeric proteins may be fused or conjugated with one or more of PEG, XTEN (e.g., as rPEG), polysialic acid (POLYXEN), albumin (e.g., human serum albumin or HAS), elastin-like protein (ELP), PAS, HAP, GLK, CTP, transferrin, and the like. In various embodiments, each of the individual chimeric proteins is fused to one or more of the agents described in BioDrugs (2015) 29:215-239.

Administration, Dosing, and Treatment Regimens The present invention includes the described chimeric protein (and/or additional agents) in various formulations. Any chimeric protein (and/or additional agents) described herein can take the form of solutions, suspensions, emulsion, drops, tablets, pills, pellets, capsules, capsules containing liquids, powders, sustained-release formulations, suppositories, emulsions, aerosols, sprays, suspensions, or any other form suitable for use. DNA or RNA constructs encoding the protein sequences may also be used. In one embodiment, the composition is in the form of a capsule (see, e.g., U.S. Patent No. 5,698,155). Other examples of suitable pharmaceutical excipients are described in Remington’s Pharmaceutical Sciences 1447-1676 (Alfonso R. Gennaro eds., 19th ed. 1995).

Where necessary, the formulations comprising the chimeric protein (and/or additional agents) can also include a solubilizing agent. Also, the agents can be delivered with a suitable vehicle or delivery device as known in the art. Combination therapies outlined herein can be co-delivered in a single delivery vehicle or delivery device. Compositions for administration can optionally include a local anesthetic such as, for example, lignocaine to lessen pain at the site of the injection.

The formulations comprising the chimeric protein (and/or additional agents) of the present invention may conveniently be presented in unit dosage forms and may be prepared by any of the methods well known in the art of pharmacy. Such methods generally include the step of bringing the therapeutic agents into association with a carrier, which constitutes one or more accessory ingredients. Typically, the formulations are prepared by uniformly and intimately bringing the therapeutic agent into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product into dosage forms of the desired formulation (e.g., wet or dry granulation, powder blends, etc., followed by tableting using conventional methods known in the art) 505 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 In one embodiment, any chimeric protein (and/or additional agents) described herein is formulated in accordance with routine procedures as a composition adapted for a mode of administration described herein.

Routes of administration include, for example: intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, oral, sublingual, intranasal, intracerebral, intravaginal, transdermal, rectally, by inhalation, or topically, particularly to the ears, nose, eyes, or skin. In some embodiments, the administering is effected orally or by parenteral injection.. In most instances, administration results in the release of any agent described herein into the bloodstream.

Any dimeric protein (and/or additional agents) described herein can be administered orally. Such chimeric proteins (and/or additional agents) can also be administered by any other convenient route, for example, by intravenous infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, efc.) and can be administered together with another biologically active agent. Administration can be systemic or local. Various delivery systems are known, e.g., encapsulation in liposomes, microparticles, microcapsules, capsules, efc., and can be used to administer.

In specific embodiments, it may be desirable to administer locally to the area in need of treatment. In one embodiment, for instance in the treatment of cancer, the chimeric protein (and/or additional agents) are administered in the tumor microenvironment (e.g. cells, molecules, extracellular matrix and/or blood vessels that surround and/or feed a tumor cell, inclusive of, for example, tumor vasculature; tumor¬ infiltrating lymphocytes; fibroblast reticular cells; endothelial progenitor cells (EPC); cancer-associated fibroblasts; pericytes; other stromal cells; components of the extracellular matrix (ECM); dendritic cells; antigen presenting cells; T-cells; regulatory T cells; macrophages; neutrophils; and other immune cells located proximal to a tumor) or lymph node and/or targeted to the tumor microenvironment or lymph node. In various embodiments, for instance in the treatment of cancer, the chimeric protein (and/or additional agents) are administered intratumorally.

In the various embodiments, the present chimeric protein allows for a dual effect that provides less side effects than are seen in conventional immunotherapy (e.g. treatments with one or more of OPDIVO, KEYTRUDA, YERVOY, and TECENTRIQ). For example, the present chimeric proteins reduce or prevent commonly observed immune-related adverse events that affect various tissues and organs including the skin, the gastrointestinal tract, the kidneys, peripheral and central nervous system, liver, lymph nodes, eyes, pancreas, and the endocrine system; such as hypophysitis, colitis, hepatitis, pneumonitis, rash, and rheumatic disease. Further, the present local administration, e.g. intratumorally, obviate adverse event seen with standard systemic administration, e.g. IV infusions, as are used with conventional immunotherapy (e.g. treatments with one or more of OPDIVO, KEYTRUDA, YERVOY, and TECENTRIQ). 515 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 Dosage forms suitable for parenteral administration {e.g. intravenous, intramuscular, intraperitoneal, subcutaneous and intra-articular injection and infusion) include, for example, solutions, suspensions, dispersions, emulsions, and the like. They may also be manufactured in the form of sterile solid compostions {e.g. lyophilized composition), which can be dissolved or suspended in sterile injectable medium immediately before use. They may contain, for example, suspending or dispersing agents known in the art.

The dosage of any chimeric protein (and/or additional agents) described herein as well as the dosing schedule can depend on various parameters, including, but not limited to, the disease being treated, the subject’s general health, and the administering physician’s discretion. Any chimeric protein described herein, can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concurrently with, or subsequent to {e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of an additional agent, to a subject in need thereof. In various embodiments any chimeric protein and additional agent described herein are administered 1 minute apart, 10 minutes apart, 30 minutes apart, less than 1 hour apart, 1 hour apart, 1 hour to 2 hours apart, 2 hours to 3 hours apart, 3 hours to 4 hours apart, 4 hours to 5 hours apart, 5 hours to 6 hours apart, 6 hours to 7 hours apart, 7 hours to 8 hours apart, 8 hours to 9 hours apart, 9 hours to 10 hours apart, 10 hours to 11 hours apart, 11 hours to 12 hours apart, no more than 24 hours apart or no more than 48 hours apart The dosage of any chimeric protein (and/or additional agents) described herein can depend on several factors including the severity of the condition, whether the condition is to be treated or prevented, and the age, weight, and health of the subject to be treated. Additionally, pharmacogenomic (the effect of genotype on the pharmacokinetic, pharmacodynamic or efficacy profile of a therapeutic) information about a particular subject may affect dosage used. Furthermore, the exact individual dosages can be adjusted somewhat depending on a variety of factors, including the specific combination of the agents being administered, the time of administration, the route of administration, the nature of the formulation, the rate of excretion, the particular disease being treated, the severity of the disorder, and the anatomical location of the disorder. Some variations in the dosage can be expected.

For administration of any chimeric protein (and/or additional agents) described herein by parenteral injection, the dosage is normally 0.1 mg to 250 mg per day, 1 mg to 20 mg per day, or 3 mg to 5 mg per day. Injections may be given up to four times daily. Generally, when orally or parenterally administered, the dosage of any agent described herein is normally 0.1 mg to 1500 mg per day, or 0.5 mg to 10 mg per day, or 0.5 mg to 5 mg per day. A dosage of up to 3000 mg per day can be administered. 525 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 In another embodiment, delivery can be in a vesicle, in particular a liposome (see Langer, 1990, Science 249:1527-1533; Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989).

Any chimeric protein (and/or additional agents) described herein can be administered by controlledrelease or sustained-release means or by delivery devices that are well known to those of ordinary skill in the art. Examples include, but are not limited to, those described in U.S. Patent Nos. 3,845,770; 3,916,899; 3,536,809; 3,598,123; 4,008,719; 5,674,533; 5,059,595; 5,591,767; 5,120,548; 5,073,543; 5,639,476; 5,354,556; and 5,733,556.

Such dosage forms can be useful for providing controlled- or sustained-release of one or more active ingredients using, for example, hydropropylmethyl cellulose, other polymer matrices, gels, permeable membranes, osmotic systems, multilayer coatings, microparticles, liposomes, microspheres, or a combination thereof to provide the desired release profile in varying proportions. Controlled- or sustained-release of an active ingredient can be stimulated by various conditions, including but not limited to, changes in pH, changes in temperature, stimulation by an appropriate wavelength of light, concentration or availability of enzymes, concentration or availability of water, or other physiological conditions or compounds.

In another embodiment, polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Florida (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York (1984); Rangerand Peppas, 1983, J. Macromol. Sci. Rev. Macromol. Chern. 23:61; see also Levy et al., 1985, Science 228:190; During ef al., 1989, Ann. Neurol. 25:351; Howard et al., 1989, J. Neurosurg. 71:105).

In another embodiment, a controlled-release system can be placed in proximity of the target area to be treated, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)). Other controlled-release systems discussed in the review by Langer, 1990, Science 249:1527-1533) may be used.

Administration of any chimeric protein (and/or additional agents) described herein can, independently, be one to four times daily or one to four times per month or one to six times per year or once every two, three, four or five years. Administration can be for the duration of one day or one month, two months, three months, six months, one year, two years, three years, and may even be for the life of the subject.

The dosage regimen utilizing any chimeric protein (and/or additional agents) described herein can be selected in accordance with a variety of factors including type, species, age, weight, sex and medical condition of the subject; the severity of the condition to be treated; the route of administration; the renal or hepatic function of the subject; the pharmacogenomic makeup of the individual; and the specific compound of the invention employed. Any chimeric protein (and/or additional agents) described herein can be administered in a single daily dose, or the total daily dosage can be administered in divided 535 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 doses of two, three or four times daily. Furthermore, any chimeric protein (and/or additional agents) described herein can be administered continuously rather than intermittently throughout the dosage regimen.

Cells and Nucleic Acids In various embodiments, the present invention provides an expression vector, comprising a nucleic acid encoding the chimeric protein described herein. In various embodiments, the expression vector comprises DNA or RNA. In various embodiments, the expression vector is a mammalian expression vector.

Both prokaryotic and eukaryotic vectors can be used for expression of the chimeric protein. Prokaryotic vectors include constructs based on E coli sequences (see, e.g., Makrides, Microbiol Rev 1996, 60:512-538). Non-limiting examples of regulatory regions that can be used for expression in E coli indude lac, trp, Ipp, phoA, recA, tac, T3, T7 and APl. Non-limiting examples of prokaryotic expression vectors may indude the Agt vector series such as Agt11 (Huynh et al., in “DNA Cloning Techniques, Vol.

I: A Practical Approach,” 1984, (D. Glover, ed.), pp. 49-78, IRL Press, Oxford), and the pET vector series (Studier et al., Methods Enzymol 1990, 185:60-89). Prokaryotic host-vector systems cannot perform much of the post-translational processing of mammalian cells, however. Thus, eukaryotic host¬ vector systems may be particularly useful. A variety of regulatory regions can be used for expression of the chimeric proteins in mammalian host cells. For example, the SV40 early and late promoters, the cytomegalovirus (CMV) immediate early promoter, and the Rous sarcoma virus long terminal repeat (RSV-LTR) promoter can be used. Inducible promoters that may be useful in mammalian cells indude, without limitation, promoters associated with the metallothionein II gene, mouse mammary tumor virus glucocorticoid responsive long terminal repeats (MMTV-LTR), the p-interferon gene, and the hsp70 gene (see, Williams et al., Cancer Res 1989, 49:2735-42; and Taylor et al., Mol Cell Biol 1990, 10:165- 75). Heat shock promoters or stress promoters also may be advantageous for driving expression of the fusion proteins in recombinant host cells.

In some embodiments, expression vectors of the invention comprise a nucleic add encoding the chimeric proteins (and/or additional agents), or a complement thereof, operably linked to an expression control region, or complement thereof, that is functional in a mammalian cell. The expression control regionis capable of driving expression of the operably linked blocking and/or stimulating agent encoding nucleic add such that the blocking and/or stimulating agent is produced in a human cell transformed with the expression vector.

Expression control regions are regulatory polynucleotides (sometimes referred to herein as elements), such as promoters and enhancers, that influence expression of an operably linked nucleic add. An expression control region of an expression vector of the invention is capable of expressing operably linked encoding nucleic acid in a human cell. In an embodiment, the cell is a tumor cell. In another 545 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 embodiment, the cell is a non-tumor cell. In an embodiment, the expression control region confers regulatable expression to an operably linked nucleic acid. A signal (sometimes referred to as a stimulus) can increase or decrease expression of a nucleic acid operably linked to such an expression control region. Such expression control regions that increase expression in response to a signal are often referred to as inducible. Such expression control regions that decrease expression in response to a signal are often referred to as repressible. Typically, the amount of increase or decrease conferred by such elements is proportional to the amount of signal present; the greater the amount of signal, the greater the increase or decrease in expression.

In an embodiment, the present invention contemplates the use of inducible promoters capable of effecting high level of expression transiently in response to a cue. For example, when in the proximity of a tumor cell, a cell transformed with an expression vector for the chimeric protein (and/or additional agents) comprising such an expression control sequence is induced to transiently produce a high level of the agent by exposing the transformed cell to an appropriate cue. Illustrative inducible expression control regions include those comprising an inducible promoter that is stimulated with a cue such as a small molecule chemical compound. Particular examples can be found, for example, in U.S. Pat. Nos. 5,989,910, 5,935,934, 6,015,709, and 6,004,941.

Expression control regions and locus control regions include full-length promoter sequences, such as native promoter and enhancer elements, as well as subsequences or polynucleotide variants which retain all or part of full-length or non-variant function. As used herein, the term "function^" and grammatical variants thereof, when used in reference to a nucleic acid sequence, subsequence or fragment, means that the sequence has one or more functions of native nucleic acid sequence (e.g., non-variant or unmodified sequence).

As used herein, “operable linkage” refers to a physical juxtaposition of the components so described as to permit them to function in their intended manner. In the example of an expression control element in operable linkage with a nucleic acid, the relationship is such that the control element modulates expression of the nucleic acid. Typically, an expression control region that modulates transcription is juxtaposed near the 5' end of the transcribed nucleic acid (/.a, “upstream”). Expression control regions can also be located at the 3’ end of the transcribed sequence (i.e., “downstream") or within the transcript (e.g., in an intron). Expression control elements can be located at a distance away from the transcribed sequence (e.g., 100 to 500, 500 to 1000, 2000 to 5000, or more nucleotides from the nucleic add). A specific example of an expression control element is a promoter, which is usually located 5' of the transcribed sequence. Another example of an expression control element is an enhancer, which can be located 5' or 3' of the transcribed sequence, or within the transcribed sequence. 555 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 Expression systems functional in human cells are well known in the art, and include viral systems.

Generally, a promoter functional in a human cell is any DNA sequence capable of binding mammalian RNA polymerase and initiating the downstream (3') transcription of a coding sequence into mRNA. A promoter will have a transcription initiating region, which is usually placed proximal to the 5' end of the coding sequence, and typically a TATA box located 25-30 base pairs upstream of the transcription initiation site. The TATA box is thought to direct RNA polymerase II to begin RNA synthesis at the correct site. A promoter will also typically contain an upstream promoter element (enhancer element), typically located within 100 to 200 base pairs upstream of the TATA box. An upstream promoter element determines the rate at which transcription is initiated and can act in either orientation. Of particular use as promoters are the promoters from mammalian viral genes, since the viral genes are often highly expressed and have a broad host range. Examples include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter, herpes simplex virus promoter, and the CMV promoter.

Typically, transcription termination and polyadenylation sequences recognized by mammalian cells are regulatory regions located 3' to the translation stop codon and thus, together with the promoter elements, flank the coding sequence. The 3’ terminus of the mature mRNA is formed by site-specific post-translational cleavage and polyadenylation. Examples of transcription terminator and polyadenylation signals include those derived from SV40. Introns may also be included in expression constructs.

There are a variety of techniques available for introducing nucleic acids into viable cells. Techniques suitable for the transfer of nucleic acid into mammalian cells in vitro include the use of liposomes, electroporation, microinjection, cell fusion, polymer-based systems, DEAE-dextran, viral transduction, the calcium phosphate precipitation method, etc. For in vivo gene transfer, a number of techniques and reagents may also be used, including liposomes; natural polymer-based delivery vehicles, such as chitosan and gelatin; viral vectors are also suitable for in vivo transduction. In some situations it is desirable to provide a targeting agent, such as an antibody or ligand specific for a tumor cell surface membrane protein. Where liposomes are employed, proteins which bind to a cell surface membrane protein associated with endocytosis may be used for targeting and/or to facilitate uptake, e.g., capsid proteins or fragments thereof tropic for a particular cell type, antibodies for proteins which undergo internalization in cycling, proteins that target intracellular localization and enhance intracellular half-life.

The technique of receptor-mediated endocytosis is described, for example, by Wu et al., J. Biol. Chern. 262, 44294432 (1987); and Wagner et al., Proc. Natl. Acad. Sci. USA 87, 3410-3414 (1990).

Where appropriate, gene delivery agents such as, e.g., integration sequences can also be employed.

Numerous integration sequences are known in the art (see, e.g., Nunes-Duby et al., Nucleic Acids Res. 26:391-406, 1998; Sadwoski, J. Bacteriol., 165:341-357, 1986; Bestor, Cell, 122(3):322-325, 2005; Plasterk et al., TIG 15:326-332, 1999; Kootstra et al., Ann. Rev. Pharm. Toxicol., 43:413-439, 2003). 565 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 These indude recombinases and transposases. Examples indude Cre (Sternberg and Hamilton, J. Mol.

Biol., 150:467-486, 1981), lambda (Nash, Nature, 247, 543-545, 1974), Flp (Broach, eta/., Cell, 29:227- 234, 1982), R (Matsuzaki, eta/., J. Bacteriology, 172:610-618, 1990), cpC31 (see, e.g., Groth ef al., J.

Mol. Biol. 335:667-678, 2004), sleeping beauty, transposases of the mariner family (Plasterk ef al., supra), and components for integrating viruses such as AAV, retroviruses, and antiviruses having components that provide for virus integration such as the LTR sequences of retroviruses or lentivirus and the ITR sequences of AAV (Kootstra ef al., Ann. Rev. Pharm. Toxicol., 43:413-439, 2003). In addition, direct and targeted genetic integration strategies may be used to insert nucleic acid sequences encoding the chimeric fusion proteins including CRISPR/CAS9, zinc finger, TALEN, and meganuclease gene-editing technologies.

In one aspect, the invention provides expression vectors for the expression of the chimeric proteins (and/or additional agents) that are viral vectors. Many viral vectors useful for gene therapy are known (see, e.g, Lundstrom, Trends Biotechnol., 21: 1 17, 122, 2003. Illustrative viral vectors include those selected from Antiviruses (LV), retroviruses (RV), adenoviruses (AV), adeno-associated viruses (AAV), and a viruses, though other viral vectors may also be used. For in vivo uses, viral vectors that do not Integrate into the host genome are suitable for use, such as a viruses and adenoviruses. Illustrative types of a viruses include Slndbis virus, Venezuelan equine encephalitis (VEE) virus, and Semliki Forest vims (SFV). For in vitro uses, viral vectors that integrate into the host genome are suitable, such as retroviruses, AAV, and Antiviruses. In one embodiment, the invention provides methods of transducing a human cell in vivo, comprising contacting a solid tumor in vivo with a viral vector of the invention.

In various embodiments, the present invention provides a host cell, comprising the expression vector comprising the chimeric protein described herein.

Expression vectors can be introduced into host cells for producing the present chimeric proteins. Cells may be cultured in vitro or genetically engineered, for example. Useful mammalian host cells include, without limitation, cells derived from humans, monkeys, and rodents (see, for example, Kriegler in “Gene Transfer and Expression: A Laboratory Manual,” 1990, New York, Freeman & Co.). These include monkey kidney cell lines transformed by SV40 (e.g., COS-7, ATCC CRL 1651); human embryonic kidney lines (e.g., 293, 293-EBNA, or 293 cells subcloned for growth in suspension culture, Graham el al., J Gen Virol 1977, 36:59); baby hamster kidney cells (e.g., BHK, ATCC CCL 10); Chinese hamster ovary-cells-DHFR (e.g., CHO, Uriaub and Chasin, Proc Natl Acad Sci USA 1980, 77:4216); DG44 CHO cells, CHO-K1 cells, mouse sertoli cells (Mather, Biol Reprod 1980, 23:243-251); mouse fibroblast cells (e.g., NIH-3T3), monkey kidney cells (e.g., CV1 ATCC CCL 70); African green monkey kidney cells, (e.g., VERO-76, ATCC CRL-1587); human cervical carcinoma cells (e.g, HELA, ATCC CCL 2); canine kidney cells (e.g, MDCK, ATCC CCL 34); buffalo rat liver cells (e.g., BRL 3A, ATCC CRL 1442); human lung cells (e.g, W138, ATCC CCL 75); human liver cells (e.g, Hep G2, HB 8065); 575 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 and mouse mammary tumor cells (e.g., MMT 060562, ATCC CCL51). Illustrative cancer cell types for expressing the fusion proteins described herein include mouse fibroblast cell line, NIH3T3, mouse Lewis lung carcinoma cell line, LLC, mouse mastocytoma cell line, P815, mouse lymphoma cell line, EL4 and its ovalbumin transfectant, E.G7, mouse melanoma cell line, B16F10, mouse fibrosarcoma cell line, MC57, and human small cell lung carcinoma cell lines, SCLC#2 and SCLC#7.

Host cells can be obtained from normal or affected subjects, including healthy humans, cancer patients, and patients with an infectious disease, private laboratory deposits, public culture collections such as the American Type Culture Collection, or from commercial suppliers.

Cells that can be used for production of the present chimeric proteins in vitro, ex vivo, and/or in vivo include, without limitation, epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes; blood cells such as T lymphocytes, B lymphocytes, monocytes, macrophages, neutrophils, eosinophils, megakaryocytes, granulocytes; various stem or progenitor cells, in particular hematopoietic stem or progenitor cells (e.g., as obtained from bone marrow), umbilical cord blood, peripheral blood, fetal liver, etc. The choice of cell type depends on the type of tumor or infectious disease being treated or prevented, and can be determined by one of skill in the art.

Subjects and/or Animals In some embodiments, the subject and/or animal is a mammal, e.g., a human, mouse, rat, guinea pig, dog, cat, horse, cow, pig, rabbit, sheep, or non-human primate, such as a monkey, chimpanzee, or baboon. In other embodiments, the subject and/or animal is a non-mammal, such, for example, a zebrafish. In some embodiments, the subject and/or animal may comprise fluorescently-tagged cells (with e.g. GFP). In some embodiments, the subject and/or animal is a transgenic animal comprising a fluorescent cell.

In some embodiments, the subject and/or animal is a human. In some embodiments, the human is a pediatric human. In other embodiments, the human is an adult human. In other embodiments, the human is a geriatric human. In other embodiments, the human may be referred to as a patient In certain embodiments, the human has an age in a range of from about 0 months to about 6 months old, from about 6 to about 12 months old, from about 6 to about 18 months old, from about 18 to about 36 months old, from about 1 to about 5 years old, from about 5 to about 10 years old, from about 10 to about 15 years old, from about 15 to about 20 years old, from about 20 to about 25 years old, from about 25 to about 30 years old, from about 30 to about 35 years old, from about 35 to about 40 years old, from about 40 to about 45 years old, from about 45 to about 50 years old, from about 50 to about 55 years old, from about 55 to about 60 years old, from about 60 to about 65 years old, from about 65 to about 70 years old, from about 70 to about 75 years old, from about 75 to about 80 years old, from about 80 to about 85 years old, from about 85 to about 90 years old, from about 90 to about 95 years old or from about 95 to about 100 years old. 585 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 In other embodiments, the subject is a non-human animal, and therefore the invention pertains to veterinary use. In a specific embodiment, the non-human animal is a household pet. In another specific embodiment, the non-human animal is a livestock animal.

Kits The invention provides kits that can simplify the administration of any agent described herein. An illustrative kit of the invention comprises any composition described herein in unit dosage form. In one embodiment, the unit dosage form is a container, such as a pre-filled syringe, which can be sterile, containing any agent described herein and a pharmaceutically acceptable carrier, diluent, excipient, or vehicle. The kit can further comprise a label or printed instructions instructing the use of any agent described herein. The kit may also include a lid speculum, topical anesthetic, and a cleaning agent for the administration location. The kit can also further comprise one or more additional agent described herein. In one embodiment, the kit comprises a container containing an effective amount of a compoation of the invention and an effective amount of another composition, such those described herein. The invention will be further described in the following example, which does not limit the scope of the invention described in the claims.

EXAMPLES Example 1. Construction and Characterization of Mouse PD-1-Fc-QX40L Construct A chimeric mouse PD-1-Fc-GX40L construct was generated and its expression in CH0-K1 cells was verified using a mouse IgG capture ELISA assay (here, the Fc is derived from lgG1). Specifically, CHOK1 cells were stably nucleofected with pVITRO2-GS-hygro or pcDNA3.4 vectors expressing either the mouse extracellular domain (ECD) of PD-1 fused to Fc (mPD-1-Fc) or mPD-1-Fc fused to the ECD of OX40L (mPD-1-Fc-OX40L). Antibiotic-resistant single cell clones were isolated via limiting dilution. The concentration of each chimeric protein secreted into the culture media was determined by a mlgG capture ELISA as shown in Figure 5.

Binding assays were carried out to characterize the ability of mouse PD-1-Fc-OX40L to bind to mOX40 as well as to mPD-L1. Figure 6, panel A, shows a schematic representation of the ELISA assay used to detect binding of mouse PD-1-Fc-OX40L to mOX40. Specifically, recombinant mOX40 fused to human Fc (mOX40-hFc) was used to capture mPD-1-Fc-OX40L in the culture media. A rabbit polyclonal antibody to mPD-1 was used to detect the mPD-1 domain in the chimeric protein and subsequently detected using a horseradish peroxidase (HRP)-conjugated polyclonal antibody to rabbit IgG (H+L).

Figure 6, panel B, shows that mouse PD-1-Fc-OX40L efficiently bound to 0X40 compared to the mPD- 1-Fc negative control. Figure 7, panel A, shows a schematic representation of the ELISA assay used to detect binding of mouse PD-1-FC-OX40L to mPD-L1. Specifically, recombinant mPD-L1 fused to human Fc (mPD-L1-hFc) was used to capture the mPD-1-Fc-OX40L chimeric protein in the culture media. A horseradish peroxidase (HRP)-conjugated polyclonal antibody to mouse IgG (H+L) was used for the 595 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 detection of the bound proteins. Figure 7, panel B, shows that mouse PD-1-FC-OX40L efficiently bound to PD-L1 as compared to a negative media control and a positive control using recombinant mouse PD1-FC.

Experiments were carried out to characterize the activity of mouse PD-1-Fc-OX40L in eliciting T-cell response and in treating tumors. Chicken ovalbumin antigen-specific OT-I/EGFP, CD8+ T cells (5*105) were adoptively transferred to C57/BL6-albino mice via tail vein injections 2 days prior to inoculation with B16.F10-ova tumor cells (5*105) into the right flank of the mice. Once tumors reached 3-5 mm in diameter, PD-1-Fc-OX40L expressing DNA (50 pg) was electroporated into the tumor using a defined electrical pulse (1500 V/cm) using 8 pulses at 100 pS. The percentage of CD8+OT-I/EGFP cells in the peripheral blood was quantified by flow cytometry analysis over the assigned time course following electroporation. As shown in Figure 8, in vivo intratumoral delivery of mouse (m) PD-1-Fc-OX40L led to an expansion of antigen-specific CD8+ T-cells.

Figure 9 shows that the in vivo intratumoral delivery of mPD-1-Fc-OX40L also led to tumor regression in the B16.F10-ova tumor model. B16.F10-ova tumors were generated in C57/BI6-albino mice that were adoptively transferred with CD8+ OT-I/EGFP cells and electroporated once with mPD-1-Fc-OX40L expressing DNA (50 pg). Control mice did not receive DNA but were subjected to electroporation (EP only). Tumor diameters were measured using a digital caliper over the assigned time course following electroporation. Figure 9 demonstrates that the administration of mPD-1-Fc-OX40L significantly reduced tumor size.

Example 2. Additional Characterization of Mouse PD-1-Fc-QX40L Construct A mPD-1-Fc-OX40L construct was generated which included the mouse extracellular domain (ECD) of PD-1 fused to the ECD of OX40L via a hinge-CH2-CH3 Fc domain derived from lgG1 (mPD-1-FcOX40L). The mPD-1-Fc-OX40L construct was transiently expressed in 293 cells and purified using protein A affinity chromatography. Western blot and functional ELISA analysis were performed to validate the detection and binding of all 3 components of mPD-1-Fc-OX40L (Figure 10, panel A).

Quanitation of mPD1-Fc-OX40L can be assessed using a murine IgG capture and detection ELISA (Figure 10, panel B). The binding of mPD-1 and mOX40L to their partners mPD-L1 and mOX40, respectively, was demonstrated simultaneously by capturing mPD-1-Fc-OX40L with mPD-L1-Fc and detecting it with mOX40-His, followed by His-HRP for chemiluminescence quantitation (Figure 8, panel C). It was also noted that there were monomeric and dimeric conformations of mPD-1-Fc-OX40L.

To assess the ex vivo cellular binding of mPD-1-Fc-OX40L, primary mouse splenocytes were isolated and activated for 2 days with PMA/PHA/lonomycin, in order to up-regulate OX40 and PD-L1 expression.

Activated splenocytes were then treated with 500 ng/mL of mPD-1-Fc-OX40L and analyzed by flow cytometry for binding (Fc-PE) (Figure 8, panel D). To isolate PD-L1 expressing cells, splenocytes were co-stained with an antibody targeting MHC II on antigen presenting cells (l-A/l-E). To isolate OX40 605 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 expressing cells, splenocytes were co-stained with CD4. mPD-1-Fc-OX40L bound significantly to both PD-L1+ and OX40+ populations of splenocytes, indicating that mPD-1-Fc-OX40L had been generated and purified competently to bind its targets on primary derived cells. The binding activity of mPD1-FcOX40L to primary mouse tumor cell lines expressing PD-L1 was also assessed. The murine 4T1 tumor cell line was identified as expressing low amounts of PD-L1 and the B16.F10 tumor cell line expressed comparatively high amounts of PD-L1. mPD1-Fc-OX40L was shown to bind the PD-L1 positive B16.F10 tumor cell line to a greater extent than the PD-L1 low 4T1 tumor cell line (Figure 10, panel E).

Additional functional activities of mPD-1-Fc-OX40L were characterized using a T cell activation/tumor co-culture assay. First, murine PD-L1bW (4T1) and PD-L1high (B16.F10) cells were identified by flow cytometry (Figure 8, panel E). Next, mouse splenocytes were activated for 2 days with CD3/CD28 beads and a sub-saturating concentration of IL2. After 2 days, activated splenocytes were co-cultured with either irradiated 4T1 or B16.F10 cells in the presence or absence of mPD-1-Fc-OX40L. Five days after the initial isolation of splenocytes, culture medium was collected and analyzed for the cytokine IL2 by ELISA (Figure 8, panel F). It was observed that mPD-1-Fc-OX40L was capable of significant induction of IL2 secretion, especially in co-cultures containing PD-L1high tumor cells. Without wishing to be bound by theory, it is believed that mPD-1-Fc-OX40L was concomitantly blocking the suppressive effects of PD-L1 while also activating T cells via OX40/OX40L signaling, thereby inducing IL2 secretion.

Altogether, these findings suggest that mPD-1-Fc-OX40L may provide significant anti-tumor immunity in pre-dinical models.

The anti-tumor potency of mPD-1-Fc-OX40L was tested using several predinical tumor model systems.

Specifically murine models of colorectal cancer (CT26 and MC38) were used to assess the effects of mPD-1-Fc-OX40L on tumor growth, overall survival, and the induction of a serum cytokine response following therapy. These experiments were performed head-to-head with extensively characterized 0X40 agonist (0X86) and PD-L1 blocking (10F.9G2) antibodies given as monotherapy or in combination, at an equivalent active dose to mPD-1-Fc-OX40L via intraperitoneal injection (2 doses of 100 ug each). As shown in Figure 11, panel A, mPD-1-Fc-OX40L significantly reduced tumor size in the MC38 model. More particularly, administration of mPD-1-Fc-OX40L resulted in greater tumor regression than the 0X40 agonist and PD-L1 blocking antibodies administered individually or in combination.

Importantly, repeat challenge of mice that rejected the primary tumor with the parental MC38 tumor cell line was performed for each group. These data demonstrated that, in the absence of repeat treatment, mice treated with mPD1-Fc-OX40L were able to reject a re-challenge with the parental tumor to a greater degree than any of the other treatment groups (Figure 11, panels A and B). Further, other fusion constructs including mPD1-Fc-GITRL and mPD1-Fc-41BBL were produced and used in tumor bearing mice as described above for mPD1-Fc-OX40L. Both the GITRL and 41BBL containing constructs led to reduced tumor size in treated animals. 615 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 In addition to measuring tumor size, a pharmacodynamic biomarker for mPD-1-Fc-OX40L signaling in vivo was also determined. Specifically, a serum cytokine analysis for mice treated with anti-PD-L1 and anti-OX40 antibodies as well as with PD-1-Fc-OX40L was performed. As shown in Figure 11, panels B and C, there was a dose-dependent cytokine signature following treatment with mPD-1-Fc-OX40L that was remarkably similar to the cytokine signature observed following combined administration of anti-PDL1 and anti-OX40 antibodies, comprising of increased IFNy, TNFa, IL-2, IL-4, IL-5, IL-6, IL-10, IL-17A and IL-22 (Figure 11, panels C, D & J). Importantly, detection of a serum cytokine response following treatment with mPD1-Fc-OX40L was shown to be dose dependent. Specifically, treatment with one or two injections of 40|jg did not lead to a detectable serum cytokine response, while treatment with 100 pg once led to an intermediate cytokine response and treatment with 100 pg two times led to a higher cytokine response (Figure 11, panel K). Treatment of mice with mPD1-Fc-GITRL was also shown to stimulated a specific serum cytokine response.

In some experiments, mice bearing MC38 tumors were sacrificed on day 13 of the experiment to evaluate the cellular immune response in the tumor, peripheral blood and spleen. On day 13 of the experiment, mPD1-Fc-OX40L, mPD1-Fc-GITRL and mCD172a-Fc-CD40L were all shown to cause reduced tumor growth as compared to untreated animals or animals treated with 0X40 agonist antibodies, GITR agonist antibodies or PD-L1 blocking antibodies (Figure 11, panel E). In accordance with these data, mice treated with mPD1-Fc-OX40L or mPD1-Fc-GITRL were shown to have increased numbers of tumor antigen specific tumor infiltrating lymphocytes (TIL) on day 13 of the experiment (Figure 11, panel F). Analysis of the memory phenotype in the spleen of CD8+ T cells was performed (Figure 11, panel G) and the CD4/CD8 T cell ratio was also compared across multiple treatments (Figure 11, panel H).

The pharmacodynamic biomarkers for PD-1-Fc-OX40L signaling in vivo was also determined using the CT26 model. Specifically, a serum cytokine analysis for mice treated with anti-PD-L1 and anti-OX40 antibodies, individually or in combination, as well as with PD-1-Fc-OX40L was performed. As shown in Figure 11, panel D, the cytokine signature following treatment with mPD-1-Fc-OX40L was remarkably similar to the cytokine signature observed following the combined administration of anti-PD-L1 and anti- 0X40 antibodies. Specifically, the cytokine signature comprised of increased IFNy, TNFa, IL-2, IL-4, IL- 5, IL-6, IL-9, IL-10, IL-13, IL-17A, IL-17F, and IL-22 (Figure 11, panels J and K).

Consistent with the results derived from the MC38 model, administration of mPD-1-Fc-OX40L also significantly reduced tumor size in the CT26 colorectal cancer model. Particularly, use of mPD-1-FcOX40L resulted in greater tumor regression than the 0X40 agonist and PD-L1 blocking antibodies (Figure 11, panel L). Further, mice administered with mPD-1-Fc-OX40L exhibited longer survival time than mice administered with the 0X40 agonist and PD-L1 blocking antibodies (Figure 11, panel L). In addition, other chimeric fusion protein constructs including PD1-Fc-GITRL, PD1-Fc-41BBL and PD1-Fc- 625 Date ReQue/Date Received 2023-02-27 WO 2017/059168 aa 02999280 20X8-03-20 PCT/US2016/054598 TL1A were all shown to exhibit delayed tumor growth an regression in the CT26 model (Figure 11, panel L).

Altogether, these data dearly demonstrate, inter alia, the functional activity of mPD-1-Fc-OX40L in vivo.

Example 3. Construction and Characterization of Human PD-1-Fc-QX40L A human PD-1-Fc-OX40L comprising human PD-1 linked to OX40L via a hinge-CH2-CH3 Fc domain derived from the human immunoglobulin 4 (lgG4) antibody was constructed. This construct was referred to as SL-279252.

The mRNA sequence of human OX40L was as follows: 1 TCAATCGCCT TTTATCTCTG GCCCTGGGAC CTTTGCCTAT TTTCTGATTG ATAGGCTTTG 61 TTTTGTCTTT ACCTCCTTCT TTCTGGGGAA AACTK AGTT TTATCGCACG TTCCCCTTTT 121 CCATATCTTC ATCTTCCCTC TACCCAGATT GTGAAGATGG AAAGGGTCCA ACCCCTGGAA 181 GAGAATGTGG GAAATGCAGC CAGGCCAAGA TTCGAGAGGA ACAAGCTATT GCTGGTGGCC 241 TCTGTAATTC AGGGACTGGG GCTGCTCCTG TGCTTCACCT ACATCTGCCT GCACTTCTCT 301 GCTCTTCAGG TATCACATCG GTATCCTCGA ATTCAAAGTA TCAAAGTACA ATTTACCGAA 361 TATAAGAAGG AGAAAGGTTT CATCCTCACT TCCCAAAAGG AGGATGAAAF CATGAAGGTG 421 CAGAACAAC1 CAGTCAICAFCAACTCIGAf GGG1 HTA1C FCATCfCCCI GAAGGGCTAC 481 TTCTCCCAGG AAGTCAACAT TAGCCTTCAT TACCAGAAGG ATGAGGAGCC CCTCTTCCAA 541 CTGAAGAAGG TCAGGTCTGT CAACTCCTTG ATGG IGGCCF CTC1GACTTA CAAAGACAAA 601 GTCTACUGAAfGTGACCAC IGACAAFACC ICCCIGGATG ACTTCCATGT GAAIGGCGGA 661 GAACTGATTC TTATCCATCA &AATCCTGGT GAATTCTGTG TCCTTTGAGG GGCTGATGGC 721 AATATCTAAA ACCAGGCACC AGCATGAACA CCAAGCTGGG GGTGGACAGG GCATGGATTC 781 TTCATTGCAA GTGAAGGAGC CTCCCAGCTC AGCCACGTGG GATGTGACAA GAAGCAGATC 841 CTGGCCCTCC CGCCCCCACC CCTCAGGGAT ATTTAAAACT TATTTTATAT ACCAGTTAAT 901 CTTATTTATC CTTATATTTT CTAAATTGCC TAGCCGTCAC ACCCCAAGAT TGCCTTGAGC 961 CTACTAGGCA CCTTTGTGAG AAAGAAAAAA TAGATGCCTC TTCTTCAAGA TGCATTGTTT 1021 CTATTGGTCA GGCAATTGTC ATAATAAACT TATGTCATTG AAAACGGTAC CTGACTACCA 1081 TTTGCTGGAA ATTTGACATG TGTGTGGCAT TATCAAAATG AAGAGGAGCAAGGAGTGAAG 1141 GAGTGGGGTT ATGAATCTGC CAAAGGTGGT ATGAACCAAC CCCTGGAAGC CAAAGCGGCC 1201 TCTCCAAGGT TAAATTGATT GCAGTTTGCA TATTGCCTAA ATTTAAACTT TCTCATTTGG 1261 TGGGGGTTCA AAAGAAGAAT CAGCTTGTGA AAAATCAGGA CTTGAAGAGA GCCGTCTAAG 1321 AAATACCACG TGCTTTTTTT CTTTACCATT TTGCTTTCCC AGCCTCCAAA CATAGTTAAT 1381 AGAAATTTCC CTTCAAAGAA CTGTCTGGGG ATGTGATGCT TTGAAAAATC TAATCAGTGA 1441 CTTAAGAGAG ATTTTCTTGT ATACAGGGAG AGTGAGATAA CTTATTGTGA AGGGTTAGCT 1501 TTACTGTACA GGATAGCAGG GAACTGGACA TCTCAGGGTA AAAGTCAGTA CGGATTTTAA 1561 TAGCCTGGGG AGGAAAACAC ATTCTTTGCC ACAGACAGGC AAAGCAACAC ATGCTCATCC 1621 TCCTGCCTAT GCTGAGATAC GCACTCAGCT CCATGTCTTG TACACACAGA AACATTGCTG 1681 GTTTCAAGAA ATGAGGTGAT CCTATTATCA AATTCAATCT GATGTCAAAT AGCACTAAGA 1741 AGTTATTGTG CCTTATGAAA AATAATGATC TCTGTCTAGA AATACCATAG ACCATATATA 1801 GTCTCACATT GATAATTGAA ACTAGAAGGG TCTATAATCA GCCTATGCCA GGGCTTCAAT 1861 GGAATAGTAT CCCCTTATGT TTAGTTGAAA TGTCCCCTTA ACTTGATATA ATGTGTTATG 1921 CTTATGGCGC TGTGGACAAT CTGATTTTTC ATGTCAACTT TCCAGATGAT TTGTAACTTC 1981 TCTGTGCCAA ACCTTTTATA AACATAAATT TTTGAGATAT GTATTTTAAA ATTGTAGCAC 2041 ATGTTTCCCT GACATTTTCA ATAGAGGATA CAACATCACA GAATCTTTCT GGATGATTCT 2101 GTGTTATCAAGGAATTGTAC TGTGCTACAA TTATCTCTAG AATCTCCAGA AAGGTGGAGG 2161 GCTGTTCGCC CTTACACTAA ATGGTCTCAG TTGGATTTTT TTTTCCTGTT TTCTATTTCC 2221 TCTTAAGTAC ACCTTCAACT ATATTCCCAT CCCTCTATTT TAATCTGTTA TGAAGGAAGG 2281 TAAATAAAAA TGCTAAATAG AAGAAATTGT AGGTAAGGTA AGAGGAATCA AGTTCTGAGT 635 Date ReQue/Date Received 2023-02-27 WO 2017/059168 O& 02999280 20X8-03-20 PCT/US2016/054598 2341 GGCTGCCAAG GCACTCACAG AATCATAATC ATGGCTAAAT ATTTATGGAG GGCCTACTGT 2401 GGACCAGGCA CTGGGCTAAA TACTTACATT TACAAGAATC ATTCTGAGAC AGATATTCAA 2461 TGATATCTGG CTTCACTACT CAGAAGATTG TGTGTGTGTT TGTGTGTGTG TGTGTGTGTG 2521 TATTTCACTT TTTGTTATTG ACCATGTTCT GCAAAATTGC AGTTACTCAG TGAGTGATAT 2581 CCGAAAAAGT AAACGTTTAT GACTATAGGT AATATTTAAG AAAATGCATG GTTCATTTTT 2641 AAGTTTGGAA TTTTTATCTA TATTTCTCAC AGATGTGCAG TGCACATGCA GGCCTAAGTA 2701 TATGTTGTGT GTGTTGTTTG TCTTTGATGT CATGGTCCCC TCTCTTAGGT GCTCACTCGC 2761 TTTGGGTGCACCTGGCCTGC TCTTCCCATG TTGGCCTCTG CAACCACACA GGGATATTTC 2821 TGCTATGCAC CAGCCTCACT CCACCTTCCT TCCATCAAAA ATATGTGTGT GTGTCTCAGT 2881 CCCTGTAAGT CATGTCCTTC ACAGGGAGAA TTAACCCTTC GATATACATG GCAGAGTTTT 2941 GTGGGAAAAG AATTGAATGA AAAGTCAGGA GATCAGAATT TTAAATTTGA CTTAGCCACT 3001 AACTAGCCAT GTAACCTTGG GAAAGTCATT TCCCATTTCT GGGTCTTGCT TTTCTTTCTG 3061 TTAAATGAGA GGAATGTTAA ATATCTAACA GTTTAGAATC TTATGCTTAC AGTGTTATCT 3121 GTGAATGCAC ATATTAAATG TCTATGTTCT TGTTGCTATG AGTCAAGGAG TGTAACCTTC 3181 TCCTTTACTA TGTTGAATGT ATTTTTTTCT GGACAAGCTT ACATCTTCCT CAGCCATCTT 3241 TGTGAGTCCT TCAAGAGCAG TTATCAATTG TTAGTTAGAT ATTTTCTATT TAGAGAATGC 3301 TTAAGGGATT CCAATCCCGA TCCAAATCAT AATTTGTTCT TAAGTATACT GGGCAGGTCC 3361 CCTATTTTAA GTCATAATTT TGTATTTAGT GCTTTCCTGG CTCTCAGAGA GTATTAATAT 3421 TGATATTAAT AATATAGTTA ATAGTAATAT TGCTATTTAC ATGGAAACAA ATAAAAGATC 3481 TCAGAATTCACTA (SEQ ID N0:16) The amino acid sequence of human OX40L was as follows (shaded- extracellular domain): MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYP RIQSlKVQFTEYKKEKGFlLTSQKEDEiMKVQNNSVIJNCDGFYLlSLKGYFSQEVNISL HYQKDEEPLFQLKKVRSVNSLUVASLTYK0KVYLNVTTDNTSLWFHVNGGELIL1H QNPGEFCVL (SEQ ID NO:17) The nucleic acid sequence of the hinge-CH2-CH3 Sequence from human lgG4 was as follows: TCTAAGTACGGCCCTCCCTGCCCTAGCTGTCCCGCCCCTGAATTTCTGGGCGGA CCCTCCGTGTTTCTGTTCCCCCCAAAGCCCAAGGACACCCTGATGATCAGCCGG ACCCCCGAAGTGACCTGTGTGGTGGTGGATGTGTCCCAGGAAGATCCCGAGGT GCAGTTCAATTGGTACGTGGACGGGGTGGAAGTGCACAACGCCAAGACCAAGC CCAGAGAGGAACAGTTCAACAGCACCTACCGGGTGGTGTCTGTGCTGACCGTG CTGCACCAGGATTGGCTGAGCGGCAAAGAGTACAAGTGCAAGGTGTCCAGCAA GGGCCTGCCCAGCAGCATCGAAAAGACCATCAGCAACGCCACCGGCCAGCCCA GGGAACCCCAGGTGTACACACTGCCCCCTAGCCAGGAAGAGATGACCAAGAAC CAGGTGTCCCTGACATGCCTCGTGAAGGGCTTCTACCCCTCCGATATCGCCGTG GAATGGGAGAGCAACGGCCAGCCAGAGAACAACTACAAGACCACCCCCCCAGT GCTGGACAGCGACGGCTCATTCTTCCTGTACTCCCGGCTGACAGTGGACAAGAG CAGCTGGCAGGAAGGCAACGTGTTCAGCTGCAGCGTGATGCACGAAGCCCTGC ACAACCACTACACCCAGAAGTCCCTGAGCCTGTCCCTGGGCAAA (SEQ ID NO:18) The cDNA sequence of human PD-1 was as follows: 645 Date ReQue/Date Received 2023-02-27 O& 02999280 20X8-03-20 ATGCAGATCCCACAGGCGCCCTGGCCAGTCGTCTGGGCGGTGCTACAACTGGG CTGGCGGCCAGGATGGTTCTTAGACTCCCCAGACAGGCCCTGGAACCCCCCCA CCTTCTCCCCAGCCCTGCTCGTGGTGACCGAAGGGGACAACGCCACCTTCACCT GCAGCTTCTCCAACACATCGGAGAGCTTCGTGCTAAACTGGTACCGCATGAGCC CCAGCAACCAGACGGACAAGCTGGCCGCCTTCCCCGAGGACCGCAGCCAGCCC GGCCAGGACTGCCGCTTCCGTGTCACACAACTGCCCAACGGGCGTGACTTCCA CATGAGCGTGGTCAGGGCCCGGCGCAATGACAGCGGCACCTACCTCTGTGGGG CCATCTCCCTGGCCCCCAAGGCGCAGATCAAAGAGAGCCTGCGGGCAGAGCTC AGGGTGACAGAGAGAAGGGCAGAAGTGCCCACAGCCCACCCCAGCCCCTCACC CAGGCCAGCCGGCCAGTTCCAAACCCTGGTGGTTGGTGTCGTGGGCGGCCTGC TGGGCAGCCTGGTGCTGCTAGTCTGGGTCCTGGCCGTCATCTGCTCCCGGGCC GCACGAGGGACAATAGGAGCCAGGCGCACCGGCCAGCCCCTGAAGGAGGACC CCTCAGCCGTGCCTGTGTTCTCTGTGGACTATGGGGAGCTGGATTTCCAGTGGC GAGAGAAGACCCCGGAGCCCCCCGTGCCCTGTGTCCCTGAGCAGACGGAGTAT GCCACCATTGTCTTTCCTAGCGGAATGGGCACCTCATCCCCCGCCCGCAGGGG CTCAGCTGACGGCCCTCGGAGTGCCCAGCCACTGAGGCCTGAGGATGGACACT GCTCTTGGCCCCTCTGA (SEQ ID N0:19) The nucleic acid sequence of human PD-1-Fc-OX40L was as follows: GTCGACGCCACCATGCAGATCCCACAGGCGCCCTGGCCAGTCGTCTGGGCGGT GCTACAACTGGGCTGGCGGCCAGGATGGTTCTTAGACTCCCCAGACAGGCCCT GGAACCCCCCCACCTTCTCCCCAGCCCTGCTCGTGGTGACCGAAGGGGACAAC GCCACCTTCACCTGCAGCTTCTCCAACACATCGGAGAGCTTCGTGCTAAACTGG TACCGCATGAGCCCCAGCAACCAGACGGACAAGCTGGCCGCCTTCCCCGAGGA CCGCAGCCAGCCCGGCCAGGACTGCCGCTTCCGTGTCACACAACTGCCCAACG GGCGTGACTTCCACATGAGCGTGGTCAGGGCCCGGCGCAATGACAGCGGCACC TACCTCTGTGGGGCCATCTCCCTGGCCCCCAAGGCGCAGATCAAAGAGAGCCT GCGGGCAGAGCTCAGGGTGACAGAGAGAAGGGCAGAAGTGCCCACAGCCCAC CCCAGCCCCTCACCCAGGCCAGCCGGCCAGTTCCAATCTAAGTACGGCCCTCC CTGCCCTAGCTGTCCCGCCCCTGAATTTCTGGGCGGACCCTCCGTGTTTCTGTT CCCCCCAAAGCCCAAGGACACCCTGATGATCAGCCGGACCCCCGAAGTGACCT GTGTGGTGGTGGATGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAATTGGTACG TGGACGGGGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTC AACAGCACCTACCGGGTGGTGTCTGTGCTGACCGTGCTGCACCAGGATTGGCT GAGCGGCAAAGAGTACAAGTGCAAGGTGTCCAGCAAGGGCCTGCCCAGCAGCA TCGAAAAGACCATCAGCAACGCCACCGGCCAGCCCAGGGAACCCCAGGTGTAC ACACTGCCCCCTAGCCAGGAAGAGATGACCAAGAACCAGGTGTCCCTGACATGC 655 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 CTCGTGAAGGGCTTCTACCCCTCCGATATCGCCGTGGAATGGGAGAGCAACGG CCAGCCAGAGA^^ CAncnCCTGTACICCCGGCT^ ACGTGTTCAGCTGCA^^ AGTCCCTGAGCCTGTCCCTGGGCAAAATAGAGGGACGAATGGACcaaatatcacatc ggtatcctcgaattcaaagtatcaaagtacaatttaccgaatataagaaggagaaaggtttcatcctcacttccc aaaaggaggatgaaatcatgaaggtgcagaacaactcagtcatcatcaactgtgatgggttttatctcatctcc ctgaagggctacttctcccaggaagteaacattagccttcattaccagaaggatgaggagcccctcttccaac tgaagaaggtcaggtctgtcaactccttgatggtggcctctctgacttacaaagacaaagtctacttgaatgtga ccactgacaatacctccctggatgacttccatgtgaatggcggagaactgattcttatccatcaaaatcctggt gaattctgtgtccttTGAGTCGAC (SEQ ID NO:20) The sequence was codon optimized for expression by Chinese Hamster (CHO) cells as follows: CACCGGCGAGATCTGCCACCATGCAGATCCCTCAGGCCCCCTGGCCTGTCGTG TGGGCTGTGCTGCAGCTGGGATGGCGGCCTGGCTGGTTCCTGGACTCTCCTGA CAGACCCTGGAACCCCCCCACCTTTAGCCCTGCTCTGCTGGTCGTGACCGAGG GCGACAACGCCACCTTCACCTGTTCCTTCAGCAACACCTCCGAGTCCTTCGTGC TGAACTGGTACAGAATGTCCCCCAGCAACCAGACCGACAAGCTGGCCGCCTTCC CCGAGGATAGATCCCAGCCTGGACAGGACTGCCGGTTCAGAGTGACCCAGCTG CCCAACGGCCGGGACTTCCACATGTCTGTCGTGCGGGCCAGACGGAACGACTC CGGCACATATCTGTGCGGCGCCATCTCCCTGGCCCCCAAGGCTCAGATCAAAGA GTCTCTGCGGGCCGAGCTGAGAGTGACCGAGAGAAGGGCTGAGGTGCCAACC GCCCACCCTAGCCCATCTCCAAGACCTGCCGGCCAGTTCCAGTCTAAGTACGGC CCTCCTTGCCCTAGCTGCCCTGCCCCTGAATTTCTGGGCGGACCCTCCGTGTTC CTGTTCCCCCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCCGAAGTG ACCTGCGTGGTGGTGGATGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAATTG GTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAAC AGTTCAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATT GGCTGTCCGGCAAAGAGTACAAGTGCAAGGTGTCCTCCAAGGGCCTGCCCTCC AGCATCGAAAAGACCATCTCTAACGCCACCGGCCAGCCCCGGGAACCCCAGGT GTACACACTGCCTCCAAGCCAGGAAGAGATGACCAAGAACCAGGTGTCCCTGAC CTGTCTCGTGAAGGGCTTCTACCCCTCCGATATCGCCGTGGAATGGGAGTCCAA CGGCCAGCCTGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACTCCGACG GCTCCTTCTTCCTGTACTCCCGCCTGACCGTGGACAAGTCCTCCTGGCAGGAAG GCAACGTGTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCC AGAAGTCCCTGTCCCTGTCTCTGGGCAAGATCGAGGGCCGGATGGATCAGGTG TCACACAGATACCCCCGGATCCAGTCCATCAAAGTGCAGTTTACCGAGTACAAG 665 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 AAAGAGAAGGGATTCATCCTGACCTCCCAGAAAGAGGACGAGATCATGAAGGTG CAGAACAACTCCGTGATCATCAACTGCGACGGGTTCTACCTGATCTCCCTGAAG GGCTACTTCAGTCAGGAAGTGAACATCAGCCTGCACTACCAGAAGGACGAGGAA CCCCTGTTCCAGCTGAAGAAAGTGCGGAGCGTGAACTCCCTGATGGTGGCCTCT CTGACCTACAAGGACAAGGTGTACCTGAACGTGACCACCGACAATACCTCCCTG GACGACTTCCACGTGAACGGCGGCGAGCTGATCCTGATCCACCAGAACCCTGG CGAGTTCTGCGTGCTGTGACTCGAGGCTAGC (SEQ ID N0:21) According, the amino acid sequence of SL-279252 was as follows: MQIPQAPWPWWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLWTEGDNATFTCS FSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSV VRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQ SKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCWVDVSQEDPEVQFN WYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLSGKEYKCKVSSKGLPSSI EKTISNATGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSRLTVDKSSWQEGNVFSCSVMHEALHNHYTQKSLSLS LGKIEGRMDQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGF YLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNT SLDDFHVNGGELILIHQNPGEFCVL(SEQ ID NO:22) Alternatively, SL-279252 may include other signaling peptides such as those derived from human collagen V or human IgG heavy chain. Alternatively, SL-279252 may include one or more mutations in the Fc domain to increase stability or to increase binding affinity to FcRn, such as those previously described. The human PD-1-Fc-OX40L construct was imported into the protein tertiary prediction software RaptorX, to ensure proper folding of the three major domains (see Figure 12, panel A). The tertiary structures of each component (/.e., PD-1, Fc, and OX40L) adopted their native conformations within the larger macromolecule, suggesting that PD-1-Fc-OX40L would retain binding capability and molecular function of all domains. Next, the immunogenic probability of PD-1-Fc-OX40L was assessed using an in silico molecular modeling algorithm, cross-referenced to a T cell epitope database (ABZENA/ANTITOPE, Figure 12, panel B). Although all coding sequences were human, there was minimal potential for lead and linker sequences to elicit an immune response following treatment.

Further analysis was performed using the iTope antigen prediction technology in silico (ANTITOPE).

Based on this analysis, SL-279252 was predicted to have a ‘low-risk’ of immunogenicity because no identifiable T cell epitopes were detected. Accordingly, SL-279252 was expected to have low immunogenicity.

The codon-optimized DNA sequence of SL-279252 was then synthesized and directionally cloned into pcDNA3.4-hygro-mcs (THERMO FISHER) and pVITRO2-hygro-mcs (INVIVOGEN) expression vectors. 675 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 Vectors were then either transiently or stably transfected into CH0-K1 and 293T cells, and culture supernatants were purified using standard protein A agarose affinity chromatography. Human Fc/IgG ELISAs on eluted fractions (from stable transfection experiments) of purified protein show definitive peaks that align with the first major peak detected from a large-scale purification obtained from transient transfection experiments (Figure 13, panel A), indicating that successful production of SL-279252 can be achieved using routine protein purification techniques such as protein A.

To confirm that all three domains of SL-279252 are intact and recognizable by a protein detection assay, Western blot analysis was performed on purified fusion protein probing for human anti-PD-1, anti-Fc, and anti-OX40L (Figure 13, panel B). SL-279252 was detected by all three antibodies and when the protein was run under reducing conditions, migrated at approximately 75 kDa. Approximately 50% of the non-reduced protein ran as a dimer, which was a potential advantage, given the in vivo oligomerization associated with OX40/L signaling and function. The predicted molecular weight for SL- 279252 was 60.3 kDa. The reduced fraction of SL-279252 was detected at a higher molecular weight, which, without wishing to be bound by theory, may be due to glycosylation. This was verified by treating SL-279252 with a protein deglycosylase, PNGase F (Figure 13, panel B). Following deglycosylalion, the reduced fraction of SL-279252 migrated exactly at the predicted molecular weight of 60.3 kDa. This provided evidence that SL-279252 was co/post-translationally modified through glycosylation, which played essential roles in the proper folding and stability of proteins, and cell-to-cell adhesion (Dalziel M, Dwek RA. Science 2014, Maverakis E, Lebrilla CB. J Autoimmun. 2015).

Next, analysis was performed to determine whether SL-279252 was able to bind to its receptor/ligand targets using plate-immobilized recombinant proteins in functional ELISA assays, SL-279252 was successfully captured with recombinant human 0X40 (Figure 13, panel C), and detected with anti¬ human OX40L/anti-goat HRP. In this regard, the capture of SL-279252 with human 0X40, followed by detection with a two-step incubation with goat-anti-OX40L followed by anti-goat-HRP led to efficient detection. To establish whether both ends of SL-279252 could bind their respective receptor/ligand simultaneously, another ELISA assay was developed which captures SL-279252 using plate absorbed human PD-L1 and detects SL-279252 using recombinant OX40-his (Figure 13, panel D). This assay demonstrates that SL-279252 can simultaneously bind human PD-L1 and human 0X40.

Next, surface plasmon resonance (SPR) analysis was performed to determine the affinity by which SL- 279252 bound to hPD-L1, hPD-L1, hOX40 and various human Fc receptors (Figure 14). Specifically, polyhistidine-tagged versions of recombinant human PD-L1, PD-L2 and human 0X40 was bound to ProteOn HTG tris-NTA chips (BIORAD). SL-279252 was then flowed over the bound ligands over a time course and a relative index of 'on-rate’ (Ka) and ‘off-rate’ (Kd) was generated to calculate binding affinity (Kd) of SL-279252 to each partner. Recombinant human PD-1-Fc and OX40L-Fc were used as positive controls for binding. These controls have a relatively fast ‘on-rate’ and an equally fast ‘off-rate’, resulting in low nanomolar binding affinities. Consistent with these results, the ‘on-rate’ of SL-279252 to human 685 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 PD-L1 was rapid, however the ‘off-rate’ was much lower, in fact ~20-fold slower than the ‘off-rate’ of recombinant PD-1-Fc, indicating that SL-279252 bound quickly and stably, with long on-target residence time (Figure 14, panel A). The Ko of SL-279252 binding to human PD-L1 was calculated to be 2.08 nM, nearly identical to the observed Kd of BMS’s OPDIVO (~4 nM). The Ko of SL-279252 binding to human PD-L2 was calculated to be 1.24 nM (Figure 14, panel B). SL-279252 bound with high affinity to human 0X40 (246 pM), again with a fast ‘on-rate’ and slow ‘off-rate’ (Figure 14, panel C).

To further define the molecular characteristics of SL-279252, SPR was performed, analyzing the binding affinities of SL-279252 to chip-bound, Fey receptors FcyRIA and to the neonatal receptor, FcRn. The human immunoglobulin IgG1 was shown to bind with the highest affinities to FcyRIA, followed by FcRn, in addition to low-level binding to FcyR2b (Figure 14, panel C and D). SL-279252 did not bind to FcyRIA or FcyR2B, but did bind to FcRn at 73 nM affinity (Figure 14, panel D and E). Without wishing to be bound by theory, this binding characteristic may be important to the fusion protein because FcRn is involved in IgG recycling to the surface of a cell, thereby avoiding lysosomal degradation, and potentially extending the in vivo half-life of SL-279252. Summary data for SL-279252 binding affinities are including (Figure 14, panel F).

Next, surface plasmon resonance (SPR) analysis was performed to determine the affinity by which a mutated SL-279252 construct containing a collagen V leader peptide and Fc region mutations to increase binding to FcRn (named colPD1-FcRnOX40L ) was examined for binding to hPD-L1, hPD-L1, hOX40 and various human Fc receptors (Figure 14). Specifically, polyhistidine-tagged versions of recombinant human PD-L1, PD-L2 and human 0X40 was bound to ProteOn HTG tris-NTA chips (BIORAD). colPD1-FcRnOX40L was then flowed over the bound ligands over a time course and a relative index of ‘on-rate’ (Ka) and ‘off-rate’ (Kd) was generated to calculate binding affinity (Kd) of colPD1-FcRnOX40L to each partner. Recombinant human PD-1-Fc and OX40L-Fc were used as positive controls for binding. These controls have a relatively fast 'on-rate' and an equally fast ‘off-rate’, resulting in low nanomolar binding affinities. Consistent with these results, the ‘on-rate’ of colPDIFcRnOX40L to human PD-L1 was rapid, however the ‘off-rate’ was much lower, in fact —10-fold slower than the ‘off-rate’ of recombinant PD-1-Fc, indicating that colPD1-FcRnOX40L bound quickly and stably, with long on-target residence time (Figure 14, panel G). The Kd of colPD1-FcRnOX40L binding to human PD-L1 was calculated to be 6.35 nM, nearly identical to the observed Kd of BMS’s OPDIVO (~4 nM). The Kd of colPD1-FcRnOX40L binding to human PD-L2 was calculated to be 7.93 nM (Figure 14, panel H). colPD1-FcRnOX40L bound with high affinity to human 0X40 (9.61 nM), again with a fast ‘onrate’ and slow ‘off-rate’ (Figure 14, panel I).

To further define the molecular characteristics of colPD1-FcRnOX40L, SPR was performed, analyzing the binding affinities of colPD1-FcRnOX40L to chip-bound, Fey receptors FcyRIA and to the neonatal receptor, FcRn. The human immunoglobulin lgG1 was shown to bind with the highest affinities to 695 Date ReQue/Date Received 2023-02-27 aa 02999280 20X8-03-20 FcyRIA, followed by FcRn, in addition to low-level binding to FcyR2b (Figure 14, panel J and K). colPD1-FcRnOX40L did not bind to FcyRIA or FcyR2B, but did bind to FcRn at 2.51 nM affinity (Figure 14, panel K). Without wishing to be bound by theory, this binding characteristic may be important to the fusion protein because FcRn is involved in IgG recycling to the surface of a cell, thereby avoiding lysosomal degradation, and potentially extending the in vivo half-life of colPD1-FcRnOX40L Summary data for colPD1-FcRnOX40L binding affinities are including (Figure 14, panel L).

Additionally, the in vivo half-life of the purified SL-279252 was tested in C57BL/6 mice by injecting 200 pg of the protein by intra-peritoneal injection. Blood was then collected from treated animals by cardiac puncture at 10 minutes, 30 minutes, 1 hour, 3, 6, 12 and 24 hours and allowed to clot for 2 hours at room temperature. The serum was then assayed using a human IgG or OX40L specific ELISA as outlined ebove. As shown in Figure 14, panel M, the serum half-life of SL-279252 in mice following a single injection of 200 pg of protein was determined to be between 7-15 hours. It is anticipated that constructs containing mutations to increase binding affinity to FcRn will lead to longer half-life in vivo.

The slow off-rates detected by SPR suggested that SL-279252 may have a longer on-target (/.e. intratumoral) half-life than serum half life. To investigate this question, immunocompromised NSG mice were implanted with a PD-L1 negative HeLa (human cervical cancer) tumor on one flank, and with a PD-L1 expressing HeLa tumor on the opposite flank. Mice were treated with single injections of 200 pg of SL-279252 and individual mice were sacrificed at defined time points. At the time of sacrifice, both HeLa tumors were excised and bisected. Half of the tumor was dissociated and analyzed for SL-279252 binding by flow cytometry. This analysis demonstrated that SL-279252 accumulated specifically in PDL1 positive, but not PD-L1 negative tumors. The concentration of SL-279252 was observed to increase in the tumor up to 48 hours post treatment (Figure 14, panel N). Further, immunohistochemical analysis of the other half of each tumor demonstrated that significant staining for human OX40L was present 5 days post treatment, suggesting that SL-279252 was detectable in PD-L1 positive human tumors at least 5 days following a single treatment (Figure 14, panel O).

Example 4. Additional Functional Characterization of Human PD-1-Fc-QX40L The previous data indicated that SL-279252 binds to immobilized targets at low nanomolar affinities and was detectable by multiple protein assays. Additional analysis was carried out to determine whether SL- 279252 could bind its targets on the surface of living cells in vitro. To assess SL-279252 binding to the human 0X40 receptor, the human AML T cell line Jurkat was engineered to overexpress 0X40, creating Jurkat/hOX40 cells (verified by flow cytometry; Figure 15, panel A). To assess binding to PDL1, the Chinese hamster ovary cell line, CHO-K1, which does not express human PD-L1, was transfected to stably express human PD-L1 (Figure 15, panel B). To assess binding to human CD47, CHO-K1 cells were transfected to stably express human CD47 (Figure 15, panel C). 705 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 CH0-K1 or CH0-K1-PD-L1 cells were then treated with increasing amounts of SL-279252 and analyzed by flow cytometry for the detection of the human OX40L domain using anti-human OX40L-APC antibodies. SL-279252 did not bind to parental CHO-K1 cells since they expressed no detectable human PD-L1. However, nearly the entire population of CH0-K1-PD-L1 cells shifted significantly, indicating that the human PD1 component of SL-279252 was capable of binding its receptor on living cells (Figure 15, panel D). Jurkat or Jurkat/OX40 cells were then treated with increasing amounts of SL- 279252 and analyzed by flow cytometry for detection of the human OX40L domain using anti-human OX40L-APC antibodies. SL-279252 did not bind parental Jurkat cells with high efficiency, since they express low amounts of human 0X40. However, nearly the entire population of Jurkat/OX40 cells shifted significantly, indicating that the human OX40L component of SL-279252 was capable of binding its receptor on living cells (Figure 15, panel E).

To investigate binding of another chimeric fusion protein, human CD172a-Fc-OX40L, CHO-K1 orCHOK1-CD47 cells were then treated with increasing amounts of CD172a-Fc-OX40L and analyzed by flow cytometry for the detection of the human OX40L domain using anti-human OX40L-APC antibodies.

CD172a-Fc-OX40L did not bind to parental CHO-K1 cells since they expressed no detectable human CD47. However, nearly the entire population of CH0-K1-PD-L1 cells shifted significantly, indicating that the human CD172a component of CD172a-Fc-OX40L was capable of binding its receptor on living cells (Figure 15, panel F). Jurkat or Jurkat/OX40 cells were then treated with increasing amounts of CD172aFc-OX40L and analyzed by flow cytometry for detection of the human OX40L domain using anti-human OX40L-APC antibodies. CD172a-Fc-OX40L did not bind parental Jurkat cells with high efficiency, since they express low amounts of human 0X40. However, nearly the entire population of Jurkat/OX40 cells shifted significantly, indicating that the human OX40L component of CD172a-Fc-OX40L was capable of bindingits receptor on living cells (Figure 15, panel G).

Additionally, a number of human tumor cell lines were screened for differing levels of endogenous human PD-L1 expression by flow cytometry. A prostate cancer cell line (PC3) as PD-L1iow and a lung adenocarcinoma cell line (HCC827) as PD-L1hlgh were identified (Figure 15, panel H). The PC3 and HCC827 cells were incubated with increasing amounts of SL-279252, and binding was detected using flow cytometry. SL-279252 did not bind to PC3 cells (PD-L1i0W) efficiently (Figure 15, panel I). However, SL-279252 bound significantly to HCC827 cells (PD-L1high) in a concentration dependent manner (Figure 15, panel J). This dearly indicated that SL-279252 could bind both human 0X40 and PD-L1 expressed on the cell surface, which provided compelling evidence for its dual binding functionality.

To expand upon these results, experiments were performed SL-279252 binding to primary T cells isolated from peripheral blood mononuclear cells (PBMCs), induced for 2 days ex vivo with a chemical combination known to stimulate 0X40 expression (phorbol 12-myristate 13-acetate; PMA, phytohemagglutinin; PHA, and lonomydn). As expected, a large increase in 0X40 expression on CD4+ and CD8+T cells was observed following PMA/PHA/lon treatment (Figure 16, panel A). Binding of SL- 715 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 279252 to CD4+ and CD8+ cells was confirmed using the methods described above (Figure 16, panel B). It wasnoted that SL-279252 bound efficiently to human T cells (both CD4+ and CD8+).

A T cell activation/lL2 release assay was utilized to assess the extent that PD-L1 expression on tumor cells inhibited T cell secretion of the anti-tumorigenic cytokine IL2 when the cells were co-cultured (Figure 16, panel C). After 2 days, activated T cells were plated on irradiated PD-L1|OW (PC3) and PDLlhigh (HCC827) expressing cancer cell lines in the presence or absence of SL-279252. Various readouts of T cell activation were assessed for up to 1 week following initial T cell isolation, including IL2 secretion (Figure 16 panel D), proliferation and cytokine expression (Figure 16, panel E). Baseline levels of IL2 secretion (in the absence of SL-279252) were significantly higher in PD-L1iow PC3 co¬ cultures than with PD-L1hi8h HCC827 cells 6 days after T cell isolation, suggesting that tumor PD-L1 expression either directly or indirectly suppressed the further activation of T cells, as determined by IL2 secretion (Figure 16, panel D). The addition of SL-279252 to both PC3 and HCC827 co-cultures increased the IL2 secretion in a concentration dependent manner. Specifically, the observed increase in IL-2 from HCC827 co-cultures (PD-L1hign) from baseline (no SL-279252) to 5 ug/mL of SL-279252 was 1.92-fold, compared to 1.27-fold when co-cultured with PC3 cells (PD-L1iow).

Furthermore, additional characteristics of T cell activation were analyzed, including expression of the proliferation marker Ki67 (Figure 16, panel E; top). Co-culture of activated T cells with PD-L1hrgh HCC827 cells inhibited proliferation as compared to the level observed in the absence of HCC827 cells (black line). The addition of SL-279252 to the co-culture increased Ki67 staining in both CD4+ and CD8+ T cells. Moreover, activated T cells expressed higher levels of the cytokines IFNy and TNFa when co-cultured on HCC827 cells than when T cells were cultured alone, possibly due to the secretion of other stimulatory factors by the tumor cells (Figure 16, panel E; bottom). The expression of these cytokinesincreased significantly following treatment with SL-279252.

Altogether these data demonstrate, inter alia, that SL-279252 bound tightly to its partners PD-L1 and 0X40 and was able to reverse PD-L1 mediated T cell inhibition by PD-L1 positive human tumor cells in vitro.

Example 5. Construction and Characterization of Additional Chimeric Proteins Additional constructs were generated which include: additional human PD-1-Fc-OX40L constructs as well as human hCD172a-Fc-OX40L, hPD1-Fc-TL1A, hBTLA-Fc-OX40L, hTMIGD2-Fc-OX40L, hTIM3- FC-OX40L, mPD1-Fc-GITRL, mPD1-Fc-41BBL, mPD1-Fc-TL1A, mCD172a-Fc-CD40L, hTIGIT-FcOX40L and canine PD-1-Fc-OX40L. Each of these constructs was codon optimized for expression in Chinese Hamster Ovary (CHO) cells, transfected into CHO cells and individual clones were selected for high expression. High expressing clones were then used for small-scale manufacturing in stirred bioreactors in serum-free media and the relevant chimeric fusion proteins were purified with Protein A binding resin columns. Figure 17, panel A shows a Western blot characterization of various chimeric 725 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 proteins including hCD172a-Fc-OX40L, hPD1-Fc-TL1A, hBTLA-Fc-OX40L, hTMIGD2-Fc-OX40L, hTIM3-Fc-OX40L, mPD1-Fc-GITRL, mPD1-Fc-41BBL, mPD1-Fc-TL1A, mCD172a-Fc-CD40L, hTIGITFC-OX40L Binding assays were carried out to characterize the ability of the various human ECD-F&OX40L constructs to bind to hOX40. With respect to hXECD-Fc-OX40L, X refers to the ECD of each protein listed in the bracket on the left (with reference to Figure 17, panel B). Panel B of Figure 17 shows a schematic representation of the ELISA method used to detect binding of hXEco-Fc-OX40L to hOX40. Recombinant hOX40 fused to human Fc (hOX40-hFc) was used to capture hXEco-Fc-OX40L in the culture media.

Because the hOX40 fusion protein used to capture the target fusion proteins also contains a hlgG region, blocking was performed using a non-HRP conjugated anti-hlgG prior to incubation with the culture supernatants containing the target fusion proteins. A rabbit polyclonal antibody to hlgG was used to detect the hlgG domain in the chimeric protein and subsequently detected using a horseradish peroxidase (HRP)-conjugated polyclonal antibody to rabbit IgG (H+L).

The binding of SL-279252 to cell surface expressed 0X40 on Jurkat cells by flow cytometry was compared to two negative control proteins which are not expected to bind human 0X40. These data demonstrate that SL-279252 efficiently binds human 0X40 (left panel), while neither human PD1-FcTL1A or canine PD1-Fc-OX40L were observed to bind human 0X40 (Figure 17, panel C).

The human CD172a-Fc-OX40L construct was imported into the protein tertiary prediction software RaptorXto determine the tertiary structure. The predicted tertiary structure is shown in Figure 17, panel D.

The codon-optimized DNA sequence of several chimeric fusion proteins were synthesized and directionally cloned into pVITRO2, pcDNA3.4 and other expression vectors. Vectors were then either transiently or stably transfected into CHO or 293 cells and individual clones were selected for high expression. For example, SL-279252 was produced from a transient transfection from 293 cells, purified by affinity chromatography to Protein A columns and evaluated by Coomassie staining, Western blot and quantitated as compared to a BCG standard (Figure 17, panel E).

In another example, CD172a-Fc-OX40L was produced from a transient transfection from 293 cells, purified by affinity chromatography to Protein A columns and evaluated by Coomassie staining, Western blot and quantitated as compared to a BCG standard (Figure 17, panel F). In another example, CD172a-Fc-CD40L was produced from a transient transfection from 293 cells, purified by affinity chromatography to Protein A columns and evaluated by the Perkin Elmer LabChip system and quantitated as compared to a BCG standard (Figure 17, panel G). In another example, human TIGITFc-OX40L was produced from a transient transfection from 293 cells, purified by affinity chromatography to Protein A columns and evaluated by Coomassie staining, Western blot and quantitated as compared to a BCG standard (Figure 17, panel H). 735 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 The binding affinity of human CD172a-Fc-OX40L was evaluated by surface plasmon resonance (SPR) analysis to hCD47, hOX40 and various human Fc receptors (Figure 17, panels l-M). Specifically, polyhistidine-tagged versions of recombinant human CD47 and human 0X40 was bound to ProteOn HTG tris-NTA chips (BIORAD). CD172a-Fc-OX40L was then flowed over the bound ligands over a time course and a relative index of 'on-rate' (Ka) and ‘off-rate’ (Kd) was generated to calculate binding affinity (Kd) of CD172a-Fc-OX40L to each partner. Recombinant human CD47-Fc and OX40L-Fc were used as positive controls for binding. These controls have a relatively fast ‘on-rate’ and an equally fast ‘off-rate’, resulting in low nanomolar binding affinities. Consistent with these results, the ‘on-rate’ of CD172a-FcOX40L to human CD47 was rapid, however the ‘off-rate’ was much lower, in fact ~40-fold slower than the ‘off-rate’ of recombinant CD47-Fc, indicating that CD172a-Fc-OX40L bound quickly and stably, with long on-target residence time (Figure 17, panel I). The Kd of CD172a-Fc-OX40L binding to human CD47 was calculated to be 3.59 nM. CD172a-Fc-OX40L bound with high affinity to human 0X40 (869 pM), egain with a fast ‘on-rate’ and slow ‘off-rate’ (Figure 17, panel J).

To further define the molecular characteristics of CD172a-Fc-OX40L, SPR was performed, analyzing the binding affinities of CD172a-Fc-OX40L to chip-bound, Fey receptors FcyRIA and to the neonatal receptor, FcRn. The human immunoglobulin lgG1 was shown to bind with the highest affinities to FcyRIA, followed by FcRn, in addition to low-level binding to FcyR2b (Figure 17, panel K and L).

CD172a-Fc-OX40L did not bind to FcyRIA or FcyR2B, but did bind to FcRn at 790 nM affinity (Figure 17, panel L). Without wishing to be bound by theory, this binding characteristic may be important to the fusion protein because FcRn is involved in IgG recycling to the surface of a cell, thereby avoiding lysosomal degradation, and potentially extending the in vivo half-life of CD172a-Fc-OX40L. Summary data for CD172a-Fc-OX40L binding affinities are including (Figure 17, panel M).

The codon-optimized DNA sequence of several additional chimeric fusion proteins were synthesized and directionally cloned into pVITRO2, pcDNA3.4 and other expression vectors. Vectors were then either transiently or stably transfected into CHO or 293 cells and individual clones were selected for high expression. For example, canine PD1-Fc-OX40L was produced from a transient transfection from 293 cells, purified by affinity chromatography to Protein A columns and evaluated by Coomassie staining, Western blot and quantitated as compared to a BCG standard (Figure 17, panel N). In another example, mouse PD1-Fc-OX40L was produced from a transient transfection from 293 cells, purified by affinity chromatography to Protein A columns and evaluated by Coomassie staining, Western blot and quantitated as compared to a BCG standard (Figure 17, panel 0). In another example, mouse PD1-FcGITRL was produced from a transient transfection from 293 cells, purified by affinity chromatography to Protein A columns and evaluated by Coomassie staining, Western blot and quantitated as compared to a BCG standard (Figure 17, panel P). In another example, mouse PD1-Fc-41BBL was produced from a transient transfection from 293 cells, purified by affinity chromatography to Protein A columns and evaluated by Coomassie staining, Western blot and quantitated as compared to a BCG standard 745 Date ReQue/Date Received 2023-02-27 CA 02999280 20X8-03-20 (Figure 17, panel Q). In another example, mouse PD1-Fc-TL1A was produced from a transient transfection from 293 cells, purified by affinity chromatography to Protein A columns and evaluated by Coomassie staining, Western blot and quantitated as compared to a BCG standard (Figure 17, panel R). In yet another example, CD115-Fc-CD40L was produced from a transient transfection from 293 cells, purified by affinity chromatography to Protein A columns and evaluated by Coomassie staining, Western blot and quantitated as compared to a BCG standard (Figure 17, panel S).

Each purified protein is characterized by ELISA assays to bind to the marker, e.g. the intended inhibitory ligand as well as the intended costimulatory receptor. For example, to test the binding of purified human PD-1-Fc-OX40L, recombinant PD-L1-Fc is adsorbed to microtiter plates and used to capture PD-1-FcOX40L Any bound PD-1-Fc-OX40L is then detected by using recombinant human OX40-Fc linked to biotin, which is then detected in a chromogenic assay through binding with streptravidin-HRP.

In addition, each purified protein has been characterized by flow cytometry to bind the intended inhibitory ligand as well as the intended costimulatory receptor. For example, human tumor cell lines are characterized for endogenous expression of PD-L1, which was found to be particularly abundant on several human melanoma tumor cell lines. These same tumor cell lines were shown to be negative for human OX40L Following incubation with PD-1-Fc-OX40L, any bound chimeric fusion protein is detected with human OX40L specific antibodies. Similarly, human Jurkat cells were transfected with human 0X40 and shown to be negative for human PD-L1. Following incubation with the chimeric PD-1- Fc-OX40L constructs, any bound complex is detected using anti-human PD-L1 specific antibodies. A series of screening cell lines were generated in order to detect specific cell surface binding of each chimeric fusion protein to its respective receptor/ligand, these included: CHO-K1-CD47, CHO-K1-PDL1, CHO-K1-HVEM, CH0-K1-HHLA2, CH0-K1-VISTA, CHO-K1-Gal9, HeLa-PD-L1, HeLa-CD47, HeLa-HVEM, HeLa-HHLA2, HeLa-VISTA, HeLa-Gal9.

To determine the functional activity of each receptor, in vitro T cell proliferation assays are performed in the presence of inhibitory ligand positive human tumor cells. For example, human melanoma tumor cells expressing PD-L1 are pulsed with peptides specific for hen egg lysozyme (HEL) and incubated with human HEL specific T cells expressing 0X40 receptor. The proliferation of these cells is monitored in the presence and absence of the PD-1-Fc-OX40L construct and found to be functionally responsive to the presence of the chimeric constructs. In a similar system, human tumors expressing HVEM, CD47, galectin-9, TIGIT receptors or TMIGD2 receptors are used.

In some experiments, mouse PD-1-Fc-OX40L or mouse PD-1-Fc-TL1A are used to treat murine tumors known to be positive for murine PD-L1 (including B16-F10 melanoma, MC38 colon carcinoma and CT26 colon carcinoma). In these systems, established tumors are treated with purified chimeric fusion proteins as compared to PD-1-Fc fusion proteins, anti-PD-1 or anti-PD-L1 monoclonal antibodies or anti-OX40 or anti-GITR monoclonal antibodies. In these experiments, the activity of the chimeric 75CA 02999280 2018-03-20 constructs is observed to lead to enhanced antigen-specific T cell responses and increased rates of tumor rejection as compared to the individual therapeutics. In some experiments, nucleic acid constructs encoding PD-1-Fc-OX40L or PD-1-Fc-TL1A are directly electroporated into established tumors. In these experiments, the chimeric constructs are shown to lead to increased rates of tumor 5 rejection as well as increased tumor antigen specific CD8+ T cell proliferation detected both in the peripheral blood and within established tumors.

To determine the binding of purified chimeric fusion proteins to human tumor explants, fresh frozen human tumor samples are obtained and incubated with each chimeric fusion protein. Any bound fusion protein is detected with anti-human OX40L and controlled against background staining by separate 1o stainingwith anti-human OX40L.

To determine the molecular characteristics of each fusion protein, purified chimeric fusion proteins are characterized by size exclusion chromatography. This analysis is important because, for example, the OX40L ECD is known to form a homo-trimer, while the Fc region is known to form a homo-dimer, while the inhibitory ligand binding receptor may either be monomeric (e.g. PD-1) or form homo-multimers (e.g. 15 TIM3). Thus, there are several possibilities for the individual species that may be formed by these chimeric constructs. Further molecular characterization by mass spec, thermal stability, pH stability, physical stability, charge profile, hydrophobicity, physical stability, buffer compatibility and solubility up to 100 mg/mL are also performed. 76 Date ReQue/Date Received 2023-02-27Date ReQue/Date Received 2023-02-27 TABLE 1 Illustrative human Type I proteins which may be incorporated into the present compositions and methods include (as used herein “Entry” refers to the human TypeI protein entry in the Uniprot database and "Entry name’ refers to the human Type I protein entry in the Uniprot database).

Entry Entry name Protein names Gene names Length P04439 1A03_HUMAN HLA classI histocompatibility antigen, A-3 alpha chan (MHC classI antigen A*3) HLA-AHLAA 365 P30456 1A43_HUMAN HLA class I histocompatibility antigen, A-43 alpha chain (Aw-43) (MHC classI antigen A*43) HLA-AHLAA 365 P10316 1A69_HUMAN HLA class I histocompatibility antigen, A-69 alpha chain (Aw-69) (HLA classI histocompatibility antigen, A-28 alpha chain) (MHC classI antigen A*69) HLA-AHLAA 365 P30460 1B08_HUMAN HLA classI histocompatibility antigen, B-8 alpha chan (MHC classI antigen B*8) HLA-B HLAB 362 Q95365 1B38_HUMAN HLA classI histocompatibility antigen, B-38 alpha chain (Bw-4) (MHC class I antigen B*38) HLA-B HLAB 362 P18464 1B51_HUMAN HLA class I histocompatibility antigen, B-51 alpha chain (MHC classI antigen B*51) HLA-B HLAB 362 P30495 1B56_HUMAN HLA class I histocompatibility antigen, B-56 alpha chain (Bw-22) (Bw-56) (MHC class I antigen B*56) HLA-B HLAB 362 P10319 1B58_HUMAN HLA class I histocompatibility antigen, B-58 alpha chain (Bw-58) (MHC classI antigen B*58) HLA-B HLAB 362 P30501 1C02_HUMAN HLA classI histocompatibility antigen, Cw-2 alpha chain (MHC classI antigen Cw*2) HLA-C HLAC 366 P04222 1C03_HUMAN HLA classI histocompatibility antigen, Cw-3 alpha chain (MHC classI antigen Cw*3) HLA-C HLAC 366 Q9TNN7 1C05_HUMAN HLA classI histocompatibility antigen, Cw-5 alpha chain (MHC classI antigen Cw*5) HLA-C HLAC 366 P10321 1C07_HUMAN HLA classI histocompatibility antigen, Cw-7 alpha chain (MHC classI antigen Cw*7) HLA-C HLAC 366 Q07000 1C15_HUMAN HLA classI histocompatibility antigen, Cw-15 alpha chain (MHC classI antigen Cw*15) HLA-C HLAC 366 Q95604 1C17_HUMAN HLA classI histocompatibility antigen, Cw-17 alpha chain (MHC classI antigen Cw*17) HLA-C D6S204 HLAJY3 HLAC 372 P13760 2B14_HUMAN HLA class II histocompatibility antigen, DRB1-4 beta chain (MHC class II antigen DRB1*4) (DR- 4) (DR4) HLA-DRB1 266 Q9TQE0 2B19_HUMAN HLA class II histocompatibility antigen, DRB1-9 beta chain (MHC class II antigen DRB1*9) (DR- 9) (DR9) HLA-DRB1 266 Q30167 2B1A_HUMAN HLA class II histocompatibility antigen, DRB1-10 beta chain (DRw10) (MHC class II antigen DRB1*10) HLA-DRB1 266 Q29974 2B1G_HUMAN HLA class II histocompatibility antigen, DRB1-16 beta chain (MHC class II antigen DRB1*16) (DR-16) (DR16) HLA-DRB1 266 P01889 1B07_HUMAN HLA classI histocompatibility antigen, B-7 alpha chain (MHC classI antigen B*7) HLA-B HLAB 362 2018-03-20Date ReQue/Date Received 2023-02-27 P30462 1B14_HUMAN HLA classI histocompatibility antigen, B-14 alpha chain (MHC class I antigen B*14) HLA-B HLAB 362 P30464 1B15_HUMAN HLA classI histocompatibility antigen, B-15 alpha chain (MHC class I antigen B*15) HLA-B HLAB 362 P03989 1B27_HUMAN HLA classI histocompatibility antigen, B-27 alpha chain (MHC class I antigen B*27) HLA-B HLAB 362 P18463 1B37_HUMAN HLA classI histocompatibility antigen, B-37 alpha chain (MHC class I antigen B*37) HLA-B HLAB 362 P30479 1B41_HUMAN HLA class I histocompatibility antigen, B-41 alpha chain (Bw-41) (MHC classI antigen B*41) HLA-B HLAB 362 P30483 1B45_HUMAN HLA class I histocompatibility antigen, B-45 alpha chain (Bw-45) (MHC classI antigen B*45) HLA-B HLAB 362 P30485 1B47_HUMAN HLA class I histocompatibility antigen, B-47 alpha chain (Bw-47) (MHC classI antigen B*47) HLA-B HLAB 362 P30487 1B49_HUMAN HLA class I histocompatibility antigen, B-49 alpha chain (HLA classI histocompatibility antigen, B-21 alpha chain) (MHC classI antigen B*49) HLA-B HLAB 362 P30491 1B53_HUMAN HLA class I histocompatibility antigen, B-53 alpha chain (Bw-53) (MHC classI antigen B*53) HLA-B HLAB 362 Q29940 1B59_HUMAN HLA classI histocompatibility antigen, B-59 alpha chain (MHC class I antigen B*59) HLA-B HLAB 362 P30498 1B78_HUMAN HLA classI histocompatibility antigen, B-78 alpha chain (MHC class I antigen B*78) HLA-B HLAB 362 P30499 1C01_HUMAN HLA class I histocompatibility antigen, Cw-1 alpha chan (MHC class I antigen Cw*1) HLA-C HLAC 366 P30505 1C08_HUMAN HLA class I histocompatibility antigen, Cw-8 alpha chain (MHC class I antigen Cw*8) HLA-C HLAC 366 P30508 1C12_HUMAN HLA classI histocompatibility antigen, Cw-12 alpha chain (MHC classI antigen Cw*12) HLA-C HLAC 366 P01912 2B13_HUMAN HLA class II histocompatibility antigen, DRB1-3 chain (Clone P2-beta-3) (MHC class II antigen DRB1*3) HLA-DRB1 266 Q30134 2B18_HUMAN HLA class II histocompatibility antigen, DRB1-8 beta chain (MHC class II antigen DRB1*8) (DR- 8) (DR8) (DRw8) HLA-DRB1 266 Q95IE3 2B1C_HUMAN HLA class II histocompatibility antigen, DRB1-12 beta chain (MHC class II antigen DRB1*12) (DR-12) (DR12) HLA-DRB1 266 Q9BYF1 ACE2_HUMAN Angiotensin-converting enzyme 2 (EC 3.4.17,23) (ACE-related carboxypeptidase) (Angiotensin¬ converting enzyme homolog) (ACEH) (Metalloprotease MPROT15) [Cleaved into: Processed angiotensin-converting enzyme 2] ACE2 UNQ868/PRO1885 805 P16188 1A30_HUMAN HLA classI histocompatibility antigen, A-30 alpha chain (MHC class I antigen A*30) HLA-AHLAA 365 P16190 1A33_HUMAN HLA class I histocompatibility antigen, A-33 alpha chain (Aw-19) (Aw-33) (MHC class I antigen A*33) HLA-AHLAA 365 P01891 1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha chain (Aw-68) (HLA classI histocompatibility antigen, A-28 alpha chain) (MHC class I antigen A*68) HLA-AHLAA 365 Q29836 1B67JHUMAN HLA classI histocompatibility antigen, B-67 alpha chan (MHC class I antigen B*67) HLA-B HLAB 362 P13761 2B17_HUMAN HLA class II histocompatibility antigen, DRB1-7 beta chain (MHC class II antigen DRB1*7) (DR- HLA-DRB1 266 © Ul Ui a © VI 2018-03-20Date Re^ue/Date Received 2023-02-27 7)(DR7) Q5Y7A7 2B1D_HUMAN HLA class II histocompatibility antigen, DRB1-13 beta chain (MHO class II antigen DRB1*13) (DR-13) (DR13) HLA-DRB1 266 P13746 1A11_HUMAN HLA classI histocompatibility antigen, A-11 alpha chain (MHC class I antigen A*11) HLA-AHLAA 365 P05534 1A24_HUMAN HLA class I histocompatibility antigen, A-24 alpha chain (Aw-24) (HLA classI histocompatibility antigen, A-9 alpha chain) (MHC classI antigen A*24) HLA-AHLAA 365 P30512 1A29_HUMAN HLA class I histocompatibility antigen, A-29 alpha chain (Aw-19) (MHC classI antigen A*29) HLA-AHLAA 365 P16189 1A31_HUMAN HLA classI histocompatibility antigen, A-31 alpha chain (MHC class I antigen A*31) HLA-AHLAA 365 P10314 1A32_HUMAN HLA classI histocompatibility antigen, A-32 alpha chain (MHC class I antigen A*32) HLA-AHLAA 365 Q04826 1B40_HUMAN HLA class I histocompatibility antigen, B-40 alpha chain (Bw-60) (MHC classI antigen B*40) HLA-B HLAB 362 P30484 1B46_HUMAN HLA class I histocompatibility antigen, B-46 alpha chain (Bw-46) (MHC classI antigen B*46) HLA-B HLAB 362 P30486 1B48_HUMAN HLA class I histocompatibility antigen, B-48 alpha chain (Bw-48) (MHC classI antigen B*48) HLA-B HLAB 362 P30490 1B52_HUMAN HLA class I histocompatibility antigen, B-52 alpha chain (Bw-52) (HLA classI histocompatibility antigen, B-5 alpha chain) (MHC classI antigen B*52) HLA-B HLAB 362 Q31612 1B73_HUMAN HLA classI histocompatibility antigen, B-73 alpha chain (MHC class I antigen B*73) HLA-B HLAB 363 Q31610 1B81_HUMAN HLA class I histocompatibility antigen, B-81 alpha chain (B'DT) (MHC classI antigen B*81) HLA-B HLAB 362 Q29960 1C16_HUMAN HLA classI histocompatibility antigen, Cw-16 alpha chain (MHC classI antigen Cw*16) HLA-C HLAC 366 Q29865 1C18_HUMAN HLA classI histocompatibility antigen, Cw-18 alpha chain (MHC classI antigen Cw*18) HLA-C HLAC 366 Q9GIY3 2B1E_HUMAN HLA class II histocompatibility antigen, DRB1-14 beta chain (MHC class II antigen DRB1*14) (DR-14) (DR14) HLA-DRB1 266 P30443 1A01_HUMAN HLA classI histocompatibility antigen, A-1 alpha chain (MHC class I antigen A*1) HLA-AHLAA 365 P01892 1A02_HUMAN HLA classI histocompatibility antigen, A-2 alpha chain (MHC class I antigen A*2) HLA-AHLAA 365 P30447 1A23_HUMAN HLA class I histocompatibility antigen, A-23 alpha chain (HLA classI histocompatibility antigen, A-9 alpha chain) (MHC class I antigen A*23) HLA-AHLAA 365 P18462 1A25_HUMAN HLA class I histocompatibility antigen, A-25 alpha chain (HLA classI histocompatibility antigen, A-10 alpha chain) (MHC class I antigen A*25) HLA-AHLAA 365 P30450 1A26_HUMAN HLA classI histocompatibility antigen, A-26 alpha chain (MHC class I antigen A*26) HLA-AHLAA 365 P30453 1A34_HUMAN HLA class I histocompatibility antigen, A-34 alpha chain (Aw-34) (HLA classI histocompatibility antigen, A-10 alpha chain) (MHC class I antigen A*34) HLA-AHLAA 365 P30457 1A66_HUMAN HLA class I histocompatibility antigen, A-66 alpha chain (Aw-66) (HLA classI histocompatibility antigen, A-10 alpha chain) (MHC class I antigen A*66) HLA-AHLAA 365 2018-03-20Date Re^ue/Date Received 2023-02-27 Q09160 1A80_HUMAN HLA class I histocompatibility antigen, A-80 alpha chain (Aw-80) (HLA classI histocompatibility antigen, A-1 alpha chain) (MHO classI antigen A*80) HLA-AHLAA 365 P30461 1B13_HUMAN HLA classI histocompatibility antigen, B-13 alpha chain (MHO class I antigen B*13) HLA-B HLAB 362 P30466 1B18_HUMAN HLA classI histocompatibility antigen, B-18 alpha chain (MHO class I antigen B*18) HLA-B HLAB 362 P30685 1B35_HUMAN HLA classI histocompatibility antigen, B-35 alpha chain (MHO class I antigen B*35) HLA-B HLAB 362 P30475 1B39_HUMAN HLA classI histocompatibility antigen, B-39 alpha chain (MHC class I antigen B*39) HLA-B HLAB 362 P30480 1B42_HUMAN HLA classI histocompatibility antigen, B-42 alpha chain (MHC class I antigen B*42) HLA-B HLAB 362 P30481 1B44_HUMAN HLA class I histocompatibility antigen, B-44 alpha chain (Bw-44) (MHC classI antigen B*44) HLA-B HLAB 362 P30488 1B50_HUMAN HLA class I histocompatibility antigen, B-50 alpha chain (Bw-50) (HLA classI histocompatibility antigen, B-21 alpha chain) (MHC class I antigen B*50) HLA-B HLAB 362 P30492 1B54_HUMAN HLA class I histocompatibility antigen, B-54 alpha chain (Bw-22) (Bw-54) (MHC class I antigen B*54) HLA-B HLAB 362 P18465 1B57_HUMAN HLA class I histocompatibility antigen, B-57 alpha chain (Bw-57) (MHC classI antigen B*57) HLA-B HLAB 362 Q29718 1B82_HUMAN HLA classI histocompatibility antigen, B-82 alpha chain (MHC class I antigen B*82) HLA-B HLAB 362 P30504 1C04_HUMAN HLA class I histocompatibility antigen, Cw-4 alpha chain (MHC class I antigen Cw*4) HLA-C HLAC 366 Q29963 1C06_HUMAN HLA class I histocompatibility antigen, Cw-6 alpha chan (MHC class I antigen Cw*6) HLA-C HLAC 366 P30510 1C14_HUMAN HLA classI histocompatibility antigen, Cw-14 alpha chain (MHC classI antigen Cw*14) HLA-C HLAC 366 P04229 2B11_HUMAN HLA class II histocompatibility antigen, DRB1-1 beta chain (MHC class II antigen DRB1*1) (DR- 1) (DR1) HLA-DRB1 266 P20039 2B1B_HUMAN HLA class II histocompatibility antigen, DRB1-11 beta chain (DR-5) (DR5) (DRw11) (MHC class II antigen DRB1*11) HLA-DRB1 266 P01911 2B1F_HUMAN HLA class II histocompatibility antigen, DRB1-15 beta chan (DW2.2/DR2.2) (MHC class II antigen DRB1*15) HLA-DRB1 HLADRB2 266 014672 ADA10_HUMAN Disintegrin and metalloproteinase domain-containing protein 10 (ADAM 10) (EC 3.4.24,81) (CDw156) (Kuzbanian protein homolog) (Mammalian disintegrin-metalloprotease) (CD antigen CD156c) ADAM10KUZ MADM 748 Q13444 ADA15_HUMAN Disintegrin and metalloproteinase domain-containing protein 15 (ADAM 15) (EC 3.4.24.-) (Metalloprotease RGD disintegrin protein) (Metalloproteinase-like, disintegrin-like, and cysteinerich protein 15) (MDC-15) (Metargidin) ADAM15 MDC15 863 075077 ADA23_HUMAN Disintegrin and metalloproteinase domain-containing protein 23 (ADAM 23) (Metalloproteinase¬ like, disintegrin-like, and cysteine-rich protein 3) (MDC-3) ADAM23 MDC3 832 P30455 1A36_HUMAN HLA class I histocompatibility antigen, A-36 alpha chain (Aw-36) (MHC classI antigen A*36) HLA-AHLAA 365 2018-03-20Date Re^ue/Date Received 2023-02-27 P30459 1A74_HUMAN HLA class I histocompatibility antigen, A-74 alpha chain (Aw-19) (Aw-74) (MHC class I antigen A*74) HLA-AHLAA 365 P30493 1B55_HUMAN HLA class I histocompatibility antigen, B-55 alpha chain (Bw-55) (HLA classI histocompatibility antigen, B-12 alpha chain) (MHC class I antigen B*55) HLA-B HLAB CDABP0067 362 043184 ADA12_HUMAN Disintegrin and metalloproteinase domain-containing protein 12 (ADAM 12) (EC 3.4.24.-) (Meltrin-alpha) ADAM12MLTN UNQ346/PRO545 909 Q9Y3Q7 ADA18_HUMAN Disintegrin and metalloproteinase domain-containing protein 18 (ADAM 18) (Transmembrane metalloproteinase-like, disintegrin-like, and cysteine-rich protein III) (tMDC III) ADAM18TMDC3 UNQ858/PRO1867 739 Q9H013 ADA19_HUMAN Disintegrin and metalloproteinase domain-containing protein 19 (ADAM 19) (EC 3.4.24.-) (Meltrin-beta) (Metalloprotease and disintegrin dendritic antigen marker) (MADDAM) ADAM19 MLTNB FKSG34 955 Q9UKF5 ADA29_HUMAN Disintegrin and metalloproteinase domain-containing protein 29 (ADAM 29) (Cancer/testis antigen 73) (CT73) ADAM29 820 Q8TC27 ADA32_HUMAN Disintegrin and metalloproteinase domain-containing protein 32 (ADAM 32) ADAM32 UNQ5982/PRO21340 787 Q9BZ11 ADA33_HUMAN Disintegrin and metalloproteinase domain-containing protein 33 (ADAM 33) (EC 3.4.24.-) ADAM33C20orf153 UNQ873/PRO1891 813 P05067 A4_HUMAN Amyloid beta A4 protein (ABPP) (APPI) (APP) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Beta-amyloid precursor protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-ll) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99; Beta-amyloid protein 42 (Beta-APP42); Beta-amyloid protein 40 (Beta-APP40); C83; P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase Cterminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] APPA4AD1 770 P12821 ACE_HUMAN Angiotensin-converting enzyme (ACE) (EC 3.2.1.-) (EC 3,4.15.1) (Dipeptidyl carboxypeptidase I) (Kininase II) (CD antigen CD143) [Cleaved into: Angiotensin-converting enzyme, soluble form) ACE DCP DCP1 1306 Q04771 ACVR1_HUMAN Activin receptor type-1 (EC 2.7.11.30) (Activin receptor type I) (ACTR-I) (Activin receptor-like kinase 2) (ALK-2) (Serine/threonine-protein kinase receptor R1) (SKR1) (TGF-B superfamily receptor type I) (TSR-I) ACVR1 ACVRLK2 509 Q8NER5 ACV1C_HUMAN Activin receptor type-1C (EC 2.7.11.30) (Activin receptor type IC) (ACTR-IC) (Activin receptor¬ like kinase 7) (ALK-7) ACVR1CALK7 493 Q9H2U9 ADAM7_HUMAN Disintegrin and metalloproteinase domain-containing protein 7 (ADAM 7) (Sperm maturationrelated glycoprotein GP-83) ADAM7GP83 754 2018-03-20Date Re^ue/Date Received 2023-02-27 P36896 ACV1B_HUMAN Activin receptor type-1B (EC 2.7.11.30) (Activin receptor type IB) (ACTR-IB) (Activin receptor¬ like kinase 4) (ALK-4) (Serine/threonine-protein kinase receptor R2) (SKR2) ACVR1BACVRLK4 ALK4 505 075078 ADA11_HUMAN Disintegrin and metalloproteinase domain-containing protein 11 (ADAM 11) (Metalloproteinase¬ like, disintegrin-like, and cysteine-rich protein) (MDC) ADAM11 MDC 769 P78536 ADA17_HUMAN Disintegrin and metalloproteinase domain-containing protein 17 (ADAM 17) (EC 3.4.24.86) (Snake venom-like protease) (TNF-alpha convertase) (TNF-alpha-converting enzyme) (CD antigen CD156b) ADAM17CSVP TACE 824 Q9P0K1 ADA22_HUMAN Disintegrin and metalloproteinase domain-containing protein 22 (ADAM 22) (Metalloproteinasedisintegrin ADAM22-3) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2) ADAM22 MDC2 906 Q9UKQ2 ADA28_HUMAN Disintegrin and metalloproteinase domain-containing protein 28 (ADAM 28) (EC 3.4.24.-) (Epididymal metalloproteinase-like, disintegrin-like, and cysteine-rich protein II) (eMDC II) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L) (MDC-L) ADAM28ADAM23 MDCL 775 Q9UKF2 ADA30_HUMAN Disintegrin and metalloproteinase domain-containing protein 30 (ADAM 30) (EC 3.4.24.-) ADAM30 UNQ2509/PRO5997 790 P19021 AMD_HUMAN Peptidyl-glycine alpha-amidating monooxygenase (PAM) [Includes: Peptidylglycine alphahydroxylating monooxygenase (PHM) (EC 1.14.17.3); Peptidyl-alpha-hydroxyglycine alphaamidating lyase (EC 4.3.2.5) (Peptidylamidoglycolate lyase) (PAL)] PAM 973 Q86SJ2 AMGO2_HUMAN Amphoterin-induced protein 2 (AMIGO-2) (Alivin-1) (Differentially expressed in gastric adenocarcinomas) (DEGA) AMIGO2ALI1 522 Q16671 AMHR2_HUMAN Anti-Muellerian hormone type-2 receptor (EC 2.7.11.30) (Anti-Muellerian hormone type II receptor) (AMH type II receptor) (MIS type II receptor) (MISRII) (MRII) AMHR2AMHR MISR2 573 P37023 ACVL1_HUMAN Serine/threonine-protein kinase receptor R3 (SKR3) (EC 2.7.11.30) (Activin receptor-like kinase 1) (ALK-1) (TGF-B superfamily receptor type I) (TSR-I) ACVRL1 ACVRLK1 ALK1 503 Q13443 ADAM9_HUMAN Disintegrin and metalloproteinase domain-containing protein 9 (ADAM 9) (EC 3.4.24.-) (Cellular disintegrin-related protein) (Meltrin-gamma) (Metalloprotease/disintegrin/cysteine-rich protein 9) (Myeloma cell metalloproteinase) ADAM9 KIAA0021 MCMP MDC9 MLTNG 819 043506 ADA20_HUMAN Disintegrin and metalloproteinase domain-containing protein 20 (ADAM 20) (EC 3.4.24.-) ADAM20 726 Q9UKJ8 ADA21_HUMAN Disintegrin and metalloproteinase domain-containing protein 21 (ADAM 21) (EC 3.4.24.-) ADAM21 722 Q99965 ADAM2_HUMAN Disintegrin and metalloproteinase domain-containing protein 2 (ADAM 2) (Cancer/testis antigen 15) (CT15) (Fertilin subunit beta) (PH-30) (PH30) (PH30-beta) ADAM2 FTNB 735 P78325 ADAM8_HUMAN Disintegrin and metalloproteinase domain-containing protein 8 (ADAM 8) (EC 3.4.24.-) (Cell surface antigen MS2) (CD antigen CD156a) ADAM8MS2 824 Q9H6X2 ANTR1_HUMAN Anthrax toxin receptor 1 (Tumor endothelial marker 8) ANTXR1 ATRTEM8 564 P58335 ANTR2_HUMAN Anthrax toxin receptor 2 (Capillary morphogenesis gene 2 protein) (CMG-2) ANTXR2CMG2 489 2018-03-20Date Re^ue/Date Received 2023-02-27 Q86WK6 AMG01_HUMAN Amphoterin-induced protein 1 (AMIGO-1) (Alivin-2) AMIGO1 ALI2 AMIGO KIAA1163 493 P16066 ANPRA_HUMAN Atrial natriuretic peptide receptor 1 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type A) (ANPA) (ANPR-A) (NPR-A) (Guanylate cyclase A) (GC-A) NPR1 ANPRA 1061 Q6UXC1 AEGP_HUMAN Apical endosomal glycoprotein (MAM domain-containing protein 4) MAMDC4AEGP UNQ3001/PRO9742 1216 Q9BXJ7 AMNLS_HUMAN Protein amnionless AMN UNQ513/PRO1028 453 P20594 ANPRB_HUMAN Atrial natriuretic peptide receptor 2 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type B) (ANPB) (ANPR-B) (NPR-B) (Guanylate cyclase B) (GC-B) NPR2ANPRB 1047 Q8J025 APCD1_HUMAN Protein APCDD1 (Adenomatosis polyposis coli down-regulated 1 protein) APCDD1 DRAPC1 FP7019 514 P51693 APLP1_HUMAN Amyloid-like protein 1 (APLP) (APLP-1) [Cleaved into: C30] APLP1 650 Q9UM73 ALK_HUMAN ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246) ALK 1620 A6NF34 ANTRL_HUMAN Anthrax toxin reraptor-like ANTXRL 631 Q86WK7 AMG03_HUMAN Amphoterin-induced protein 3 (AMIGO-3) (Alivin-3) AMIGO3ALI3 KIAA1851 UNQ6084/PRO20089 504 P17342 ANPRC_HUMAN Atrial natriuretic peptide receptor 3 (Atrial natriuretic peptide clearance receptor) (Atrial natriuretic peptide receptor type C) (ANP-C) (ANPR-C) (NPR-C) NPR3ANPRC C5orf23 NPRC 541 Q06481 APLP2_HUMAN Amyloid-like protein 2 (APLP-2) (APPH) (Amyloid protein homolog) (CDEI box-binding protein) (CDEBP) APLP2APPL2 763 Q13705 AVR2B_HUMAN Activin receptor type-2B (EC 2.7.11.30) (Activin receptor type IIB) (ACTR-IIB) ACVR2B 512 P35613 BASLHUMAN Basigin (5F7) (Collagenase stimulatory factor) (Extracellular matrix metalloproteinase inducer) (EMMPRIN) (Leukocyte activation antigen M6) (OK blood group antigen) (Tumor cell-derived collagenase stimulatory factor) (TCSF) (CD antigen CD147) BSG UNQ6505/PRO21383 385 P50895 BCAM_HUMAN Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239) BCAM LU MSK19 628 075882 ATRN_HUMAN Attractin (DPPT-L) (Mahogany homolog) ATRN KIAA0548 MGCA 1429 Q9Y5Z0 BACE2_HUMAN Beta-secretase 2 (EC 3.4.23.45) (Aspartic-like protease 56 kDa) (Aspartyl protease 1) (ASP1) (Asp 1) (Beta-site amyloid precursor protein cleaving enzyme 2) (Beta-site APP cleaving enzyme 2) (Down region aspartic protease) (DRAP) (Memapsin-1) (Membrane-associated aspartic protease 1) (Theta-secretase) BACE2AEPLC ALP56ASP21 CDA13 UNQ418/PRO852 518 2018-03-20Date Re^ue/Date Received 2023-02-27 Q13145 BAMBLHUMAN BMP and action membrane-bound inhibitor homolog (Non-metastatic gene A protein) (Putative transmembrane protein NMA) BAMBI NMA 260 P36894 BMR1A_HUMAN Bone morphogenetic protein receptor type-1A (BMP type-1A receptor) (BMPR-1A) (EC 2.7.11.30) (Activin receptor-like kinase 3) (ALK-3) (Serine/threonine-protein kinase receptor R5) (SKR5) (CD antigen CD292) BMPR1AACVRLK3 ALK3 532 P56817 BACE1_HUMAN Beta-secretase 1 (EC 3.4.23.46) (Aspartyl protease 2) (ASP2) (Asp 2) (Beta-site amyloid precursor protein cleaving enzyme 1) (Beta-site APP cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2) BACE1 BACE KIAA1149 501 Q5W63 ATRN1_HUMAN Attractin-like protein 1 ATRNL1 KIAA0534 1379 P27037 AVR2A_HUMAN Activin receptor type-2A (EC 2.7.11.30) (Activin receptor type HA) (ACTR-IIA) (ACTRIIA) ACVR2AACVR2 513 Q9BWV1 BOC_HUMAN Brother of CDO (Protein BOC) BOC UNQ604/PRO1190 1114 000238 BMR1B_HUMAN Bone morphogenetic protein receptor type-1B (BMP type-1B receptor) (BMPR-1B) (EC 2.7.11.30) (CD antigen CDw293) BMPR1B 502 000481 BT3A1_HUMAN Butyrophilin subfamily 3 member A1 (CD antigen CD277) BTN3A1 BTF5 513 Q7Z6A9 BTLA_HUMAN B- and T-lymphocyte attenuator (B- and T-lymphocyte-associated protein) (CD antigen CD272) BTLA 289 Q96KV6 BT2A3_HUMAN Putative butyrophilin subfamily 2 member A3 BTN2A3P BTN2A3 586 P78410 BT3A2_HUMAN Butyrophilin subfamily 3 member A2 BTN3A2 BT3.2 BTF3 BTF4 334 Q6UXE8 BTNL3_HUMAN Butyrophilin-like protein 3 (Butyrophilin-like receptor) BTNL3 BTNLR COLF4100 UNQ744/PRO1472 466 Q6UXG8 BTNL9_HUMAN Butyrophilin-like protein 9 BTNL9 UNQ1900/PRO4346 535 Q5SY80 CA101_HUMAN Uncharacterized protein C1orf101 C1orf101 951 F2Z333 CA233_HUMAN Fibronectin type-Ill domain-containing transmembrane protein C1orf233 C1orf233 226 Q13410 BT1A1_HUMAN Butyrophilin subfamily 1 member A1 (BT) BTN1A1 BTN 526 Q8WW5 BT2A2_HUMAN Butyrophilin subfamily 2 member A2 BTN2A2 BT2.2 BTF2 523 000478 BT3A3_HUMAN Butyrophilin subfamily 3 member A3 BTN3A3 BTF3 584 Q6UX41 BTNL8_HUMAN Butyrophilin-like protein 8 BTNL8 UNQ702/PRO1347 500 Q6UWJ8 C16L2_HUMAN CD164 sialomucin-like 2 protein CD164L2 UNQ6122/PRO20044 174 2018-03-20Date Re^ue/Date Received 2023-02-27 P55289 CAD12_HUMAN Cadherin-12 (Brain cadherin) (BR-cadherin) (Neural type cadherin 2) (N-cadherin 2) CDH12 794 Q9UJ99 CAD22_HUMAN Cadherin-22 (Pituitary and brain cadherin) (PB-cadherin) CDH22 C20orf25 828 Q9H251 CAD23_HUMAN Cadherin-23 (Otocadherin) CDH23 KIAA1774 KIAA1812 UNQ1894/PRO4340 3354 Q8IXH8 CAD26_HUMAN Cadherin-like protein 26 (Cadherin-like protein VR20) CDH26 852 P19022 CADH2_HUMAN Cadherin-2 (CDw325) (Neural cadherin) (N-cadherin) (CD antigen CD325) CDH2CDHNNCAD 906 P55285 CADH6_HUMAN Cadherin-6 (Kidney cadherin) (K-cadherin) CDH6 790 Q9ULB5 CADH7_HUMAN Cadherin-7 CDH7 CDH7L1 785 P55286 CADH8_HUMAN Cadherin-8 CDH8 799 Q9ULX7 CAH14_HUMAN Carbonic anhydrase 14 (EC 4.2.1.1) (Carbonate dehydratase XIV) (Carbonic anhydrase XIV) (CA-XIV) CA14 UNQ690/PRO1335 337 Q5VU97 CAHD1_HUMAN VWFA and cache domain-containing protein 1 (Cache domain-containing protein 1) CACHD1 KIAA1573 VWCD1 1274 P27824 CALX_HUMAN Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) CANX 592 Q13873 BMPR2_HUMAN Bone morphogenetic protein receptor type-2 (BMP type-2 receptor) (BMPR-2) (EC 2.7.11.30) (Bone morphogenetic protein receptor type II) (BMP type II receptor) (BMPR-II) BMPR2PPH1 1038 Q7KYR7 BT2A1_HUMAN Butyrophilin subfamily 2 member A1 BTN2A1 BT2.1 BTF1 527 P35070 BTC_HUMAN Probetacellulin [Cleaved into: Betacellulin (BTC)] BTC 178 Q86VB7 C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 (Hemoglobin scavenger receptor) (CD antigen CD163) [Cleaved into: Soluble CD163 (sCD163)] CD163 M130 1156 Q8TCZ2 C99L2_HUMAN CD99 antigen-like protein 2 (MIC2-like protein 1) (CD antigen CD99) CD99L2 MIC2L1 UNQ1964/PRO4486 262 Q8IZS8 CA2D3_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-3 (Voltage-gated calcium channel subunit alpha-2/delta-3) [Cleaved into: Voltage-dependent calcium channel subunit alpha-2-3; Voltage-dependent calcium channel subunit delta-3] CACNA2D3 1091 Q7Z3S7 CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 (Voltage-gated calcium channel subunit alpha-2/delta-4) [Cleaved into: Voltage-dependent calcium channel subunit alpha-2-4; Voltage-dependent calcium channel subunit delta-4] CACNA2D4 1137 Q9Y6N8 CAD10_HUMAN Cadherin-10 (T2-cadherin) CDH10 788 Q12864 CAD17_HUMAN Cadherin-17 (Intestinal peptide-associated transporter HPT-1) (Liver-intestine cadherin) (Llcadherin) CDH17 832 2018-03-20Date Re^ue/Date Received 2023-02-27 P55283 CADH4_HUMAN Cadherin-4 (Retinal cadherin) (R-CAD) (R-cadherin) CDH4 916 P33151 CADH5_HUMAN Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144) CDH5 784 Q8NFZ8 CADM4_HUMAN Cell adhesion molecule 4 (Immunoglobulin superfamily member 4C) (lgSF4C) (Nectin-like protein 4) (NECL-4) (TSLC1-like protein 2) CADM4 IGSF4C NECL4TSLL2 388 Q9NPY3 C1QR1_HUMAN Complement component C1q receptor (C1q/MBL/SPA receptor) (C1qR) (C1qR(p)) (C1qRp) (CDw93) (Complement component 1 q subcomponent receptor 1) (Matrix-remodeling-associated protein 4) (CD antigen CD93) CD93C1QR1 MXRA4 652 Q9NY47 CA2D2_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-2 (Voltage-gated calcium channel subunit alpha-2/delta-2) [Cleaved into: Voltage<iependent calcium channel subunit alpha-2-2; Voltage-dependent calcium channel subunit delta-2] CACNA2D2 KIAA0558 1150 Q8N3J6 CADM2_HUMAN Cell adhesion molecule 2 (Immunoglobulin superfamily member 4D) (lgSF4D) (Nectin-like protein 3) (NECL-3) (Synaptic cell adhesion molecule 2) (SynCAM 2) CADM2 IGSF4D NECL3 435 Q13634 CAD18_HUMAN Cadherin-18 (Cadherin-14) CDH18CDH14 790 A8MVZ5 BTNLA_HUMAN Butyrophilin-like protein 10 BTNL10 291 Q9NR16 C163B_HUMAN Scavenger receptor cysteine-rich type 1 protein M160 (CD163 antigen-like 1) (CD antigen CD163b) CD163L1 CD163B M160 UNQ6434/PRO23202 1453 P54289 CA2D1_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-1 (Voltage-gated calcium channel subunit alpha-2/delta-1) [Cleaved into: Voltage-dependent calcium channel subunit alpha-2-1; Voltage-dependent calcium channel subunit delta-1] CACNA2D1 CACNL2ACCHL2A MHS3 1103 Q86UP0 CAD24_HUMAN Cadherin-24 CDH24CDH11L UNQ2834/PRO34009 819 Q9BY67 CADM1_HUMAN Cell adhesion molecule 1 (Immunoglobulin superfamily member 4) (lgSF4) (Nectin-like protein 2) (NECL-2) (Spermatogenic immunoglobulin superfamily) (SglgSF) (Synaptic cell adhesion molecule) (SynCAM) (Tumor suppressor in lung cancer 1) (TSLC-1) CADM1 IGSF4 IGSF4ANECL2 SYNCAM TSLC1 442 Q9HBT6 CAD20_HUMAN Cadherin-20 CDH20CDH7L3 801 Q16790 CAH9_HUMAN Carbonic anhydrase 9 (EC 4.2.1.1) (Carbonate dehydratase IX) (Carbonic anhydrase IX) (CAIX) (CAIX) (Membrane antigen MN) (P54/58N) (Renal cell carcinoma-associated antigen G250) (RCC-associated antigen G250) (pMW1) CA9G250MN 459 075976 CBPD_HUMAN Carboxypeptidase D (EC 3.4.17.22) (Metallocarboxypeptidase D) (gp180) CPD 1380 P55287 CAD11_HUMAN Cadherin-11 (OSF-4) (Osteoblast cadherin) (OB-cadherin) CDH11 796 P55291 CAD15_HUMAN Cadherin-15 (Cadherin-14) (Muscle cadherin) (M-cadherin) CDH15CDH14CDH3 814 075309 CAD16_HUMAN Cadherin-16 (Kidney-specific cadherin) (Ksp-cadherin) CDH16 829 2018-03-20Date Re^ue/Date Received 2023-02-27 UNQ695/PRO1340 Q9H159 CAD19_HUMAN Cadherin-19 CDH19CDH7L2 UNQ478/PRO941 772 P12830 CADH1_HUMAN Cadherin-1 (CAM 120/80) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) (Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF31 CDH1 CDHE UVO 882 P22223 CADH3_HUMAN Cadherin-3 (Placental cadherin) (P-cadherin) CDH3CDHP 829 Q9ULB4 CADH9_HUMAN Cadherin-9 CDH9 789 Q8N126 CADM3_HUMAN Cell adhesion molecule 3 (Brain immunoglobulin receptor) (Immunoglobulin superfamily member 4B) (lgSF4B) (Nectin-like protein 1) (NECL-1) (Synaptic cell adhesion molecule 3) (SynCAM3) (TSLC1-like protein 1) (TSLL1) CADM3 IGSF4B NECL1 SYNCAM3 TSLL1 UNQ225/PRO258 398 043570 CAH12_HUMAN Carbonic anhydrase 12 (EC 4.2.1.1) (Carbonate dehydratase XII) (Carbonic anhydrase XII) (CAXII) (Tumor antigen HOM-RCC-3.1.3) CA12 354 P15813 CD1D_HUMAN Antigen-presenting glycoprotein CD1d (R3G1) (CD antigen CD1d) CD1D 335 Q9BZW8 CD244_HUMAN Natural killer cell receptor 2B4 (NK cell activation-inducing ligand) (NAIL) (NK cell type I receptor protein 2B4) (NKR2B4) (h2B4) (SLAM family member 4) (SLAMF4) (Signaling lymphocytic activation molecule 4) (CD antigen CD244) CD2442B4 370 Q5ZPR3 CD276_HUMAN CD276 antigen (4lg-B7-H3) (B7 homolog 3) (B7-H3) (Costimulatory molecule) (CD antigen CD276) CD276 B7H3 PSEC0249 UNQ309/PRO352 534 P34810 CD68_HUMAN Macrosialin (Gp110) (CD antigen CD68) CD68 354 P40259 CD79B_HUMAN B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b) CD79B B29 IGB 229 P01732 CD8A_HUMAN T-cell surface glycoprotein CD8 alpha chain (T-lymphocyte differentiation antigen T8/Leu-2) (CD antigen CD8a) CD8A MAL 235 P06126 CD1A_HUMAN T-cell surface glycoprotein CD1a (T-cell surface antigen T6/Leu-6) (hTa1 thymocyte antigen) (CD antigen CD1a) CD1A 327 P20273 CD22_HUMAN B-cell receptor CD22 (B-lymphocyte cell adhesion molecule) (BL-CAM) (Sialic acid-binding Iglike lectin 2) (Sigleo-2) (T-cell surface antigen Leu-14) (CD antigen CD22) CD22SIGLEC2 847 P06127 CD5_HUMAN T-cell surface glycoprotein CD5 (Lymphocyte antigen T1/Leu-1) (CD antigen CD5) CD5 LEU1 495 P10966 CD8B_HUMAN T-cell surface glycoprotein CD8 beta chain (CD antigen CD8b) CD8BCD8B1 210 P14209 CD99_HUMAN CD99 antigen (12E7) (E2 antigen) (Protein MIC2) (T-cell surface glycoprotein E2) (CD antigen CD99) CD99 MIC2 MIC2X MIC2Y 185 2018-03-20Date Re^ue/Date Received 2023-02-27 P29017 CD1C_HUMAN T-cell surface glycoprotein CD1c (CD antigen CD1c) CD1C 333 P10747 CD28_HUMAN T-cell-specific surface glycoprotein CD28 (TP44) (CD antigen CD28) CD28 220 A6NJW9 CD8BL_HUMAN Putative T-cell surface glycoprotein CD8 beta-2 chain (CD8b pseudogene) CD8BPCD8B2 211 Q9BYE9 CDHR2_HUMAN Cadherin-related family member 2 (Protocadherin LKC) (PC-LKC) (Protocadherin-24) CDHR2 PCDH24 PCLKC 1310 Q9HBB8 CDHR5_HUMAN Cadherin-related family member 5 (Mu-protocadherin) (Mucin and cadherin-like protein) (Mucin¬ like protocadherin) (MLPCDH) CDHR5 MUCDHL MUPCDH UNQ2781/PRO7168 845 Q6UY09 CEA20_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 20 CEACAM20 UNQ9366/PRO34155 585 Q3KPI0 CEA21_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 21 CEACAM21 UNQ3098/PR010075 293 P15391 CD19_HUMAN B-lymphocyte antigen CD19 (B-lymphocyte surface antigen B4) (Differentiation antigen CD19) (T-cell surface antigen Leu-12) (CD antigen CD19) CD19 556 P15812 CD1E_HUMAN T-cell surface glycoprotein CD1e, membrane-associated (hCD1e) (R2G1) (CD antigen CD1e) [Cleaved into: T-cell surface glycoprotein CD1e, soluble (sCD1e)l CD1E 388 Q15762 CD226_HUMAN CD226 antigen (DNAX accessory molecule 1) (DNAM-1) (CD antigen CD226) CD226DNAM1 336 P26842 CD27_HUMAN CD27 antigen (CD27L receptor) (T-cell activation antigen CD27) (T14) (Tumor necrosis factor receptor superfamily member 7) (CD antigen CD27) CD27TNFRSF7 260 P06729 CD2_HUMAN T-cell surface antigen CD2 (Erythrocyte receptor) (LFA-2) (LFA-3 receptor) (Rosette receptor) (T-cell surface antigen T11/Leu-5) (CD antigen CD2) CD2SRBC 351 Q9NPF0 CD320_HUMAN CD320 antigen (8D6 antigen) (FDC-signaling molecule 8D6) (FDC-SM-8D6) (Transcobalamin receptor) (TCblR) (CD antigen CD320) CD320 8D6A UNQ198/PRO224 282 P04234 CD3D_HUMAN T-cell surface glycoprotein CD3 delta chain (T-cell receptor T3 delta chain) (CD antigen CD3d) CD3D T3D 171 P16070 CD44_HUMAN CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Heparan sulfate proteoglycan) (Hennes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44) CD44 LHR MDU2 MDU3 MIC4 742 P30203 CD6_HUMAN T-cell differentiation antigen CD6 (T12) (TP120) (CD antigen CD6) [Cleaved into: Soluble CD6] CD6 668 P33681 CD80_HUMAN T-lymphocyte activation antigen CD80 (Activation B7-1 antigen) (BB1) (CTLA-4 counter-receptor B7.1)(B7) (CD antigen CD80) CD80CD28LG CD28LG1 LAB7 288 P13688 CEAM1_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 1 (Biliary glycoprotein 1) (BGP-1) (CD antigen CD66a) CEACAM1 BGP BGP1 526 2018-03-20Date Re^ue/Date Received 2023-02-27 P29016 CD1B_HUMAN T-cell surface glycoprotein CD1b (CD antigen CD1b) CD1B 333 Q9HCU0 CD248_HUMAN Endosialin (Tumor endothelial marker 1) (CD antigen CD248) CD248CD164L1 TEM1 757 P28906 CD34_HUMAN Hematopoietic progenitor cell antigen CD34 (CD antigen CD34) CD34 385 P07766 CD3E_HUMAN T-cell surface glycoprotein CD3 epsilon chain (T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e) CD3ET3E 207 P09693 CD3G_HUMAN T-cell surface glycoprotein CD3 gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g) CD3GT3G 182 Q6ZTQ4 CDHR3_HUMAN Cadherin-related family member 3 (Cadherin-like protein 28) CDHR3CDH28 885 P20963 CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247) CD247CD3ZT3Z TCRZ 164 P11912 CD79A_HUMAN B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a) CD79AIGAMB1 226 075871 CEAM4_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 4 (Cardnoembryonic antigen CGM7) (Non-spedfic cross-reacting antigen W236) CEACAM4CGM7 244 Q13740 CD166_HUMAN CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166) ALCAM MEMD 583 Q99467 CD180_HUMAN CD180 antigen (Lymphocyte antigen 64) (Radioprotective 105 kDa protein) (CD antigen CD180) CD180 LY64 RP105 661 Q8IX05 CD302_HUMAN CD302 antigen (C-type lectin BIMLEC) (C-type lectin domain family 13 member A) (DEC205- assodated C-type lectin 1) (Type I transmembrane C-type lectin receptor DCL-1) (CD antigen CD302) CD302CLEC13A DCL1 KIAA0022 232 P20138 CD33_HUMAN Myeloid cell surface antigen CD33 (Sialic acid-binding Ig-like lectin 3) (Siglec-3) (gp67) (CD antigen CD33) CD33SIGLEC3 364 P01730 CD4_HUMAN T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4) CD4 458 P09564 CD7_HUMAN T-cell antigen CD7 (GP40) (T-cell leukemia antigen) (T-cell surface antigen Leu-9) (TP41) (CD antigen CD7) CD7 240 Q01151 CD83_HUMAN CD83 antigen (hCD83) (B-cell activation protein) (Cell surface protein HB15) (CD antigen CD83) CD83 205 P42081 CD86_HUMAN T-lymphocyte activation antigen CD86 (Activation B7-2 antigen) (B70) (BU63) (CTLA-4 counterreceptor B7.2) (FUN-1) (CD antigen CD86) CD86CD28LG2 329 A6H8M9 CDHR4_HUMAN Cadherin-related family member 4 (Cadherin-like protein 29) CDHR4CDH29 UNQ9392/PRO34300 788 Q7Z692 CEA19_HUMAN Cardnoembryonic antigen-related cell adhesion molecule 19 (Carcinoembryonic antigen-like 1) CEACAM19CEAL1 UNQ2973/PRO7436 300 2018-03-20Date ReQue/Date Received 2023-02-27 P40198 CEAM3_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 3 (Carcinoembryonic antigen CGM1) (CD antigen CD66d) CEACAM3 CD66D CGM1 252 Q9H9P2 CH0DL_HUMAN Chondrolectin (Transmembrane protein MT75) CHODLC21orf68 PRED12 UNQ872/PRO1890 273 Q08708 CLM6_HUMAN CMRF35-like molecule 6 (CLM-6) (CD300 antigen-like family member C) (CMRF35-A1) (CMRF- 35) (Immunoglobulin superfamily member 16) (lgSF16) (CD antigen CD300c) CD300C CMRF35 CMRF35A CMRF35A1 IGSF16 224 014967 CLGN_HUMAN Calmegin CLGN 610 Q496F6 CLM2_HUMAN CMRF354ike molecule 2 (CLM-2) (CD300 antigen-like family member E) (CMRF35-A5) (Immune receptor expressed on myeloid cells 2) (IREM-2) (Polymeric immunoglobulin receptor 2) (PlgR-2) (PlgR2) (Poly-lg receptor 2) (CD antigen CD300e) CD300ECD300LE CLM2CMRF35A5 IREM2 205 Q6UXG3 CLM9_HUMAN CMRF35-like molecule 9 (CLM-9) (CD300 antigen-like family member G) (Triggering receptor expressed on myeloid cells 4) (TREM-4) (CD antigen CD300g) CD300LG CLM9 TREM4 UNQ422/PRO846 332 Q9UQC9 CLCA2_HUMAN Calcium-activated chloride channel regulator 2 (EC 3.4.-.-) (Calcium-activated chloride channel family member 2) (hCLCA2) (Calcium-activated chloride channel protein 3) (CaCC-3) (hCaCC-3) [Cleaved into: Calcium-activated chloride channel regulator 2, 109 kDa form; Calcium-activated chloride channel regulator 2, 35 kDa form] CLCA2CACC3 943 Q9H6B4 CLMP_HUMAN CXADR-like membrane protein (Adipocyte adhesion molecule) (Coxsackie- and adenovirus receptor-like membrane protein) (CAR-like membrane protein) CLMPACAMASAM UNQ318/PRO363 373 Q96F05 CK024_HUMAN Uncharacterized protein C11orf24 (Protein DM4E3) C11orf24 FP2568 UNQ1872/PRO4315 449 Q6NUJ2 CK087_HUMAN Uncharacterized protein C11orf87 C11orf87 197 A8K4G0 CLM7_HUMAN CMRF354ike molecule 7 (CLM-7) (CD300 antigen-like family member B) (CMRF35-A2) (Immune receptor expressed on myeloid cells 3) (IREM-3) (Leukocyte mono-lg-like receptor 5) (Triggering receptor expressed on myeloid cells 5) (TREM-5) (CD antigen CD300b) CD300LBCD300B CLM7CMRF35A2 IREM3 LMIR5 TREM5 UNQ2530/PRO6029 201 Q9UGN4 CLM8_HUMAN CMRF35-like molecule 8 (CLM-8) (CD300 antigen-like family member A) (CMRF-35-H9) (CMRF35-H9) (CMRF35-H) (IRC1/IRC2) (Immunoglobulin superfamily member 12) (lgSF12) (Inhibitory receptor protein 60) (IRp60) (NK inhibitory receptor) (CD antigen CD300a) CD300A CMRF35H IGSF12 HSPC083 299 Q96NU0 CNT3B_HUMAN Contactin-associated protein-like 3B (Cell recognition molecule Caspr3b) CNTNAP3B CASPR3B 1288 Ul © Ui a © VI 2018-03-20Date Re^ue/Date Received 2023-02-27 P78357 CNTP1_HUMAN Contactin-associated protein 1 (Caspr) (Casprl) (Neurexin IV) (Neurexin-4) (p190) CNTNAP1 CASPR NRXN4 1384 Q9UHC6 CNTP2_HUMAN Contactin-associated protein-like 2 (Cell recognition molecule Caspr2) CNTNAP2 CASPR2 KIAA0868 1331 Q9C0A0 CNTP4_HUMAN Contactin-associated protein-like 4 (Cell recognition molecule Caspr4) CNTNAP4 CASPR4 KIAA1763 1308 Q8WYK1 CNTP5_HUMAN Contactin-associated protein-like 5 (Cell recognition molecule Caspr5) CNTNAP5CASPR5 1306 Q8TDQ1 CLM1_HUMAN CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Immune receptor expressed on myeloid cells 1) (IREM-1) (Immunoglobulin superfamily member 13) (lgSF13) (NK inhibitory receptor) (CD antigen CD300f) CD300LF CD300F CLM1 IGSF13 IREM1 NKIR UNQ3105/PRO10111 290 Q5T292 CJ128_HUMAN Putative uncharacterized protein C1Oorfl28 C10orf128 105 Q86T13 CLC14HUMAN C-type lectin domain family 14 member A (Epidermal growth factor receptor 5) (EGFR-5) CLEC14AC14orf27 EGFR5 UNQ236/PRO269 490 Q6UXZ3 CLM4_HUMAN CMRF35-like molecule 4 (CLM-4) (CD300 antigen-like family member D) (CMRF35-A4) (CD antigen CD300d) CD300LD CD300D CMRF35A4 UNQ9218/PRO28686 194 Q9BZ76 CNTP3_HUMAN Contactin-associated protein-like 3 (Cell recognition molecule Caspr3) CNTNAP3 CASPR3 KIAA1714 1288 Q86TY3 CN037_HUMAN Uncharacterized protein C14orf37 C14orf37 774 Q9HC73 CRLF2J4UMAN Cytokine receptor-like factor 2 (Cytokine receptor-like 2) (IL-XR) (Thymic stromal lymphopoietin protein receptor) (TSLP receptor) CRLF2 CRL2 ILXR TSLPR 371 Q9BW8 CS024_HUMAN Uncharacterized membrane protein C19orf24 C19orf24 132 P09603 CSF1_HUMAN Macrophage colony-stimulating factor 1 (CSF-1) (M-CSF) (MCSF) (Lanimostim) [Cleaved into: Processed macrophage colony-stimulating factor 1] CSF1 554 Q5IJ48 CRUM2_HUMAN Protein crumbs homolog 2 (Crumbs-like protein 2) CRB2 1285 Q96PZ7 CSMD1_HUMAN CUB and sushi domain-containing protein 1 (CUB and sushi multiple domains protein 1) CSMD1 KIAA1890 UNQ5952/PRO19863 3565 095196 CSPG5_HUMAN Chondroitin sulfate proteoglycan 5 (Acidic leucine-rich EGF-like domain-containing brain protein) (Neuroglycan C) CSPG5 CALEB NGC 566 Q9BUF7 CRUM3_HUMAN Protein crumbs homolog 3 CRB3 UNQ588/PRO1158 120 2018-03-20Date Re^ue/Date Received 2023-02-27 094985 CSTN1_HUMAN Calsyntenin-1 (Alcadein-alpha) (Alc-alpha) (Alzheimer-related cadherin-like protein) (Nondassical cadherin XB31alpha) [Cleaved into: Soluble Alc-alpha (SAIc-alpha); CTF1-alpha (Cterminal fragment 1-alpha)] CLSTN1 CS1 KIAA0911 981 Q6ZRH7 CTSRG_HUMAN Cation channel sperm-associated protein subunit gamma CATSPERGC19orf15 1159 Q86UP6 CUZD1_HUMAN CUB and zona pellucida-like domain-containing protein 1 (CUB and ZP domain-containing protein 1) (Transmembrane protein UO-44) CUZD1 UNQ224/PRO257 607 Q5JRM2 CX066_HUMAN Uncharacterized protein CXorf66 CXorf66 361 Q8NEA5 CS018_HUMAN Uncharacterized protein C19orf18 C19orf18 215 P17927 CR1_HUMAN Complement receptor type 1 (C3b/C4b receptor) (CD antigen CD35) CR1 C3BR 2039 P20023 CR2_HUMAN Complement receptor type 2 (Cr2) (Complement C3d receptor) (Epstein-Barr virus receptor) (EBV receptor) (CD antigen CD21) CR2C3DR 1033 P15509 CSF2R_HUMAN Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (GM-CSF-R-alpha) (GMCSFR-alpha) (GMR-alpha) (CDw116) (CD antigen CD116) CSF2RACSF2R CSF2RY 400 Q99062 CSF3R_HUMAN Granulocyte colony-stimulating factor receptor (G-CSF receptor) (G-CSF-R) (CD antigen CD114) CSF3RGCSFR 836 Q9BQT9 CSTN3_HUMAN Calsyntenin-3 (Alcadein-beta) (Alc-beta) CLSTN3CS3 KIAA0726 956 Q9NZV1 CRIM1_HUMAN Cysteine-rich motor neuron 1 protein (CRIM-1) (Cysteine-rich repeat-containing protein S52) [Cleaved into: Processed cysteine-rich motor neuron 1 protein] CRIM1 S52 UNQ1886/PRO4330 1036 P82279 CRUM1_HUMAN Protein crumbs homolog 1 CRB1 1406 Q6UVK1 CSPG4_HUMAN Chondroitin sulfate proteoglycan 4 (Chondroitin sulfate proteoglycan NG2) (Melanoma chondroitin sulfate proteoglycan) (Melanoma-associated chondroitin sulfate proteoglycan) CSPG4 MCSP 2322 P16410 CTLA4_HUMAN Cytotoxic T-lymphocyte protein 4 (Cytotoxic T-lymphocyte-associated antigen 4) (CTLA-4) (CD antigen CD152) CTLA4CD152 223 Q86XM0 CTSRD_HUMAN Cation channel sperm-associated protein subunit delta (CatSper-delta) (CatSperdelta) (Transmembrane protein 146) CATSPERD TMEM146 798 P78310 CXAR_HUMAN Coxsackievirus and adenovirus receptor (CAR) (hCAR) (CVB3-binding protein) (Coxsackievirus B-adenovirus receptor) (HCVADR) CXADRCAR 365 095727 CRTAM_HUMAN Cytotoxic and regulatory T-cell molecule (Class-I MHC-restricted T-cell-associated molecule) (CD antigen CD355) CRTAM 393 P07333 CSF1R_HUMAN Macrophage colony-stimulating factor 1 receptor (CSF-1 receptor) (CSF-1-R) (CSF-1R) (M-CSFR) (EC 2.7.10.1) (Proto-oncogene c-Fms) (CD antigen CD115) CSF1R FMS 972 Q4G0I0 CSMT1_HUMAN Protein CCSMST1 CCSMST1 C16orf91 132 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9H4D0 CSTN2_HUMAN Calsyntenin-2 (Alcadein-gamma) (Alc-gamma) CLSTN2CS2 955 Q9H2A7 CXL16_HUMAN C-X-C motif chemokine 16 (Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein) (SR-PSOX) (Small-inducible cytokine B16) (Transmembrane chemokine CXCL16) CXCL16SCYB16 SRPSOX UNQ2759/PRO6714 254 P08174 DAF_HUMAN Complement decay-accelerating factor (CD antigen CD55) CD55CRDAF 381 Q14118 DAG1_HUMAN Dystroglycan (Dystrophin-associated glycoprotein 1) [Cleaved into: Alpha-dystroglycan (AlphaDG); Beta-dystroglycan (Beta-DG)] DAG1 895 Q96J86 CYYR1_HUMAN Cysteine and tyrosine-rich protein 1 (Proline-rich domain-containing protein) CYYR1 C21orf95 154 P43146 DCCHUMAN Netrin receptor DCC (Colorectal cancer suppressor) (Immunoglobulin superfamily DCC subclass member 1) (Tumor suppressor protein DCC) DCC IGDCC1 1447 Q08345 DDR1_HUMAN Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protein-tyrosine kinase 3A) (Protein-tyrosine kinase RTK-6) (TRK E) (Tyrosine kinase DDR) (Tyrosine-protein kinase CAK) (CD antigen CD167a) DDR1 CAK EDDR1 NEP NTRK4 PTK3A RTK6TRKE 913 Q16832 DDR2_HUMAN Discoidin domain-containing receptor 2 (Discoidin domain receptor 2) (EC 2.7.10.1) (CD167 antigen-like family member B) (Discoidin domain-containing receptor tyrosine kinase 2) (Neurotrophic tyrosine kinase, receptor-related 3) (Receptor protein-tyrosine kinase TKT) (Tyrosine-protein kinase TYRO10) (CD antigen CD167b) DDR2 NTRKR3 TKT TYRO10 855 Q8N8Z6 DCBD1_HUMAN Discoidin, CUB and LCCL domain-containing protein 1 DCBLD1 715 Q96PD2 DCBD2_HUMAN Discoidin, CUB and LCCL domain-containing protein 2 (CUB, LCCL and coagulation factor VA/IIl-homology domains protein 1) (Endothelial and smooth muscle cell-derived neuropilin-like protein) DCBLD2CLCP1 ESDN 775 P28068 DMB_HUMAN HLA class II histocompatibility antigen, DM beta chain (MHC class II antigen DMB) (Really interesting new gene 7 protein) HLA-DMB DMB RING7 263 P80370 DLK1_HUMAN Protein delta homolog 1 (DLK-1) (pG2) [Cleaved into: Fetal antigen 1 (FA1)] DLK1 DLK 383 Q9NYJ7 DLL3_HUMAN Delta-like protein 3 (Drosophila Delta homolog 3) (Delta3) DLL3 618 P28067 DMA_HUMAN HLA class II histocompatibility antigen, DM alpha chain (MHC class II antigen DMA) (Really interesting new gene 6 protein) HLA-DMA DMA RING6 261 P06340 D0A_HUMAN HLA class II histocompatibility antigen, DO alpha chain (MHC DN-alpha) (MHC DZ alpha) (MHC class II antigen DOA) HLA-DOA HLA-DNA HLA-DZA 250 Q6UY11 DLK2_HUMAN Protein delta homolog 2 (DLK-2) (Epidermal growth factor-like protein 9) (EGF-like protein 9) DLK2 EGFL9 UNQ2903/PRO28633 383 2018-03-20Date Re^ue/Date Received 2023-02-27 Q8NFT8 DNER_HUMAN Delta and Notch-like epidermal growth factor-related receptor DNERBET UNQ262/PRO299 737 P20036 DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA-SB alpha chain) (MHO class II DP3-alpha) (MHO class II DPA1) HLA-DPA1 HLADP1AHLASB 260 P79483 DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain (MHC class II antigen DRB3) HLA-DRB3 266 Q96KC8 DNJC1_HUMAN DnaJ homolog subfamily 0 member 1 (DnaJ protein homolog MTJ1) DNAJC1 HTJ1 554 Q8TD84 DSCL1_HUMAN Down syndrome cell adhesion molecule-like protein 1 (Down syndrome cell adhesion molecule 2) DSCAML1 DSCAM2 KIAA1132 2053 000548 DLL1.HUMAN Delta-like protein 1 (Drosophila Delta homolog 1) (Deltal) (H-Delta-1) DLL1 UNQ146/PRO172 723 Q02487 DSC2.HUMAN Desmocollin-2 (Cadherin family member 2) (Desmocollin-3) (Desmosomal glycoprotein II) (Desmosomal glycoprotein III) DSC2CDHF2DSC3 901 060469 DSCAM.HUMAN Down syndrome cell adhesion molecule (CHD2) DSCAM 2012 Q9NR61 DLL4.HUMAN Delta-like protein 4 (Drosophila Delta homolog 4) (Delta4) DLL4 UNQ1895/PRO4341 685 P13765 DOB.HUMAN HLA class II histocompatibility antigen, DO beta chain (MHC class II antigen DOB) HLA-DOB 273 P01906 DQA2.HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain (DX alpha chain) (HLA class II histocompatibility antigen, DQ(6) alpha chain) (HLA-DQA1) (MHC class II DQA2) HLA-DQA2 HLA-DXA 255 P01920 DQB1.HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain (MHC class II antigen DQB1) HLA-DQB1 HLA-DQB 261 Q30154 DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain (DR beta-5) (DR2-beta-2) (Dw2) (MHC class II antigen DRB5) HLA-DRB5 266 Q14574 DSC3.HUMAN Desmocollin-3 (Cadherin family member 3) (Desmocollin-4) (HT-CP) DSC3CDHF3DSC4 896 P01909 DQA1.HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain (DC-1 alpha chain) (DC-alpha) (HLADCA) (MHC class II DQA1) HLA-DQA1 254 P32926 DSG3.HUMAN Desmoglein-3 (130 kDa pemphigus vulgaris antigen) (PVA) (Cadherin family member 6) DSG3CDHF6 999 Q9NZJ5 E2AK3.HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 (EC 2.7.11.1) (PRKR-like endoplasmic reticulum kinase) (Pancreatic elF2-alpha kinase) (HsPEK) EIF2AK3 PEK PERK 1116 P04440 DPB1_HUMAN HLA class II histocompatibility antigen, DP beta1 chain (HLA class II histocompatibility antigen, DP(W4) beta chain) (MHC class II antigen DPB1) HLA-DPB1 HLADP1B 258 P13762 DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain (MHC class II antigen DRB4) HLA-DRB4 266 Q86SJ6 DSG4.HUMAN Deanoglein-4 (Cadherin family member 13) DSG4CDHF13 1040 Q3MIW9 DPCR1.HUMAN Diffuse panbronchiolitis critical region protein 1 DPCR1 C6orf37 PBLT 517 2018-03-20Date Re^ue/Date Received 2023-02-27 P01903 DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (MHO class II antigen DRA) HLA-DRA HLA-DRA1 254 Q08554 DSC1_HUMAN Desmocollin-1 (Cadherin family member 1) (Desmosomal glycoprotein 2/3) (DG2/DG3) DSC1 CDHF1 894 Q02413 DSG1_HUMAN Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) DSG1 CDHF4 1049 P05538 DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain (HLA class II histocompatibility antigen, DX beta chain) (MHC class II antigen DQB2) HLA-DQB2 HLA-DXB 268 Q14126 DSG2_HUMAN Desmoglein-2 (Cadherin family member 5) (HDGC) DSG2CDHF5 1118 P01133 EGF_HUMAN Pro-epidermal growth factor (EGF) [Cleaved into: Epidermal growth factor (Urogastrone)] EGF 1207 Q19T08 ECSCRHUMAN Endothelial cell-specific chemotaxis regulator (Apoptosis regulator through modulating IAP expression) (ARIA) (Endothelial cell-specific molecule 2) ECSCRECSM2 205 Q9UNE0 EDARHUMAN Tumor necrosis factor receptor superfamily member EDAR (Anhidrotic ectodysplasin receptor 1) (Downless homolog) (EDA-A1 receptor) (Ectodermal dysplasia receptor) (Ectodysplasin-A receptor) EDAR DL 448 P98172 EFNB1_HUMAN Ephrin-B1 (EFL-3) (ELK ligand) (ELK-L) (EPH-related receptor tyrosine kinase ligand 2) (LERK- 2) EFNB1 EFL3 EPLG2 LERK2 346 Q15768 EFNB3_HUMAN Ephrin-B3 (EPH-related receptor transmembrane ligand ELK-L3) (EPH-related receptor tyrosine kinase ligand 8) (LERK-8) EFNB3 EPLG8 LERK8 340 Q9NPA0 EMC7_HUMAN ER membrane protein complex subunit 7 EMC7C11orf3 C15orf24 HT022 UNQ905/PRO1926 242 Q902F9 EN113_HUMAN Endogenous retrovirus group K member 113 Env polyprotein (EnvK5 protein) (Envelope polyprotein) (HERV-K113 envelope protein) (HERV-K_19p13.11 provirus ancestral Env polyprotein) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)] HERVKJ13 699 Q6UWV6 ENPP7_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 (E-NPP 7) (NPP-7) (EC 3.1.4.12) (Alkaline sphingomyelin phosphodiesterase) (Intestinal alkaline sphingomyelinase) (Alk-SMase) ENPP7 UNQ3077/PRO9912 458 P61566 ENK24_HUMAN Endogenous retrovirus group K member 24 Env polyprotein (Envelope polyprotein) (HERV-K101 envelope protein) (HERV-K_22q11.21 provirus ancestral Env polyprotein) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)] ERVK-24 588 Q902F8 ENK8_HUMAN Endogenous retrovirus group K member 8 Env polyprotein (EnvK6 protein) (Envelope polyprotein) (HERV-K115 envelope protein) (HERV-K_8p23.1 provirus ancestral Env polyprotein) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)] ERVK-8 699 P29320 EPHA3_HUMAN Ephrin type-A receptor 3 (EC 2.7.10.1) (EPH-like kinase 4) (EK4) (hEK4) (HEK) (Human embryo kinase) (Tyrosine-protein kinase TYRO4) (Tyrosine-protein kinase receptor ETK1) (Eph-like EPHA3 ETK ETK1 HEK TYR04 983 2018-03-20Date Re^ue/Date Received 2023-02-27 tyrosine kinase 1) P54764 EPHA4_HUMAN Ephrin type-A receptor 4 (EC 2.7.10.1) (EPH-like kinase 8) (EK8) (hEK8) (Tyrosine-protein kinase TYRO1) (Tyrosine-protein kinase receptor SEK) EPHA4HEK8SEK TYRO1 986 Q9UF33 EPHA6_HUMAN Ephrin type-A receptor 6 (EC 2.7.10.1) (EPH homology kinase 2) (EHK-2) (EPH-like kinase 12) (EK12) EPHA6EHK2HEK12 1036 Q5JZY3 EPHAA_HUMAN Ephrin type-A receptor 10 (EC 2.7.10.1) EPHA10 1008 P19235 EPOR_HUMAN Erythropoietin receptor (EPO-R) EPOR 508 P04626 ERBB2_HUMAN Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340) ERBB2HER2MLN19 NEU NGL 1255 P52799 EFNB2_HUMAN Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L) EFNB2 EPLG5 HTKL LERK5 333 P17813 EGLN_HUMAN Endoglin (CD antigen CD105) ENG END 658 Q5UCC4 EMC10_HUMAN ER membrane protein complex subunit 10 (Hematopoietic signal peptide-containing membrane domain-containing protein 1) EMC10C19orf63 HSM1 INM02 UNQ764/PRO1556 262 Q69384 ENK6_HUMAN Endogenous retrovirus group K member 6 Env polyprotein (EnvK2 protein) (Envelope polyprotein) (HERV-K(C7) envelope protein) (HERV-K(HML-2,HOM) envelope protein) (HERVK108 envelope protein) (HERV-K_7p22.1 provirus ancestral Env polyprotein) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)] ERVK-6 ERVK6 699 Q9UKH3 ENK9_HUMAN Endogenous retrovirus group K member 9 Env polyprotein (EnvK4 protein) (Envelope polyprotein) (HERV-K(C6) envelope protein) (HERV-K109 envelope protein) (HERV-K_6q14.1 provirus ancestral Env polyprotein) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)] ERVK-9 698 Q6UW88 EPGN_HUMAN Epigen (Epithelial mitogen) (EPG) EPGN UNQ3072/PRO9904 154 P29317 EPHA2_HUMAN Ephrin type-A receptor 2 (EC 2.7.10.1) (Epithelial cell kinase) (Tyrosine-protein kinase receptor ECK) EPHA2 ECK 976 P54753 EPHB3_HUMAN Ephrin type-B receptor 3 (EC 2.7.10.1) (EPH-like tyrosine kinase 2) (EPH-like kinase 2) (Embryonic kinase 2) (EK2) (hEK2) (Tyrosine-protein kinase TYRO6) EPHB3 ETK2 HEK2 TYRO6 998 015197 EPHB6_HUMAN Ephrin type-B receptor 6 (HEP) (Tyrosine-protein kinase-defective receptor EPH-6) EPHB6 1021 014944 EREG_HUMAN Proepiregulin [Cleaved into: Epiregulin (EPR)] EREG 169 B6SEH8 ERW1_HUMAN Endogenous retrovirus group V member 1 Env polyprotein (HERV-V_19q13.41 provirus ERW-1 ENW1 477 2018-03-20Date Re^ue/Date Received 2023-02-27 ancestral Env polyprotein 1) P00533 EGFRHUMAN Epidermal growth factor receptor (EC 2.7.10.1) (Proto-oncogene c-ErbB-1) (Receptor tyrosine¬ protein kinase erbB-1) EGFRERBB ERBB1 HER1 1210 Q8N766 EMC1_HUMAN ER membrane protein complex subunit 1 EMC1 KIAA0090 PSEC0263 993 042043 ENK18_HUMAN Endogenous retrovirus group K member 18 Env polyprotein (Envelope polyprotein) (HERVK(C1a) envelope protein) (HERV-K110 envelope protein) (HERV-K18 envelope protein) (HERVK18 superantigen) (HERV-K_1q23.3 provirus ancestral Env polyprotein) (IDDMK1.2 22 envelope protein) (IDDMK1,2 22 superantigen) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)] ERVK-18 560 071037 ENK19_HUMAN Endogenous retrovirus group K member 19 Env polyprotein (EnvK3 protein) (Envelope polyprotein) (HERV-K(C19) envelope protein) (HERV-K_19q11 provirus ancestral Env polyprotein) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)] ERVK-19 699 Q15375 EPHA7_HUMAN Ephrin type-A receptor 7 (EC 2.7.10.1) (EPH homology kinase 3) (EHK-3) (EPH-like kinase 11) (EK11) (hEK11) EPHA7EHK3HEK11 998 Q9NQ60 EQTN_HUMAN Equatorin (Acrosome formation-associated factor) EQTN AFAF C9orf11 294 P61565 ENK21_HUMAN Endogenous retrovirus group K member 21 Env polyprotein (EnvK1 protein) (Envelope polyprotein) (HERV-K_12q14.1 provirus ancestral Env polyprotein) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)] ERVK-21 698 Q9UNN8 EPCRHUMAN Endothelial protein C receptor (Activated protein C receptor) (APC receptor) (Endothelial cell protein C receptor) (CD antigen CD201) PROCREPCR 238 P54762 EPHB1_HUMAN Ephrin type-B receptor 1 (EC 2.7.10.1) (ELK) (EPH tyrosine kinase 2) (EPH-like kinase 6) (EK6) (hEK6) (Neuronally-expressed EPH-related tyrosine kinase) (NET) (Tyrosine-protein kinase receptor EPH-2) EPHB1 ELK EPHT2 HEK6 NET 984 P54760 EPHB4_HUMAN Ephrin type-B receptor 4 (EC 2.7.10.1) (Hepatoma transmembrane kinase) (Tyrosine-protein kinase TYRO11) EPHB4 HTK MYK1 TYRO11 987 P21860 ERBB3_HUMAN Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3) ERBB3 HER3 1342 A8MVW0 F1712_HUMAN Protein FAM171A2 FAM171A2 826 Q5JX69 F209B_HUMAN Protein FAM209B FAM209B C20orf107 171 P0C7U0 ELFN1_HUMAN Protein ELFN1 (Extracellular leucine-rich repeat and fibronectin type-Ill domain-containing protein 1) (Protein phosphatase 1 regulatory subunit 28) ELFN1 PPP1R28 828 Q6PCB8 EMB_HUMAN Embigin EMB 327 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9Y6X5 ENPP4_HUMAN Bis(5'-adenosyl)-triphosphatase ENPP4 (EC 3,6.1.29) (AP3A hydrolase) (AP3Aase) (Ectonucleotide pyrophosphatase/phosphodiesterase family member 4) (E-NPP 4) (NPP-4) ENPP4 KIAA0879 NPP4 453 P21709 EPHA1_HUMAN Ephrin type-A receptor 1 (hEphal) (EC 2.7.10.1) (EPH tyrosine kinase) (EPH tyrosine kinase 1) (Erythropoietin-producing hepatoma receptor) (Tyrosine-protein kinase receptor EPH) EPHA1 EPH EPHT EPHT1 976 P54756 EPHA5_HUMAN Ephrin type-A receptor 5 (EC 2.7.10.1) (Brain-specific kinase) (EPH homology kinase 1) (EHK-1) (EPH-like kinase 7) (EK7) (hEK7) EPHA5 BSK EHK1 HEK7TYRO4 1037 P29322 EPHA8_HUMAN Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK) EPHA8 EEK HEK3 KIAA1459 1005 P29323 EPHB2_HUMAN Ephrin type-B receptor 2 (EC 2.7.10.1) (Developmentally-regulated Eph-related tyrosine kinase) (ELK-related tyrosine kinase) (EPH tyrosine kinase 3) (EPH-like kinase 5) (EK5) (hEK5) (Renal carcinoma antigen NY-REN-47) (Tyrosine-protein kinase TYRO5) (Tyrosine-protein kinase receptor EPH-3) EPHB2DRTEPHT3 EPTH3 ERK HEK5 TYRO5 1055 P03372 ESR1_HUMAN Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) ESR1 ESRNR3A1 595 Q15884 F1892_HUMAN Protein FAM189A2 (Protein X123) FAM189A2C9orf61 X123 450 P16422 EPCAM_HUMAN Epithelial cell adhesion molecule (Ep-CAM) (Adenocarcinoma-associated antigen) (Cell surface glycoprotein Trop-1) (Epithelial cell surface antigen) (Epithelial glycoprotein) (EGP) (Epithelial glycoprotein 314) (EGP314) (hEGP314) (KS 1/4 antigen) (KSA) (Major gastrointestinal tumorassociated protein GA733-2) (Tumor-associated calcium signal transducer 1) (CD antigen CD326) EPCAM GA733-2 M1S2M4S1 MIC18 TACSTD1 TROP1 314 Q15303 ERBB4_HUMAN Receptor tyrosine-protein kinase erbB-4 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-4) (Tyrosine kinase-type cell surface receptor HER4) (p180erbB4) [Cleaved into: ERBB4 intracellular domain (4ICD) (E4ICD) (s80HER4)l ERBB4 HER4 1308 075460 ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 (Endoplasmic reticulum-to-nucleus signaling 1) (Inositol-requiring protein 1) (hIREIp) (Ire1-alpha) (IRE1a) [Includes: Serine/threonine-protein kinase (EC 2.7.11.1); Endoribonuclease (EC 3.1.26.-)] ERN1 IRE1 977 P58658 EVA1C_HUMAN Protein eva-1 homolog C (Protein FAM176C) (SUE21) EVA1C C21orf63 C21orf64 FAM176C PRED34 UNQ2504/PRO5993 441 P22794 EVI2A_HUMAN Protein EVI2A (Ecotropic viral integration site 2A protein homolog) (EVI-2A) EVI2A EVDA EVI2 236 Q5VUB5 F1711_HUMAN Protein FAM171A1 (Astroprincin) FAM171A1 C10orf38 890 Q6V0I7 FAT4_HUMAN Protocadherin Fat 4 (hFat4) (Cadherin family member 14) (FAT tumor suppressor homolog 4) FAT4CDHF14FATJ 4981 2018-03-20Date ReQue/Date Received 2023-02-27 (Fat-like cadherin protein FAT-J) Nbla00548 Q96PL5 ERMAP_HUMAN Erythroid membrane-associated protein (hERMAP) (Radin blood group antigen) (Scianna blood group antigen) ERMAPRDSC 475 Q76MJ5 ERN2_HUMAN Serine/threonine-protein kinase/endoribonudease IRE2 (Endoplasmic reticulum-to-nucleus signaling 2) (Inositol-requiring protein 2) (hlRE2p) (Ire1-beta) (IRE1b) [Includes: Serine/threonine-protein kinase (EC 2.7.11.1); Endoribonuclease (EC 3.1.26.-)] ERN2 IRE2 926 Q96AP7 ESAM_HUMAN Endothelial cell-selective adhesion molecule ESAM UNQ220/PRO246 390 P34910 EVI2B_HUMAN Protein EVI2B (Ecotropic viral integration site 2B protein homolog) (EVI-2B) (CD antigen CD361) EVI2B EVDB 448 Q3ZCQ3 F174B_HUMAN Membrane protein FAM174B FAM174B 159 Q8WWV6 FCAMR_HUMAN High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor (Fc alpha/mu receptor) (CD antigen CD351) FCAMR FKSG87 532 P30273 FCERG_HUMAN High affinity immunoglobulin epsilon receptor subunit gamma (Fc receptor gamma-chain) (FcRgamma) (Fc-epsilon Rl-gamma) (IgE Fc receptor subunit gamma) (FceRI gamma) FCER1G 86 Q8TBP5 F174A_HUMAN Membrane protein FAM174A (Hepatitis C virus NS5A-transactivated protein 6) (HCV NS5Atransactivated protein 6) (Transmembrane protein 157) FAM174ANS5ATP6 TMEM157 UNQ1912/PRO4371 190 P31995 FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c (IgG Fc receptor ll-c) (CDw32) (Fcgamma RII-c) (Fo-gamma-Rllc) (FcRII-c) (CD antigen CD32) FCGR2CCD32FCG2 IGFR2 323 P55899 FCGRN_HUMAN IgG receptor FcRn large subunit p51 (FcRn) (IgG Fc fragment receptor transporter alpha chain) (Neonatal Fc receptor) FCGRT FCRN 365 Q96LA5 FCRL2_HUMAN Fc receptor-like protein 2 (FcR-like protein 2) (FcRL2) (Fc receptor homolog 2) (FcRH2) (IFGP family protein 4) (Immunoglobulin receptor translocation-associated protein 4) (SH2 domain¬ containing phosphatase anchor protein 1) (CD antigen CD307b) FCRL2 FCRH2 IFGP4IRTA4SPAP1 UNQ9236/PRO31998 508 Q96RD9 FCRL5_HUMAN Fc receptor-like protein 5 (FcR-like protein 5) (FcRL5) (BXMAS1) (Fc receptor homolog 5) (FcRH5) (Immune receptor translocation-associated protein 2) (CD antigen CD307e) FCRL5 FCRH5 IRTA2 UNQ503/PRO820 977 P31994 FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor Il-b (IgG Fc receptor ll-b) (CDw32) (Fcgamma Rll-b) (Fc-gamma-Rllb) (FcRII-b) (CD antigen CD32) FCGR2BCD32FCG2 IGFR2 310 Q96PJ5 FCRL4_HUMAN Fc receptor-like protein 4 (FcR-like protein 4) (FcRL4) (Fc receptor homolog 4) (FcRH4) (IFGP family protein 2) (hlFGP2) (Immune receptor translocation-associated protein 1) (CD antigen CD307d) FCRL4 FCRH4 IFGP2 IRTA1 515 P22607 FGFR3_HUMAN Fibroblast growth factor receptor 3 (FGFR-3) (EC 2.7.10.1) (CD antigen CD333) FGFR3JTK4 806 Q6P995 F171B_HUMAN Protein FAM171B FAM171B KIAA1946 NPD019 826 Os © th a © 2018-03-20Date ReQue/Date Received 2023-02-27 A6NFU0 F187A_HUMAN Ig-like V-lype domain-containing protein FAM187A FAM187A 413 Q17R55 F187B_HUMAN Protein FAM187B (Transmembrane protein 162) FAM187BTMEM162 369 Q5JX71 F209A_HUMAN Protein FAM209A FAM209AC20orf106 171 Q14517 FAT1_HUMAN Protocadherin Fat 1 (Cadherin family member 7) (Cadherin-related tumor suppressor homolog) (Protein fat homolog) (Cleaved into: Protocadherin Fat 1, nuclear form] FAT1 CDHF7 FAT 4588 Q9NYQ8 FAT2_HUMAN Protocadherin Fat 2 (hFat2) (Cadherin family member 8) (Multiple epidermal growth factor-like domains protein 1) (Multiple EGF-like domains protein 1) FAT2CDHF8 KIAA0811 MEGF1 4349 Q8TDW7 FAT3_HUMAN Protocadherin Fat 3 (hFat3) (Cadherin family member 15) (FAT tumor suppressor homolog 3) FAT3CDHF15 KIAA1989 4589 P24071 FCAR_HUMAN Immunoglobulin alpha Fc receptor (IgA Fc receptor) (CD antigen CD89) FCARCD89 287 P12314 FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I (IgG Fc receptor I) (Fc-gamma RI) (FcRI) (Fcgamma RIA) (FcgammaRla) (CD antigen CD64) FCGR1AFCG1 FCGR1 IGFR1 374 Q96LA6 FCRL1_HUMAN Fc receptor-like protein 1 (FcR-like protein 1) (FcRL1) (Fc receptor homolog 1) (FcRH1) (IFGP family protein 1) (hlFGPI) (Immune receptor translocation-associated protein 5) (CD antigen CD307a) FCRL1 FCRH1 IFGP1 IRTA5 429 Q96P31 FCRL3_HUMAN Fc receptor-like protein 3 (FcR-like protein 3) (FcRL3) (Fc receptor homolog 3) (FcRH3) (IFGP family protein 3) (hlFGP3) (Immune receptor translocation-associated protein 3) (SH2 domain¬ containing phosphatase anchor protein 2) (CD antigen CD307c) FCRL3 FCRH3 IFGP3IRTA3SPAP2 734 P12318 FCG2A_HUMAN Low affinity immunoglobulin gamma Fc region receptor 1l-a (IgG Fc receptor ll-a) (CDw32) (Fcgamma Rll-a) (Fc-gamma-Rlla) (FcRII-a) (CD antigen CD32) FCGR2ACD32FCG2 FCGR2A1 IGFR2 317 P08637 FCG3A_HUMAN Low affinity immunoglobulin gamma Fc region receptor 11l-A (CD16a antigen) (Fc-gamma RIIIalpha) (Fc-gamma Rill) (Fc-gamma Rllla) (FcRIII) (FcRIIIa) (FcR-10) (IgG Fc receptor HI-2) (CD antigen CD16a) FCGR3ACD16A FCG3 FCGR3 IGFR3 254 Q92637 FCGRB_HUMAN High affinity immunoglobulin gamma Fc receptor IB (IgG Fc receptor IB) (Fc-gamma RIB) (FcRIB) (hFcgammaRIB) FCGR1B IGFRB 280 Q8N441 FGRL1_HUMAN Fibroblast growth factor receptor-like 1 (FGF receptor-like protein 1) (FGF homologous factor receptor) (FGFR-like protein) (Fibroblast growth factor receptor 5) (FGFR-5) FGFRL1 FGFR5 FHFR UNQ480/PRO943 504 P12319 FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha (Fc-epsilon Rl-alpha) (FcERI) (IgE Fc receptor subunit alpha) FCER1A FCE1A 257 Q6DN72 FCRL6_HUMAN Fc receptor-like protein 6 (FcR-like protein 6) (FcRL6) (Fc receptor homolog 6) (FcRH6) (IFGP6) FCRL6 FCRH6 434 P11362 FGFR1_HUMAN Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331) FGFR1 BFGFR CEK FGFBR FLG FLT2 HBGFR 822 © Ul Ui a © VI 2018-03-20Date Re^ue/Date Received 2023-02-27 P21802 FGFR2_HUMAN Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332) FGFR2 BEK KGFR KSAM 821 A6NKC4 FCGRC_HUMAN Putative high affinity immunoglobulin gamma Fc receptor IC (IgG Fc receptor IC) (Fc-gamma RIC) (FoRIC) (hFcgammaRIC) FCGR1C IGFRC 280 Q9H6D8 FNDC4_HUMAN Fibronectin type III domain-containing protein 4 (Fibronectin type III repeat-containing protein 1) FNDC4 FRCP1 UNQ6389/PRO21134 234 Q9P2B2 FPRP_HUMAN Prostaglandin F2 receptor negative regulator (CD9 partner 1) (CD9P-1) (Glu-Trp-lle EWI motif¬ containing protein F) (EWI-F) (Prostaglandin F2-alpha receptor regulatory protein) (Prostaglandin F2-alpha receptor-associated protein) (CD antigen CD315) PTGFRN CD9P1 EWIF FPRP KIAA1436 879 Q5SZK8 FREM2_HUMAN FRAS1-related extracellular matrix protein 2 (ECM3 homolog) FREM2 3169 P22455 FGFR4_HUMAN Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334) FGFR4JTK2TKF 802 095866 G6B_HUMAN Protein G6b G6BC6orf25 241 P49771 FLT3L_HUMAN Fms-related tyrosine kinase 3 ligand (Flt3 ligand) (Flt3L) (SL cytokine) FLT3LG 235 P59646 FXYD4_HUMAN FXYD domain-containing ion transport regulator 4 FXYD4 UNQ526/PRO1069 89 P36888 FLT3_HUMAN Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase-2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Stem cell tyrosine kinase 1) (STK-1) (CD antigen CD135) FLT3CD135FLK2 STK1 993 Q8NAU1 FNDC5_HUMAN Fibronectin type III domain-containing protein 5 (Fibronectin type III repeat-containing protein 2) [Cleaved into: Irisin] FNDC5 FRCP2 212 Q86XX4 FRAS1_HUMAN Extracellular matrix protein FRAS1 FRAS1 KIAA1500 4008 P09958 FURIN_HUMAN Furin (EC 3.4.21.75) (Dibasic-processing enzyme) (Paired basic amino add residue-cleaving enzyme) (PACE) FURIN FUR PACE PCSK3 794 Q14802 FXYD3_HUMAN FXYD domain-containing ion transport regulator 3 (Chloride conductance inducer protein Mat-8) (Mammary tumor 8 kDa protein) (Phospholemman-like) FXYD3 MAT8 PLML 87 Q9H0Q3 FXYD6_HUMAN FXYD domain-containing ion transport regulator 6 (Phosphohippolin) FXYD6 UNQ521/PRO1056 95 Q96DB9 FXYD5_HUMAN FXYD domain-containing ion transport regulators (Dysadherin) FXYD5 DYSAD IWU1 HSPC113 UNQ2561/PRO6241 178 P58550 FXYD8_HUMAN Putative FXYD domain-containing ion transport regulator 8 FXYD6P3 FXYD8 94 I3L273 GFY_HUMAN Golgi-assodated olfactory signaling regulator (Protein Goofy) GFY 518 P06028 GLPB_HUMAN Glycophorin-B (PAS-3) (SS-active sialoglycoprotein) (Sialoglycoprotein delta) (CD antigen GYPB GPB 91 2018-03-20Date Re^ue/Date Received 2023-02-27 CD235b) P10912 GHRHUMAN Growth hormone receptor (GH receptor) (Somatotropin receptor) [Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)! GHR 638 P15421 GLPE_HUMAN Glycophorin-E GYPE GPE 78 P13224 GP1BB_HUMAN Platelet glycoprotein lb beta chain (GP-lb beta) (GPIb-beta) (GPIbB) (Antigen CD42b-beta) (CD antigen CD42c) GP1BB 206 Q9NU53 GINM1_HUMAN Glycoprotein integral membrane protein 1 GINM1 C6orf72 UNQ710/PRO1361 330 P02724 GLPA_HUMAN Glycophorin-A (MN sialoglycoprotein) (PAS-2) (Sialoglycoprotein alpha) (CD antigen CD235a) GYPAGPA 150 Q3T906 GNPTA_HUMAN N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (EC 2.7.8.17) (GlcNAc-1- phosphotransferase subunits alpha/beta) (Stealth protein GNPTAB) (UDP-N-acetylglucosamine- 1-phosphotransferase subunits alpha/beta) [Cleaved into: N-acetylglucosamine-1- phosphotransferase subunit alpha; N-acetylglucosamine-1-phosphotransferase subunit beta] GNPTAB GNPTA KIAA1208 1256 Q8WWB7 GLMP_HUMAN Glycosylated lysosomal membrane protein (Lysosomal protein NCU-G1) GLMPC1orf85 PSEC0030 UNQ2553/PRO6182 406 P07359 GP1BA_HUMAN Platelet glycoprotein lb alpha chain (GP-lb alpha) (GPIb-alpha) (GPIbA) (Glycoprotein Ibalpha) (Antigen CD42b-alpha) (CD antigen CD42b) [Cleaved into: Glycocalicin] GP1BA 652 P40197 GPVHUMAN Platelet glycoprotein V (GPV) (Glycoprotein 5) (CD antigen CD42d) GP5 560 Q99795 GPA33_HUMAN Cell surface A33 antigen (Glycoprotein A33) GPA33 319 P14770 GPIX_HUMAN Platelet glycoprotein IX (GP-IX) (GPIX) (Glycoprotein 9) (CD antigen CD42a) GP9 177 Q86XS8 GOLLHUMAN E3 ubiquitin-protein ligase RNF130 (EC 6.3.2.-) (Goliath homolog) (H-Goliath) (RING finger protein 130) RNF130 419 P25092 GUC2C_HUMAN Heat-stable enterotoxin receptor (STA receptor) (hSTAR) (EC 4.6.1.2) (Guanylyl cyclase C) (GC-C) (Intestinal guanylate cyclase) GUCY2C GUC2C STAR 1073 Q14789 G0GB1_H(JMAN Golgin subfamily B member 1 (372 kDa Golgi complex-associated protein) (GCP372) (Giantin) (Macrogolgin) GOLGB1 3259 Q14956 GPNMB_HUMAN Transmembrane glycoprotein NMB (Transmembrane glycoprotein HGFIN) GPNMB HGFIN NMB UNQ1725/PRO9925 572 P51841 GUC2F_HUMAN Retinal guanylyl cyclase 2 (RETGC-2) (EC 4.6.1.2) (Guanylate cyclase 2F, retinal) (Guanylate cyclase F) (GC-F) (Rod outer segment membrane guanylate cyclase 2) (R0S-GC2) GUCY2FGUC2F RETGC2 1108 Q92643 GPI8_HUMAN GPI-anchor transamidase (GPI transamidase) (EC 3.-.-.-) (GPI8 homolog) (hGPI8) (Phosphatidylinositol-glycan biosynthesis class K protein) (PIG-K) PIGK GPI8 395 2018-03-20Date Re^ue/Date Received 2023-02-27 Q02846 GUC2D_HUMAN Retinal guanylyl cyclase 1 (RETGC-1) (EC 4.6.1,2) (Guanylate cyclase 2D, retinal) (Rod outer segment membrane guanylate cyclase) (ROS-GC) GUCY2D CORD6 GUC1A4GUC2D RETGC RETGC1 1103 Q9UBK5 HCST_HUMAN Hematopoietic cell signal transducer (DNAX-activation protein 10) (Membrane protein DAP10) (Transmembrane adapter protein KAP10) HCSTDAP10KAP10 PIK3AP UNQ587/PRO1157 93 Q14CZ8 HECAM_HUMAN Hepatocyte cell adhesion molecule (Protein hepaCAM) HEPACAM 416 A8MVW5 HECA2_HUMAN HEPACAM family member 2 (Mitotic kinetics regulator) HEPACAM2 MIKI UNQ305/PRO346 462 Q9ULI3 HEG1_HUMAN Protein HEG homolog1 HEG1 KIAA1237 1381 Q92896 GSLG1_HUMAN Golgi apparatus protein 1 (CFR-1) (Cysteine-rich fibroblast growth factor receptor) (E-selectin ligand 1) (ESL-1) (Golgi sialoglycoprotein MG-160) GLG1 CFR1 ESL1 MG160 1179 Q99075 HBEGF_HUMAN Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor (HB-EGF) (HBEGF) (Diphtheria toxin receptor) (DT-R)l HBEGF DTR DTS HEGFL 208 Q96D42 HAVR1_HUMAN Hepatitis A virus cellular receptor 1 (HAVcr-1) (Kidney injury molecule 1) (KIM-1) (T-cell immunoglobulin and mucin domain-containing protein 1) (TIMD-1) (T-cell immunoglobulin mucin receptor 1) (TIM) (TIM-1) (T-cell membrane protein 1) HAVCR1 KIM1 TIM1 TIMD1 359 Q8TDQ0 HAVR2_HUMAN Hepatitis A virus cellular receptor 2 (HAVcr-2) (T-cell immunoglobulin and mucin domain¬ containing protein 3) (TIMD-3) (T-cell immunoglobulin mucin receptor 3) (TIM-3) (T-cell membrane protein 3) HAVCR2TIM3TIMD3 301 Q30201 HFE_HUMAN Hereditary hemochromatosis protein (HLA-H) HFE HLAH 348 P30511 HLAF-HUMAN HLA classI histocompatibility antigen, alpha chain F (CDA12) (HLA F antigen) (Leukocyte antigen F) (MHC classI antigen F) HLA-F HLA-5.4 HLAF 346 A8MVS5 HIDE1_HUMAN Protein HIDE1 HIDE1 C19orf38 230 P13747 HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E (MHC classI antigen E) HLA-E HLA-6.2 HLAE 358 Q9BQS7 HEPH_HUMAN Hephaestin (EC 1.-.-.-) HEPH KIAA0698 UNQ2562/PRO6242 1158 Q95460 HMR1_HUMAN Major histocompatibility complex class l-related gene protein (MHC class l-related gene protein) (ClassI histocompatibility antigen-like protein) MR1 341 Q6MZM0 HPHL1_HUMAN Hephaestin-like protein 1 (EC 1.-.-.-) HEPHL1 1159 Q9UM44 HHLA2_HUMAN HERV-H LTR-associating protein 2 (Human endogenous retrovirus-H long terminal repeat¬ associating protein 2) HHLA2 414 P17693 HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G (HLA G antigen) (MHC classI antigen G) HLA-G HLA-6.0 338 2018-03-20Date Re^ue/Date Received 2023-02-27 HLAG Q08334 I1OR2_HUMAN lnterleukin-10 receptor subunit beta (IL-10 receptor subunit beta) (IL-10R subunit beta) (IL- 10RB) (Cytokine receptor dass-lI member 4) (Cytokine receptor family 2 member 4) (CRF2-4) (Interleukin-10 receptor subunit 2) (IL-1OR subunit 2) (IL-10R2) (CD antigen CDw210b) IL10RBCRFB4 D21S58D21S66 325 Q96F46 I17RAHUMAN Interleukin-17 receptorA (IL-17 receptor A) (IL-17RA) (CDw217) (CD antigen CD217) IL17RA IL17R 866 Q99665 I12R2_HUMAN Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL- 12R-beta-2) (IL-12RB2) IL12RB2 862 Q14627 I13R2_HUMAN Interieukin-13 receptor subunit alpha-2 (IL-13 receptor subunit alpha-2) (IL-13R subunit alpha-2) (IL-13R-alpha-2) (IL-13RA2) (lnterieukin-13-bindinq protein) (CD antigen CD213a2) IL13RA2 IL13R 380 Q9NRM6 I17RB_HUMAN Interleukin-17 receptor B (IL-17 receptor B) (IL-17RB) (Cytokine receptor-like 4) (IL-17 receptor homolog 1) (IL-17Rh1) (IL17Rh1) (lnterleukin-17B receptor) (IL-17B receptor) IL17RBCRL4 EVI27 IL17BR UNQ2501/PRO19612 502 Q8NFM7 I17RD_HUMAN Interleukin-17 receptor D (IL-17 receptor D) (IL-17RD) (IL17Rhom) (Interleukin-17 receptor-like protein) (Sef homolog) (hSef) IL17RD IL17RLM SEF UNQ6115/PRO20026 739 Q8N6P7 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 (IL-22 receptor subunit alpha-1) (IL-22R-alpha-1) (IL- 22RA1) (Cytokine receptor dass-ll member 9) (Cytokine receptor family 2 member 9) (CRF2-9) (ZcytoRU) IL22RA1 IL22R 574 Q9UMF0 ICAM5_HUMAN Intercellular adhesion molecule 5 (ICAM-5) (Telencephalin) ICAM5TLCN TLN 924 P42701 I12R1_HUMAN lnterleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL- 12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212) IL12RB1 IL12R IL12RB 662 P78552 I13R1_HUMAN lnterleukin-13 receptor subunit alpha-1 (IL-13 receptor subunit alpha-1) (IL-13R subunit alpha-1) (IL-13R-alpha-1) (IL-13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1) IL13RA1 IL13R IL13RA 427 Q8NFR9 I17RE_HUMAN Interleukin-17 receptor E (IL-17 receptor E) (IL-17RE) IL17RE UNQ3056/PRO9877 667 095256 I18RA_HUMAN Interleukin-18 receptor accessory protein (IL-18 receptor accessory protein) (IL-18RAcP) (Accessory protein-like) (AcPL) (CD218 antigen-like family member B) (CDw218b) (IL-1R accessory protein-like) (IL-1RAcPL) (lnterleukin-1 receptor?] (IL-1R-7) (IL-1R7) (Interleukin-18 receptor accessory protein-like) (Interleukin-18 receptor beta) (IL-18R-beta) (IL-18Rbeta) (CD antigen CD218b) IL18RAP IL1R7 599 Q6UXL0 I2ORB_HUMAN Interleukin-20 receptor subunit beta (IL-20 receptor subunit beta) (IL-20R-beta) (IL-20RB) (Fibronectin type III domain containing 6) (FNDC6) (IL-20R2) IL20RBDIRS1 UNQ557/PRO1114 311 P32942 ICAM3_HUMAN Intercellular adhesion molecule 3 (ICAM-3) (CDw50) (ICAM-R) (CD antigen CD50) ICAM3 547 Q13261 I15RA_HUMAN lnterleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) IL15RA 267 2018-03-20Date ReQue/Date Received 2023-02-27 (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (slL-15 receptor subunit alpha) (slL-15R-alpha) (slL-15RA)] Q9H2X8 I27L2_HUMAN Interferon alpha-inducible protein 27-like protein 2 (Interferon-stimulated gene 12b protein) (ISG12(b)) (Protein TLH29) (plFI27-like protein) IFI27L2 FAM14A TLH29 130 Q9Y6W8 IC0S_HUMAN Inducible T-cell costimulator (Activation-inducible lymphocyte immunomediatory molecule) (CD antigen CD278) ICOS AILIM 199 P13598 ICAM2_HUMAN Intercellular adhesion molecule 2 (ICAM-2) (CD antigen CD102) ICAM2 275 P98153 IDD_HUMAN Integral membrane protein DGCR2/IDD DGCR2 IDD KIAA0163 550 075054 IGSF3_HUMAN Immunoglobulin superfamily member 3 (lgSF3) (Glu-Trp-lle EWI motif-containing protein 3) (EWI-3) IGSF3 EWI3 KIAA0466 1194 P01589 IL2RA_HUMAN lnterleukin-2 receptor subunit alpha (IL-2 receptor subunit alpha) (IL-2-RA) (IL-2R subunit alpha) (IL2-RA) (TAC antigen) (p55) (CD antigen CD25) IL2RA 272 P26951 IL3RA_HUMAN lnterleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3Ralpha) (IL-3RA) (CD antigen CD123) IL3RA IL3R 378 P24394 IL4RA_HUMAN lnterleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4Ralpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (slL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)] IL4R IL4RA582J2.1 825 Q8NAC3 I17RC_HUMAN Interleukin-17 receptor C (IL-17 receptorC) (IL-17RC) (Interleukin-17 receptor homolog) (IL17Rhom) (Interleukin-17 receptor-like protein) (IL-17RL) (ZcytoRI4) IL17RC UNQ6118/PRO20040 /PRO38901 791 Q9UHF4 I2ORA_HUMAN Interleukin-20 receptor subunit alpha (IL-20 receptor subunit alpha) (IL-20R-alpha) (IL-20RA) (Cytokine receptor class-11 member 8) (Cytokine receptor family 2 member 8) (CRF2-8) (1L- 20R1) (ZcytoR7) IL20RA UNQ681/PRO1315 553 Q6UWB1 I27RA_HUMAN Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL- 27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoRI) IL27RACRL1 TCCR WSX1 UNQ296/PRO336 636 Q9H665 IGFR1_HUMAN IGF-like family receptor 1 (Transmembrane protein 149) (U2 small nuclear RNA auxiliary factor 1-like 4) IGFLR1 TMEM149 U2AF1L4 355 P01880 IGHD_HUMAN Ig delta chain C region IGHD 384 Q5DX21 IGS11_HUMAN Immunoglobulin superfamily member 11 (IgSF11) (Brain and testis-specific immunoglobulin superfamily protein) (Bt-IGSF) (V-set and immunoglobulin domain-containing protein 3) IGSF11 BTIGSF CXADRL1 VSIG3 431 Q93033 IGSF2_HUMAN Immunoglobulin superfamily member 2 (IgSF2) (Cell surface glycoprotein V7) (Glu-Trp-lle EWI CD101 EWI101 1021 © Ul Ui a © VI 2018-03-20Date Re^ue/Date Received 2023-02-27 motif-containing protein 101) (EWI-101) (CD antigen CD101) IGSF2V7 Q9HBE5 IL21R_HUMAN Interleukin-21 receptor (IL-21 receptor) (IL-21R) (Novel interleukin receptor) (CD antigen CD360) IL21R NILR UNQ3121/PRO10273 538 Q71H61 ILDR2_HUMAN Immunoglobulin-like domain-containing receptor 2 ILDR2C1orf32 639 075144 ICOSL.HUMAN IGOS ligand (B7 homolog 2) (B7-H2) (B7-like protein GI50) (B7-related protein 1) (B7RP-1) (CD antigen CD275) ICOSLG B7H2 B7RP1 ICOSL KIAA0653 302 Q8TDY8 IGDC4_HUMAN Immunoglobulin superfamily DCC subclass member 4 (Neighbor of punc e11) (Protein DDM36) (hDDM36) IGDCC4DDM36 KIAA1628 NOPE 1250 P01871 IGHM_HUMAN Ig mu chain C region IGHM 452 095976 IGSF6_HUMAN Immunoglobulin superfamily member 6 (lgSF6) (Protein DORA) IGSF6DORA 241 Q9NPH3 IL1AP_HUMAN lnterleukin-1 receptor accessory protein (IL-1 receptor accessory protein) (IL-1RAcP) (lnterleukin-1 receptor 3) (IL-1R-3) (IL-1R3) IL1RAPC3orf13 IL1R3 570 P31785 IL2RG.HUMAN Cytokine receptor common subunit gamma (lnterleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132) IL2RG 369 P32927 IL3RB_HUMAN Cytokine receptor common subunit beta (CDw131) (GM-CSF/IL-3/IL-5 receptor common beta subunit) (CD antigen CD131) CSF2RB IL3RB IL5RB 897 Q01113 IL9R_HUMAN lnterleukin-9 receptor (IL-9 receptor) (IL-9R) (CD antigen CD129) IL9R 521 Q9HB29 ILRL2_HUMAN lnterleukin-1 receptor-like 2 (IL-36 receptor) (IL-36R) (Interleukin-1 receptor-related protein 2) (IL-1Rfp2)(IL1R-rp2) IL1RL2IL1RRP2 575 P15260 INGR1.HUMAN Interferon gamma receptor 1 (IFN-gamma receptor 1) (IFN-gamma-R1) (CDw119) (CD antigen CD119) IFNGR1 489 Q13651 I1OR1_HUMAN Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL- 10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210) IL10RA IL10R 578 Q14626 I11RA_HUMAN lnterleukin-11 receptor subunit alpha (IL-11 receptor subunit alpha) (IL-11R subunit alpha) (IL- 11R-alpha) (IL-11RA) IL11RA 422 P05362 ICAM1_HUMAN Intercellular adhesion molecule 1 (ICAM-1) (Major group rhinovirus receptor) (CD antigen CD54) ICAM1 532 014773 ICAM4_HUMAN Intercellular adhesion molecule 4 (ICAM-4) (Landsteiner-Wiener blood group glycoprotein) (LW blood group protein) (CD antigen CD242) ICAM4 LW 271 Q9NSI5 IGSF5_HUMAN Immunoglobulin superfamily member 5 (lgSF5) (Junctional adhesion molecule 4) (JAM-4) IGSF5JAM4 407 P14778 IL1R1_HUMAN lnterleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (CD121 antigen-like family member A) (lnterleukin-1 receptor alpha) (IL-1R-alpha) (lnterleukin-1 receptor type I) (p80) (CD antigen IL1R1 IL1R IL1RA IL1RT1 569 2018-03-20Date Re^ue/Date Received 2023-02-27 CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mlL-1R1) (mlL-1RI); lnterleukin-1 receptor type 1, soluble form (slL-1R1) (slL-1RI)l Q8NI17 IL31R_HUMAN Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL- 31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17) IL31RACRL3GPL UNQ6368/PRO21073 /PRO21384 732 Q01344 IL5RA_HUMAN lnterleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5Ralpha) (IL-5RA) (CDw125) (CD antigen CD125) IL5RA IL5R 420 P16871 IL7RA_HUMAN lnterleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7Ralpha) (IL-7RA) (CDw127) (CD antigen CD127) IL7R 459 P08887 IL6RA_HUMAN lnterleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6Ralpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (qp80) (CD antigen CD126) IL6R 468 Q01638 ILRL1_HUMAN lnteiieukin-1 receptor-like 1 (Protein ST2) IL1RL1 DER4ST2T1 556 P06213 INSR_HUMAN Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta] INSR 1382 P08069 IGF1R.HUMAN Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factorI receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] IGF1R 1367 P14784 IL2RB_HUMAN lnterleukin-2 receptor subunit beta (IL-2 receptor subunit beta) (IL-2R subunit beta) (IL-2RB) (High affinity IL-2 receptor subunit beta) (p70-75) (p75) (CD antigen CD122) IL2RB 551 Q86SU0 ILDR1_HUMAN Immunoglobulin-like domain-containing receptor 1 ILDR1 546 P14616 INSRR_HUMAN Insulin receptor-related protein (IRR) (EC 2.7.10.1) (IR-related receptor) [Cleaved into: Insulin receptor-related protein alpha chain; Insulin receptor-related protein beta chain] INSRR IRR 1297 Q13478 IL18R_HUMAN Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (CD antigen CD218a) IL18R1 IL1RRP 541 Q5VWK5 IL23R_HUMAN Interleukin-23 receptor (IL-23 receptor) (IL-23R) IL23R 629 Q9BZV3 IMPG2_HUMAN Interphotoreceptor matrix proteoglycan 2 (Interphotoreceptor matrix proteoglycan of 200 kDa) (IPM 200) (Sialoprotein associated with cones and rods proteoglycan) (Spacrcan) IMPG2 IPM200 1241 Q8IU57 INLR1_HUMAN Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor dassII member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2) IFNLR1 IL28RA LICR2 520 Q6GPH6 IPIL1HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 ITPRIPL1 KIAA1754L 555 Q9NP60 IRPL2_HUMAN X-linked interieukin-1 receptor accessory protein-like 2 (IL-1 receptor accessory protein-like 2) (IL-1-RAPL-2) (IL-1RAPL-2) (IL1RAPL-2) (IL1RAPL-2-related protein) (lnterieukin-1 receptor9) IL1RAPL2IL1R9 686 2018-03-20Date Re^ue/Date Received 2023-02-27 (IL-1R-9) (IL-1R9) (Three immunoglobulin domain-containing IL-1 receptor-related 1) (TIGIRR-1) Q8IVU1 IGDC3_HUMAN Immunoglobulin superfamily DCC subclass member 3 (Putative neuronal cell adhesion molecule) IGDCC3 PUNC 814 P17181 INAR1_HUMAN Interferon alpha/beta receptor 1 (IFN-R-1) (IFN-alpha/beta receptor 1) (Cytokine receptor dass-ll member 1) (Cytokine receptor family 2 member 1) (CRF2-1) (Type I interferon receptor 1) IFNAR1 IFNAR 557 Q13683 ITA7_HUMAN Integrin alpha-7 [Cleaved into: Integrin alpha-7 heavy chain; Integrin alpha-7 light chain; Integrin alpha-7 70 kDa form] ITGA7 UNQ406/PRO768 1181 P53708 ITA8_HUMAN Integrin alpha-8 [Cleaved into: Integrin alpha-8 heavy chain; Integrin alpha-8 light chain] ITGA8 1063 Q13349 ITAD_HUMAN Integrin alpha-D (ADB2) (CD11 antigen-like family member D) (Leukointegrin alpha D) (CD antigen CD11d) ITGAD 1161 P06756 ITAVHUMAN Integrin alpha-V (Vitronectin receptor subunit alpha) (CD antigen CD51) [Cleaved into: Integrin alpha-V heavy chain; Integrin alpha-V light chain] ITGAVMSK8VNRA 1048 Q6UXV1 IZUM2_HUMAN Izumo sperm-egg fusion protein 2 IZUMO2 C19orf41 SCRL UNQ6978/PRO21961 221 P27930 IL1R2_HUMAN lnterleukin-1 receptor type 2 (IL-1R-2) (IL-1RT-2) (IL-1RT2) (CD121 antigen-like family member B) (CDw121b) (IL-1 type II receptor) (lnterleukin-1 receptor beta) (IL-1R-beta) (lnterleukin-1 receptor type II) (CD antigen CD121b) [Cleaved into: lnterleukin-1 receptor type 2, membrane form (mlL-1R2) (mlL-1RII); lnterleukin-1 receptor type 2, soluble form (slL-1R2) (slL-1RII)] IL1R2 IL1RB 398 P40189 IL6RB_HUMAN lnterieukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (lL-6R-beta) (IL-6RB) (CDw130) (lnterieukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130) IL6ST 918 PI7301 ITA2_HUMAN Integrin alpha-2 (CD49 antigen-like family member B) (Collagen receptor) (Platelet membrane glycoprotein la) (GPIa) (VLA-2 subunit alpha) (CD antigen CD49b) ITGA2CD49B 1181 P26006 ITA3_HUMAN Integrin alpha-3 (CD49 antigen-like family member C) (FRP-2) (Galactoprotein B3) (GAPB3) (VLA-3 subunit alpha) (CD antigen CD49c) [Cleaved into: Integrin alpha-3 heavy chain; Integrin alpha-3 light chain] ITGA3MSK18 1051 P11215 ITAM_HUMAN Integrin alpha-M (CD11 antigen-like family member B) (CR-3 alpha chain) (Cell surface glycoprotein MAC-1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b) ITGAM CD11BCR3A 1152 P16144 ITB4_HUMAN Integrin beta-4 (GP150) (CD antigen CD104) ITGB4 1822 075578 ITA10_HUMAN Integrin alpha-10 ITGA10 UNQ468/PRO827 1167 P56199 ITA1_HUMAN Integrin alpha-1 (CD49 antigen-like family member A) (Laminin and collagen receptor) (VLA-1) ITGA1 1179 2018-03-20Date Re^ue/Date Received 2023-02-27 (CD antigen CD49a) P08514 ITA2B_HUMAN Integrin alpha-lib (GPalpha lib) (GPIIb) (Platelet membrane glycoprotein lib) (CD antigen CD41) [Cleaved into: Integrin alpha-lib heavy chain; Integrin alpha-ilb light chain, form 1; Integrin alphalib light chain, form 2] ITGA2BGP2B ITGAB 1039 P08648 ITA5_HUMAN Integrin alpha-5 (CD49 antigen-like family member E) (Fibronectin receptor subunit alpha) (Integrin alpha-F) (VLA-5) (CD antigen CD49e) [Cleaved into: Integrin alpha-5 heavy chain; Integrin alpha-5 light chain] ITGA5 FNRA 1049 P38570 ITAE_HUMAN Integrin alpha-E (HML-1 antigen) (Integrin alpha-IEL) (Mucosal lymphocyte 1 antigen) (CD antigen CD103) [Cleaved into: Integrin alpha-E light chain; Integrin alpha-E heavy chain] ITGAE 1179 P20702 ITAX.HUMAN Integrin alpha-X (CD11 antigen-like family member C) (Leu M5) (Leukocyte adhesion glycoprotein p150,95 alpha chain) (Leukocyte adhesion receptor p150,95) (CD antigen CD11c) ITGAXCD11C 1163 P05106 ITB3_HUMAN Integrin beta-3 (Platelet membrane glycoprotein Illa) (GPIIIa) (CD antigen CD61) ITGB3GP3A 788 Q5VZ72 IZUM3_HUMAN Izumo sperm-egg fusion protein 3 IZUMO3 C9orf134 239 P78504 JAG1_HUMAN Protein jagged-1 (Jaggedl) (hJ1) (CD antigen CD339) JAG1 JAGL1 1218 A8MWY0 K132L_HUMAN UPF0577 protein KIAA1324-like (Estrogen-induced gene 121-like protein) (hEIG121L) KIAA1324L EIG121L 1029 P48551 INAR2_HUMAN Interferon alpha/beta receptor 2 (IFN-R-2) (IFN-alpha binding protein) (IFN-alpha/beta receptor 2) (Interferon alpha binding protein) (TypeI interferon receptor 2) IFNAR2 IFNABR IFNARB 515 P38484 INGR2_HUMAN Interferon gamma receptor 2 (IFN-gamma receptor 2) (IFN-gamma-R2) (Interferon gamma receptor accessory factor 1) (AF-1) (Interferon gamma transducer 1) IFNGR2 IFNGT1 337 Q3MIP1 IPIL2_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein-like 2 ITPRIPL2 535 Q6UXG2 K1324_HUMAN UPF0577 protein KIAA1324 (Estrogen-induced gene 121 protein) KIAA1324 EIG121 UNQ2426/PRO4985 1013 Q3SXP7 K1644_HUMAN Uncharacterized protein KIAA1644 KIAA1644 199 Q9NZN1 IRPL1_HUMAN lnterieukin-1 receptor accessory protein-like 1 (IL-1-RAPL-1) (IL-1RAPL-1) (IL1RAPL-1) (Oligophrenin-4) (Three immunoglobulin domain-containing IL-1 receptor-related 2) (TIGIRR-2) (X-linked interleukin-1 receptor accessory protein-like 1) IL1RAPL1 OPHN4 696 Q9UKX5 ITA11_HUMAN Integrin alpha-11 ITGA11 MSTP018 1188 P05556 ITB1_HUMAN Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein Ila) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29) ITGB1 FNRB MDF2 MSK12 798 P05107 ITB2_HUMAN Integrin beta-2 (Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta) (Complement receptor C3 subunit beta) (CD antigen CD18) ITGB2CD18MFI7 769 P18564 ITB6_HUMAN Integrin beta-6 ITGB6 788 P26010 ITB7_HUMAN Integrin beta-7 (Gut homing receptor beta subunit) ITGB7 798 2018-03-20Date Re^ue/Date Received 2023-02-27 P26012 ITB8_HUMAN Integrin beta-8 ITGB8 769 Q9Y624 JAM1_HUMAN Junctional adhesion molecule A (JAM-A) (Junctional adhesion molecule 1) (JAM-1) (Platelet F11 receptor) (Platelet adhesion molecule 1) (PAM-1) (CD antigen CD321) F11RJAM1 JCAM UNQ264/PRO301 299 Q9BX67 JAM3_HUMAN Junctional adhesion molecule C (JAM-C) (JAM-2) (Junctional adhesion molecule 3) (JAM-3) JAM3 UNQ859/PRO1868 310 Q8IYV9 IZUM1_HUMAN Izumo sperm-egg fusion protein 1 (Oocyte binding/fusion factor) (OBF) (Sperm-specific protein izumo) IZUMO1 350 Q9UJ90 KCNE5_HUMAN Potassium voltage-gated channel subfamily E regulatory beta subunit 5 (AMME syndrome candidate gene 2 protein) (Potassium channel subunit beta MiRP4) (Potassium voltage-gated channel subfamily E member 1-like protein) KCNE5AMMECR2 KCNE1L 142 P13612 ITA4_HUMAN Integrin alpha-4 (CD49 antigen-like family member D) (Integrin alpha-IV) (VLA-4 subunit alpha) (CD antigen CD49d) ITGA4CD49D 1032 P23229 ITA6_HUMAN Integrin alpha-5 (CD49 antigen-like family member F) (VLA-6) (CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain; Integrin alpha-6 light chain; Processed integrin alpha-6 (Alpha6p)l ITGA6 1130 Q13797 ITA9_HUMAN Integrin alpha-9 (Integrin alpha-RLC) ITGA9 1035 P20701 ITAL_HUMAN Integrin alpha-L (CD11 antigen-like family member A) (Leukocyte adhesion glycoprotein LFA-1 alpha chain) (LFA-1A) (Leukocyte function-associated molecule 1 alpha chain) (CD antigen CD11a) ITGALCD11A 1170 P18084 ITB5_HUMAN Integrin beta-5 ITGB5 799 Q9Y219 JAG2_HUMAN Protein jagged-2 (Jagged2) (hJ2) JAG2 1238 Q5W43 K0319_HUMAN Dyslexia-associated protein KIAA0319 KIAA0319 1072 Q8IYS2 K2013_HUMAN Uncharacterized protein KIAA2013 KIAA2013 634 P57087 JAM2_HUMAN Junctional adhesion molecule B (JAM-B) (Junctional adhesion molecule 2) (JAM-2) (Vascular endothelial junction-associated molecule) (VE-JAM) (CD antigen CD322) JAM2C21orf43 VEJAM UNQ219/PRO245 298 Q86YT9 JAML_HUMAN Junctional adhesion molecule-like (Adhesion molecule interacting with CXADR antigen 1) (Dendritic cell-specific protein CREA7-1) JAMLAMICA1 UNQ722/PRO1387 394 A0A087W TH5 KCE1B_HUMAN Potassium voltage-gated channel subfamily E member 1B KCNE1B 132 Q8NC54 KCT2_HUMAN Keratinocyte-associated transmembrane protein 2 KCT2C5orf15 HTGN29 265 Q6UWL6 KIRR2_HUMAN Kin of IRRE-like protein 2 (Kin of irregular chiasm-like protein 2) (Nephrin-like protein 3) KIRREL2 NEPH3 UNQ5827/PRO19646 708 2018-03-20Date ReQue/Date Received 2023-02-27 076095 JTB_HUMAN Protein JTB (Jumping translocation breakpoint protein) (Prostate androgen-regulated protein) (PAR protein) JTB HSPC222 146 Q9Y6J6 KCNE2_HUMAN Potassium voltage-gated channel subfamily E member 2 (MinK-related peptide 1) (Minimum potassium ion channel-related peptide 1) (Potassium channel subunit beta MiRP1) KCNE2 123 Q9Y6H6 KCNE3_HUMAN Potassium voltage-gated channel subfamily E member 3 (MinK-related peptide 2) (Minimum potassium ion channel-related peptide 2) (Potassium channel subunit beta MiRP2) KCNE3 103 Q8NHK3 KI2LB_HUMAN Killer cell immunoglobulin-like receptor 2DL5B (CD158 antigen-like family member F2) (Killer cell immunoglobulin-like receptor 2DLX) (CD antigen CD158f2) KIR2DL5BCD158F CD158F2 KIR2DL5 KIR2DLX 375 Q14952 KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 (MHC class I NK cell receptor) (Natural killerassociated transcript 7) (NKAT-7) KIR2DS3 NKAT7 304 Q14943 KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 (MHC class I NK cell receptor) (Natural killerassociated transcript 10) (NKAT-10) KIR3DS1 NKAT10 387 Q9NRX6 KISHB_HUMAN Protein kish-B (Transmembrane protein 167B) TMEM167BC1orf119 AD-020 74 P15382 KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 (Delayed rectifier potassium channel subunit IsK) (IKs producing slow voltage-gated potassium channel subunit beta Mink) (Minimal potassium channel) KCNE1 129 P43626 KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 (CD158 antigen-like family member A) (MHC class 1 NK cell receptor) (Natural killer-associated transcript 1) (NKAT-1) (p58 natural killer cell receptor clones CL-42/47.11) (p58 NK receptor CL-42/47.11) (p58.1 MHC dass-l-specific NK receptor) (CD antigen CD158a) KIR2DL1 CD158A NKAT1 348 Q99706 KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 (CD158 antigen-like family member D) (G9P) (Killer cell inhibitory receptor 103AS) (KIR-103AS) (MHC class I NK cell receptor KIR103AS) (CD antigen CD158d) KIR2DL4CD158D KIR103AS 377 P43632 KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 (CD158 antigen-like family member I) (MHC classI NK cell receptor) (Natural killer-associated transcript 8) (NKAT-8) (P58 natural killer cell receptor clones CL-39/CL-17) (p58 NK receptor CL-39/CL-17) (CD antigen CD158i) KIR2DS4 CD158I KKA3 NKAT8 304 Q8IZU9 KIRR3_HUMAN Kin of IRRE-like protein 3 (Kin of irregular chiasm-like protein 3) (Nephrin-like protein 2) [Cleaved into: Processed kin of IRRE-like protein 3] KIRREL3 KIAA1867 NEPH2 UNQ5923/PRO4502/ PRO19814 778 P32004 L1CAM_HUMAN Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171) L1CAM CAML1 MIC5 1257 Q6GTX8 LAIR1_HUMAN Leukocyte-associated immunoglobulin-like receptor 1 (LAIR-1) (hLAIRI) (CD antigen CD305) LAIR1 CD305 287 © Ul Ui a © VI 2018-03-20Date Re^ue/Date Received 2023-02-27 P43628 KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 (CD158 antigen-like family member B2) (KIR- 023GB) (Killer inhibitory receptor cl 2^) (MHC class I NK cell receptor) (NKAT2a) (NKAT2b) (Natural killer-associated transcript 2) (NKAT-2) (p58 natural killer cell receptor clone CL-6) (p58 NK receptor CL-6) (p58.2 MHC class-l-specific NK receptor) (CD antigen CD158b2) KIR2DL3 CD158B2 KIRCL23 NKAT2 341 Q14954 KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 (CD158 antigen-like family member H) (MHC class I NK cell receptor Eb6 Actl) (CD antigen CD158h) KIR2DS1 CD158H 304 Q14953 KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 (CD158 antigen-like family member G) (MHC class I NK cell receptor) (Natural killer-associated transcript 9) (NKAT-9) (CD antigen CD158g) KIR2DS5CD158G NKAT9 304 P43629 KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 (CD158 antigen-like family member E) (HLA-BW4- specific inhibitory NK cell receptor) (MHC class I NK cell receptor) (Natural killer-associated transcript 3) (NKAT-3) (p70 natural killer cell receptor clones CL-2/CL-11) (p70 NK receptor CL- 2/CL-11) (CD antigen CD158e) KIR3DL1 CD158E NKAT3 NKB1 444 Q8N743 KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 (CD158 antigen-like family member Z) (Killer celI inhibitory receptor 1) (CD antigen CD158z) KIR3DL3CD158Z KIR3DL7 KIRC1 410 Q96J84 KIRR1_HUMAN Kin of IRRE-like protein 1 (Kin of irregular chiasm-like protein 1) (Nephrin-like protein 1) KIRREL KIRREL1 NEPH1 757 P10721 KIT_HUMAN Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Piebald trait protein) (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD antigen CD117) KIT SCFR 976 Q86UK5 LBN_HUMAN Umbin (Ellis-van Creveld syndrome protein 2) (EVC2) EVC2 LBN 1308 P43627 KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 (CD158 antigen-like family member B1) (MHC classI NK cell receptor) (Natural killer-associated transcript 6) (NKAT-6) (p58 natural killer cell receptor clone CL-43) (p58 NK receptor CL-43) (CD antigen CD158b1) KIR2DL2CD158B1 NKAT6 348 Q8N109 KI2LA_HUMAN Killer cell immunoglobulin-like receptor 2DL5A (CD antigen CD158f1) KIR2DL5ACD158F CD158F1 KIR2DL5 375 P43631 KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 (CD158 antigen-like family member J) (MHC class I NK cell receptor) (NK receptor 183 Actl) (Natural killer-associated transcript 5) (NKAT-5) (p58 natural killer cell receptor clone CL-49) (p58 NK receptor CL-49) (CD antigen CD158j) KIR2DS2 CD158J NKAT5 304 P43630 KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 (CD158 antigen-like family member K) (MHC class I NK cell receptor) (Natural killer-associated transcript 4) (NKAT-4) (p70 natural killer cell receptor clone CL-5) (p70 NK receptorCL-5) (CD antigen CD158k) KIR3DL2CD158K NKAT4 455 Q8TBQ9 KISHA_HUMAN Protein kish-A (Transmembrane protein 167) (Transmembrane protein 167A) TMEM167A TMEM167 72 Q96MU8 KREM1_HUMAN Kremen protein 1 (Dickkopf receptor) (Kringle domain-containing transmembrane protein 1) KREMEN1 KREMEN 473 2018-03-20Date Re^ue/Date Received 2023-02-27 (Kringle-containing protein marking the eye and the nose) KRM1 P11279 LAMP1_HUMAN Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a) LAMP1 417 P13473 LAMP2_HUMAN Lysosome-associated membrane glycoprotein 2 (LAMP-2) (Lysosome-associated membrane protein 2) (CD107 antigen-like family member B) (CD antigen CD107b) LAMP2 410 P01130 LDLR_HUMAN Low-density lipoprotein receptor (LDL receptor) LDLR 860 Q9UEF7 KLOT_HUMAN Klotho (EC 3.2.1.31) [Cleaved into: Klotho peptide] KL 1012 A6NM11 L37A2_HUMAN Leucine-rich repeat-containing protein 37A2 LRRC37A2 1700 Q9UJQ1 LAMP5_HUMAN Lysosome-associated membrane glycoprotein 5 (Brain and dendritic cell-associated LAMP) (Brain-associated LAMP-like protein) (BAD-LAMP) (Lysosome-associated membrane protein 5) (LAMP-5) LAMP5C20orf103 280 P19256 LFA3_HUMAN Lymphocyte function-associated antigen 3 (Ag3) (Surface glycoprotein LFA-3) (CD antigen CD58) CD58 LFA3 250 Q8NCW0 KREM2_HUMAN Kremen protein 2 (Dickkopf receptor 2) (Kringle domain-containing transmembrane protein 2) (Kringle-containing protein marking the eye and the nose) KREMEN2 KRM2 462 A6NMS7 L37A1_HUMAN Leucine-rich repeat-containing protein 37A LRRC37A LRRC37A1 1700 060309 L37A3_HUMAN Leucine-rich repeat-containing protein 37A3 LRRC37A3 KIAA0563 1634 P18627 LAG3_HUMAN Lymphocyte activation gene 3 protein (LAG-3) (Protein FDC) (CD antigen CD223) LAG3 FDC 525 Q6UX15 LAYN_HUMAN Layilin LAYN UNQ208/PRO234 382 P48357 LEPR_HUMAN Leptin receptor (LEP-R) (HuB219) (OB receptor) (OB-R) (CD antigen CD295) LEPRDBOBR 1165 Q8N149 LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 (CD85 antigen-like family member H) (Immunoglobulin-like transcript 1) (ILT-1) (Leukocyte immunoglobulin-like receptor 7) (UR-7) (CD antigen CD85h) LILRA2 ILT1 LIR7 483 A6NI73 LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 (CD85 antigen-like family member F) (Immunoglobulin-like transcript 11) (ILT-11) (Leukocyte immunoglobulin-like receptor 9) (LIR-9) (CD antigen CD85f) LILRA5 ILT11 ULRB7 LIR9 299 Q8N423 LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 (LIR-2) (Leukocyte immunoglobulin-like receptor 2) (CD85 antigen-like family member D) (Immunoglobulin-like transcript 4) (ILT-4) (Monocyte/macrophage immunoglobulin-like receptor 10) (MIR-10) (CD antigen CD85d) LILRB2 ILT4 LIR2 MIR10 598 P42702 UFR_HUMAN Leukemia inhibitory factor receptor (LIF receptor) (LIF-R) (CD antigen CD118) LIFR 1097 Q6UY18 LIGO4_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting LINGO4 LRRN6D 593 2018-03-20Date Re^ue/Date Received 2023-02-27 protein 4 (Leucine-rich repeat neuronal protein 6D) UNQ9248/PRO34002 Q6PI73 LIRA6_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 6 (Immunoglobulin-like transcript 8) (ILT-8) (Leukocyte Ig-like receptor) LILRA6 ILT8 481 075022 LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 (UR-3) (Leukocyte immunoglobulin-like receptor 3) (CD85 antigen-like family member A) (Immunoglobulin-like transcript 5) (ILT-5) (Monocyte inhibitory receptor HL9) (CD antigen CD85a) LILRB3 ILT5 LIR3 631 P49257 LMAN1_HUMAN Protein ERGIC-53 (ER-Golgi intermediate compartment 53 kDa protein) (Gp58) (Intracellular mannose-specific lectin MR60) (Lectin mannose-binding 1) LMAN1 ERGIC53 F5F8D 510 Q9UQV4 LAMP3_HUMAN Lysosome-associated membrane glycoprotein 3 (LAMP-3) (Lysosomal-associated membrane protein 3) (DC-lysosome-associated membrane glycoprotein) (DC LAMP) (Protein TSC403) (CD antigen CD208) LAMP3 DCLAMP TSC403 416 Q7L985 LIGO2_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 (Leucine-rich repeat neuronal protein 3) (Leucine-rich repeat neuronal protein 6C) LING02 LERN3 LRRN6C UNQ9234/PRO31993 606 Q9H0V9 LMA2L_HUMAN VIP36-like protein (Lectin mannose-binding 2-like) (LMAN2-like protein) LMAN2LVIPL PSEC0028 UNQ368/PRO704 348 P09848 LPH_HUMAN Lactase-phlorizin hydrolase (Lactase-glycosylceramidase) [Indudes: Lactase (EC 3.2.1.108); Phlorizin hydrolase (EC 3.2.1.62)] LCT LPH 1927 Q96FE5 LIGO1_HUMAN Leudne-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 (Leudne-rich repeat and immunoglobulin domain-containing protein 1) (Leucine-rich repeat neuronal protein 1) (Leudne-rich repeat neuronal protein 6A) LINGO1 LERN1 LRRN6A UNQ201/PRO227 620 Q12907 LMAN2_HUMAN Vesicular integral-membrane protein VIP36 (Glycoprotein GP36b) (Lectin mannose-binding 2) (Vesicular integral-membrane protein 36) (VIP36) LMAN2C5orf8 356 Q9H756 LRC19_HUMAN Leudne-rich repeat-containing protein 19 LRRC19 370 Q5VT99 LRC38_HUMAN Leucine-rich repeat-containing protein 38 (BK channel auxiliary gamma subunit LRRC38) LRRC38 294 A6NDA9 LRIT2_HUMAN Leudne-rich repeat immunoglobulin-like domain and transmembrane domain-containing protein 2 (Leudne-rich repeat-containing protein 22) LRIT2 LRRC22 550 P16150 LEUK_HUMAN Leukosialin (Galactoglycoprotein) (GALGP) (Leukocyte sialoglycoprotein) (Sialophorin) (CD antigen CD43) SPN CD43 400 P0C6S8 UG03_HUMAN Leudne-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 (Leucine-rich repeat neuronal protein 2) (Leucine-rich repeat neuronal protein 6B) LINGO3LERN2 LRRN6B 592 075023 LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 (CD85 antigen-like family member C) (Leukocyte immunoglobulin-like receptor 8) (UR-8) (CD antigen CD85c) LILRB5 LIR8 590 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9HAT1 LMA1L_HUMAN Protein ERGIC-53-like (ERGIC53-like protein) (Lectin mannose-binding 1-like) (LMAN1-like protein) LMAN1LERGL UNQ2784/PRO7174 526 075197 LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 (LRP-5) LRP5 LR3 LRP7 1615 075581 LRP6_HUMAN Low-density lipoprotein receptor-related protein 6 (LRP-6) LRP6 1613 Q9H3W5 LRRN3_HUMAN Leucine-rich repeat neuronal protein 3 (Neuronal leucine-rich repeat protein 3) (NLRR-3) LRRN3 Nbla10363 UNQ194/PRO220 708 P59901 LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 (CD85 antigen-like family member G) (Immunoglobulin-like transcript 7) (ILT-7) (CD antigen CD85g) LILRA4 ILT7 499 Q8NHL6 LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 (UR-1) (Leukocyte immunoglobulin-like receptor 1) (CD85 antigen-like family member J) (Immunoglobulin-like transcript 2) (ILT-2) (Monocyte/macrophage immunoglobulin-like receptor 7) (MIR-7) (CD antigen CD85j) LILRB1 ILT2 LIR1 MIR7 650 Q96QE4 LR37B_HUMAN Leucine-rich repeat-containing protein 37B (C66 SLIT-like testicular protein) LRRC37B 947 Q9HCJ2 LRC4C_HUMAN Leucine-rich repeat-containing protein 4C (Netrin-G1 ligand) (NGL-1) LRRC4C KIAA1580 NGL1 UNQ292/PRO331 640 Q9P2V4 LRIT1_HUMAN Leucine-rich repeat immunoglobulin-like domain and transmembrane domain-containing protein 1 (Leucine-rich repeat-containing protein 21) (Photoreceptor-associated LRR superfamily protein) (Retina-specific protein PAL) LRIT1 LRRC21 PAL 623 P29376 LTK_HUMAN Leukocyte tyrosine kinase receptor (EC 2.7.10.1) (Protein tyrosine kinase 1) LTK TYK1 864 Q9HBG7 LY9_HUMAN T-lymphocyte surface antigen Ly-9 (Cell surface molecule Ly-9) (Lymphocyte antigen 9) (SLAM family member 3) (SLAMF3) (Signaling lymphocytic activation molecule 3) (CD antigen CD229) LY9CDABP0070 655 P14151 LYAM1_HUMAN L-selectin (CD62 antigen-like family member L) (Leukocyte adhesion molecule 1) (LAM-1) (Leukocyte surface antigen Leu-8) (Leukocyte-endothelial cell adhesion molecule 1) (LECAM1) (Lymph node homing receptor) (TQ1) (gp90-MEL) (CD antigen CD62L) SELL LNHR LYAM1 372 Q5SZI1 LRAD2_HUMAN Low-density lipoprotein receptor class A domain-containing protein 2 LDLRAD2 272 Q8TF66 LRC15_HUMAN Leucine-rich repeat-containing protein 15 (Leucine-rich repeat protein induced by beta-amyloid homolog) (hLib) LRRC15 LIB 581 Q2I0M4 LRC26_HUMAN Leucine-rich repeat-containing protein 26 (BK channel auxiliary gamma subunit LRRC26) (Cytokeratin-associated protein in cancer) LRRC26CAPC 334 Q9P244 LRFN1_HUMAN Leucine-rich repeat and fibronectin type III domain-containing protein 1 (Synaptic adhesion-like molecule 2) LRFN1 KIAA1484 SALM2 771 Q9ULH4 LRFN2_HUMAN Leucine-rich repeat and fibronectin type-Ill domain-containing protein 2 (Synaptic adhesion-like molecule 1) LRFN2 KIAA1246 SALM1 789 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9BTN0 LRFN3_HUMAN Leucine-rich repeat and fibronectin type-Ill domain-containing protein 3 (Synaptic adhesion-like molecule 4) LRFN3SALM4 UNQ5865/PRO34192 628 Q6PJG9 LRFN4_HUMAN Leucine-rich repeat and fibronectin type-lII domain-containing protein 4 LRFN4SALM3 635 Q96NI6 LRFN5_HUMAN Leucine-rich repeat and fibronectin type-lII domain-containing protein 5 LRFN5C14orf146 SALM5 719 Q96JA1 LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 (LIG-1) LRIG1 LIG1 1093 094898 LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 (LIG-2) LRIG2 KIAA0806 LIG2 1065 Q6UXM1 LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 (LIG-3) LRIG3 LIG3 UNQ287/PRO326/PR 0335 1119 Q9HBW1 LRRC4_HUMAN Leucine-rich repeat-containing protein 4 (Brain tumor-associated protein BAG) (Nasopharyngeal carcinoma-associated gene 14 protein) (Netrin-G2 ligand) (NGL-2) LRRC4 BAG NAG14 UNQ554/PRO1111 653 Q6UXK5 LRRN1_HUMAN Leucine-rich repeat neuronal protein 1 (Neuronal leucine-rich repeat protein 1) (NLRR-1) LRRN1 KIAA1497 Nbla10449 UNQ693/PRO1338 716 Q86VH5 LRRT3_HUMAN Leucine-rich repeat transmembrane neuronal protein 3 LRRTM3 UNQ803/PRO1693 581 P16581 LYAM2_HUMAN E-selectin (CD62 antigen-like family member E) (Endothelial leukocyte adhesion molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD antigen CD62E) SELEELAM1 610 P16109 LYAM3_HUMAN P-selectin (CD62 antigen-like family member P) (Granule membrane protein 140) (GMP-140) (Leukocyte-endothelial cell adhesion molecule 3) (LECAM3) (Platelet activation dependent granule-external membrane protein) (PADGEM) (CD antigen CD62P) SELPGMRPGRMP 830 075019 LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 (CD85 antigen-like family member I) (Leukocyte immunoglobulin-like receptor 6) (LIR-6) (CD antigen CD85i) LILRA1 LIR6 489 Q8NHJ6 LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 (CD85 antigen-like family member K) (Immunoglobulin-like transcript 3) (ILT-3) (Leukocyte immunoglobulin-like receptor 5) (UR-5) (Monocyte inhibitory receptor HM18) (CD antigen CD85k) LILRB4 ILT3 LIR5 448 Q6ZMQ8 LMTK1_HUMAN Serine/threonine-protein kinase LMTK1 (EC 2.7.11.1) (Apoptosis-associated tyrosine kinase) (AATYK) (Brain apoptosis-associated tyrosine kinase) (CDK5-binding protein) (Lemur tyrosine kinase 1) (p35-binding protein) (p35BP) AATK AATYK KIAA0641 LMR1 LMTK1 1374 Q8N386 LRC25_HUMAN Leucine-rich repeat-containing protein 25 (Monocyte and plasmacytoid-activated protein) LRRC25 MAPA UNQ6169/PRO20174 305 Q8ND94 LRN4L_HUMAN LRRN4 C-terminal-like protein LRRN4CL 238 2018-03-20Date Re^ue/Date Received 2023-02-27 UNQ728/PRO1410 Q86VZ4 LRP11_HUMAN Low-density lipoprotein receptor-related protein 11 (LRP-11) LRP11 500 Q07954 LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 (LRP-1) (Alpha-2-macroglobulin receptor) (A2MR) (Apolipoprotein E receptor) (APOER) (CD antigen CD91) [Cleaved into: Low-density lipoprotein receptor-related protein 1 85 kDa subunit (LRP-85); Low-density lipoprotein receptorrelated protein 1 515 kDa subunit (LRP-515); Low-density lipoprotein receptor-related protein 1 intracellular domain (LRPICD)l LRP1 A2MRAPR 4544 075074 LRP3_HUMAN Low-density lipoprotein receptor-related protein 3 (LRP-3) (105 kDa low-density lipoprotein receptor-related protein) (hLRp105) LRP3 770 075096 LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 (LRP-4) (Multiple epidermal growth factor-like domains 7) LRP4KIAA0816 LRP10MEGF7 1905 Q14114 LRP8_HUMAN Low-density lipoprotein receptor-related protein 8 (LRP-8) (Apolipoprotein E receptor 2) LRP8APOER2 963 043300 LRRT2_HUMAN Leucine-rich repeat transmembrane neuronal protein 2 (Leucine-rich repeat neuronal 2 protein) LRRTM2 KIAA0416 LRRN2 516 Q9HBL6 LRTM1_HUMAN Leucine-rich repeat and transmembrane domain-containing protein 1 LRTM1 HT017 345 Q7Z4F1 LRP10_HUMAN Low-density lipoprotein receptor-related protein 10 (LRP-10) LRP10 MSTP087 SP220 UNQ389/PRO724 713 Q8N967 LRTM2_HUMAN Leucine-rich repeat and transmembrane domain-containing protein 2 LRTM2 370 Q9Y561 LRP12_HUMAN Low-density lipoprotein receptor-related protein 12 (LRP-12) (Suppressor of tumorigenicity 7 protein) LRP12ST7 859 P98164 LRP2_HUMAN Low-density lipoprotein receptor-related protein 2 (LRP-2) (Glycoprotein 330) (gp330) (Megalin) LRP2 4655 Q9H8J5 MANS1_HUMAN MANSC domain-containing protein 1 (Loss of heterozygosity 12 chromosomal region 3 protein) MANSC1 LOH12CR3 UNQ316/PRO361 431 Q86YD5 LRAD3_HUMAN Low-density lipoprotein receptor class A domain-containing protein 3 LDLRAD3 345 Q14392 LRC32_HUMAN Leucine-rich repeat-containing protein 32 (Garpin) (Glycoprotein A repetitions predominant) (GARP) LRRC32 D11S833E GARP 662 Q9NZR2 LRP1B_HUMAN Low-density lipoprotein receptor-related protein 1B (LRP-1B) (Low-density lipoprotein receptorrelated protein-deleted in tumor) (LRP-DIT) LRP1B LRPDIT 4599 075325 LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 (Glioma amplified on chromosome 1 protein) (Leucinerich repeat neuronal protein 5) LRRN2GAC1 LRRN5 UNQ256/PRO293 713 Q8WUT4 LRRN4_HUMAN Leucine-rich repeat neuronal protein 4 (Neuronal leucine-rich repeat protein 4) (NLRR-4) LRRN4 C20orf75 740 Q86UE6 LRRT1_HUMAN Leucine-rich repeat transmembrane neuronal protein 1 LRRTM1 522 2018-03-20Date Re^ue/Date Received 2023-02-27 UNQ675/PRO1309 A6NHS7 MANS4_HUMAN MANSC domain-containing protein 4 MANSC4 340 P15529 MCP_HUMAN Membrane cofactor protein (TLX) (Trophoblast leukocyte common antigen) (CD antigen CD46) CD46MCPMIC10 392 Q86VH4 LRRT4_HUMAN Leucine-rich repeat transmembrane neuronal protein 4 LRRTM4 UNQ3075/PRO9907 590 Q13477 MADCA_HUMAN Mucosal addressin cell adhesion molecule 1 (MAdCAM-1) (hMAdCAM-1) MADCAM1 382 Q5SQ64 LY66F_HUMAN Lymphocyte antigen 6 complex locus protein G6f LY6G6F C6orf21 G6F LY6G6D NG32 297 060449 LY75_HUMAN Lymphocyte antigen 75 (Ly-75) (C-type lectin domain family 13 member B) (DEC-205) (gp200- MR6) (CD antigen CD205) LY75CD205 CLEC13B 1722 Q9Y5Y7 LYVE1_HUMAN Lymphatic vessel endothelial hyaluronic acid receptor 1 (LYVE-1) (Cell surface retention sequence-binding protein 1) (CRSBP-1) (Extracellular link domain-containing protein 1) (Hyaluronic acid receptor) LYVE1 CRSBP1 HAR XLKD1 UNQ230/PRO263 322 P20916 MAG_HUMAN Myelin-associated glycoprotein (Siglec-4a) MAGGMA 626 Q16820 MEP1B_HUMAN Meprin A subunit beta (EC 3.4.24,63) (Endopeptidase-2) (Meprin B) (N-benzoyl-L-tyrosyl-Pamino-benzoic acid hydrolase subunit beta) (PABA peptide hydrolase) (PPH beta) MEP1B 701 Q9H9K5 MER34_HUMAN Endogenous retrovirus group MER34 member 1 Env polyprotein (HERV-MER_4q12 provirus ancestral Env polyprotein) ERVMER34-1 LP9056 563 Q14703 MBTP1_HUMAN Membrane-bound transcription factor site-1 protease (EC 3.4.21.112) (Endopeptidase S1P) (Subtilisin/kexin-isozyme 1) (SKI-1) MBTPS1 KIAA0091 S1PSKI1 1052 Q12866 MERTK_HUMAN Tyrosine-protein kinase Mer (EC 2.7.10.1) (Proto-oncogene c-Mer) (Receptor tyrosine kinase MerTK) MERTK MER 999 Q7Z7M0 MEGF8_HUMAN Multiple epidermal growth factor-like domains protein 8 (Multiple EGF-like domains protein 8) (Epidermal growth factor-like protein 4) (EGF-like protein 4) MEGF8C19orf49 EGFL4 KIAA0817 2845 P55082 MFAP3_HUMAN Microfibril-associated glycoprotein 3 MFAP3 362 Q96KG7 MEG10_HUMAN Multiple epidermal growth factor-like domains protein 10 (Multiple EGF-like domains protein 10) MEGF10 KIAA1780 1140 A6BM72 MEG11_HUMAN Multiple epidermal growth factor-like domains protein 11 (Multiple EGF-like domains protein 11) MEGF11 KIAA1781 UNQ1949/PRO4432 1044 Q16819 MEP1A_HUMAN Meprin A subunit alpha (EC 3.4.24.18) (Endopeptidase-2) (N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit alpha) (PABA peptide hydrolase) (PPH alpha) MEP1A 746 P51512 MMP16_HUMAN Matrix metalloproteinase-16 (MMP-16) (EC 3.4.24.-) (MMP-X2) (Membrane-type matrix metalloproteinase 3) (MT-MMP 3) (MTMMP3) (Membrane-type-3 matrix metalloproteinase) (MT3-MMP) (MT3MMP) MMP16 MMPX2 607 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9H1U4 MEGF9_HUMAN Multiple epidermal growth factor-like domains protein 9 (Multiple EGF-like domains protein 9) (Epidermal growth factor-like protein 5) (EGF-like protein 5) MEGF9 EGFL5 KIAA0818 UNQ671/PRO1305 602 Q5JRA6 MIA3_HUMAN Melanoma inhibitory activity protein 3 (C219-reactive peptide) (D320) (Transport and Golgi organization protein 1) MIA3 KIAA0268 TANGO TANG01 UNQ6077/PRO20088 1907 P51511 MMP15_HUMAN Matrix metalloproteinase-15 (MMP-15) (EC 3.4.24.-) (Membrane-type matrix metalloproteinase 2) (MT-MMP 2) (MTMMP2) (Membrane-type-2 matrix metalloproteinase) (MT2-MMP) (MT2MMP) (SMCP-2) MMP15 669 075121 MFA3L_HUMAN Microfi brillar-assodated protein 3-like (Testis development protein NYD-SP9) MFAP3L KIAA0626 HSD-39 HSD39 409 P08581 METHUMAN Hepatocyte growth factor receptor (HGF receptor) (EC 2.7.10.1) (HGF/SF receptor) (Proto¬ oncogene c-Met) (Scatter factor receptor) (SF receptor) (Tyrosine-protein kinase Met) MET 1390 Q29983 MICA_HUMAN MHC class I polypeptide-related sequence A (MIC-A) MICA PERB11.1 383 Q8TD46 M02R1_HUMAN Cell surface glycoprotein CD200 receptor 1 (CD200 cell surface glycoprotein receptor) (Cell surface glycoprotein 0X2 receptor 1) CD200R1 CD200R CRTR2 MOX2R OX2R UNQ2522/PRO6015 325 Q29980 MICB_HUMAN MHC class I polypeptide-related sequence B (MIC-B) MICB PERB11.2 383 P50281 MMP14_HUMAN Matrix metalloproteinase-14 (MMP-14) (EC 3.4.24.80) (MMP-X1) (Membrane-type matrix metalloproteinase 1) (MT-MMP 1) (MTMMP1) (Membrane-type-1 matrix metalloproteinase) (MT1-MMP) (MT1MMP) MMP14 582 Q2M385 MPEG1_HUMAN Macrophage-expressed gene 1 protein (Macrophage gene 1 protein) (Mpg-1) MPEG1 716 Q7Z6M3 MILR1_HUMAN Allergin-1 (Allergy inhibitory receptor 1) (Mast cell antigen 32) (MCA-32) (Mast cell immunoglobulin-like receptor 1) MILR1 C17orf60 MCA32 343 P20645 MPRD_HUMAN Cation-dependent mannose-6-phosphate receptor (CD Man-6-P receptor) (CD-MPR) (46 kDa mannose 6-phosphate receptor) (MPR 46) M6PR MPR46 MPRD 277 P11717 MPRLHUMAN Cation-independent mannose-6-phosphate receptor (Cl Man-6-P receptor) (CI-MPR) (M6PR) (300 kDa mannose 6-phosphate receptor) (MPR 300) (Insulin-like growth factor 2 receptor) (Insulin-like growth factor II receptor) (IGF-II receptor) (M6P/IGF2 receptor) (M6P/IGF2R) (CD antigen CD222) IGF2R MPRI 2491 Q14165 MLEC_HUMAN Malectin MLECKIAA0152 292 Q9Y5R2 MMP24_HUMAN Matrix metalloproteinase-24 (MMP-24) (EC 3.4.24.-) (Membrane-type matrix metalloproteinase 5) (MT-MMP 5) (MTMMP5) (Membrane-type-5 matrix metalloproteinase) (MT5-MMP) MMP24 MT5MMP 645 2018-03-20Date Re^ue/Date Received 2023-02-27 (MT5MMP) [Cleaved into: Processed matrix metalloproteinase-24] Q16653 MOG_HUMAN Myelin-oligodendrocyte glycoprotein MOG 247 Q6UWV2 MPZL3_HUMAN Myelin protein zero-like protein 3 MPZL3 UNQ2966/PRO7425 235 Q6UVY6 MOXD1_HUMAN DBH-like monooxygenase protein 1 (EC 1.14.17,-) (Monooxygenase X) MOXD1 MOX UNQ2493/PRO5780 613 Q6Q8B3 MO2R2_HUMAN Cell surface glycoprotein CD200 receptor 2 (CD200 cell surface glycoprotein receptor-like 2) (CD200 receptor-like 2) (HuCD200R2) (CD200 cell surface glycoprotein receptor-like a) (CD200RLa) (Cell surface glycoprotein CD200 receptor 1-like) (Cell surface glycoprotein 0X2 receptor 2) CD200R1L CD200R2 271 060487 MPZL2_HUMAN Myelin protein zero-like protein 2 (Epithelial V-like antigen 1) MPZL2 EVA EVA1 UNQ606/PRO1192 215 Q96KJ4 MSLNL_HUMAN Mesothelin-like protein (Pre-pro-megakaryocyte-potentiating-factor-like) MSLNLC16orf37 MPFL 702 P43121 MUC18_HUMAN Cell surface glycoprotein MUC18 (Cell surface glycoprotein P1H12) (Melanoma cell adhesion molecule) (Melanoma-associated antigen A32) (Melanoma-associated antigen MUC18) (S-endo 1 endothelial-associated antigen) (CD antigen CD146) MCAM MUC18 646 P15941 MUC1_HUMAN Mucin-1 (MUC-1) (Breast carcinoma-associated antigen DF3) (Cancer antigen 15-3) (CA 15-3) (Carcinoma-associated mucin) (Episialin) (H23AG) (Krebs von den Lungen-6) (KL-6) (PEMT) (Peanut-reactive urinary mucin) (PUM) (Polymorphic epithelial mucin) (PEM) (Tumor-associated epithelial membrane antigen) (EMA) (Tumor-associated mucin) (CD antigen CD227) [Cleaved into: Mucin-1 subunit alpha (MUC1-NT) (MUC1-alpha); Mucin-1 subunit beta (MUC1-beta) (MUC1-CT)] MUC1 PUM 1255 095297 MPZL1_HUMAN Myelin protein zero-like protein 1 (Protein zero-related) MPZL1 PZR UNQ849/PRO1787 269 P22897 MRC1_HUMAN Macrophage mannose receptor 1 (MMR) (C-type lectin domain family 13 member D) (C-type lectin domain family 13 member D-like) (Human mannose receptor) (hMR) (Macrophage mannose receptor 1-like protein 1) (CD antigen CD206) MRC1 CLEC13D CLEC13DL MRC1L1 1456 Q9UBG0 MRC2_HUMAN C-type mannose receptor 2 (C-type lectin domain family 13 member E) (Endocytic receptor 180) (Macrophage mannose receptor 2) (Urokinase-type plasminogen activator receptor-associated protein) (UPAR-associated protein) (Urokinase receptor-associated protein) (CD antigen CD280) MRC2CLEC13E ENDO180 KIAA0709 UPARAP 1479 Q9UKN1 MUC12_HUMAN Mucin-12 (MUC-12) (Mucin-11) (MUC-11) MUC12MUC11 5478 Q8N387 MUC15_HUMAN Mucin-15 (MUC-15) MUC15 UNQ750/PRO1481 334 2018-03-20Date Re^ue/Date Received 2023-02-27 Q8WXI7 MUC16_HUMAN Mudn-16 (MUC-16) (Ovarian cancer-related tumor marker CA125) (CA-125) (Ovarian carcinoma antigen CA125) MUC16CA125 14507 Q5SSG8 MUC21_HUMAN Mucin-21 (MUC-21) (Epiglycanin) MUC21 C6orf205 UNQ697/PRO1342 566 Q9H3R2 MUC13_HUMAN Mucin-13 (MUC-13) (Down-regulated in colon cancer 1) MUC13DRCC1 RECC UNQ6194/PRO20221 512 015146 MUSK_HUMAN Muscle, skeletal receptor tyrosine-protein kinase (EC 2.7.10.1) (Muscle-specific tyrosine-protein kinase receptor) (MuSK) (Muscle-specific kinase receptor) MUSK 869 Q13505 MTX1_HUMAN Metaxin-1 (Mitochondrial outer membrane import complex protein 1) MTX1 MTX MTXN 466 Q9ULC0 MUCEN_HUMAN Endomucin (Endomucin-2) (Gastric cancer antigen Ga34) (Mucin-14) (MUC-14) EMCN EMCN2 MUC14 261 Q04900 MUC24_HUMAN Sialomucin core protein 24 (MUC-24) (Endolyn) (Multi-glycosylated core protein 24) (MGC-24) (MGC-24v) (CD antigen CD164) CD164 197 P25189 MYPO_HUMAN Myelin protein PO (Myelin peripheral protein) (MPP) (Myelin protein zero) MPZ 248 Q9BRK3 MXRA8_HUMAN Matrix-remodeling-associated protein 8 (Limitrin) MXRA8 442 Q9UK23 NAGPA_HUMAN N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (EC 3.1.4.45) (Mannose 6-phosphate-uncovering enzyme) (Phosphodiester alpha-GIcNAcase) NAGPA 515 015394 NCAM2_HUMAN Neural cell adhesion molecule 2 (N-CAM-2) (NCAM-2) NCAM2 NCAM21 837 076036 NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 (Lymphocyte antigen 94 homolog) (NK cell-activating receptor) (Natural killer cell p46-related protein) (NK-p46) (NKp46) (hNKp46) (CD antigen CD335) NCR1 LY94 304 Q8NC67 NET02_HUMAN Neuropilin and tolloid-like protein 2 (Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2) NETO2 BTCL2 UNQ1926/PRO4401 525 Q8TD07 N2DL4_HUMAN NKG2D ligand 4 (N2DL-4) (NKG2DL4) (Lymphocyte effector toxicity activation ligand) (RAE-1- like transcript 4) (RL-4) (Retinoic acid early transcript 1E) RAET1ELETAL N2DL4 ULBP4 UNQ1867/PRO4303 263 014931 NCTR3_HUMAN Natural cytotoxicity triggering receptor 3 (Activating natural killer receptor p30) (Natural killer cell p30-related protein) (NK-p30) (NKp30) (CD antigen CD337) NCR31C7LY117 201 Q8TDF5 NET01_HUMAN Neuropilin and tolloid-like protein 1 (Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 1) NET01 BTCL1 533 Q92542 NICA_HUMAN Nicastrin NCSTN KIAA0253 UNQ1874/PRO4317 709 P13591 NCAM1_HUMAN Neural cell adhesion molecule 1 (N-CAM-1) (NCAM-1) (CD antigen CD56) NCAM1 NCAM 858 2018-03-20Date Re^ue/Date Received 2023-02-27 Q5T1S8 NCMAP_HUMAN Noncompact myelin-associated protein (Myelin protein of 11 kDa) (MP11) NCMAPC1orf130 102 095944 NCTR2_HUMAN Natural cytotoxicity triggering receptor 2 (Lymphocyte antigen 95 homolog) (NK cell-activating receptor) (Natural killer cell p44-related protein) (NK-p44) (NKp44) (CD antigen CD336) NCR2 LY95 276 Q15223 NECT1_HUMAN Nectin-1 (Herpes virus entry mediator C) (Herpesvirus entry mediator C) (HveC) (Herpesvirus Iglike receptor) (HlgR) (Nectin cell adhesion molecule 1) (Poliovirus receptor-related protein 1) (CD antigen CD111) NECTIN1 HVEC PRR1 PVRL1 517 Q92859 NE01_HUMAN Neogenin (Immunoglobulin superfamily DCC subclass member 2) NE01 IGDCC2 NGN 1461 000533 NCHL1_HUMAN Neural cell adhesion molecule L1-like protein (Close homolog of L1) [Cleaved into: Processed neural cell adhesion molecule L1-like protein] CHL1 CALL 1208 Q8N2Q7 NLGN1_HUMAN Neuroligin-1 NLGN1 KIAA1070 840 Q8N0W4 NLGNX_HUMAN Neuroligin-4, X-linked (Neuroligin X) (HNLX) NLGN4X KIAA1260 NLGN4 UNQ365/PRO701 816 060500 NPHN_HUMAN Nephrin (Renal glomerulus-specific cell adhesion receptor) NPHS1 NPHN 1241 Q96NY8 NECT4_HUMAN Nectin-4 (Ig superfamily receptor LNIR) (Nectin cell adhesion molecule 4) (Poliovirus receptorrelated protein 4) [Cleaved into: Processed poliovirus receptor-related protein 4] NECTIN4 LNIR PRR4 PVRL4 510 Q8NET5 NFAM1_HUMAN NFAT activation molecule 1 (Calcineurin/NFAT-activating ITAM-containing protein) (NFATactivating protein with ITAM motif 1) NFAM1 CNAIP 270 094856 NFASC_HUMAN Neurofascin NFASC KIAA0756 1347 Q9UM47 NOTC3_HUMAN Neurogenic locus notch homolog protein 3 (Notch 3) [Cleaved into: Notch 3 extracellular truncation; Notch 3 intracellular domain] NOTCH3 2321 014511 NRG2_HUMAN Pro-neuregulin-2, membrane-bound isoform (Pro-NRG2) [Cleaved into: Neuregulin-2 (NRG-2) (Divergent of neuregulin-1) (DON-1) (Neural- and thymus-derived activator for ERBB kinases) (NTAK)] NRG2 NTAK 850 Q02297 NRG1_HUMAN Pro-neuregulin-1, membrane-bound isoform (Pro-NRG1) [Cleaved into: Neuregulin-1 (Acetylcholine receptor-inducing activity) (ARIA) (Breast cancer cell differentiation factor p45) (Glial growth factor) (Heregulin) (HRG) (Neu differentiation factor) (Sensory and motor neuronderived factor)] NRG1 GGF HGL HRGANDF SMDF 640 Q9Y4C0 NRX3A_HUMAN Neurexin-3 (Neurexin Ill-alpha) (Neurexin-3-alpha) NRXN3C14orf60 KIAA0743 1643 Q92692 NECT2_HUMAN Nectin-2 (Herpes virus entry mediator B) (Herpesvirus entry mediator B) (HveB) (Nectin cell adhesion molecule 2) (Poliovirus receptor-related protein 2) (CD antigen CD112) NECTIN2 HVEB PRR2 PVRL2 538 Q8NFZ4 NLGN2_HUMAN Neuroligin-2 NLGN2 KIAA1366 835 2018-03-20Date Re^ue/Date Received 2023-02-27 Q8NFZ3 NLGNY_HUMAN Neuroligin-4, Y-linked (Neuroligin Y) NLGN4Y KIAA0951 816 Q15155 N0M01_HUMAN Nodal modulator 1 (pM5 protein) NOMO1 PM5 1222 P69849 N0M03_HUMAN Nodal modulator 3 (pM5 protein 3) NOMO3 1222 Q9NZ94 NLGN3_HUMAN Neuroligin-3 (Gliotactin homolog) NLGN3 KIAA1480 NL3 848 P46531 NOTC1_HUMAN Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) [Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD)l NOTCH1 TAN1 2555 Q04721 NOTC2_HUMAN Neurogenic locus notch homolog protein 2 (Notch 2) (hN2) [Cleaved into: Notch 2 extracellular truncation (N2ECD); Notch 2 intracellular domain (N2ICD)] NOTCH2 2471 Q92823 NRCAM_HUMAN Neuronal cell adhesion molecule (Nr-CAM) (Neuronal surface protein Bravo) (hBravo) (NgCAMrelated cell adhesion molecule) (Ng-CAM-related) NRCAM KIAA0343 1304 060462 NRP2_HUMAN Neuropilin-2 (Vascular endothelial cell growth factor 165 receptor 2) NRP2VEGF165R2 931 Q9Y639 NPTN_HUMAN Neuroplastin (Stromal cell-derived receptor 1) (SDR-1) NPTN SDFR1 SDR1 398 Q68D85 NR3L1_HUMAN Natural cytotoxicity triggering receptor 3 ligand 1 (B7 homolog 6) (B7-H6) NCR3LG1 B7H6 454 014786 NRP1_HUMAN Neuropilin-1 (Vascular endothelial cell growth factor 165 receptor) (CD antigen CD304) NRP1 NRP VEGF165R 923 P56975 NRG3_HUMAN Pro-neuregulin-3, membrane-bound isoform (Pro-NRG3) [Cleaved into: Neuregulin-3 (NRG-3)] NRG3 720 Q86YC3 NRROS_HUMAN Negative regulator of reactive oxygen species (Leucine-rich repeat-containing protein 33) NRROS LRRC33 UNQ3030/PRO9833 692 P58400 NRX1B_HUMAN Neurexin-1-beta (Neurexin l-beta) NRXN1 442 Q9HDB5 NRX3B_HUMAN Neurexin-3-beta (Neurexin Ill-beta) [Cleaved into: Neurexin-3-beta, soluble form; Neurexin-3- beta, C-terminal fragment (NRXN3-CTF)] NRXN3 KIAA0743 637 Q16620 NTRK2_HUMAN BDNF/NT-3 growth factors receptor (EC 2.7.10.1) (GP145-TrkB) (Trk-B) (Neurotrophic tyrosine kinase receptor type 2) (TrkB tyrosine kinase) (Tropomyosin-related kinase B) NTRK2TRKB 822 Q16288 NTRK3_HUMAN NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) NTRK3TRKC 839 Q99466 NOTC4_HUMAN Neurogenic locus notch homolog protein 4 (Notch 4) (hNotch4) [Cleaved into: Notch 4 extracellular truncation; Notch 4 intracellular domain] NOTCH4 INT3 2003 Q8WWG1 NRG4_HUMAN Pro-neuregulin-4, membrane-bound isoform (Pro-NRG4) [Cleaved into: Neuregulin-4 (NRG-4)] NRG4 115 Q9P2S2 NRX2A_HUMAN Neurexin-2 (Neurexin ll-alpha) (Neurexin-2-alpha) NRXN2 KIAA0921 1712 Q9ULB1 NRX1A_HUMAN Neurexin-1 (Neurexin l-alpha) (Neurexin-1-alpha) NRXN1 KIAA0578 1477 2018-03-20Date Re^ue/Date Received 2023-02-27 P58401 NRX2B_HUMAN Neurexin-2-beta (Neurexin ll-beta) NRXN2 666 P04629 NTRK1_HUMAN High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA) NTRK1 MTC TRK TRKA 796 Q96PE5 OPALLHUMAN Opalin (Oligodendrocytic myelin paranodal and inner loop protein) (Transmembrane protein 10) OPALIN HTMP10 TMEM10 141 P41217 OX2G_HUMAN OX-2 membrane glycoprotein (CD antigen CD200) CD200 MOX1 M0X2 My033 278 Q8NBR0 P5I13_HUMAN Tumor protein p53-inducible protein 13 (Damage-stimulated cytoplasmic protein 1) TP53I13DSCP1 393 Q99650 OSMR_HUMAN Oncostatin-M-spedfic receptor subunit beta (Interleukin-31 receptor subunit beta) (IL-31 receptor subunit beta) (IL-31R subunit beta) (IL-31R-beta) (IL-31RB) OSMROSMRB 979 Q8IYS5 OSCAR_HUMAN Osteoclast-assodated immunoglobulin-like receptor (Osteoclast-associated receptor) (hOSCAR) (Polymeric immunoglobulin receptor 3) (PlgR-3) (PlgR3) (Poly-lg receptor 3) OSCAR 282 P39656 OST48_HUMAN Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit (DDOST 48 kDa subunit) (Oligosaccharyl transferase 48 kDa subunit) (EC 2.4.99.18) DDOST KIAA0115 OST48OK/SW-d.45 456 Q86WC4 OSTM1_HUMAN Osteopetrosis-associated transmembrane protein 1 (Chloride channel 7 beta subunit) OSTM1 GL HSPC019 UNQ6098/PRO21201 334 Q9BZA7 PC11X_HUMAN Protocadherin-11 X-linked (Protocadherin-11) (Protocadherin on the X chromosome) (PCDH-X) (Protocadherin-S) PCDH11X KIAA1326 PCDH11 PCDHX 1347 Q9P2E7 PCD10_HUMAN Protocadherin-10 PCDH10 KIAA1400 1040 Q96QU1 PCD15_HUMAN Protocadherin-15 PCDH15USH1F 1955 Q8N6Y1 PCD20_HUMAN Protocadherin-20 (Protocadherin-13) PCDH20PCDH13 951 Q9UN67 PCDBA-HUMAN Protocadherin beta-10 (PCDH-beta-10) PCDHB10 UNQ1906/PRO4352 800 Q9Y5E8 PCDBF_HUMAN Protocadherin beta-15 (PCDH-beta-15) PCDHB15 787 Q9Y5I4 PCDC2_HUMAN Protocadherin alpha-02 (PCDH-alpha-C2) PCDHAC2 1007 Q9Y5H0 PCDG3_HUMAN Protocadherin gamma-A3 (PCDH-gamma-A3) PCDHGA3 932 Q9Y5G8 PCDG5_HUMAN Protocadherin gamma-A5 (PCDH-gamma-A5) PCDHGA5 931 Q9Y5G6 PCDG7_HUMAN Protocadherin gamma-A7 (PCDH-gamma-A7) PCDHGA7 932 Q9Y5G1 PCDGF.HUMAN Protocadherin gamma-B3 (PCDH-gamma-B3) PCDHGB3 929 Q96FE7 P3IP1_HUMAN Phosphoinositide-3-kinase-interacting protein 1 (Kringle domain-containing protein HGFL) PIK3IP1 HGFL 263 Q9HCL0 PCD18_HUMAN Protocadherin-18 PCDH18 KIAA1562 1135 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9Y5H7 PCDA5_HUMAN Protocadherin alpha-5 (PCDH-alpha-5) PCDHA5CNRS6 936 Q9Y5I1 PCDAB_HUMAN Protocadherin alpha-11 (PCDH-alpha-11) PCDHA11 CNRS7 949 Q9Y5E7 PCDB2_HUMAN Protocadherin beta-2 (PCDH-beta-2) PCDHB2 798 Q9Y5E5 PCDB4_HUMAN Protocadherin beta-4 (PCDH-beta-4) PCDHB4 795 Q9HC56 PCDH9_HUMAN Protocadherin-9 PCDH9 1237 Q92824 PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 (EC 3.4.21.-) (Proprotein convertase 5) (PC5) (Proprotein convertase 6) (PC6) (hPC6) (Subtilisin/kexin-like protease PC5) PCSK5 PC5 PC6 1860 Q96JQ0 PCD16_HUMAN Protocadherin-16 (Cadherin-19) (Cadherin-25) (Fibroblast cadherin-1) (Protein dachsous homolog 1) DCHS1 CDH19 CDH25 FIB1 KIAA1773 PCDH16 3298 Q9Y5I0 PCDAD_HUMAN Protocadherin alpha-13 (PCDH-alpha-13) PCDHA13CNRS5 950 Q9Y5E6 PCDB3_HUMAN Protocadherin beta-3 (PCDH-beta-3) PCDHB3 796 Q9Y5E3 PCDB6_HUMAN Protocadherin beta-6 (PCDH-beta-6) PCDHB6 794 Q9Y5F1 PCDBC_HUMAN Protocadherin beta-12 (PCDH-beta-12) PCDHB12 795 Q9Y5G7 PCDG6_HUMAN Protocadherin gamma-A6 (PCDH-gamma-A6) PCDHGA6 932 Q9Y5G5 PCDG8_HUMAN Protocadherin gamma-A8 (PCDH-gamma-A8) PCDHGA8 KIAA0327 932 Q9Y5H3 PCDGA_HUMAN Protocadherin gamma-A10 (PCDH-gamma-A10) PCDHGA10 936 Q9Y5H2 PCDGB_HUMAN Protocadherin gamma-A11 (PCDH-gamma-A11) PCDHGA11 935 Q9Y5F6 PCDGM_HUMAN Protocadherin gamma-C5 (PCDH-gamma-C5) PCDHGC5 944 Q08174 PCDH1_HUMAN Protocadherin-1 (Cadherin-like protein 1) (Protocadherin-42) (PC42) PCDH1 1060 095206 PCDH8_HUMAN Protocadherin-8 (Arcadlin) PCDH8 1070 Q9NZQ7 PD1L1_HUMAN Programmed cell death 1 ligand 1 (PD-L1) (PDCD1 ligand 1) (Programmed death ligand 1) (B7 homolog 1) (B7-H1) (CD antigen CD274) CD274 B7H1 PDCD1L1 PDCD1LG1 PDL1 290 Q6UWI2 PARM1_HUMAN Prostate androgen-regulated mucin-like protein 1 (PARM-1) PARM1 UNQ1879/PRO4322 310 Q9Y5I3 PCDA1_HUMAN Protocadherin alpha-1 (PCDH-alpha-1) PCDHA1 950 Q9Y5H8 PCDA3_HUMAN Protocadherin alpha-3 (PCDH-alpha-3) PCDHA3 950 Q9UN74 PCDA4_HUMAN Protocadherin alpha-4 (PCDH-alpha-4) PCDHA4 947 Q86YL7 PDPN_HUMAN Podoplanin (Aggrus) (Glycoprotein 36) (Gp36) (PA2.26 antigen) (T1-alpha) (T1A) PDPN GP36 PSEC0003 162 2018-03-20Date Re^ue/Date Received 2023-02-27 PSEC0025 P07202 PERT_HUMAN Thyroid peroxidase (TPO) (EC 1.11.1.8) TPO 933 Q9BZA8 PC11Y_HUMAN Protocadherin-11 Y-linked (Protocadherin-11) (Protocadherin on the Y chromosome) (PCDH-Y) (Protocadherin prostate cancer) (Protocadherin-PC) (Protocadherin-22) PCDH11Y PCDH11 PCDH22PCDHY 1340 014917 PCD17_HUMAN Protocadherin-17 (Protocadherin-68) PCDH17 PCDH68 PCH68 1159 Q8TAB3 PCD19_HUMAN Protocadherin-19 PCDH19 KIAA1313 1148 Q9UN73 PCDA6_HUMAN Protocadherin alpha-6 (PCDH-alpha-6) PCDHA6CNRS2 950 Q9Y5I2 PCDAA_HUMAN Protocadherin alpha-10 (PCDH-alpha-10) PCDHA10CNRS8 948 Q9UN75 PCDAC_HUMAN Protocadherin alpha-12 (PCDH-alpha-12) PCDHA12 941 Q9Y5F3 PCDB1_HUMAN Protocadherin beta-1 (PCDH-beta-1) PCDHB1 818 Q9Y5E4 PCDB5_HUMAN Protocadherin beta-5 (PCDH-beta-5) PCDHB5 795 Q9UN66 PCDB8_HUMAN Protocadherin beta-8 (PCDH-beta-8) (Protocadherin-3I) PCDHB8 PCDH3I 801 Q9Y5F2 PCDBB_HUMAN Protocadherin beta-11 (PCDH-beta-11) PCDHB11 797 Q9Y5F0 PCDBD_HUMAN Protocadherin beta-13 (PCDH-beta-13) PCDHB13 UNQ332/PRO531 798 Q9Y5H1 PCDG2_HUMAN Protocadherin gamma-A2 (PCDH-gamma-A2) PCDHGA2 932 Q9Y5G4 PCDG9_HUMAN Protocadherin gamma-A9 (PCDH-gamma-A9) PCDHGA9 932 060330 PCDGC_HUMAN Protocadherin gamma-A12 (PCDH-gamma-A12) (Cadherin-21) (Fibroblast cadherin-3) PCDHGA12CDH21 FIB3 KIAA0588 UNQ371/PRO707 932 Q9Y5G2 PCDGE_HUMAN Protocadherin gamma-B2 (PCDH-gamma-B2) PCDHGB2 931 Q9Y5F9 PCDGLHUMAN Protocadherin gamma-B6 (PCDH-gamma-B6) PCDHGB6 930 Q9UN70 PCDGKHUMAN Protocadherin gamma-C3 (PCDH-gamma-C3) (Protocadherin-2) (Protocadherin-43) (PC-43) PCDHGC3 PCDH2 934 060245 PCDH7_HUMAN Protocadherin-7 (Brain-heart protocadherin) (BH-Pcdh) PCDH7 BHPCDH 1069 Q16549 PCSK7_HUMAN Proprotein convertase subtilisin/kexin type 7 (EC 3.4.21.-) (Lymphoma proprotein convertase) (Prohormone convertase 7) (Proprotein convertase 7) (PC7) (Proprotein convertase 8) (PC8) (hPC8) (Subtilisin/kexin-like protease PC7) PCSK7 LPC PC7 PC8SPC7 785 Q9BQ51 PD1L2_HUMAN Programmed cell death 1 ligand 2 (PD-1 ligand 2) (PD-L2) (PDCD1 ligand 2) (Programmed death ligand 2) (Butyrophilin B7-DC) (B7-DC) (CD antigen CD273) PDCD1LG2 B7DC CD273PDCD1L2 PDL2 273 2018-03-20Date Re^ue/Date Received 2023-02-27 P16284 PECA1_HUMAN Platelet endothelial cell adhesion molecule (PECAM-1) (EndoCAM) (GPIIA') (PECA1) (CD antigen CD31) PECAM1 738 Q9NPG4 PCD12_HUMAN Protocadherin-12 (Vascular cadherin-2) (Vascular endothelial cadherin-2) (VE-cad-2) (VEcadherin-2) PCDH12 UNQ395/PRO731 1184 Q9Y5H9 PCDA2_HUMAN Protocadherin alpha-2 (PCDH-alpha-2) PCDHA2 948 Q9UN72 PCDA7_HUMAN Protocadherin alpha-7 (PCDH-alpha-7) PCDHA7CNRS4 937 Q9Y5H6 PCDA8_HUMAN Protocadherin alpha-8 (PCDH-alpha-8) PCDHA8 950 Q9Y5H5 PCDA9_HUMAN Protocadherin alpha-9 (PCDH-alpha-9) PCDHA9 KIAA0345 950 Q9Y5E2 PCDB7_HUMAN Protocadherin beta-7 (PCDH-beta-7) PCDHB7 793 Q9Y5E1 PCDB9_HUMAN Protocadherin beta-9 (PCDH-beta-9) (Protocadherin-3H) PCDHB9 PCDH3H 797 Q9Y5E9 PCDBE_HUMAN Protocadherin beta-14 (PCDH-beta-14) PCDHB14 798 Q9NRJ7 PCDBG_HUMAN Protocadherin beta-16 (PCDH-beta-16) (Protocadherin-3X) PCDHB16KIAA1621 PCDH3X 776 Q9H158 PCDC1_HUMAN Protocadherin alpha-C1 (PCDH-alpha-C1) PCDHAC1 963 Q9Y5H4 PCDG1_HUMAN Protocadherin gamma-A1 (PCDH-gamma-A1) PCDHGA1 931 Q9Y5G9 PCDG4_HUMAN Protocadherin gamma-A4 (PCDH-gamma-A4) PCDHGA4 931 Q9Y5G3 PCDGDHUMAN Protocadherin gamma-B1 (PCDH-gamma-B1) PCDHGB1 927 Q9UN71 PCDGG_HUMAN Protocadherin gamma-B4 (PCDH-gamma-B4) (Cadherin-20) (Fibroblast cadherin-2) PCDHGB4 CDH20 FIB2 923 Q9Y5G0 PCDGH_HUMAN Protocadherin gamma-B5 (PCDH-gamma-B5) PCDHGB5 923 Q9Y5F8 PCDGJ_HUMAN Protocadherin gamma-B7 (PCDH-gamma-B7) PCDHGB7 929 Q9Y5F7 PCDGLHUMAN Protocadherin gamma-C4 (PCDH-gamma-C4) PCDHGC4 938 P09619 PGFRB_HUMAN Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2,7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor receptor 1) (PDGFR-1) (CD antigen CD140b) PDGFRB PDGFR PDGFR1 1106 Q15116 PDCD1_HUMAN Programmed cell death protein 1 (Protein PD-1) (hPD-1) (CD antigen CD279) PDCD1 PD1 288 P16234 PGFRA_HUMAN Platelet-derived growth factor receptor alpha (PDGF-R-alpha) (PDGFR-alpha) (EC 2.7.10.1) (Alpha platelet-derived growth factor receptor) (Alpha-type platelet-derived growth factor receptor) (CD140 antigen-like family member A) (CD140a antigen) (Platelet-derived growth factor alpha receptor) (Platelet-derived growth factor receptor 2) (PDGFR-2) (CD antigen CD140a) PDGFRA PDGFR2 RHEPDGFRA 1089 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9NZ53 PDXL2_HUMAN Podocalyxin-like protein 2 (Endoglycan) PODXL2 UNQ1861/PRO3742 605 Q6UXB8 PI16_HUMAN Peptidase inhibitor 16 (PI-16) (Cysteine-rich secretory protein 9) (CRISP-9) (PSP94-binding protein) PI16CRISP9PSPBP PSEC0164 UNQ289/PRO328 463 Q9UKJ0 PILRB_HUMAN Paired immunoglobulin-like type 2 receptor beta (Activating receptor PILR-beta) (Cell surface receptor FDFACT) PILRB FDFACT PP1551 227 Q8IYJ0 PIANP_HUMAN PILR alpha-associated neural protein (PILR-associating neural protein) (Paired immunoglobin¬ like type 2 receptor-associating neural protein) PIANP C12orf53 PANP UNQ828/PRO1755 282 P01833 PIGRHUMAN Polymeric immunoglobulin receptor (PlgR) (Poly-lg receptor) (Hepatocellular carcinomaassociated protein TB6) (Cleaved into: Secretory component] PIGR 764 Q9UKJ1 PILRA_HUMAN Paired immunoglobulin-like type 2 receptor alpha (Cell surface receptor FDF03) (Inhibitory receptor PILR-alpha) PILRA 303 Q13018 PLA2R_HUMAN Secretory phospholipase A2 receptor (PLA2-R) (PLA2R) (180 kDa secretory phospholipase A2 receptor) (C-type lectin domain family 13 member C) (M-type receptor) [Cleaved into: Soluble secretory phospholipase A2 receptor (Soluble PLA2-R) (Soluble PLA2R)] PLA2R1 CLEC13C 1463 Q8IUK5 PLDX1_HUMAN Plexin domain-containing protein 1 (Tumor endothelial marker 3) (Tumor endothelial marker?) PLXDC1 TEM3 TEM7 500 043157 PLXB1_HUMAN Plexin-B1 (Semaphorin receptor SEP) PLXNB1 KIAA0407 PLXN5SEP 2135 060486 PLXC1_HUMAN Plexin-C1 (Virus-encoded semaphorin protein receptor) (CD antigen CD232) PLXNC1 VESPR 1568 Q969N2 PIGT_HUMAN GPI transamidase component PIG-T (Phosphatidylinositol-glycan biosynthesis class T protein) PIGT CGI-06 PSEC0163 UNQ716/PRO1379 578 P08F94 PKHD1_HUMAN Fibrocystin (Polycystic kidney and hepatic disease 1 protein) (Polyductin) (Tigmin) PKHD1 FCYTTIGM1 4074 Q6P1J6 PLB1_HUMAN Phospholipase B1, membrane-associated (Phospholipase B) (hPLB) (Phospholipase B/lipase) (PLB/UP) [Indudes: Phospholipase A2 (EC 3,1.1.4); Lysophospholipase (EC 3.1.1.5)] PLB1 PLB 1458 Q8TEM1 PO210_HUMAN Nuclear pore membrane glycoprotein 210 (Nudear pore protein gp210) (Nudear envelope pore membrane protein POM 210) (POM210) (Nudeoporin Nup210) (Pore membrane protein of 210 kDa) NUP210 KIAA0906 PSEC0245 1887 000168 PLM_HUMAN Phospholemman (FXYD domain-containing ion transport regulator 1) FXYD1 PLM 92 P51805 PLXA3_HUMAN Plexin-A3 (Plexin-4) (Semaphorin receptor SEX) PLXNA3 PLXN4 SEX 1871 Q9UIW2 PLXA1_HUMAN Plexin-A1 (Semaphorin receptor NOV) PLXNA1 NOV PLXN1 1896 2018-03-20Date Re^ue/Date Received 2023-02-27 075051 PLXA2_HUMAN Plexin-A2 (Semaphorin receptor OCT) PLXNA2 KIAA0463 OCT PLXN2 UNQ209/PRO235 1894 Q8TBF5 PIGX_HUMAN Phosphatidylinositol-glycan biosynthesis class X protein (PIG-X) PIGX 258 P40967 PMEL_HUMAN Melanocyte protein PMEL (ME20-M) (ME20M) (Melanocyte protein Pmel 17) (Melanocytes lineage-specific antigen GP100) (Melanoma-associated ME20 antigen) (P1) (P100) (Premelanosome protein) (Silver locus protein homolog) [Cleared into: M-alpha (95 kDa melanocyte-specific secreted glycoprotein) (P26) (Secreted melanoma-associated ME20 antigen) (ME20-S) (ME20S); M-beta] PMELD12S53E PMEL17SILV 661 Q8IY17 PLPL6_HUMAN Neuropathy target esterase (EC 3.1.1.5) (Patatin-like phospholipase domain-containing protein 6) PNPLA6 NTE 1366 Q9BZG2 PPAT_HUMAN Testicular acid phosphatase (EC 3.1.3.2) ACPT 426 Q86XR5 PRIMA_HUMAN Proline-rich membrane anchor 1 (PRiMA) PRIMA1 153 Q9HCM2 PLXA4_HUMAN Plexin-A4 PLXNA4 KIAA1550 PLXNA4A PLXNA4B UNQ2820/PRO34003 1894 015031 PLXB2_HUMAN Plexin-B2 (MM1) PLXNB2 KIAA0315 1838 Q9ULL4 PLXB3_HUMAN Plexin-B3 PLXNB3 KIAA1206 PLXN6 1909 000592 PODXL_HUMAN Podocalyxin (GCTM-2 antigen) (Gp200) (Podocalyxin-like protein 1) (PC) (PCLP-1) PODXLPCLPPCLP1 558 Q8N131 PORIM_HUMAN Porimin (Keratinocytes-assodated transmembrane protein 3) (KCT-3) (Pro-oncosis receptor inducing membrane injury) (Transmembrane protein 123) TMEM123 KCT3 PSEC0111 UNQ641/PRO1271 208 P15309 PPAP_HUMAN Prostatic add phosphatase (PAP) (EC 3.1.3.2) (5'-nudeotidase) (5'-NT) (EC 3.1.3.5) (Ecto-5'- nucleotidase) (Thiamine monophosphatase) (TMPase) [Cleaved into: PAPf39) ACPP 386 Q5SGD2 PPM1L_HUMAN Protein phosphatase 1L (EC 3.1,3.16) (Protein phosphatase 1-like) (Protein phosphatase 2C isoform epsilon) (PP2C-epsilon) PPM1LPP2CE 360 P16471 PRLR_HUMAN Prolactin receptor (PRL-R) PRLR 622 Q6UWB4 PRS55_HUMAN Serine protease 55 (EC 3.4.21.-) (Testis serine protease 1) (T-SP1) PRSS55TSP1 UNQ9391/PRO34284 352 P10586 PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F (EC 3.1.3.48) (Leukocyte common antigen related) (LAR) PTPRF LAR 1907 P28827 PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu (Protein-tyrosine phosphatase mu) (R-PTP-mu) PTPRM PTPRL1 1452 2018-03-20Date Re^ue/Date Received 2023-02-27 (EC 3.1.3.48) Q16849 PTPRN_HUMAN Receptor-type tyrosine-protein phosphatase-like N (R-PTP-N) (Islet cell antigen 512) (ICA 512) (Islet cell autoantigen 3) (PTP IA-2) PTPRN ICA3 ICA512 979 Q13332 PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S (R-PTP-S) (EC 3.1.3.48) (Receptor-type tyrosine¬ protein phosphatase sigma) (R-PTP-sigma) PTPRS 1948 Q6ISU1 PTCRA_HUMAN Pre T-cell antigen receptor alpha (pT-alpha) (pTa) (pT-alpha-TCR) PTCRA 281 P53801 PTTG_HUMAN Pituitary tumor-transforming gene 1 protein-interacting protein (Pituitary tumor-transforming gene protein-binding factor) (PBF) (PTTG-binding factor) PTTG1IP C21orf1 C21orf3 180 Q13308 PTK7_HUMAN Inactive tyrosine-protein kinase 7 (Colon carcinoma kinase 4) (CCK-4) (Protein-tyrosine kinase 7) (Pseudo tyrosine kinase receptor 7) (Tyrosine-protein kinase-like 7) PTK7CCK4 1070 P23468 PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTPdelta) (EC 3.1.3.48) PTPRD 1912 Q15262 PTPRK_HUMAN Receptor-type tyrosine-protein phosphatase kappa (Protein-tyrosine phosphatase kappa) (RPTP-kappa) (EC 3.1.3.48) PTPRK PTPK 1439 Q9UMZ3 PTPRQ_HUMAN Phosphatidylinositol phosphatase PTPRQ (EC 3.1.3.-) (Receptor-type tyrosine-protein phosphatase Q) (PTP-RQ) (R-PTP-Q) (EC 3.1.3.48) PTPRQ 2332 P23467 PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta (Protein-tyrosine phosphatase beta) (R-PTPbeta) (EC 3.1.3.48) (Vascular endothelial protein tyrosine phosphatase) (VE-PTP) PTPRB PTPB 1997 Q9HD43 PTPRH_HUMAN Receptor-type tyrosine-protein phosphatase H (R-PTP-H) (EC 3.1.3.48) (Stomach cancerassociated protein tyrosine phosphatase 1) (SAP-1) (Transmembrane-type protein-tyrosine phosphatase type H) PTPRH SAP1 1115 Q16827 PTPRO_HUMAN Receptor-type tyrosine-protein phosphatase0 (R-PTP-O) (EC 3.1.3.48) (Glomerular epithelial protein 1) (Protein tyrosine phosphatase U2) (PTP-U2) (PTPase U2) PTPRQ GLEPP1 PTPU2 1216 Q15256 PTPRR_HUMAN Receptor-type tyrosine-protein phosphatase R (R-PTP-R) (EC 3.1.3.48) (Ch-1PTPase) (NCPTPCOM1) (Protein-tyrosine phosphatase PCPTP1) PTPRR ECPTP PTPRQ 657 P15151 PVR_HUMAN Poliovirus receptor (Nectin-like protein 5) (NECL-5) (CD antigen CD155) PVRPVS 417 P18433 PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha (Protein-tyrosine phosphatase alpha) (RPTP-alpha) (EC 3.1.3.48) PTPRA PTPA PTPRL2 802 P08575 PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C (EC 3.1.3.48) (Leukocyte common antigen) (LCA) (T200) (CD antigen CD45) PTPRC CD45 1304 014522 PTPRT_HUMAN Receptor-type tyrosine-protein phosphatase T (R-PTP-T) (EC 3.1.3.48) (Receptor-type tyrosine¬ protein phosphatase rho) (RPTP-rho) PTPRT KIAA0283 1441 Q92729 PTPRU_HUMAN Receptor-type tyrosine-protein phosphatase U (R-PTP-U) (EC 3.1.3.48) (Pancreatic carcinoma phosphatase 2) (PCP-2) (Protein-tyrosine phosphatase J) (PTP-J) (hPTP-J) (Protein-tyrosine PTPRU FMI PCP2 PTPRQ 1446 2018-03-20Date Re^ue/Date Received 2023-02-27 phosphatase pi) (PTP pi) (Protein-tyrosine phosphatase receptor omicron) (PTP-RO) (Receptor¬ type protein-tyrosine phosphatase psi) (R-PTP-psi) P23471 PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta (R-PTP-zeta) (EC 3.1.3,48) (Protein-tyrosine phosphatase receptor type Z polypeptide 1) (Protein-tyrosine phosphatase receptor type Z polypeptide 2) (R-PTP-zeta-2) PTPRZ1 HTPZP2 PTPRZ PTPRZ2 PTPZ 2315 Q9NXS2 QPCTL_HUMAN Glutaminyl-peptide cydotransferase-like protein (EC 2.3.2.5) (Golgi-resident glutaminyl-peptide cyclotransferase) (isoQC) (gQC) QPCTL 382 Q92932 PTPR2_HUMAN Receptor-type tyrosine-protein phosphatase N2 (R-PTP-N2) (EC 3.1.3.48) (Islet cell autoantigen-related protein) (IAR) (ICAAR) (Phogrin) PTPRN2 KIAA0387 1015 P23469 PTPRE_HUMAN Receptor-type tyrosine-protein phosphatase epsilon (Protein-tyrosine phosphatase epsilon) (RPTP-epsilon) (EC 3.1.3.48) PTPRE 700 P23470 PTPRG_HUMAN Receptor-type tyrosine-protein phosphatase gamma (Protein-tyrosine phosphatase gamma) (RPTP-gamma) (EC 3.1.3.48) PTPRG PTPG 1445 Q12913 PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta (Protein-tyrosine phosphatase eta) (R-PTP-eta) (EC 3.1.3.48) (Density-enhanced phosphatase 1) (DEP-1) (HPTP eta) (Protein-tyrosine phosphatase receptor type J) (R-PTP-J) (CD antigen CD148) PTPRJ DEP1 1337 Q15109 RAGE_HUMAN Advanced glycosylation end product-specific receptor (Receptor for advanced glycosylation end products) AGER RAGE 404 Q6UX71 PXDC2_HUMAN Plexin domain-containing protein 2 (Tumor endothelial marker 7-related protein) PLXDC2TEM7R UNQ2514/PRO6003 529 060894 RAMP1_HUMAN Receptor activity-modifying protein 1 (Calcitonin-receptor-like receptor activity-modifying protein 1) (CRLR activity-modifying protein 1) RAMP1 148 060895 RAMP2_HUMAN Receptor activity-modifying protein 2 (Calcitonin-receptor-like receptor activity-modifying protein 2) (CRLR activity-modifying protein 2) RAMP2 175 060896 RAMP3_HUMAN Receptor activity-modifying protein 3 (Calcitonin-receptor-like receptor activity-modifying protein 3) (CRLR activity-modifying protein 3) RAMP3 148 Q8IUW5 RELL1_HUMAN RELT-like protein 1 RELL1 PSEC0162 271 075787 RENR_HUMAN Renin receptor (ATPase H(+)-transporting lysosomal accessory protein 2) (ATPase H(+)- transporting lysosomal-interacting protein 2) (ER-localized typeI transmembrane adaptor) (Embryonic liver differentiation factor 10) (N14F) (Renin/prorenin receptor) (Vacuolar ATP synthase membrane sector-associated protein M8-9) (ATP6M8-9) (V-ATPase M8.9 subunit) ATP6AP2ATP6IP2 CAPER ELDF10 HT028 MSTP009 PSEC0072 350 Q6H3X3 RET1G_HUMAN Retinoic acid early transcript 1G protein (UL-16 binding protein 5) (ULBP5) RAET1G 334 P07949 RETHUMAN Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cellRETCDHF12 CDHR16 PTC RET51 1114 2018-03-20Date Re^ue/Date Received 2023-02-27 membrane anchored RET cadherin 120 kDa fragment] Q9ULK6 RN150_HUMAN RING finger protein 150 RNF150 KIAA1214 438 Q9Y6N7 ROBO1_HUMAN Roundabout homolog1 (Deleted in U twenty twenty) (H-Robo-1) ROBO1 DUTT1 1651 Q01974 R0R2_HUMAN Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2) ROR2 NTRKR2 943 P04843 RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (EC 2.4.99.18) (Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit) (Ribophorin I) (RPN-I) (Ribophorin-1) RPN1 607 Q68DV7 RNF43_HUMAN E3 ubiquitin-protein ligase RNF43 (EC 6.3.2.-) (RING finger protein 43) RNF43 783 Q04912 R0N_HUMAN Macrophage-stimulating protein receptor (MSP receptor) (EC 2.7.10.1) (CDw136) (Protein¬ tyrosine kinase 8) (p185-Ron) (CD antigen CD136) [Cleaved into: Macrophage-stimulating protein receptor alpha chain; Macrophage-stimulating protein receptor beta chain] MST1RPTK8RON 1400 Q96MS0 ROBO3_HUMAN Roundabout homolog 3 (Roundabout-like protein 3) ROBO3 1386 Q01973 ROR1_HUMAN Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Neurotrophic tyrosine kinase, receptor-related 1) ROR1 NTRKR1 937 P08922 ROS1_HUMAN Proto-oncogene tyrosine-protein kinase ROS (EC 2.7.10.1) (Proto-oncogene c-Ros) (Proto¬ oncogene c-Ros-1) (Receptor tyrosine kinase c-ros oncogene 1) (c-Ros receptor tyrosine kinase) ROS1 MCF3 ROS 2347 Q9HCK4 ROBO2_HUMAN Roundabout homolog 2 ROBO2 KIAA1568 1378 P34925 RYK_HUMAN Tyrosine-protein kinase RYK (EC 2.7.10.1) RYK JTK5A 604 Q9HBV2 SACA1_HUMAN Sperm acrosome membrane-associated protein 1 (Sperm acrosomal membrane-associated protein 32) SPACA1 SAMP32 294 P31431 SDC4_HUMAN Syndecan-4 (SYND4) (Amphiglycan) (Ryudocan core protein) SDC4 198 P21583 SCF.HUMAN Kit ligand (Mast cell growth factor) (MGF) (Stem cell factor) (SCF) (c-Kit ligand) [Cleaved into: Soluble KIT ligand (sKITLG)] KITLG MGF SCF 273 060939 SCN2B_HUMAN Sodium channel subunit beta-2 SCN2B UNQ326/PRO386 215 Q8IWT1 SCN4B_HUMAN Sodium channel subunit beta-4 SCN4B 228 P18827 SDC1_HUMAN Syndecan-1 (SYND1) (CD antigen CD138) SDC1 SDC 310 075056 SDC3.HUMAN Syndecan-3 (SYND3) SDC3 KIAA0468 442 Q9NTN9 SEM4G_HUMAN Semaphorin-4G SEMA4G KIAA1619 838 W5XKT8 SACA6_HUMAN Sperm acrosome membrane-associated protein 6 (BACHELOR-like protein) SPACA6SPACA6P 324 2018-03-20Date Re^ue/Date Received 2023-02-27 UNQ2487/PRO5774 Q96BY9 SARAF_HUMAN Store-operated calcium entry-associated regulatory factor (SARAF) (SOCE-associated regulatory factor) (HBV X-transactivated gene 3 protein) (HBV XAg-transactivated protein 3) (Protein FOAP-7) (Transmembrane protein 66) SARAF TMEM66 XTP3 HSPC035 NPD003 PSEC0019 UNQ1967/PRO4499 339 Q13591 SEM5A_HUMAN Semaphorin-5A (Semaphorin-F) (Sema F) SEMA5ASEMAF 1074 Q53EL9 SEZ6_HUMAN Seizure protein 6 homolog (SEZ-6) (hSEZ-6) SEZ6 994 Q9NY72 SCN3B_HUMAN Sodium channel subunit betas? SCN3B KIAA1158 215 Q8WVN6 SCTM1_HUMAN Secreted and transmembrane protein 1 (Protein K-12) SECTM1 K12 248 Q9UBV2 SE1L1_HUMAN Protein sel-1 homolog 1 (Suppressor of lin-12-like protein 1) (Sel-1L) SEL1LTSA305 UNQ128/PRO1063 794 Q9NPR2 SEM4B_HUMAN Semaphorin-4B SEMA4B KIAA1745 SEMAC UNQ749/PRO1480 832 095754 SEM4F_HUMAN Semaphorin-4F (Semaphorin-M) (Sema M) (Semaphorin-W) (Sema W) SEMA4FSEMAM SEMAW 770 Q96RL6 SIG11_HUMAN Sialic add-binding Ig-like lectin 11 (Sialic acid-binding lectin 11) (Siglec-11) SIGLEC11 UNQ9222/PRO28718 698 Q07699 SCN1B_HUMAN Sodium channel subunit beta-1 SCN1B 218 P34741 SDC2_HUMAN Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362) SDC2 HSPG1 201 Q7Z5N4 SDK1_HUMAN Protein sidekick-1 SDK1 2213 Q58EX2 SDK2_HUMAN Protein sidekick-2 SDK2 KIAA1514 2172 Q5TEA6 SE1L2_HUMAN Protein sel-1 homolog 2 (Suppressor of lin-12-like protein 2) (Sel-1L2) SEL1L2C20orf50 688 Q9BYH1 SE6L1_HUMAN Seizure 6-like protein SEZ6L KIAA0927 UNQ2542/PRO6094 1024 Q14242 SELPL_HUMAN P-selectin glycoprotein ligand 1 (PSGL-1) (Selectin P ligand) (CD antigen CD162) SELPLG 412 Q9H3T2 SEM6C_HUMAN Semaphorin-6C (Semaphorin-Y) (SemaY) SEMA6C KIAA1869 SEMAY 930 Q96DD7 SHSA4_HUMAN Protein shisa-4 (Transmembrane protein 58) SHISA4C1orf40 TMEM58 UNQ583/PRO1153 197 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9P0V8 SLAF8_HUMAN SLAM family member 8 (B-lymphocyte activator macrophage expressed) (BCM-tike membrane protein) (CD antigen CD353) SLAMF8 BLAME 285 Q9H3T3 SEM6B_HUMAN Semaphorin-6B (Semaphorin-Z) (SemaZ) SEMA6BSEMAN SEMAZ UNQ1907/PRO4353 888 Q8NFY4 SEM6D_HUMAN Semaphorin-6D SEMA6D KIAA1479 1073 094933 SLIK3_HUMAN SLIT and NTRK-like protein 3 SLITRK3 KIAA0848 977 Q6UXD5 SE6L2_HUMAN Seizure 6-like protein 2 SEZ6L2 PSK UNQ1903/PRO4349 910 Q9C0C4 SEM4C_HUMAN Semaphorin-4C SEMA4C KIAA1739 SEMAI UNQ5855/PRO34487 833 Q92854 SEM4D_HUMAN Semaphoring (A8) (BB18) (GR3) (CD antigen CD100) SEMA4D C9orf164 CD100SEMAJ 862 P78324 SHPS1_HUMAN Tyrosine-protein phosphatase non-receptor type substrate 1 (SHP substrate 1) (SHPS-1) (Brain Ig-like molecule with tyrosine-based activation motifs) (Bit) (CD172 antigen-like family member A) (Inhibitory receptor SHPS-1) (Macrophage fusion receptor) (MyD-1 antigen) (Signalregulatory protein alpha-1) (Sirp-alpha-1) (Signal-regulatory protein alpha-2) (Sirp-alpha-2) (Signal-regulatory protein alpha-3) (Sirp-alpha-3) (p84) (CD antigen CD172a) SIRPABITMFR MYD1 PTPNS1 SHPS1 SIRP 504 Q8N114 SHSA5_HUMAN Protein shisa-5 (Putative NF-kappa-B-activating protein 120) (Scotin) SHISA5 SCOTIN PSEC0133 240 B8ZZ34 SHSA8_HUMAN Putative protein shisa-8 SHISA8 C22orf17 492 Q96PQ1 SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 (Siglec-12) (Sialic acid-binding Ig-like lectin-like 1) (Siglec-L1) SIGLEC12 SIGLECL1 SLG UNQ9215/PRO34042 595 Q5JXA9 SIRB2_HUMAN Signal-regulatory protein beta-2 (SIRP-beta-2) (Protein tyrosine phosphatase non-receptor type substrate Hike 3) (Protein tyrosine phosphatase non-receptor type substrate protein) SIRPB2 PTPN1L PTPNS1L3 342 Q9P1W8 SIRPG_HUMAN Signal-regulatory protein gamma (SIRP-gamma) (CD172 antigen-like family member B) (Signalregulatory protein beta-2) (SIRP-b2) (SIRP-beta-2) (CD antigen CD172g) SIRPG SIRPB2 387 Q9BQ49 SMIM7_HUMAN Small integral membrane protein 7 SMIM7 C19orf42 75 Q9H3S1 SEM4A_HUMAN Semaphorin-4A (Semaphorin-B) (Sema B) SEMA4ASEMAB SEMB UNQ783/PRO1317 761 Q9H2E6 SEM6A_HUMAN Semaphorin-6A (Semaphorin VIA) (Sema VIA) (Semaphorin-6A-1) (SEMA6A-1) SEMA6A KIAA1368 1030 2018-03-20Date Re^ue/Date Received 2023-02-27 SEMAQ B4DS77 SHSA9_HUMAN Protein shisa-9 SHISA9 424 A6NMB1 SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 (Siglec-16) (Siglec-P16) SIGLEC16 SIGLECP16 481 Q9NYZ4 SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 (Siglec-8) (Sialoadhesin family member 2) (SAF-2) SIGLEC8SAF2 499 Q9UIB8 SLAF5_HUMAN SLAM family member 5 (Cell surface antigen MAX.3) (Hly9-beta) (Leukocyte differentiation antigen CD84) (Signaling lymphocytic activation molecule 5) (CD antigen CD84) CD84SLAMF5 345 Q16586 SGCA_HUMAN Alpha-sarcoglycan (Alpha-SG) (50 kDa dystrophin-associated glycoprotein) (50DAG) (Adhalin) (Dystroglycan-2) SGCAADLDAG2 387 A0PJX4 SHSA3_HUMAN Protein shisa-3 homolog SHISA3 238 Q96LC7 SIG10_HUMAN Sialic acid-binding Ig-like lectin 10 (Siglec-10) (Siglec-like protein 2) SIGLEC10SLG2 UNQ477/PRO940 697 015389 SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 (Siglec-5) (CD33 antigen-like 2) (Obesity-binding protein 2) (0B-BP2) (OB-binding protein 2) (CD antigen CD170) SIGLEC5CD33L2 OBBP2 551 043699 SIGL6_HUMAN Sialic acid-binding Ig-like lectin 6 (Siglec-6) (CD33 antigen-like 1) (CDw327) (Obesity-binding protein 1) (0B-BP1) (CD antigen CD327) SIGLEC6CD33L CD33L1 0BBP1 453 Q9Y336 SIGL9_HUMAN Sialic acid-binding Ig-like lectin 9 (Siglec-9) (CDw329) (Protein FOAP-9) (CD antigen CD329) SIGLEC9 UNQ668/PRO1302 463 000241 SIRB1_HUMAN Signal-regulatory protein beta-1 (SIRP-beta-1) (CD172 antigen-like family member B) (CD antigen CD172b) SIRPB1 398 Q13291 SLAF1_HUMAN Signaling lymphocytic activation molecule (CDw150) (IPO-3) (SLAM family member 1) (CD antigen CD150) SLAMF1 SLAM 335 Q96DU3 SLAF6_HUMAN SLAM family member6 (Activating NK receptor) (NK-T-B-antigen) (NTB-A) (CD antigen CD352) SLAMF6 KALI UNQ6123/PRO20080 332 094991 SLIK5_HUMAN SLIT and NTRK-like protein 5 (Leucine-rich repeat-containing protein 11) SLITRK5 KIAA0918 LRRC11 958 Q96PQ0 SORC2_HUMAN VPS10 domain-containing receptor SorCS2 SORCS2 KIAA1329 1159 Q6UWI4 SHSA2_HUMAN Protein shisa-2 homolog (Transmembrane protein 46) SHISA2C13orf13 TMEM46 UNQ9166/PRO28631 295 Q6ZMC9 SIG15_HUMAN Sialic acid-binding Ig-like lectin 15 (Siglec-15) (CD33 antigen-like 3) SIGLEC15 CD33L3 328 Q9Y286 SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 (Siglec-7) (Adhesion inhibitory receptor molecule 1) (AIRM-1) (CDw328) (D-siglec) (QA79 membrane protein) (p75) (CD antigen CD328) SIGLEC7AIRM1 467 2018-03-20Date Re^ue/Date Received 2023-02-27 Q96A28 SLAF9_HUMAN SLAM family member 9 (CD2 family member 10) (CD2F-10) (CD84 homolog 1) (CD84-H1) SLAMF9CD2F10 UNQ1938/PRO4421 289 Q9H156 SLIK2_HUMAN SLIT and NTRK4ike protein 2 SUTRK2CXorf2 KIAA1854SLITL1 UNQ9197/PRO34756 845 Q8IW52 SLIK4_HUMAN SLIT and NTRKTike protein 4 SUTRK4 837 A6NGZ8 SMIM9_HUMAN Small integral membrane protein 9 SMIM9CXorf68 99 Q8WY21 S0RC1_HUMAN VPS10 domain-containing receptor SorCSI (hSorCS) SORCS1 SORCS 1168 Q92673 S0RL_HUMAN Sortilin-related receptor (Low-density lipoprotein receptor relative with 11 ligand-binding repeats) (LDLR relative with 11 ligand-binding repeats) (LR11) (SorLA-1) (Sorting protein-related receptor containing LDLR class A repeats) (SorLA) SORL1 C11orf32 2214 Q99523 S0RT.HUMAN Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3) SORT1 831 Q9Y3P8 SIT1_HUMAN Signaling threshold-regulating transmembrane adapter 1 (SHP2-interacting transmembrane adapter protein) (Suppression-inducing transmembrane adapter 1) (gp30/40) SIT1 SIT 196 Q9NQ25 SLAF7_HUMAN SLAM family member 7 (CD2 subset 1) (CD24ike receptor-activating cytotoxic cells) (CRACC) (Membrane protein FOAP-12) (Novel Ly9) (Protein 19A) (CD antigen CD319) SLAMF7CS1 UNQ576/PRO1138 335 Q96PX8 SLIK1_HUMAN SLIT and NTRK-like protein 1 (Leucine-rich repeat-containing protein 12) SLITRK1 KIAA1910 LRRC12 UNQ233/PRO266 696 Q9H5Y7 SLIK6_HUMAN SLIT and NTRK-like protein 6 SLITRK6 841 Q6ZSJ9 SHSA6_HUMAN Protein shisa-6 homolog SHISA6 500 Q08ET2 SIG14_HUMAN Sialic add-binding Ig-like lectin 14 (Siglec-14) SIGLEC14 UNQ294/PRO333 396 Q5TFQ8 SIRBL_HUMAN Signal-regulatory protein beta-1 isoform 3 (SIRP-beta-1 isoform 3) SIRPB1 398 Q9UPU3 S0RC3_HUMAN VPS10 domain-containing receptor SorCS3 SORCS3 KIAA1059 1222 043291 SPIT2_HUMAN Kunitz-type protease inhibitor 2 (Hepatocyte growth factor activator inhibitor type 2) (HAI-2) (Placental bikunin) SPINT2 HAI2 KOP 252 Q9BZZ2 SNHUMAN Sialoadhesin (Sialic acid-binding Ig-like lectin 1) (Siglec-1) (CD antigen CD169) SIGLEC1 SN 1709 Q9P246 STIM2.HUMAN Stromal interaction molecule 2 STIM2 KIAA1482 746 Q9UBS9 SUCO_HUMAN SUN domain-containing ossification factor (Membrane protein CH1) (Protein osteopotentia homolog) (SUN-like protein 1) SUCO C1orf9 CH1 OPTSLP1 1254 Q96GP6 SREC2_HUMAN Scavenger receptor class F member 2 (SRECRP-1) (Scavenger receptor expressed by endothelial cells 2 protein) (SREC-II) SCARF2 SREC2 SREPCR 870 2018-03-20Date Re^ue/Date Received 2023-02-27 P43307 SSRA_HUMAN Translocon-assodated protein subunit alpha (TRAP-alpha) (Signal sequence receptor subunit alpha) (SSR-alpha) SSR1 TRAPA PSEC0262 286 Q5VX71 SUSD4_HUMAN Sushi domain-containing protein 4 SUSD4 UNQ196/PRO222 490 P43308 SSRB_HUMAN Translocon-associated protein subunit beta (TRAP-beta) (Signal sequence receptor subunit beta) (SSR-beta) SSR2TRAPB HSD25 183 P51571 SSRD_HUMAN Translocon-associated protein subunit delta (TRAP-delta) (Signal sequence receptor subunit delta) (SSR-delta) SSR4TRAPD 173 Q13586 STIM1_HUMAN Stromal interaction molecule 1 STIM1 GOK 685 Q14162 SREC_HUMAN Scavenger receptor class F member 1 (Acetyl LDL receptor) (Scavenger receptor expressed by endothelial cells 1) (SREC-I) SCARF1 KIAA0149 SREC 830 Q92537 SUSD6_HUMAN Sushi domain-containing protein 6 (Drug-activated gene overexpressed protein) SUSD6 DRAGO KIAA0247 303 Q9NY15 STAB1_HUMAN Stabilin-1 (Fasdclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1) (FEEL-1) (MS-1 antigen) STAB1 FEEL1 KIAA0246 2570 Q8WWQ8 STAB2_HUMAN Stabilin-2 (FAS1 EGF-like and X-link domain-containing adhesion molecule 2) (Fasciclin, EGFlike, laminin-type EGF-like and link domain-containing scavenger receptor 2) (FEEL-2) (Hyaluronan receptor for endocytosis) [Cleaved into: 190 kDaform stabilin-2 (190 kDa hyaluronan receptor for endocytosis)! STAB2 FEEL2 FELL FEX2 HARE 2551 060279 SUSD5_HUMAN Sushi domain-containing protein 5 SUSD5 KIAA0527 629 Q9UGT4 SUSD2_HUMAN Sushi domain-containing protein 2 SUSD2 822 Q9UQF0 SYCY1_HUMAN Syncytin-1 (Endogenous retrovirus group W member 1) (Env-W) (Envelope polyprotein gPr73) (Enverin) (HERV-7q Envelope protein) (HERV-W envelope protein) (HERV-W_7q21.2 provirus ancestral Env polyprotein) (Syncytin) [Cleaved into: Surface protein (SU) (gp50); Transmembrane protein (TM) (gp24)] ERVW-1 ERVWE1 538 Q6UWL2 SUSD1_HUMAN Sushi domain-containing protein 1 SUSD1 UNQ2438/PRO4999 747 Q8N3T6 T132C.HUMAN Transmembrane protein 132C TMEM132C 1108 A2VDJ0 T131L_HUMAN Transmembrane protein 131-like KIAA0922 TMEM131L 1609 Q6IEE7 T132E_HUMAN Transmembrane protein 132E TMEM132E 984 Q14DG7 T132B_HUMAN Transmembrane protein 132B TMEM132B KIAA1786 KIAA1906 1078 2018-03-20Date ReQue/Date Received 2023-02-27 P09758 TACD2_HUMAN Tumor-associated calcium signal transducer 2 (Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) TACSTD2GA733-1 M1S1 TROP2 323 Q14C87 T132D_HUMAN Transmembrane protein 132D (Mature oligodendrocytes transmembrane protein) (Mature OL transmembrane protein) TMEM132D HBE120 KIAA1944 MOLT 1099 Q96GX1 TECT2_HUMAN Tectonic-2 TCTN2C12orf38 TECT2 697 Q24JP5 T132A_HUMAN Transmembrane protein 132A (HSPA5-binding protein 1) TMEM132A HSPA5BP1 KIAA1583 1023 B6A8C7 TARM1_HUMAN T-cell-interacting, activating receptor on myeloid cells protein 1 (OSCAR-like transcript-2 protein) (OLT-2) TARM1 271 P40200 TACT_HUMAN T-cell surface protein tactile (Cell surface antigen CD96) (T cell-activated increased late expression protein) (CD antigen CD96) CD96 585 Q9UIK5 TEFF2_HUMAN Tomoregulin-2 (TR-2) (Hyperplastic polyposis protein 1) (Transmembrane protein with EGF-like and two follistatin-like domains) TMEFF2 HPP1 TENB2TPEF UNQ178/PRO204 374 P36897 TGFR1_HUMAN TGF-beta receptor type-1 (TGFR-1) (EC 2.7.11.30) (Activin A receptor type Il-like protein kinase of 53kD) (Activin receptor-like kinase 5) (ALK-5) (ALK5) (Serine/threonine-protein kinase receptor R4) (SKR4) (TGF-beta type I receptor) (Transforming growth factor-beta receptor type I) (TGF-beta receptor type I) (TbetaR-l) TGFBR1 ALK5SKR4 503 Q9NS62 THSD1_HUMAN Thrombospondin type-1 domain-containing protein 1 (Transmembrane molecule with thrombospondin module) THSD1 TMTSP UNQ3010/PRO9769 852 Q02763 TIE2_HUMAN Angiopoietin-1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (Tunica interna endothelial cell kinase) (Tyrosine kinase with Ig and EGF homology domains-2) (Tyrosine-protein kinase receptor TEK) (Tyrosine-protein kinase receptor TIE-2) (hTIE2) (p140 TEK) (CD antigen CD202b) TEK TIE2VMCM VMCM1 1124 P13726 TF.HUMAN Tissue factor (TF) (Coagulation factor III) (Thromboplastin) (CD antigen CD142) F3 295 Q495A1 TIGIT_HUMAN T-cell immunoreceptor with Ig and ITIM domains (V-set and immunoglobulin domain-containing protein 9) (V-set and transmembrane domain-containing protein 3) TIGITVSIG9VSTM3 244 Q03167 TGBR3_HUMAN Transforming growth factor beta receptor type 3 (TGF-beta receptor type 3) (TGFR-3) (Betaglycan) (Transforming growth factor beta receptor III) (TGF-beta receptor type III) TGFBR3 851 043493 TG0N2_HUMAN Trans-Golgi network integral membrane protein 2 (TGN38 homolog) (TGN46) (TGN48) (Trans¬ Golgi network protein TGN51) TGOLN2TGN46 TGN51 480 Q9BXR5 TLR10_HUMAN Toll-like receptor 10 (CD antigen CD290) TLR10 811 © Ul Ui a © VI 2018-03-20Date ReQue/Date Received 2023-02-27 UNQ315/PRO358 Q8IYR6 TEFF1_HUMAN Tomoregulin-1 (TR-1) (H7365) (Transmembrane protein with EGF-like and one follistatin-like domain) TMEFF1 C9orf2 380 Q8N3G9 TM130_HUMAN Transmembrane protein 130 TMEM130 UNQ719/PRO1383 435 Q4KMG9 TM52B_HUMAN Transmembrane protein 52B TMEM52BC12orf59 UNQ5927/PRO19821 183 Q9BZD6 TMG4_HUMAN Transmembrane gamma-carboxyglutamic add protein 4 (Proline-rich gamma-carboxyglutamic add protein 4) (Proline-rich Gia protein 4) PRRG4 PRGP4 TMG4 226 Q8NEW7 TMIE_HUMAN Transmembrane inner ear expressed protein TMIE 156 Q9HBJ8 TMM27_HUMAN Collectrin (Transmembrane protein 27) TMEM27 UNQ679/PRO1312 222 Q6UXU6 TMM92_HUMAN Transmembrane protein 92 TMEM92 UNQ5801/PRO19608 159 Q6NUS6 TECT3_HUMAN Tectonic-3 TCTN3C10orf61 TECT3 PSEC0041 UNQ1881/PRO4324 607 P35590 TIE1_HUMAN Tyrosine-protein kinase receptor Tie-1 (EC 2.7.10.1) TIE1 TIE 1138 Q15363 TMED2_HUMAN Transmembrane emp24 domain-containing protein 2 (Membrane protein p24A) (p24) (p24 family protein beta-1) (p24beta1) TMED2 RNP24 201 Q7Z7H5 TMED4_HUMAN Transmembrane emp24 domain-containing protein 4 (Endoplasmic reticulum stress-response protein 25) (ERS25) (GMP25iso) (Putative NF-kappa-B-activating protein 156) (p24 family protein alpha-3) (p24alpha3) TMED4 ERS25 227 Q9Y3B3 TMED7_HUMAN Transmembrane emp24 domain-containing protein 7 (p24 family protein gamma-3) (p24gamma3) (p27) TMED7 CGI-109 224 Q07011 TNR9_HUMAN Tumor necrosis factor receptor superfamily member 9 (4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137) TNFRSF9CD137 ILA 255 P01135 TGFA_HUMAN Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha (TGFalpha) (EGF-like TGF) (ETGF) (TGF type 1)] TGFA 160 P37173 TGFR2_HUMAN TGF-beta receptor type-2 (TGFR-2) (EC 2.7.11.30) (TGF-beta type II receptor) (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-ll) TGFBR2 567 Q9UPZ6 THS7A_HUMAN Thrombospondin type-1 domain-containing protein 7A THSD7AKIAA0960 1657 Q9C0I4 THS7B_HUMAN Thrombospondin type-1 domain-containing protein 7B THSD7B KIAA1679 1608 Ul © Ui a © VI 2018-03-20Date Re^ue/Date Received 2023-02-27 Q96H15 TIMD4_HUMAN T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD-4) (T-cell immunoglobulin mucin receptor 4) (TIM-4) (T-cell membrane protein 4) TIMD4TIM4 378 Q15399 TLR1_HUMAN Toll-like receptor 1 (Toll/interieukin-1 receptor-like protein) (TIL) (CD antigen CD281) TLR1 KIAA0012 786 015455 TLR3_HUMAN Toll-like receptors (CD antigen CD283) TLR3 904 060602 TLR5_HUMAN Toll-like receptor 5 (Toll/interleukin-1 receptor-like protein 3) TLR5TIL3 858 Q4V9L6 TM119_HUMAN Transmembrane protein 119 (Osteoblast induction factor) (OBIF) TMEM119 PSEC0199 UNQ731/PRO1415 283 Q13445 TMED1_HUMAN Transmembrane emp24 domain-containing protein 1 (lnterieukin-1 receptor-like 1 ligand) (Putative T1/ST2 receptor-binding protein) (p24 family protein gamma-1) (Tp24) (p24gamma1) TMED1 IL1RL1L IL1RL1LG 227 Q9Y3A6 TMED5_HUMAN Transmembrane emp24 domain-containing protein 5 (p24 family protein gamma-2) (p24gamma2) (p28) TMED5 CGI-100 UNQ397/PRO733 229 P49755 TMEDA_HUMAN Transmembrane emp24 domain-containing protein 10 (21 kDa transmembrane-trafficking protein) (S31III125) (S311125) (Tmp-21-l) (Transmembrane protein Tmp21) (p23) (p24 family protein delta-1) (p24delta1) (p24delta) TMED10TMP21 219 Q86V40 TIKI1_HUMAN Metalloprotease TIKI1 (EC 3.4.-,-) (TRAB domain-containing protein 2A) TRABD2A C2orf89 TIKI1 505 Q9Y2C9 TLR6_HUMAN Toll-like receptor 6 (CD antigen CD286) TLR6 796 Q9NR97 TLR8_HUMAN Toll-like receptor8 (CD antigen CD288) TLR8 UNQ249/PRO286 1041 Q8WZ59 TM190_HUMAN Transmembrane protein 190 TMEM190 MDAC1 177 Q6UWW9 TM207_HUMAN Transmembrane protein 207 TMEM207 UNQ846/PRO1784 146 Q9UK28 TM59L_HUMAN Transmembrane protein 59-like (Brain-specific membrane-anchored protein) TMEM59LBSMAP C19orf4 342 Q8WW62 TMED6_HUMAN Transmembrane emp24 domain-containing protein 6 (p24 family protein gamma-5) (p24gamma5) TMED6 UNQ9146/PRO34237 240 Q9BVK6 TMED9_HUMAN Transmembrane emp24 domain-containing protein 9 (GMP25) (Glycoprotein 25L2) (p24 family protein alpha-2) (p24alpha2) (p25) TMED9GP25L2 235 014668 TMG1_HUMAN Transmembrane gamma-carboxyglutamic add protein 1 (Proline-rich gamma-carboxyglutamic add protein 1) (Proline-rich Gia protein 1) PRRG1 PRGP1 TMG1 218 Q96BF3 TMIG2_HUMAN Transmembrane and immunoglobulin domain-containing protein 2 (CD28 homolog) (Immunoglobulin and proline-rich receptor 1) (IGPR-1) TMIGD2CD28H IGPR1 UNQ3059/PRO9879 282 2018-03-20Date Re^ue/Date Received 2023-02-27 P43489 TNR4_HUMAN Tumor necrosis factor receptor superfamily member 4 (ACT35 antigen) (OX40L receptor) (TAX transcriptionally-activated glycoprotein 1 receptor) (CD antigen CD134) TNFRSF4TXGP1L 277 P25942 TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 (B-cell surface antigen CD40) (Bp50) (CD40L receptor) (CDw40) (CD antigen CD40) CD40TNFRSF5 277 P25445 TNR6_HUMAN Tumor necrosis factor receptor superfamily member 6 (Apo-1 antigen) (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (CD antigen CD95) FASAPT1 FAS1 TNFRSF6 335 014763 TR10B_HUMAN Tumor necrosis factor receptor superfamily member 10B (Death receptor 5) (TNF-related apoptosis-inducing ligand receptor 2) (TRAIL receptor 2) (TRAIL-R2) (CD antigen CD262) TNFRSF10BDR5 KILLER TRAILR2 TRICK2 ZTNFR9 UNQ160/PRO186 440 Q8TB96 TIP_HUMAN T-cell immunomodulatory protein (Protein TIP) (Integrin-alpha FG-GAP repeat-containing protein 1) (Linkin) ITFG1 LNKN-1 TIP CDA08 612 000206 TLR4_HUMAN Toll-like receptor 4 (hToll) (CD antigen CD284) TLR4 839 Q6P9G4 TM154_HUMAN Transmembrane protein 154 TMEM154 183 Q9BXS4 TMM59_HUMAN Transmembrane protein 59 (Liver membrane-bound protein) TMEM59C1orf8 HSPC001 UNQ169/PRO195 323 Q9NP84 TNR12_HUMAN Tumor necrosis factor receptor superfamily member 12A (Fibroblast growth factor-inducible immediate-early response protein 14) (FGF-indudble 14) (Tweak-receptor) (TweakR) (CD antigen CD266) TNFRSF12AFN14 129 Q9Y5U5 TNR18HUMAN Tumor necrosis factor receptor superfamily member 18 (Activation-inducible TNFR family receptor) (Glucocorticoid-induced TNFR-related protein) (CD antigen CD357) TNFRSF18AITR GITR UNQ319/PRO364 241 P20333 TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNFR2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis factor receptor superfamily member 1b, membrane form; Tumor necrosis factor-binding protein 2 (TBP-2) (TBPII)l TNFRSF1BTNFBR TNFR2 461 Q9UBN6 TR10D_HUMAN Tumor necrosis factor receptor superfamily member 10D (Decoy receptor 2) (DcR2) (TNFrelated apoptosis-inducing ligand receptor 4) (TRAIL receptor 4) (TRAIL-R4) (TRAIL receptor with a truncated death domain) (CD antigen CD264) TNFRSF10D DCR2 TRAILR4TRUNDD UNQ251/PRO288 386 Q9NZC2 TREM2JHUMAN Triggering receptor expressed on myeloid cells 2 (TREM-2) (Triggering receptor expressed on monocytes 2) TREM2 230 A6NFA1 TIKI2_HUMAN Metalloprotease TIKI2 (EC 3.4.-.-) (Heart, kidney and adipose-enriched transmembrane protein homolog) (TRAB domain-containing protein 2B) TRABD2B HKAT TIKI2 517 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9NYK1 TLR7_HUMAN Toll-like receptor 7 TLR7 UNQ248/PRO285 1049 Q9NR96 TLR9_HUMAN Toll-like receptor 9 (CD antigen CD289) TLR9 UNQ5798/PRO19605 1032 A2RRL7 TM213_HUMAN Transmembrane protein 213 TMEM213 107 Q9P0T7 TMEM9_HUMAN Transmembrane protein 9 (Dermal papilla-derived protein 4) TMEM9 DERP4 TMEM9A HSPC186 PSEC0012 UNQ631/PRO1248 183 A2RUT3 TMM89_HUMAN Transmembrane protein 89 TMEM89 159 Q9H3N1 TMX1_HUMAN Thioredoxin-related transmembrane protein 1 (Thioredoxin domain-containing protein 1) (Transmembrane Trx-related protein) TMX1 TMXTXNDC TXNDC1 PSEC0085 UNQ235/PRO268 280 Q92956 TNR14HUMAN Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270) TNFRSF14 HVEA HVEM UNQ329/PRO509 283 Q9NS68 TNR19_HUMAN Tumor necrosis factor receptor superfamily member 19 (TRADE) (Toxicity and JNK inducer) TNFRSF19TAJ TROY UNQ1888/PRO4333 423 P19438 TNR1A_HUMAN Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNFR1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD antigen CD120a) [Cleaved into: Tumor necrosis factor receptor superfamily member 1A, membrane form; Tumor necrosis factor-binding protein 1 (TBPI)] TNFRSF1ATNFAR TNFR1 455 Q93038 TNR25_HUMAN Tumor necrosis factor receptor superfamily member 25 (Apo-3) (Apoptosis-inducing receptor AIR) (Apoptosis-mediating receptor DR3) (Apoptosis-mediating receptor TRAMP) (Death receptor 3) (Lymphocyte-associated receptor of death) (LARD) (Protein WSL) (Protein WSL-1) TNFRSF25APO3 DDR3 DR3 TNFRSF12WSL WSL1 UNQ455/PRO779 417 P0DKB5 TPBGL_HUMAN Trophoblast glycoprotein-like TPBGL 382 Q9BX59 TPSNR_HUMAN Tapasin-related protein (TAPASIN-R) (TAP-binding protein-like) (TAP-binding protein-related protein) (TAPBP-R) (Tapasin-like) TAPBPL 468 060603 TLR2_HUMAN Toll-like receptor 2 (Toll/interleukin-1 receptor-like protein 4) (CD antigen CD282) TLR2TIL4 784 Q6UXF1 TM108_HUMAN Transmembrane protein 108 TMEM108 KIAA1690 UNQ1875/PRO4318 575 2018-03-20Date Re^ue/Date Received 2023-02-27 Q8IV31 TM139_HUMAN Transmembrane protein 139 TMEM139 UNQ1932/PRO4407 216 A6NLX4 TM210_HUMAN Transmembrane protein 210 TMEM210 147 Q9Y3Q3 TMED3_HUMAN Transmembrane emp24 domain-containing protein 3 (Membrane protein p24B) (p24 family protein gamma-4) (p24gamma4) (p26) TMED3C15orf22 UNQ5357/PRO1078 217 014669 TMG2_HUMAN Transmembrane gamma-carboxyglutamic add protein 2 (Proline-rich gamma-carboxyglutamic add protein 2) (Proline-rich Gia protein 2) PRRG2 PRGP2 TMG2 202 Q9BZD7 TMG3_HUMAN Transmembrane gamma-carboxyglutamic add protein 3 (Proline-rich gamma-carboxyglutamic add protein 3) (Proline-rich Gia protein 3) PRRG3 PRGP3 TMG3 231 Q9Y320 TMX2_HUMAN Thioredoxin-related transmembrane protein 2 (Cell proliferation-inducing gene 26 protein) (Thioredoxin domain-containing protein 14) TMX2TXNDC14 CGI- 31 My009 PIG26 PSEC0045 UNQ237/PRO270 296 P36941 TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 (Lymphotoxin-beta receptor) (Tumor necrosis factor C receptor) (Tumor necrosis factor receptor 2-related protein) (Tumor necrosis factor receptor type III) (TNF-RIII) (TNFR-III) LTBRD12S370 TNFCRTNFR3 TNFRSF3 435 Q13641 TPBG_HUMAN Trophoblast glycoprotein (5T4 oncofetal antigen) (5T4 oncofetal trophoblast glycoprotein) (5T4 oncotrophoblast glycoprotein) (M6P1) (Wnt-activated inhibitory factor 1) (WAIF1) TPBG 5T4 420 P40238 TPOR_HUMAN Thrombopoietin receptor (TPO-R) (Myeloproliferative leukemia protein) (Proto-oncogene c-MpI) (CD antigen CD110) MPLTPOR 635 P07204 TRBM_HUMAN Thrombomodulin (TM) (Fetomodulin) (CD antigen CD141) THBD THRM 575 Q5T2D2 TRML2_HUMAN Trem-like transcript 2 protein (TLT-2) (Triggering receptor expressed on myeloid cells-like protein 2) TREML2C6orf76 TLT2 UNQ6268/PRO20473 321 Q6UXZ0 TMIG1_HUMAN Transmembrane and immunoglobulin domain-containing protein 1 TMIGD1 TMIGD UNQ9372/PRO34164 262 Q86YD3 TMM25_HUMAN Transmembrane protein 25 TMEM25 UNQ2531/PRO6030 366 Q6P7N7 TMM81_HUMAN Transmembrane protein 81 TMEM81 UNQ2788/PRO7178 255 Q3KNT9 TMM95_HUMAN Transmembrane protein 95 TMEM95 UNQ9390/PRO34281 176 Q9H1E5 TMX4_HUMAN Thioredoxin-related transmembrane protein 4 (Thioredoxin domain-containing protein 13) TMX4KIAA1162 TXNDC13 PSEC0095 349 2018-03-20DEMANDE OU BREVET VOLUMINEUX LA PRESENTE PARTIE DE CETTE DEMANDE OU CE BREVET COMPREND PLUS D’UN TOME.

CECI EST LE TOME 1 DE 2 CONTENANT LES PAGES 1 A 143 NOTE : Pour les tomes additionels, veuillez contacter le Bureau canadien des brevets JUMBO APPLICATIONS/PATENTS THIS SECTION OF THE APPLICATION/PATENT CONTAINS MORE THAN ONE VOLUME THIS IS VOLUME 1 OF 2 CONTAINING PAGES 1 TO 143 NOTE: For additional volumes, please contact the Canadian Patent Office NOM DU FICHIER / FILE NAME : NOTE POUR LE TOME / VOLUME NOTE:DEMANDE OU BREVET VOLUMINEUX LA PRESENTE PARTIE DE CETTE DEMANDE OU CE BREVET COMPREND PLUS D’UN TOME.

CECI EST LE TOME 2 DE 2 CONTENANT LES PAGES 144 A 205 NOTE : Pour les tomes additionels, veuillez contacter le Bureau canadien des brevets JUMBO APPLICATIONS/PATENTS THIS SECTION OF THE APPLICATION/PATENT CONTAINS MORE THAN ONE VOLUME THIS IS VOLUME 2 OF 2 CONTAINING PAGES 144 TO 205 NOTE: For additional volumes, please contact the Canadian Patent Office NOM DU FICHIER / FILE NAME : NOTE POUR LE TOME / VOLUME NOTE:Date Re^ue/Date Received 2023-02-27 UNQ475/PRO938 Q9Y6Q6 TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A (Osteoclast differentiation factor receptor) (ODFR) (Receptor activator of NF-KB) (CD antigen CD265) TNFRSF11A RANK 616 Q86YW5 TRML1_HUMAN Trem-like transcript 1 protein (TLT-1) (Triggering receptor expressed on myeloid cells-like protein 1) TREML1 TLT1 UNQ1825/PRO3438 311 P08138 TNR16_HUMAN Tumor necrosis factor receptor superfamily member 16 (Gp80-LNGFR) (Low affinity neurotrophin receptor p75NTR) (Low-affinity nerve growth factor receptor) (NGF receptor) (p75 ICD) (CD antigen CD271) NGFRTNFRSF16 427 075509 TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 (Death receptor 6) (CD antigen CD358) TNFRSF21 DR6 UNQ437/PRO868 655 P28908 TNR8_HUMAN Tumor necrosis factor receptor superfamily member 8 (CD30L receptor) (Ki-1 antigen) (Lymphocyte activation antigen CD30) (CD antigen CD30) TNFRSF8CD30 D1S166E 595 000220 TR10A_HUMAN Tumor necrosis factor receptor superfamily member 10A (Death receptor 4) (TNF-related apoptosis-inducing ligand receptor 1) (TRAIL receptor 1) (TRAIL-R1) (CD antigen CD261) TNFRSF10AAPO2 DR4TRAILR1 468 Q9NP99 TREM1_HUMAN Triggering receptor expressed on myeloid cells 1 (TREM-1) (Triggering receptor expressed on monocytes 1) (CD antigen CD354) TREM1 234 015533 TPSN_HUMAN Tapasin (TPN) (TPSN) (NGS-17) (TAP-associated protein) (TAP-binding protein) TAPBP NGS17TAPA 448 Q969Z4 TR19L_HUMAN Tumor necrosis factor receptor superfamily member 19L (Receptor expressed in lymphoid tissues) RELTTNFRSF19L 430 Q7L0X0 TRILHUMAN TLR4 interactor with leucine rich repeats (Leucine-rich repeat-containing protein KIAA0644) TRILKIAA0644 811 Q5BVD1 TTMP_HUMAN TPA-induced transmembrane protein TTMPC3orf52 217 Q96J42 TXD15_HUMAN Thioredoxin domain-containing protein 15 TXNDC15C5orf14 UNQ335/PRO534 360 Q9P2J2 TUTLA_HUMAN Protein turtle homolog A (Immunoglobulin superfamily member 9A) (lgSF9A) IGSF9 IGSF9A KIAA1355NRT1 1179 Q9UPX0 TUTLB_HUMAN Protein turtle homolog B (Immunoglobulin superfamily member 9B) (lgSF9B) IGSF9B KIAA1030 1349 Q3SY77 UD3A2_HUMAN UDP-glucuronosyltransferase 3A2 (UDPGT 3A2) (EC 2.4.1.17) UGT3A2 PSEC0073 UNQ842/PRO1780 523 P14679 TYRO_HUMAN Tyrosinase (EC 1.14.18.1) (LB24-AB) (Monophenol monooxygenase) (SK29-AB) (Tumor rejection antigen AB) TYR 529 P40126 TYRP2_HUMAN L-dopachrome tautomerase (DCT) (DT) (EC 5.3.3.12) (L-dopachrome Delta-isomerase) (Tyrosinase-related protein 2) (TRP-2) (TRP2) DCT TYRP2 519 095185 UNC5C_HUMAN Netrin receptor UNC5C (Protein unc-5 homolog 3) (Protein unc-5 homolog C) UNC5C UNC5H3 931 2018-03-20Date Re^ue/Date Received 2023-02-27 Q06418 TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine¬ protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine¬ protein kinase TIF) TYRO3 BYK DTK RSE SKY TIF 890 Q9Y4X1 UD2A1_HUMAN UDP-glucuronosyltransferase 2A1 (UDPGT 2A1) (EC 2.4.1.17) UGT2A1 UGT2A2 527 Q9BT76 UPK3B_HUMAN Uroplakin-3b (UP3b) (Uroplakin lllb) (UPlIlb) (p35) UPK3B 320 043914 TY0BP_HUMAN TYRO protein tyrosine kinase-binding protein (DNAX-activation protein 12) (Killer-activating receptor-associated protein) (KAR-assodated protein) TYROBP DAP12 KARAP 113 Q6NUS8 UD3A1_HUMAN UDP-glucuronosyltransferase 3A1 (UDPGT 3A1) (EC 2.4.1.17) UGT3A1 523 000526 UPK2_HUMAN Uroplakin-2 (UP2) (Uroplakin II) (UPII) UPK2 184 B0FP48 UPK3LHUMAN Uroplakin-3b-like protein UPK3BLUPLP 263 P17643 TYRP1_HUMAN 5,6-dihydroxyindole-2-carboxylic acid oxidase (DHICA oxidase) (EC 1.14.18.-) (Catalase B) (Glycoprotein 75) (Melanoma antigen gp75) (Tyrosinase-related protein 1) (TRP) (TRP-1) (TRP1) TYRP1CAS2TYRP TYRRP 537 075631 UPK3A_HUMAN Uroplakin-3a (UP3a) (Uroplakin III) (UPIII) UPK3A UPK3 287 075445 USH2A_HUMAN Usherin (Usher syndrome type Ila protein) (Usher syndrome type-2A protein) USH2A 5202 P30530 UF0_HUMAN Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene) AXL UFO 894 Q8IZJ1 UNC5B_HUMAN Netrin receptor UNC5B (Protein unc-5 homolog 2) (Protein unc-5 homolog B) (p53-regulated receptor for death and life protein 1) (p53RDL1) UNC5B P53RDL1 UNC5H2 UNQ1883/PRO4326 945 Q6UWM9 UD2A3_HUMAN UDP-glucuronosyltransferase 2A3 (UDPGT 2A3) (EC 2.4.1.17) UGT2A3 UNQ2559/PRO6239 527 Q5DID0 UR0L1_HUMAN Uromodulin-like 1 (Olfactorin) UMODL1 1318 Q6ZN44 UNC5A_HUMAN Netrin receptor UNC5A (Protein unc-5 homolog 1) (Protein unc-5 homolog A) UNC5A KIAA1976 UNC5H1 842 Q6UXZ4 UNC5D_HUMAN Netrin receptor UNC5D (Protein unc-5 homolog 4) (Protein unc-5 homolog D) UNC5D KIAA1777 UNC5H4 UNQ6012/PRO34692 953 P19320 VCAM1_HUMAN Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106) VCAM1 L1CAM 739 P35916 VGFR3_HUMAN Vascular endothelial growth factor receptor 3 (VEGFR-3) (EC 2.7.10.1) (Fms-like tyrosine kinase 4) (FLT-4) (Tyrosine-protein kinase receptor FLT4) FLT4VEGFR3 1363 Q7Z7D3 VTCN1_HUMAN V-set domain-containing T-cell activation inhibitor 1 (B7 homolog 4) (B7-H4) (B7h.5) (Immune costimulatory protein B7-H4) (Protein B7S1) (T-cell costimulatory molecule B7x) VTCN1 B7H4 UNQ659/PRO1291 282 2018-03-20Date Re^ue/Date Received 2023-02-27 Q6EMK4 VASN_HUMAN Vasorin (Protein slit-like 2) VASN SLITL2 UNQ314/PRO357/PR 01282 673 Q96AW1 VOPP1_HUMAN Vesicular, overexpressed in cancer, prosurvival protein 1 (EGFR-coamplified and overexpressed protein) (ECop) (Glioblastoma-amplified secreted protein) (Putative NF-kappa-B-activating protein 055N) VOPP1 ECOP GASP 172 P17948 VGFR1_HUMAN Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor) FLT1 FLT FRT VEGFR1 1338 Q9H7M9 VISTA_HUMAN V-type immunoglobulin domain-containing suppressor of T-cell activation (Platelet receptor Gi24) (Stress-induced secreted protein-1) (Sisp-1) (V-set domain-containing immunoregulatory receptor) C10orf54SISP1 VISTA PP2135 UNQ730/PRO1412 311 Q86VR7 VS10L_HUMAN V-set and immunoglobulin domain-containing protein 10-like VSIG10L 867 Q96IQ7 VSIG2_HUMAN V-set and immunoglobulin domain-containing protein 2 (Cortical thymocyte-like protein) (CT-like protein) VSIG2CTH CTXL UNQ2770/PRO7154 327 Q5VU13 VSIG8_HUMAN V-set and immunoglobulin domain-containing protein 8 VSIG8 C1orf204 414 P78423 X3CL1_HUMAN Fractalkine (C-X3-C motif chemokine 1) (CX3C membrane-anchored chemokine) (Neurotactin) (Small-inducible cytokine D1) [Cleared into: Processed fractalkine) CX3CL1 FKN NTT SCYD1 A-152E5.2 397 P35968 VGFR2_HUMAN Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase insert domain receptor) (KDR) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309) KDRFLK1VEGFR2 1356 Q8N0Z9 VSI10_HUMAN V-set and immunoglobulin domain-containing protein 10 VSIG10 540 Q8IW00 VSTM4_HUMAN V-set and transmembrane domain-containing protein 4 [Cleaved into: Peptide Lv] VSTM4C10orf72 320 P55808 XG_HUMAN Glycoprotein Xg (Protein PBDX) XG PBDX 180 P98155 VLDLR_HUMAN Very low-density lipoprotein receptor (VLDL receptor) (VLDL-R) VLDLR 873 Q86XK7 VSIG1_HUMAN V-set and immunoglobulin domain-containing protein 1 (Cell surface A33 antigen) (Glycoprotein A34) VSIG1 GPA34 387 Q9Y279 VSIG4_HUMAN V-set and immunoglobulin domain-containing protein 4 (Protein Z39lg) VSIG4CRIgZ39IG UNQ317/PRO362 399 A6NLU5 VTM2B_HUMAN V-set and transmembrane domain-containing protein 2B VSTM2B 285 A8MXK1 VSTM5_HUMAN V-set and transmembrane domain-containing protein 5 VSTM5C11orf90 200 Q8N1Y9 YI025_HUMAN Putative uncharacterized protein FLJ37218 231 P60852 ZP1_HUMAN Zona pellucida sperm-binding protein 1 (Zona pellucida glycoprotein 1) (Zp-1) [Cleaved into: ZP1 638 2018-03-20Date Re^ue/Date Received 2023-02-27 Processed zona pellucida sperm-binding protein 1] Q05996 ZP2_HUMAN Zona pellucida sperm-binding protein 2 (Zona pellucida glycoprotein 2) (Zp-2) (Zona pellucida protein A) [Cleaved into: Processed zona pellucida sperm-binding protein 2] ZP2ZPA 745 Q9Y493 ZAN_HUMAN Zonadhesin ZAN 2812 Q9ULT6 ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 (EC 6.3.2.-) (RING finger protein 203) (Zinc/RING finger protein 3) ZNRF3 KIAA1133 RNF203 936 Q8TCW7 ZPLD1_HUMAN Zona pellucida-like domain-containing protein 1 (ZP domain-containing protein 1) ZPLD1 415 Q8WWF5 ZNRF4_HUMAN E3 ubiquitin-protein ligase ZNRF4 (EC 6.3.2.-) (Nixin) (RING finger protein 204) (Zinc/RING finger protein 4) ZNRF4 RNF204 429 P21754 ZP3_HUMAN Zona pellucida sperm-binding protein 3 (Sperm receptor) (ZP3A/ZP3B) (Zona pellucida glycoprotein 3) (Zp-3) (Zona pellucida protein C) [Cleaved into: Processed zona pellucida sperm-binding protein 3] ZP3ZP3AZP3BZPC 424 Q12836 ZP4_HUMAN Zona pellucida sperm-binding protein 4 (Zona pellucida glycoprotein 4) (Zp-4) (Zona pellucida protein B) [Cleaved into: Processed zona pellucida sperm-binding protein 4) ZP4ZPB 540 K9MUJ5 K9MUJ5_HUMAN Toll-like receptor 4 (Fragment) TLR4 138 K9MUQ3 K9MUQ3_HUMAN Toll-like receptor 4 (Fragment) TLR4 138 D3DNA1 D3DNA1_HUMAN Integrin beta ITGB5 hCG_17803 691 K9MTL8 K9MTL8_HUMAN Toll-like receptor 4 (Fragment) TLR4 138 K9MSZ3 K9MSZ3_HUMAN Toll-like receptor 4 (Fragment) TLR4 138 K9MT91 K9MT91_HUMAN Toll-like receptor 4 (Fragment) TLR4 138 D3DSM0 D3DSM0_HUMAN Integrin beta ITGB2 hCG_401305 712 K9MT22 K9MT22_HUMAN Toll-like receptor 4 (Fragment) TLR4 138 K9MUK7 K9MUK7_HUMAN Toll-like receptor 4 (Fragment) TLR4 138 D0EWT7 D0EWT7_HUMAN Toll-like receptor 4 (Fragment) TLR-4TLR4 169 G3V1J9 G3V1J9_HUMAN Transmembrane emp24 domain-containing protein 3 (Transmembrane emp24 protein transport domain containing 3, isoform CRA_b) TMED3 hCG_24828 146 L7RT22 L7RT22_HUMAN Integrin beta ITGB5 799 G3V1W8 G3V1W8_HUMAN Serine/threonine-protein kinase receptor (EC 2.7.11.30) ACVRL1 hCG_37967 517 A3QNQ0 A3QNQ0_HUMAN TGF-beta receptor type-2 (TGFR-2) (EC 2.7.11.30) (TGF-betatype II receptor) (Transforming growth factor-beta receptor type II) TGFBR2 hCGJ997782 567 B4E1S6 B4E1S6_HUMAN Syndecan SDC4 hCG_38363 126 2018-03-20Date Re^ue/Date Received 2023-02-27 A0A024R8 TO A0A024R8T0_HUM AN Integrin beta ITGB4 hCG_27538 1822 D3DPA4 D3DPA4_HUMAN Serine/threonine-protein kinase receptor (EC 2.7.11.30) ACVR1 hCG_1811747 509 A0A024R6 13 A0A024R6l3_HUMA N Testicular tissue protein Li 206 (Transmembrane emp24-like trafficking protein 10 (Yeast), isoform CRA_a) TMED10hCG_22348 219 A0A024R B01 A0A024RB01_HUM AN Integrin, alpha 5 (Fibronectin receptor, alpha polypeptide), isoform CRA_b ITGA5hCG_21939 1098 A0A024R7 MO A0A024R7M0_HUM AN Transmembrane emp24 protein transport domain containing 9, isoform CRA_a TMED9 hCG_41592 235 B7Z4L4 B7Z4L4_HUMAN Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 1 (EC 2.4.99.18) RPN1 435 A0A024D BFO A0A024DBF0_HUM AN Integrin beta (Fragment) ITGB2 80 A0A024R DAO A0A024RDA0_HUM AN V-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, isoform CRA_a KIT hCG_22160 976 Q9BUG9 Q9BUG9_HUMAN Integrin beta ITGB8hCG_37311 439 D3DPN2 D3DPN2_HUMAN Syndecan SDC3 hCG_15913 384 A0A024R C30 A0A024RC30_HUM AN Desmoglein 3 (Pemphigus vulgaris antigen), isoform CRA_a DSG3 hCG_25473 999 E9PBI9 E9PBI9_HUMAN Syndecan SDC2 172 A0A024R C29 A0A024RC29_HUM AN Desmocollin 3, isoform CRA_b DSC3 hCG_2022649 896 X5D8X5 X5D8X5_HUMAN Cadherin 10 type 2 isoform A (Cadherin 10, type 2 (T2-cadherin)) (Fragment) CDH10 hCG_36812 788 B2R627 B2R627_HUMAN cDNA, FLJ92752, highly similar to Homo sapiens integrin, alpha 5 (fibronectin receptor, alphapolypeptide) (ITGA5), mRNA 1049 Q6FHT8 Q6FHT8_HUMAN RNP24 protein (Transmembrane emp24 domain trafficking protein 2, isoform CRA_a) (cDNA, FLJ93436, Homo sapiens coated vesicle membrane protein (RNP24), mRNA) RNP24TMED2 hCG_1743563 201 B4DTY8 B4DTY8_HUMAN cDNA FLJ61587, highly similar to Integrin alpha-1 (Fragment) 1173 Q96CZ9 Q96CZ9_HUMAN Cadherin 11, type 2, OB-cadherin (Osteoblast) (Cadherin 11, type 2, OB-cadherin (Osteoblast), isoform CRA_c) CDH11 hCG_26636 796 A0A024R D88 A0A024RD88_HUM AN Kinase insert domain receptor (A type III receptor tyrosine kinase), isofomi CRA_a KDRhCG_31572 1356 A0A024R8 A0A024R8N2_HUM Integrin beta ITGB4 hCG_27538 1875 2018-03-20Date Re^ue/Date Received 2023-02-27 N2 AN A0A024R2 B2 A0A024R2B2_HUM AN Cadherin 7, type 2, isoform CRA_a CDH7hCG_32903 785 E7EQW5 E7EQW5_HUMAN Integrin beta (Fragment) ITGB1 163 Q59F03 Q59F03_HUMAN Integrin alpha 3 isoform b, variant (Fragment) 749 A0A0G2J RA4 A0A0G2JRA4_HUM AN Cadherin-4 (Fragment) CDH4 566 U3KQ84 U3KQ84_HUMAN Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit (Oligosaccharyl transferase 48 kDa subunit) (EC 2.4.99,18) (Fragment) DDOST 155 B4E2C1 B4E2C1_HUMAN cDNA FLJ57776, highly similar to Transmembrane emp24 domain-containing protein 7 136 J3KRI5 J3KRI5_HUMAN Cadherin-8 CDH8 744 E9PD35 E9PD35_HUMAN Vascular endothelial growth factor receptor 3 FLT4 1306 E7EQ72 E7EQ72_HUMAN Transmembrane emp24 domain-containing protein 2 (Fragment) TMED2 166 D2JYI3 D2JYI3_HUMAN Toll-like receptor 4 (Fragment) TLR4 121 J3KT08 J3KT08_HUMAN Uncharacterized protein (Fragment) 172 A8K0L1 A8K0L1_HUMAN cDNA FLJ77485, highly similar to Homo sapiens cadherin-like 24 (CDH24), transcript variant 2, mRNA 781 D2JYI2 D2JYI2_HUMAN Toll-like receptor 4 (Fragment) TLR4 122 E7EP60 E7EP60_HUMAN Integrin alpha-4 (Fragment) ITGA4 614 Q59H01 Q59H01_HUMAN Protocadherin gamma subfamily A, 7 isoform 1 variant (Fragment) 895 D2JYI5 D2JYI5_HUMAN Toll-like receptor 4 (Fragment) TLR4 124 J3KNV4 J3KNV4_HUMAN Integrin alpha-7 ITGA7 1131 H3BM21 H3BM21_HUMAN Integrin beta (Fragment) 787 B4DN28 B4DN28_HUMAN cDNA FLJ54639, highly similar to Integrin alpha-8 (Fragment) 1048 A0A0S2Z4 U3 A0A0S2Z4U3_HUM AN Syndecan (Fragment) SDC3 370 B4DL99 B4DL99_HUMAN Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 1 (EC 2.4.99.18) 581 B4DLF0 B4DLF0_HUMAN cDNA FLJ50795, highly similar to Cadherin-3 774 Q6P4R2 Q6P4R2_HUMAN Protocadherin alpha subfamily C, 2 PCDHAC2 1007 V9GYZ1 V9GYZ1_HUMAN Integrin beta (Fragment) ITGB5 139 2018-03-20Date Re^ue/Date Received 2023-02-27 D1CS55 D1CS55_HUMAN Toll-like receptor 4 TLR4 839 D0EWT8 D0EWT8_HUMAN Toll-like receptor 4 (Fragment) TLR-4TLR4 169 A8K2C5 A8K2C5_HUMAN cDNA FLJ78159, highly similar to Homo sapiens cadherin 20, type 2 (CDH20), mRNA 801 Q59GD1 Q59GD1_HUMAN Protocadherin gamma subfamily A, 6 isoform 1 variant (Fragment) 950 L7RSL3 L7RSL3_HUMAN Fms-related tyrosine kinase 1 (Vascular endothelial growth factor/vascular permeability factor receptor) FLT1 1338 A8K8T0 A8K8T0_HUMAN cDNA FLJ78760, highly similar to Homo sapiens integrin, alpha 11 (ITGA11), transcript variant 1, mRNA 1188 Q4VAU9 Q4VAU9_HUMAN Serine/threonine-protein kinase receptor (EC 2.7.11.30) ACVR2B 303 Q5T3E5 Q5T3E5_HUMAN Integrin beta (Fragment) ITGB1 89 E5RK25 E5RK25_HUMAN Integrin beta (Fragment) ITGB2 160 A8KAM8 A8KAM8_HUMAN Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) 1106 E9PQJ2 E9PQJ2_HUMAN Integrin beta (Fragment) ITGB1 104 B4E2S6 B4E2S6_HUMAN Serine/threonine-protein kinase receptor (EC 2.7.11.30) 397 A0A087W XP3 A0A087WXP3_HUM AN Integrin beta ITGB6 693 A8K0L9 A8K0L9_HUMAN cDNA FLJ76999, highly similar to Homo sapiens cadherin-like 22 (CDH22), mRNA 828 D2JYI1 D2JYI1_HUMAN TGF-beta receptor type-2 (TGFR-2) (EC 2.7.11.30) (TGF-beta type II receptor) (Transforming growth factor-beta receptor type II) TGFBR2 592 B7ZLD8 B7ZLD8_HUMAN Integrin beta ITGB4 1752 L7UW06 L7UW06_HUMAN Integrin beta ITGB3 470 B4E3M0 B4E3M0_HUMAN cDNA FLJ58807, highly similar to Integrin alpha-11 650 B4DNJ5 B4DNJ5_HUMAN Dolichyl-diphosphooligosaccharide—protein glycosyltransferase subunit 1 (EC 2.4.99.18) 378 Q96HX3 Q96HX3_HUMAN Dolichyl-diphosphooligosaccharide—protein glycosyltransferase subunit 1 (EC 2.4.99.18) (Fragment) 568 X5DNG6 X5DNG6_HUMAN Cadherin 10 type 2 isoform B (Fragment) CDH10 786 B7Z5H2 B7Z5H2_HUMAN Syndecan 172 F8VNX4 F8VNX4_HUMAN Integrin beta (Fragment) ITGB7 158 B4DPP4 B4DPP4_HUMAN cDNA FLJ56646, highly similar to Transmembrane emp24 domain-containing protein 9 121 B2RCN5 B2RCN5_HUMAN cDNA, FLJ96176, highly similar to Homo sapiens cadherin 4, type 1, R-cadherin (retinal) 916 2018-03-20Date Re^ue/Date Received 2023-02-27 (CDH4), mRNA G3V2K7 G3V2K7_H(JMAN Transmembrane emp24 domain-containing protein 10 TMED10 153 A8K6T3 A8K6T3_HUMAN cDNA FLJ78674, highly similar to Homo sapiens desmocollin type 4 896 E9PLR6 E9PLR6_HUMAN Integrin beta (Fragment) ITGB1 143 D3XNU5 D3XNU5_HUMAN E-cadherin 1 CDH1 882 B4E2A1 B4E2A1_HUMAN cDNA FLJ54402, highly similar to Integrin alpha-10 1095 C9JPK5 C9JPK5_HUMAN Integrin beta (Fragment) ITGB1 98 B2R8A2 B2R8A2_HUMAN cDNA, FLJ93804, highly similar to Homo sapiens gp25L2 protein (HSGP25L2G), mRNA 214 L7UUZ7 L7UUZ7_HUMAN Integrin beta ITGB3 788 Q53EP4 Q53EP4_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (EC 2,4.99.18) (Fragment) 607 Q59H32 Q59H32_HUMAN Protocadherin gamma subfamily A, 3 isoform 1 variant (Fragment) 961 K9MUK4 K9MUK4_HUMAN Toll-like receptor 4 (Fragment) TLR4 138 B3KMS6 B3KMS6_HUMAN cDNA FLJ12486 fis, clone NT2RM2000566, highly similar to Integrin alpha-7 973 B4E045 B4E045_HUMAN cDNA FLJ59131, highly similar to Integrin alpha-4 174 B7ZLD5 B7ZLD5_HUMAN Integrin beta ITGB4 1752 Q59EA3 Q59EA3_HUMAN Cadherin 5, type 2 preproprotein variant (Fragment) 807 E7ESK6 E7ESK6_HUMAN Syndecan SDC2 165 B4DTP0 B4DTP0_HUMAN cDNA FLJ51087, highly similar to Cadherin-5 525 B4E3N0 B4E3N0_HUMAN Integrin beta 628 A7U833 A7U833_HUMAN Integrin beta (Fragment) ITGB3 65 A0A024R8 K7 A0A024R8K7_HUM AN Integrin beta ITGB4hCG_27538 1752 H7C580 H7C580 HUMAN Integrin beta (Fragment) ITGB5 79 H0YA32 H0YA32_HUMAN Integrin alpha-3 (Fragment) ITGA3 84 Q59H14 Q59H14_HUMAN PREDICTED: integrin, alpha D variant (Fragment) 1177 E9PDS3 E9PDS3_HUMAN Integrin alpha-9 ITGA9 632 B2R6U9 B2R6U9_HUMAN Delta-tike protein 1218 B4E0R1 B4E0R1_HUMAN Integrin beta 700 2018-03-20Date Re^ue/Date Received 2023-02-27 A5YM53 A5YM53_HUMAN ITGAV protein ITGAV 1048 Q6IBR0 Q6IBR0_HUMAN Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 1 (EC 2.4.99.18) RPN1 607 B4DP27 B4DP27_HUMAN cDNA FLJ52153, highly similar to Transmembrane emp24 domain-containing protein 2 169 A0A0U2Z QU7 A0A0U2ZQU7_HUM AN E-cadherin 1 CDH1 882 B4DYQ7 B4DYQ7_HUMAN cDNA FLJ57822, highly similar to Integrin alpha-V 482 B2RAL6 B2RAL6_HUMAN cDNA, FLJ94991, highly similar to Homo sapiens integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) (ITGAL), mRNA 1170 E7ERX5 E7ERX5_HUMAN Integrin beta (Fragment) ITGB1 125 F8WF32 F8WF32_HUMAN Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 1 (EC 2.4.99.18) RPN1 121 B4E0Q2 B4E0Q2_HUMAN cDNA FLJ60208, highly similar to Integrin alpha-4 366 B4DDT0 B4DDT0_HUMAN cDNA FLJ59664, highly similar to Integrin alpha-3 294 B7Z769 B7Z769_HUMAN Integrin beta 228 E9PEE8 E9PEE8_HUMAN Integrin beta ITGB6 746 H7C4W1 H7C4W1_HUMAN Integrin beta (Fragment) ITGB5 263 E9PB77 E9PB77_HUMAN Integrin alpha-2 ITGA2 641 B7Z8B0 B7Z8B0_HUMAN cDNA FLJ50317, highly similar to Integrin alpha-lIb 219 D6RA20 D6RA20_HUMAN Protocadherin alpha-4 PCDHA4 901 Q5T3E6 Q5T3E6_HUMAN Integrin beta (Fragment) ITGB1 136 B4DQ56 B4DQ56_HUMAN Syndecan 192 C9JA99 C9JA99_HUMAN Protocadherin alpha-13 PCDHA13 904 Q9UII7 Q9UII7_HUMAN E-cadherin 901 B3KRT0 B3KRT0_HUMAN cDNA FLJ34857 fis, clone NT2NE2012533, highly similar to Cadherin-12 404 Q8N6H6 Q8N6H6_HUMAN ITGA9 protein 632 A0A0B5H R54 A0A0B5HR54_HUM AN Serine/threonine-protein kinase receptor (EC 2.7.11.30) 509 C9JXX7 C9JXX7_HUMAN Integrin alpha-6 (Fragment) ITGA6 231 B4DLJ5 B4DLJ5_HUMAN cDNA FLJ55716, highly similar to Desmocollin-2 912 V9GZ57 V9GZ57_HUMAN Integrin beta (Fragment) ITGB5 324 Q4LE35 Q4LE35_HUMAN ITGA7 variant protein (Fragment) ITGA7 variant protein 1200 2018-03-20Date Re^ue/Date Received 2023-02-27 B4DIN4 B4DIN4_HUMAN Syndecan 346 J3KNI6 J3KNI6_HUMAN Integrin beta (Fragment) ITGB2 322 A8K2P8 A8K2P8_HUMAN cDNA FLJ76245, highly similar to Homo sapiens desmocollin 2 (DSC2), transcript variant Dsc2a, mRNA 901 B4DLU2 B4DLU2_HUMAN cDNA FLJ56496, highly similar to Integrin alpha-lIb 521 F5H4M7 F5H4M7_HUMAN Transmembrane emp24 domain-containing protein 3 TMED3 155 D0EWT9 D0EWT9_HUMAN Toll-like receptor 4 (Fragment) TLR-4TLR4 169 Q6PJE7 Q6PJE7_HUMAN ITGA4 protein (Fragment) ITGA4 617 E7ESP4 E7ESP4_HUMAN Integrin alpha-2 ITGA2 942 B4E277 B4E277_HUMAN cDNA FLJ58873, highly similar to Transmembrane emp24 domain-containing protein 3 155 B4DU18 B4DU18_HUMAN cDNA FLJ51093, highly similar to Cadherin-5 750 B2R9J8 B2R9J8_HUMAN cDNA, FLJ94427, highly similar to Homo sapiens cadherin 20, type 2 (CDH20), mRNA 801 B4E282 B4E282_HUMAN cDNA FLJ52401, highly similar to Integrin alpha-10 1036 F5H6T4 F5H6T4_HUMAN Integrin beta ITGB7 471 G3V2Y2 G3V2Y2_HUMAN Transmembrane emp24 domain-containing protein 7 (Fragment) TMED7 82 B4DDR7 B4DDR7_HUMAN cDNA FLJ54845, highly similar to Transmembrane emp24 domain-containing protein 5 178 A0A087W T05 A0A087WT05_HUM AN Protocadherin gamma-A4 PCDHGA4 962 B4DMA7 B4DMA7_HUMAN cDNA FLJ58514, highly similar to Gadherin-11 779 A0A0U2N 547 A0A0U2N547_HUM AN Mast/stem cell growth factor receptor Kit isoform 3 (EC 2.7.10.1) KIT 971 B2R9L8 B2R9L8_HUMAN Delta-like protein 685 E7EVZ9 E7EVZ9_HUMAN Integrin beta (Fragment) ITGB2 166 B4E2B8 B4E2B8_HUMAN Integrin beta 746 F5GX39 F5GX39_HUMAN Transmembrane emp24 domain-containing protein 2 TMED2 116 Q2VP98 Q2VP98_HUMAN Integrin beta (Fragment) ITGB4 644 A0A0S2Z3 A0A0S2Z310_HUMA N Serine/threonine-protein kinase receptor (EC 2.7.11.30) (Fragment) ACVRL1 503 H3BRM2 H3BRM2_HUMAN Integrin beta (Fragment) ITGB7 93 A9X9L0 A9X9L0_HUMAN Desmocollin 2 DSC2 901 2018-03-20Date Re^ue/Date Received 2023-02-27 B7Z6U6 B7Z6U6_HUMAN Integrin beta 471 B4DT61 B4DT61_HUMAN Syndecan 81 D2JYI4 D2JYI4_HUMAN Toll-like receptor 4 (Fragment) TLR4 124 E5RIG7 E5RIG7_HUMAN Integrin beta (Fragment) ITGB2 120 E5RFI0 E5RFI0_HUMAN Integrin beta (Fragment) ITGB2 70 B7Z506 B7Z506_HUMAN Integrin beta 626 B4DTY9 B4DTY9_HUMAN Integrin beta 751 G3V2C6 G3V2C6_HUMAN Integrin alpha-7 (Fragment) ITGA7 153 Q6PJ75 Q6PJ75_HUMAN Integrin beta (Fragment) ITGB2 758 B4DDX0 B4DDX0_HUMAN cDNA FLJ59843, highly similar to Integrin alpha-X 264 A9X9K9 A9X9K9_HUMAN Desmocollin 2 DSC2 901 H3BN02 H3BN02_HUMAN Integrin alpha-X ITGAX 1169 A0A024R AD5 A0A024RAD5_HUM AN Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit (Oligosaccharyl transferase 48 kDa subunit) (EC 2.4.99.18) DDOST hCG_38871 456 A0A0C4D GS1 A0A0C4DGS1_HUM AN Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit (Oligosaccharyl transferase 48 kDa subunit) (EC 2.4.99.18) DDOST 439 B4DFP0 B4DFP0_HUMAN cDNA FLJ57804, highly similar to Cadherin-9 382 Q53GF9 Q53GF9_HUMAN Full-length cDNA 5-PRIME end of clone CS0DF013YM24 of Fetal brain of Homo sapiens (Human) variant (Fragment) 225 A8K2N5 A8K2N5_HUMAN Integrin beta 788 E7EUI6 E7EUI6_HUMAN Integrin beta (Fragment) ITGB1 152 Q4KMR2 Q4KMR2_HUMAN Delta-like protein JAG1 1218 Q59FA8 Q59FA8_HUMAN Integrin alpha-lib variant (Fragment) 551 J3QQL2 J3QQL2_HUMAN Integrin beta (Fragment) ITGB4 114 L7RXH0 L7RXH0_HUMAN Integrin, alpha V ITGAV 1048 A0A0A6Y YAO A0A0A6YYA0_HUM AN Protein TMED7-TICAM2 TMED7-TICAM2 188 B4DL12 B4DL12_HUMAN cDNA FLJ53754, highly similar to Transmembrane emp24 domain-containing protein 10 177 B1AKT3 B1AKT3_HUMAN Transmembrane emp24 domain-containing protein 5 TMED5 162 H7C5U2 H7C5U2_HUMAN Integrin beta (Fragment) ITGB5 401 2018-03-20Date Re^ue/Date Received 2023-02-27 F8W7F7 F8W7F7_HUMAN Transmembrane emp24 domain-containing protein 4 TMED4 178 Q59H50 Q59H50_HUMAN Integrin beta (Fragment) 475 H3BUU9 H3BUU9_HUMAN Cadherin-11 CDH11 670 B4E0H8 B4E0H8_HUMAN cDNA FLJ60385, highly similar to Integrin alpha-3 1037 A8K6A5 A8K6A5_HUMAN cDNA FLJ77742, highly similar to Homo sapiens integrin, alpha 5 (fibronectin receptor, alpha polypeptide), mRNA 1049 060574 O60574_HUMAN Cadherin-7 (Fragment) CDH7 317 Q53HR4 Q53HR4_HUMAN Chromosome 15 open reading frame 22 variant (Fragment) 217 Q59H35 Q59H35_HUMAN Protocadherin alpha 13 isoform 1 variant (Fragment) 921 A0A024D AS2 A0A024DAS2_HUM AN Integrin beta (Fragment) ITGB2 80 A0A024R C42 A0A024RC42_HUM AN Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b CDH2hCG_22518 906 E7EMF1 E7EMF1_HUMAN Integrin alpha-2 ITGA2 815 A0A024R9 D1 A0A024R9D1_HUM AN Syndecan SDC2 hCG_15745 201 Q1PBM2 Q1PBM2_HUMAN Integrin beta (Fragment) ITGB3 65 Q8NB64 Q8NB64_HUMAN cDNA FLJ34177 fis, clone FCBBF3016451, highly similar to RETINAL-CADHERIN 824 Q59EB0 Q59EB0_HUMAN Kinase insert domain receptor (A type III receptor tyrosine kinase) variant (Fragment) 1451 Q2YFE1 Q2YFE1_HUMAN Integrin beta 443 Q3B7W7 Q3B7W7_HUMAN TMED7 protein (Fragment) TMED7 134 K7EQ63 K7EQ63_HUMAN Transmembrane emp24 domain-containing protein 1 (Fragment) TMED1 191 A0A087W TR7 A0A087WTR7_HUM AN Cadherin-24 CDH24 314 K7EMU3 K7EMU3_HUMAN Integrin alpha-3 (Fragment) ITGA3 117 Q49AG2 Q49AG2_HUMAN TMED5 protein TMED5 172 A0A087W X36 A0A087WX36_HUM AN Integrin beta ITGB2 378 Q9HAX1 Q9HAX1_HUMAN Desmocollin 3 (Fragment) DSC3 316 A0A087W XI5 A0A087WXI5_HUM AN Cadherin-1 CDH1 903 2018-03-20Date ReQue/Date Received 2023-02-27 TABLE 2 Illustrative human Type II proteins which may be incorporated into the present compositions and methods include (as used herein "Entry" refers to the human Type II protein entry in the UniProt database and “Entry name” refers to the human Type II protein entry in the UniProt database): M0R072 M0R072_HUMAN Transmembrane emp24 domain-containing protein 5 TMED5 120 Q8N9J3 Q8N9J3_HUMAN cDNA FLJ37047 fis, clone BRACE2012232, highly similar to Homo sapiens cadherin 20 (CDH20) mRNA 335 Q8WWJ8 Q8WWJ8_HUMAN Integrin beta 378 Q59H34 Q59H34_HUMAN Protocadherin alpha 4 isoform 1 variant (Fragment) 921 A0A024D AE5 A0A024DAE5_HUM AN Integrin beta (Fragment) ITGB2 80 Q59H46 Q59H46_HUMAN Integrin beta (Fragment) 1515 Q4VAI4 Q4VAI4_HUMAN CDH5 protein CDH5 662 Q59FL1 Q59FL1_HUMAN Serine/threonine-protein kinase receptor (EC 2.7.11.30) (Fragment) 514 Q2TAL1 Q2TAL1_HUMAN CDH24 protein CDH24 314 Q59H74 Q59H74_HUMAN Integrin alpha 4 variant (Fragment) 854 A0A087W X99 A0A087WX99_HUM AN Cadherin-4 CDH4 822 Q59FN1 Q59FN1_HUMAN Integrin beta (Fragment) 166 X6R3Y6 X6R3Y6_HUMAN Cadherin-8 CDH8 745 Q59EQ1 Q59EQ1_HUMAN Cadherin 11, type 2 isoform 1 preproprotein variant (Fragment) 798 X5DQT8 X5DQT8_HUMAN Cadherin 10 type 2 isoform C (Fragment) CDH10 243 Q8N2D9 Q8N2D9_HUMAN cDNA PSEC0228 fis, clone HEMBA1006099, weakly similar to COP-COATED VESICLE MEMBRANE PROTEIN P24 146 Q63HM4 Q63HM4_HUMAN Putative uncharacterized protein DKFZp686P18250 DKFZp686P18250 758 A0A0E3XJ U3 A0A0E3XJU3_HUM AN E-cadherin 1 CDH1 882 Q68DY8 Q68DY8_HUMAN Putative uncharacterized protein DKFZp686l11137 DKFZp686l11137 667 Entry Entry name Protein names Gene names Length Q9BUJ0 ABHEA_HUMAN Protein ABHD14A (EC 3.-,-.-) (Alpha/beta hydrolase domain-containing protein 14A) ABHD14A 271 2018-03-20Date Re^ue/Date Received 2023-02-27 (Abhydrolase domain-containing protein 14A) UNQ1913/PRO4373 P08195 4F2_HUMAN 4F2 cell-surface antigen heavy chain (4F2hc) (4F2 heavy chain antigen) (Lymphocyte activation antigen 4F2 large subunit) (Solute carrier family 3 member 2) (CD antigen CD98) SLC3A2 MDU1 630 Q9NPC4 A4GATHUMAN Lactosylceramide 4-alpha-galactosyltransferase (EC 2.4.1.228) (Alpha-1,4-Nacetylglucosaminyltransferase) (Alpha-1,4-galactosyltransferase) (Alpha4Gal-T1) (CD77 synthase) (Globotriaosylceramide synthase) (Gb3 synthase) (P1/Pk synthase) (UDPgalactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase) A4GALTA14GALT A4GALT1 353 Q9UNA3 A4GCT_HUMAN Alpha-1,4-N-acetylglucosaminyltransferase (Alpha4GnT) (EC 2.4.1.-) A4GNT 340 Q96SE0 ABHD1_HUMAN Protein ABHD1 (EC 3.1.1.-) (Alpha/beta hydrolase domain-containing protein 1) (Abhydrolase domain-containing protein 1) (Lung alpha/beta hydrolase 1) ABHD1 LABH1 405 P08910 ABHD2_HUMAN Monoacylglycerol lipase ABHD2 (EC 3.1.1.23) (2-arachidonoylglycerol hydrolase) (Abhydrolase domain-containing protein 2) (Lung alpha/beta hydrolase 2) (Protein PHPS1-2) ABHD2 LABH2 425 Q9BV23 ABHD6_HUMAN Monoacylglycerol lipase ABHD6 (EC 3.1.1.23) (2-arachidonoylglycerol hydrolase) (Abhydrolase domain-containing protein 6) ABHD6 337 Q7L211 ABHDD_HUMAN Protein ABHD13 (EC 3.-.-,-) (Alpha/beta hydrolase domain-containing protein 13) (Abhydrolase domain-containing protein 13) ABHD13C13orf6 337 P22760 AAAD_HUMAN Arylacetamide deacetylase (EC 3.1.1.3) AADAC DAC 399 Q5VUY2 ADCL4_HUMAN Arylacetamide deacetylase-like 4 (EC 3.1.1.-) AADACL4 407 Q8WU67 ABHD3_HUMAN Phospholipase ABHD3 (EC 3,1.1.32) (EC 3.1.1.4) (Abhydrolase domain-containing protein 3) ABHD3 409 000468 AGRIN_HUMAN Agrin [Cleaved into: Agrin N-terminal 110 kDa subunit; Agrin C-terminal 110 kDa subunit; Agrin C-terminal 90 kDa fragment (C90); Agrin C-terminal 22 kDa fragment (C22)] AGRN AGRIN 2067 Q9Y673 ALG5_HUMAN Dolichyl-phosphate beta-glucosyltransferase (DolP-glucosyltransferase) (EC 2.4.1.117) (Asparagine-linked glycosylation protein 5 homolog) ALG5 HSPC149 324 P15144 AMPN_HUMAN Aminopeptidase N (AP-N) (hAPN) (EC 3.4.11.2) (Alanyl aminopeptidase) (Aminopeptidase M) (AP-M) (Microsomal aminopeptidase) (Myeloid plasma membrane glycoprotein CD13) (gp150) (CD antigen CD13) ANPEPAPN CD13 PEPN 967 Q6Q4G3 AMPQ_HUMAN Aminopeptidase Q (AP-Q) (APQ) (EC 3.4.11.-) (CHL2 antigen) (Laeverin) LVRNAQPEP 990 Q16853 AOC3_HUMAN Membrane primary amine oxidase (EC 1.4.3.21) (Copper amine oxidase) (HPAO) (Semicarbazide-sensitive amine oxidase) (SSAO) (Vascular adhesion protein 1) (VAP-1) AOC3VAP1 763 Q9BT22 ALG1_HUMAN Chitobiosyldiphosphodolichol beta-mannosyltransferase (EC 2.4.1.142) (Asparagine-linked glycosylation protein 1 homolog) (Beta-1,4-mannosyltransferase) (GDP-Man:GlcNAc2-PPdolichol mannosyltransferase) (GDP-mannose-dolichol diphosphochitobiose mannosyltransferase) (Mannosyltransferase-1) (MT-1) (hMat-1) ALG1 HMAT1 HMT1 PSEC0061 UNQ861/PRO1870 464 2018-03-20Date Re^ue/Date Received 2023-02-27 Q07075 AMPE_HUMAN Glutamyl aminopeptidase (EAP) (EC 3.4.11.7) (Aminopeptidase A) (AP-A) (Differentiation antigen gp160) (CD antigen CD249) ENPEP 957 Q9HDC9 APMAP_HUMAN Adipocyte plasma membrane-associated protein (Protein BSCv) APMAPC20orf3 UNQ1869/PRO4305 416 P07306 ASGR1.HUMAN Asialoglycoprotein receptor 1 (ASGP-R 1) (ASGPR 1) (C-type lectin domain family 4 member H1) (Hepatic lectin H1)(HL-1) ASGR1 CLEC4H1 291 Q9NR71 ASAH2.HUMAN Neutral ceramidase (N-CDase) (NCDase) (EC 3.5.1.23) (Acylsphingosine deacylase 2) (BCDase) (LCDase) (hCD) (N-acylsphingosine amidohydrolase 2) (Non-lysosomal ceramidase) [Cleaved into: Neutral ceramidase soluble form] ASAH2HNAC1 780 Q5U4P2 ASPH1.HUMAN Aspartate beta-hydroxylase domain-containing protein 1 (EC 1.14.11.-) ASPHD1 390 Q9UN42 AT1B4_HUMAN Protein ATP1B4 (X,K-ATPase subunit beta-m) (X/potassium-transporting ATPase subunit betam) ATP1B4 357 Q99941 ATF6B.HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta (cAMP-dependent transcription factor ATF-6 beta) (Activating transcription factor 6 beta) (ATF6-beta) (Protein G13) (cAMP response element-binding protein-related protein) (Creb-rp) (cAMP-responsive element-binding protein¬ like 1) [Cleaved into: Processed cyclic AMP-dependent transcription factor ATF-6 beta] ATF6BCREBL1 G13 703 Q6ICH7 ASPH2.HUMAN Aspartate beta-hydroxylase domain-containing protein 2 (EC 1.14.11.-) ASPHD2 369 P51164 ATP4B.HUMAN Potassium-transporting ATPase subunit beta (Gastric H(+)/K(+) ATPase subunit beta) (Proton pump beta chain) ATP4B 291 Q12797 ASPH.HUMAN Aspartyl/asparaginyl beta-hydroxylase (EC 1.14.11.16) (Aspartate beta-hydroxylase) (ASP beta¬ hydroxylase) (Peptide-aspartate beta-dioxygenase) ASPH BAH 758 P07307 ASGR2_HUMAN Asialoglycoprotein receptor 2 (ASGP-R 2) (ASGPR 2) (C-type lectin domain family 4 member H2) (Hepatic lectin H2)(HL-2) ASGR2CLEC4H2 311 P05026 AT1B1.HUMAN Sodium/potassium-transporting ATPase subunit beta-1 (Sodium/potassium-dependent ATPase subunit beta-1) ATP1B1 ATP1B 303 P14415 AT1B2.HUMAN Sodium/potassium-transporting ATPase subunit beta-2 (Adhesion molecule in glia) (AMOG) (Sodium/potassium-dependent ATPase subunit beta-2) ATP1B2 290 P54709 AT1B3.HUMAN Sodium/potassium-transporting ATPase subunit beta-3 (Sodium/potassium-dependent ATPase subunit beta-3) (ATPB-3) (CD antigen CD298) ATP1B3 279 P18850 ATF6A_HUMAN Cyclic AMP-dependent transcription factor ATF-6 alpha (cAMP-dependent transcription factor ATF-6 alpha) (Activating transcription factor 6 alpha) (ATF6-alpha) [Cleaved into: Processed cyclic AMP-dependent transcription factor ATF-6 alpha] ATF6 670 Q9P2W7 B3GA1_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (EC 2.4.1.135) (Beta-1,3- glucuronyltransferase 1) (Glucuronosyltransferase P) (GlcAT-P) (UDP-GlcUA:glycoprotein beta- B3GAT1 GLCATP 334 2018-03-20Date Re^ue/Date Received 2023-02-27 1,3-glucuronyltransferase) (GlcUAT-P) Q9NPZ5 B3GA2_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 (EC 2.4.1.135) (Beta-1,3- glucuronyltransferase 2) (GlcAT-D) (UDP-glucuronosyltransferase S) (GlcAT-S) (Glucuronosyltransferase S) B3GAT2GLCATS KIAA1963 323 094766 B3GA3_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 (EC 2.4.1.135) (Beta-1,3- glucuronyltransferase 3) (Glucuronosyltransferase I) (GlcAT-l) (UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase) (GlcUAT-l) B3GAT3 335 Q9Y2A9 B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 (EC 2.4.1.149) (Beta-1,3- galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase) (EC 2.4.1.146) (Beta-1,3-galactosyltransferase 8) (Beta-1,3-GalTase 8) (Beta3Gal-T8) (Beta3GalT8) (b3Gal-T8) (Beta-3-Gx-T8) (Core 1 extending beta-1,3-N-acetylglucosaminyltransferase) (Corelbeta3GlcNAcT) (Transmembrane protein 3) (UDP-Gal:beta-GlcNAc beta-1,3- galactosyltransferase 8) (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3) (BGnT-3) (Beta-1,3-Gn-T3) (Beta-1,3-N-acetylglucosaminyltransferase 3) (Beta3Gn-T3) (UDPgalactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8) B3GNT3 B3GALT8 TMEM3 UNQ637/PRO1266 372 Q96L58 B3GT6_HUMAN Beta-1,3-galactosyltransferase 6 (Beta-1,3-GalTase 6) (Beta3Gal-T6) (Beta3GalT6) (EC 2.4.1.134) (GAG GalTII) (Galactosyltransferase II) (Galactosylxylosylprotein 3-betagalactosyltransferase) (UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) B3GALT6 329 043505 B4GA1_HUMAN Beta-1,4-glucuronyltransferase 1 (EC 2.4.1.-) (l-beta-1,3-N-acetylglucosaminyltransferase) (iGnT) (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase) (Poly-Nacetyllactosamine extension enzyme) (UDP-GlcNAc:betaGal beta-1,3-Nacetylglucosaminyltransferase 1) B4GAT1 B3GNT1 B3GNT6 415 075752 B3GL1.HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 (Beta-1,3-GalNAc-T1) (EC 2.4.1.79) (Beta-1,3-galactosyltransferase 3) (Beta-1,3-GalTase 3) (Beta3Gal-T3) (Beta3GalT3) (b3Gal-T3) (Beta-3-Gx-T3) (Galactosylgalactosylglucosylceramide beta-D-acetyl-galactosaminyltransferase) (Globoside synthase) (UDP-N-acetylgalactosamine:globotriaosylceramide beta-1,3-Nacetylgalactosaminyltransferase) B3GALNT1 B3GALT3 UNQ531/PRO1074 331 Q7Z7M8 B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 (BGnT-8) (Beta-1,3-Gn-T8) (Beta-1,3-N-acetylglucosaminyltransferase 8) (Beta3Gn-T8) (EC 2.4.1.-) B3GNT8 B3GALT7 BGALT15 397 Q9Y2C3 B3GT5_HUMAN Beta-1 ,3-galactosyltransferase 5 (Beta-1,3-GalTase 5) (Beta3Gal-T5) (Beta3GalT5) (b3Gal-T5) (EC 2.4.1.-) (Beta-3-Gx-T5) (UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5) (UDPgalactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5) B3GALT5 310 Q8NFL0 B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 (BGnT-7) (Beta-1,3-Gn-T7) (Beta-1,3-N-acetylglucosaminyltransferase 7) (Beta3Gn-T7) (EC 2.4.1.-) B3GNT7 401 2018-03-20Date Re^ue/Date Received 2023-02-27 043825 B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 (Beta-1,3-GalTase 2) (Beta3Gal-T2) (Beta3GalT2) (EC 2.4,1.-) (UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase 2) B3GALT2 422 Q00973 B4GN1_HUMAN Beta-1,4 N-acetylgalactosaminyltransferase 1 (EC 2.4.1.92) ((N-acetylneuraminyl)- galactosylglucosylceramide) (GM2/GD2 synthase) (GalNAc-T) B4GALNT1 GALGT SIAT2 533 P15291 B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 (Beta-1,4-GalTase 1) (Beta4Gal-T1) (b4Gal-T1) (EC 2.4.1.-) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1) (UDP-galactose:beta-Nacetylglucosamine beta-1,4-galactosyltransferase 1) [Cleaved into: Processed beta-1,4- galactosyltransferase 1] [Indudes: Lactose synthase A protein (EC 2.4.1.22); Nacetyllactosamine synthase (EC 2.4.1.90) (Nai synthase); Beta-Nacetylglucosaminylglycopeptide beta-1,4-galactosyltransferase (EC 2.4.1.38); Beta-Nacetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase (EC 2.4.1.-)] B4GALT1 GGTB2 398 060513 B4GT4_HUMAN Beta-1,4-galactosyltransferase 4 (Beta-1,4-GalTase 4) (Beta4Gal-T4) (b4Gal-T4) (EC 2.4.1.-) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4) (UDP-galactose:beta-Nacetylglucosamine beta-1,4-galactosyltransferase 4) [Includes: N-acetyllactosamine synthase (EC 2.4.1.90) (Nai synthase); Lactotriaosylceramide beta-1,4-galactosyltransferase (EC 2.4.1.275) (Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase)] B4GALT4 UNQ552/PRO1109 344 043286 B4GT5_HUMAN Beta-1,4-galactosyltransferase 5 (Beta-1,4-GalTase 5) (Beta4Gal-T5) (b4Gal-T5) (EC 2.4.1.-) (Beta-1,4-GalT II) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5) (UDPgalactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5) B4GALT5 388 Q9NY97 B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 (EC 2.4.1.149) (Beta-1,3-Nacetylglucosaminyltransferase 1) (BGnT-1) (Beta-1,3-Gn-T1) (Beta3Gn-T1) (Beta-1,3- galactosyltransferase 7) (Beta-1,3-GalTase 7) (Beta3Gal-T7) (Beta3GalT7) (b3Gal-T7) (Beta-3- Gx-T7) (UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 7) (UDP-GlcNAc:betaGal beta- 1,3-N-acetylglucosaminyltransferase 2) (BGnT-2) (Beta-1,3-Gn-T2) (Beta-1,3-Nacetylglucosaminyltransferase 2) (Beta3Gn-T2) (UDP-galactose:beta-N-acetylglucosamine beta- 1,3-galactosyltransferase 7) B3GNT2 B3GALT7 B3GNT1 397 060512 B4GT3_HUMAN Beta-1,4-galactosyltransferase 3 (Beta-1,4-GalTase 3) (Beta4Gal-T3) (b4Gal-T3) (EC 2.4.1.-) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 3) (UDP-galactose:beta-Nacetylglucosamine beta-1,4-galactosyltransferase 3) [Includes: N-acetyllactosamine synthase (EC 2.4.1.90) (Nai synthase); Beta-N-acetylglucosaminylglycopeptide beta-1,4- galactosyltransferase (EC 2.4.1.38); Beta-N-acetylglucosaminyl-glycolipid beta-1,4- galactosyltransferase (EC 2.4.1.-)] B4GALT3 393 Q9Y5Z6 B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 (Beta-1,3-GalTase 1) (Beta3Gal-T1) (Beta3GalT1) (EC 2,4.1.-) (UDP-galactose:beta-N-acetyl-glucosamine-beta-1,3-galactosyltransferase 1) B3GALT1 326 096024 B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 (Beta-1,3-GalTase 4) (Beta3Gal-T4) (Beta3GalT4) (GalT4) B3GALT4GALT4 378 2018-03-20Date ReQue/Date Received 2023-02-27 (b3Gal-T4) (EC 2.4.1,62) (Gal-T2) (Ganglioside galactosyltransferase) (UDP-galactose:beta-Nacetyl-galactosamine-beta-1,3-galactosyltransferase) Q76KP1 B4GN4_HUMAN N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 1 (NGalNAcT1) (EC 2.4.1.244) (Beta-1,4-N-acetylgalactosaminyltransferase IV) (Beta4GalNAc-T4) (Beta4GalNAcT4) B4GALNT4 1039 060909 B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 (Beta-1,4-GalTase2) (Beta4Gal-T2) (b4Gal-T2) (EC 2.4.1.-) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2) (UDP-galactose:beta-Nacetylglucosamine beta-1,4-galactosyltransferase 2) [Includes: Lactose synthase A protein (EC 2.4.1.22); N-acetyllactosamine synthase (EC 2.4.1.90) (Nai synthase); Beta-Nacetylglucosaminylglycopeptide beta-1,4-galactosyltransferase (EC 2.4.1.38); Beta-Nacetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase (EC 2.4.1.-)] B4GALT2 372 Q9UBX8 B4GT6_HUMAN Beta-1,4-galactosyltransferase 6 (Beta-1,4-GalTase 6) (Beta4Gal-T6) (b4Gal-T6) (UDPGal:beta-GlcNAc beta-1,4-galactosyltransferase 6) (UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6) [Includes: Glucosylceramide beta-1,4-galactosyltransferase (EC 2.4.1.274) (Lactosylceramide synthase) (LacCer synthase) (UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase)] B4GALT6 382 Q9UBV7 B4GT7_HUMAN Beta-1,4-galactosyltransferase 7 (Beta-1,4-GalTase 7) (Beta4Gal-T7) (b4Gal-T7) (EC 2.4.1.-) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 7) (UDP-galactose:beta-Nacetylglucosamine beta-1,4-galactosyltransferase 7) [Includes: Xylosylprotein 4-betagalactosyltransferase (EC 2.4.1.133) (Proteoglycan UDP-galactose:beta-xylose beta1,4- galactosyltransferase I) (UDP-galactose:beta-xylose beta-1,4-galactosyltransferase) (XGPT) (XGalT-1) (Xylosylprotein beta-1,4-galactosyltransferase)] B4GALT7XGALT1 UNQ748/PRO1478 327 Q8NCR0 B3GL2_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 (Beta-1,3-GalNAc-T2) (EC 2.4.1.-) (Beta-1,3-N-acetylgalactosaminyltransferase II) B3GALNT2 500 Q9C0J1 B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 (EC 2.4.1.149) (UDPGlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4) (BGnT-4) (Beta-1,3-Gn-T4) (Beta- 1,3-N-acetylglucosaminyltransferase 4) (Beta3Gn-T4) B3GNT4 UNQ1898/PRO4344 378 Q6ZMB0 B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase (EC 2.4.1.147) (Core 3 synthase) (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6) (BGnT-6) (Beta-1,3-Gn-T6) (Beta-1,3-N-acetylglucosaminyltransferase 6) (Beta3Gn-T6) B3GNT6 384 Q9BYG0 B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase (EC 2.4.1.206) (Lactotriaosylceramide synthase) (Lc(3)Cer synthase) (Lc3 synthase) (UDP-GlcNAc:beta-Gal beta-1,3-N-acetylglucosaminyltransferase 5) (BGnT-5) (Beta-1,3-Gn-T5) (Beta-1,3-Nacetylglucosaminyltransferase 5) (Beta3Gn-T5) B3GNT5 378 Q6UX72 B3GN9_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 (BGnT-9) (Beta-1,3-Gn-T9) B3GNT9 402 Os © th a © 2018-03-20Date Re^ue/Date Received 2023-02-27 (Beta-1,3-N-acetylglucosaminyltransferase 9) (Beta3Gn-T9) (EC 2.4.1.-) UNQ1922/PRO4397 Q6L9W6 B4GN3_HUMAN Beta-1,4-N-acetylgalactosaminyltransferase 3 (B4GalNAcT3) (Beta4GalNAc-T3) (Beta4GalNAcT3) (EC 2.4.1.244) (Beta-1,4-N-acetylgalactosaminyltransferase III) (N-acetylbeta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 2) (NGalNAc-T2) B4GALNT3 998 Q6Y288 B3GLT_HUMAN Beta-1,3-glucosyltransferase (Beta3Glc-T) (EC 2,4.1.-) (Beta 3-glucosyltransferase) (Beta-3- glycosyltransferase-like) B3GLCT B3GALTL B3GTL 498 Q8NHY0 B4GN2_HUMAN Beta-1,4 N-acetylgalactosaminyltransferase 2 (EC 2.4.1.-) (Sd(a) beta-1,4-GalNAc transferase) (UDP-GalNAc:Neu5Aca2-3Galb-R bl,4-N-acetylgalactosaminyltransferase) B4GALNT2GALGT2 566 P0DN25 C1C1L_HUMAN C1GALT1-specific chaperone 1-like protein C1GALT1C1L 315 P16442 BGAT_HUMAN Histo-blood group ABO system transferase (Fucosylglycoprotein 3-alpha-galactosyltransferase) (Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase) (Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase) (EC 2.4.1.40) (Glycoprotein-fucosylgalactoside alpha¬ galactosyltransferase) (EC 2.4.1.37) (Histo-blood group A transferase) (A transferase) (Histoblood group B transferase) (B transferase) (NAGAT) [Cleaved into: Fucosylglycoprotein alpha-Nacetylgalactosaminyltransferase soluble form] ABO 354 Q9NS00 C1GLT_HUMAN Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 (EC 2.4.1.122) (B3Gal-T8) (Core 1 O-glycan T-synthase) (Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3- galactosyltransferase 1) (Beta-1,3-galactosyltransferase) (Core 1 beta1,3-galactosyltransferase 1) (C1GalT1) (Core 1 beta3-Gal-T1) C1GALT1 363 Q10589 BST2_HUMAN Bone marrow stromal antigen 2 (BST-2) (HM1.24 antigen) (Tetherin) (CD antigen CD317) BST2 180 Q96EU7 C1GLC_HUMAN C1GALT1-specific chaperone 1 (C38H2-like protein 1) (C38H2-L1) (Core 1 betal,3- galactosyltransferase 2) (C1Gal-T2) (C1GalT2) (Core 1 beta3-Gal-T2) (Core 1 beta3- galactosyltransferase-spedfic molecular chaperone) C1GALT1C1 COSMC HSPC067 MSTP143 UNQ273/PRO310 318 Q9UIR0 BTNL2_HUMAN Butyrophilin-like protein 2 (BTL-II) BTNL2 455 Q6P4E1 CASC4_HUMAN Protein CASC4 (Cancer susceptibility candidate gene 4 protein) CASC4 UNQ2573/PRO6308 433 Q9NNX6 CD209_HUMAN CD209 antigen (C-type lectin domain family 4 member L) (Dendritic cell-specific ICAM-3- grabbing non-integrin 1) (DC-SIGN) (DC-SIGN1) (CD antigen CD209) CD209CLEC4L 404 Q8WVQ1 CANT1_HUMAN Soluble calcium-activated nucleotidase 1 (SCAN-1) (EC 3.6.1.6) (Apyrase homolog) (Putative MAPK-activating protein PM09) (Putative NF-kappa-B-activating protein 107) CANT1 SHAPY 401 P29965 CD40LHUMAN CD40 ligand (CD40-L) (T-cell antigen Gp39) (TNF-related activation protein) (TRAP) (Tumor necrosis factor ligand superfamily member 5) (CD antigen CD154) [Cleaved into: CD40 ligand, membrane form; CD40 ligand, soluble form] CD40LGCD40L TNFSF5TRAP 261 P21854 CD72_HUMAN B-cell differentiation antigen CD72 (Lyb-2) (CD antigen CD72) CD72 359 2018-03-20Date Re^ue/Date Received 2023-02-27 Q07108 CD69_HUMAN Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69) CD69CLEC2C 199 Q9ULG6 CCPG1_HUMAN Cell cycle progression protein 1 (Cell cycle progression restoration protein 8) CCPG1 CCP8CPR8 KIAA1254 757 Q8TDX6 CGAT1_HUMAN Chondroitin sulfate N-acetylgalactosaminyltransferase 1 (CsGalNAcT-1) (EC 2.4.1.174) (Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1) (Beta4GalNAcT-1) CSGALNACT1 CHGN GALNACT1 UNQ656/PRO1287 532 P32970 CD70_HUMAN CD70 antigen (CD27 ligand) (CD27-L) (Tumor necrosis factor ligand superfamily member 7) (CD antigen CD70) CD70CD27L CD27LG TNFSF7 193 Q8IZ52 CHSS2_HUMAN Chondroitin sulfate synthase 2 (EC 2.4.1.175) (EC 2.4.1.226) (Chondroitin glucuronyltransferase 2) (Chondroitin-polymerizing factor) (ChPF) (Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase II) (N-acetylgalactosaminyl-proteoglycan 3-betagiucuronosyltransferase II) (N-acetylgalactosaminyltransferase 2) CHPFCSS2 UNQ651/PRO1281 775 Q9GZX3 CHST6_HUMAN Carbohydrate sulfotransferase 6 (EC 2.8.2.-) (Corneal N-acetylglucosamine-6-0- sulfotransferase) (C-GlcNAc6ST) (hCGn6ST) (Galactose/N-acetylglucosamine/Nacetylglucosamine 6-0-sulfotransferase 4-beta) (GST4-beta) (N-acetylglucosamine 6-0- sulfotransferase 5) (GlcNAc6ST-5) (Gn6st-5) CHST6 395 Q9NRB3 CHSTC_HUMAN Carbohydrate sulfotransferase 12 (EC 2.8.2.5) (Chondroitin 4-0-sulfotransferase 2) (Chondroitin 4-sulfotransferase 2) (C4ST-2) (C4ST2) (Sulfotransferase Hlo) CHST12 UNQ500/PRO1017 414 P28907 CD38_HUMAN ADP-ribosyl cydase/cydic ADP-ribose hydrolase 1 (EC 3.2.2.6) (2'-phospho-ADP-ribosyl cydase) (2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase) (EC 2.4.99.20) (2'-phospho-cydic-ADP-ribose transferase) (ADP-ribosyl cydase 1) (ADPRC 1) (Cyclic ADP-ribose hydrolase 1) (cADPr hydrolase 1) (T10) (CD antigen CD38) CD38 300 Q8N6G5 CGAT2_HUMAN Chondroitin sulfate N-acetylgalactosaminyltransferase 2 (EC 2.4.1.174) (Chondroitin beta-1,4-Nacetylgalactosaminyltransferase 2) (Beta4GalNAcT-2) (GalNAcT-2) CSGALNACT2 CHGN2GALNACT2 PRO0082 542 Q5QGZ9 CL12A_HUMAN C-type lectin domain family 12 member A (C-type lectin-like molecule 1) (CLL-1) (Dendritic cellassociated lectin 2) (DCAL-2) (Myeloid inhibitory C-type lectin-like receptor) (MICL) CLEC12ACLL1 DCAL2 MICL 265 Q9P2E5 CHPF2_HUMAN Chondroitin sulfate glucuronyltransferase (EC 2.4.1.226) (CSGIcA-T) (Chondroitin glucuronyltransferase) (Chondroitin polymerizing factor 2) (ChPF-2) (Chondroitin synthase 3) (ChSy-3) (N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase) CHPF2CHSY3 CSGLCAT KIAA1402 UNQ299/PRO339 772 Q70JA7 CHSS3_HUMAN Chondroitin sulfate synthase 3 (EC 2.4.1.175) (EC 2.41.226) (Carbohydrate synthase 2) (Chondroitin glucuronyltransferase 3) (Chondroitin synthase 2) (ChSy-2) (Glucuronosyl-Nacetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase II) (NCHSY3CHSY2CSS3 882 2018-03-20Date Re^ue/Date Received 2023-02-27 acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 3) (Nacetylgalactosaminyltransferase 3) Q9Y4C5 CHST2_HUMAN Carbohydrate sulfotransferase 2 (EC 2.8.2.-) (Galactose/N-acetylglucosamine/Nacetylglucosamine 6-0-sulfotransferase 2) (GST-2) (N-acetylglucosamine 6-0-sulfotransferase 1) (GlcNAc6ST-1) (Gn6ST-1) CHST2GN6ST 530 Q8NCG5 CHST4_HUMAN Carbohydrate sulfotransferase 4 (EC 2.8.2.-) (Galactose/N-acetylglucosamine/Nacetylglucosamine 6-0-sulfotransferase 3) (GST-3) (High endothelial cells N-acetylglucosamine 6-0-sulfotransferase) (HEC-GlcNAc6ST) (L-selectin ligand sulfotransferase) (LSST) (Nacetylglucosamine 6-0-sulfotransferase 2) (GlcNAc6ST-2) (Gn6st-2) CHST4 386 043529 CHSTA_HUMAN Carbohydrate sulfotransferase 10 (EC 2.8.2.-) (HNK-1 sulfotransferase) (HNK-1ST) (HNK1ST) (HuHNK-1ST) CHST10 356 Q92478 CLC2B_HUMAN C-type lectin domain family 2 member B (Activation-induced C-type lectin) (C-type lectin superfamily member 2) (IFN-alpha-2b-inducing-related protein 1) CLEC2BAICL CLECSF2 IFNRG1 149 Q6UXN8 CLC9A_HUMAN C-type lectin domain family 9 member A CLEC9A UNQ9341/PRO34046 241 Q6UWU4 CF089_HUMAN Bombesin receptor-activated protein C6orf89 (Amfion) C6orf89 BRAP UNQ177/PRO203 347 Q86X52 CHSS1_HUMAN Chondroitin sulfate synthase 1 (EC 2.4.1.175) (EC 2.4.1.226) (Chondroitin glucuronyltransferase 1) (Chondroitin synthase 1) (ChSy-1) (Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4- beta-N-acetylgalactosaminyltransferase 1) (N-acetylgalactosaminyl-proteoglycan 3-betaglucuronosyltransferase 1) (N-acetylgalactosaminyltransferase 1) CHSY1 CHSYCSS1 KIAA0990 UNQ756/PRO1487 802 Q8NET6 CHSTD_HUMAN Carbohydrate sulfotransferase 13 (EC 2.8.2.5) (Chondroitin 4-0-sulfotransferase 3) (Chondroitin 4-sulfotransferase 3) (C4ST-3) (C4ST3) CHST13 341 Q7LFX5 CHSTFHUMAN Carbohydrate sulfotransferase 15 (EC 2.8.2.33) (B-cell RAG-associated gene protein) (hBRAG) (N-acetylgalactosamine 4-sulfate 6-0-sulfotransferase) (GalNAc4S-6ST) CHST15 BRAG GALNAC4S6ST KIAA0598 561 Q9P126 CLC1B_HUMAN C-type lectin domain family 1 member B (C-type lectin-like receptor 2) (CLEC-2) CLEC1B CLEC2 UNQ721/PRO1384 229 Q8IZS7 CLCLLHUMAN C-type lectin-like domain family 1 (Dendritic cell-associated lectin 1) (DC-associated lectin-1) (DCAL-1) CLECL1 DCAL1 167 043916 CHST1_HUMAN Carbohydrate sulfotransferase 1 (EC 2.8.2.21) (Galactose/N-acetylglucosamine/Nacetylglucosamine 6-0-sulfotransferase 1) (GST-1) (Keratan sulfate Gal-6 sulfotransferase) (KS6ST) (KSGal6ST) (KSST) CHST1 411 Q7LGC8 CHST3_HUMAN Carbohydrate sulfotransferase 3 (EC 2.8.2.17) (Chondroitin 6-0-sulfotransferase 1) (C6ST-1) (Chondroitin 6-sulfotransferase) (Galactose/N-acetylglucosamine/N-acetylglucosamine 6-0- CHST3 479 2018-03-20Date Re^ue/Date Received 2023-02-27 sulfotransferase 0) (GST-0) Q9GZS9 CHST5_HUMAN Carbohydrate sulfotransferase 5 (EC 2.8.2.-) (Galactose/N-acetylglucosamine/Nacetylglucosamine 6-O-sulfotransferase 4-alpha) (GST4-alpha) (Intestinal N-acetylglucosamine- 6-0-sulfotransferase) (l-GlcNAc6ST) (Intestinal GlcNAo-6-sulfotransferase) (hlGn6ST) (Nacetylglucosamine 6-O-sulfotransferase 3) (GlcNAc6ST-3) (Gn6st-3) CHST5 411 Q9NPF2 CHSTB_HUMAN Carbohydrate sulfotransferase 11 (EC 2.8.2.5) (Chondroitin 4-0-sulfotransferase 1) (Chondroitin 4-sulfotransferase 1) (C4S-1) (C4ST-1) (C4ST1) CHST11 352 Q9UMR7 CLC4A_HUMAN C-type lectin domain family 4 member A (C-type lectin DDB27) (C-type lectin superfamily member 6) (Dendritic cell immunoreceptor) (Lectin-like immunoreceptor) CLEC4ACLECSF6 DCIR LLIR HDCGC13P 237 Q8WXI8 CLC4D_HUMAN C-type lectin domain family 4 member D (C-type lectin superfamily member 8) (C-type lectin-like receptor 6) (CLEC-6) CLEC4DCLECSF8 MCL 215 Q8N1N0 CLC4F_HUMAN C-type lectin domain family 4 member F (C-type lectin superfamily member 13) (C-type lectin 13) CLEC4FCLECSF13 589 Q6UXB4 CLC4G_HUMAN C-type lectin domain family 4 member G (Liver and lymph node sinusoidal endothelial cell Ctype lectin) (LSECtin) CLEC4G UNQ431/PRO792 293 Q9BXN2 CLC7A_HUMAN C-type lectin domain family 7 member A (Beta-glucan receptor) (C-type lectin superfamily member 12) (Dendritic cell-associated C-type lectin 1) (DC-associated C-type lectin 1) (Dectin-1) CLEC7ABGR CLECSF12DECTIN1 UNQ539/PRO1082 247 Q86VU5 CMTD1_HUMAN Catechol O-methyltransferase domain-containing protein 1 (EC 2.1.1.-) COMTD1 UNQ766/PRO1558 262 Q9NS84 CHST7_HUMAN Carbohydrate sulfotransferase 7 (EC 2.8.2.-) (EC 2.8.2.17) (Chondroitin 6-sulfotransferase 2) (C6ST-2) (Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 5) (GST-6) (N-acetylglucosamine 6-O-sulfotransferase 4) (GlcNAc6ST-4) (Gn6st-4) CHST7 486 Q8NCH0 CHSTE_HUMAN Carbohydrate sulfotransferase 14 (EC 2.8.2.35) (Dermatan 4-sulfotransferase 1) (D4ST-1) (hD4ST1) CHST14D4ST1 UNQ1925/PRO4400 376 Q6UVW9 CLC2A_HUMAN C-type lectin domain family 2 member A (Keratinocyte-associated C-type lectin) (KACL) (Proliferation-induced lymphocyte-associated receptor) (PILAR) CLEC2A KACL UNQ5792/PR019597 174 Q8WTT0 CLC4C_HUMAN C-type lectin domain family 4 member C (Blood dendritic cell antigen 2) (BDCA-2) (C-type lectin superfamily member 7) (Dendritic lectin) (CD antigen CD303) CLEC4C BDCA2 CLECSF11 CLECSF7 DLEC HECL UNQ9361/PRO34150 213 Q9ULY5 CLC4E_HUMAN C-type lectin domain family 4 member E (C-type lectin superfamily member 9) (Macrophage¬ inducible C-type lectin) CLEC4ECLECSF9 MINCLE UNQ218/PRO244 219 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9H2A9 CHST8_HUMAN Carbohydrate sulfotransferase 8 (EC 2.8.2.-) (GalNAc-4-O-sulfotransferase 1) (GalNAc-4-ST1) (GalNAc4ST-1) (N-acetylgalactosamine-4-O-sulfotransferase 1) CHST8 424 Q8IUN9 CLC10_HUMAN C-type lectin domain family 10 member A (C-type lectin superfamily member 14) (Macrophage lectin 2) (CD antigen CD301) CLEC10ACLECSF13 CLECSF14 HML 316 Q8NC01 CLC1A_HUMAN C-type lectin domain family 1 member A (C-type lectin-like receptor 1) (CLEC-1) CLEC1ACLEC1 UNQ569/PRO1131 280 Q9UJ71 CLC4K_HUMAN C-type lectin domain family 4 member K (Langerin) (CD antigen CD207) CD207CLEC4K 328 Q7L1S5 CHST9_HUMAN Carbohydrate sulfotransferase 9 (EC 2.8.2.-) (GalNAc-4-O-sulfotransferase 2) (GalNAc-4-ST2) (GalNAc4ST-2) (N-acetylgalactosamine-4-O-sulfotransferase 2) CHST9 UNQ2549/PRO6175 443 Q07065 CKAP4_HUMAN Cytoskeleton-associated protein 4 (63-kDa cytoskeleton-linking membrane protein) (Climp-63) (P63) CKAP4 602 Q2HXU8 CL12B_HUMAN C-type lectin domain family 12 member B (Macrophage antigen H) CLEC12B UNQ5782/PR016089 276 Q6ZS10 CL17A_HUMAN C-type lectin domain family 17, memberA (Prolectin) CLEC17A 378 Q9NY25 CLC5A_HUMAN C-type lectin domain family 5 memberA (C-type lectin superfamily member 5) (Myeloid DAP12- associating lectin 1) (MDL-1) CLEC5ACLECSF5 MDL1 188 Q6EIG7 CLC6A_HUMAN C-type lectin domain family 6 memberA (C-type lectin superfamily member 10) (Dendritic cellassociated C-type lectin 2) (DC-associated C-type lectin 2) (Dectin-2) CLEC6ACLECSF10 DECTIN2 209 P21964 C0MT_HUMAN Catechol O-methyltransferase (EC 2.1.1.6) COMT 271 Q9UHP7 CLC2D_HUMAN C-type lectin domain family 2 member D (Lectin-like NK cell receptor) (Lectin-like transcript 1) (LLT-1) (Osteoclast inhibitory lectin) CLEC2D CLAX LLT1 OCIL 191 Q9H2X3 CLC4M_HUMAN C-type lectin domain family 4 member M (CD209 antigen-like protein 1) (DC-SIGN-related protein) (DC-SIGNR) (Dendritic cell-specific ICAM-3-grabbing non-integrin 2) (DC-SIGN2) (Uver/lymph node-specific ICAM-3-grabbing non-integrin) (L-SIGN) (CD antigen CD299) CLEC4M CD209L CD209L1 CD299 399 Q5KU26 COL12_HUMAN Collectin-12 (Collectin placenta protein 1) (CL-P1) (hCL-P1) (Nurse cell scavenger receptor 2) (Scavenger receptor class A member 4) (Scavenger receptor with C-type lectin) COLEC12CLP1 NSR2SCARA4SRCL 742 Q5TAT6 CODA1.HUMAN Collagen alpha-1(XIII) chain (COLXIIIA1) COL13A1 717 Q96BA8 CR3L1_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 1 (cAMP-responsive element¬ binding protein 3-like protein 1) (Old astrocyte specifically-induced substance) (OASIS) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 1] CREB3L1 OASIS PSEC0238 519 Q86Y22 C0NA1_HUMAN Collagen alpha-1(XXIII) chain COL23A1 540 Q70SY1 CR3L2_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 2 (cAMP-responsive element¬ binding protein 3-like protein 2) (BBF2 human homolog on chromosome 7) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 2] CREB3L2 BBF2H7 520 2018-03-20Date ReQue/Date Received 2023-02-27 Q9UMD9 COHA1.HUMAN Collagen alpha-1(XVII) chain (180 kDa bullous pemphigoid antigen 2) (Bullous pemphigoid antigen 2) [Cleaved into: 120 kDa linear IgA disease antigen (120 kDa linear IgA dermatosis antigen) (Linear IgA disease antigen 1) (LAD-1); 97 kDa linear IgA disease antigen (97 kDa linear IgA bullous dermatosis antigen) (97 kDa LAD antigen) (97-LAD) (Linear IgA bullous disease antigen of 97 kDa) (LABD97)] COL17A1 BP180 BPAG2 1497 Q8N1L4 CP4Z2_HUMAN Putative inactive cytochrome P450 family member 4Z2 CYP4Z2P 340 Q9BXS0 C0PA1.HUMAN Collagen alpha-1(XXV) chain (Alzheimer disease amyloid-associated protein) (AMY) (CLAC-P) [Cleaved into: Collagen-like Alzheimer amyloid plaque component (CLAC)] COL25A1 654 Q9Y5Q5 CORIN.HUMAN Atrial natriuretic peptide-converting enzyme (EC 3.4.21.-) (Corin) (Heart-specific serine proteinase ATC2) (Pro-ANP-converting enzyme) (Transmembrane protease serine 10) [Cleaved into: Atrial natriuretic peptide-converting enzyme, N-terminal propeptide; Atrial natriuretic peptide-converting enzyme, activated protease fragment; Atrial natriuretic peptide-converting enzyme, 180 kDa soluble fragment; Atrial natriuretic peptide-converting enzyme, 160 kDa soluble fragment; Atrial natriuretic peptide-converting enzyme, 100 kDa soluble fragment] CORIN CRN TMPRSS10 1042 Q86W10 CP4Z1.HUMAN Cytochrome P450 4Z1 (EC 1.14.14.1) (CYPIVZ1) CYP4Z1 UNQ3060/PRO9882 505 043889 CREB3.HUMAN Cyclic AMP-responsive element-binding protein 3 (CREB-3) (cAMP-responsive element-binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP-alpha) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 (N-terminal Luman) (Transcriptionally active form)] CREB3 LZIP 395 Q8TEY5 CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 (cAMP-responsive element¬ binding protein 3-like protein 4) (Androgen-induced basic leucine zipper protein) (AlbZIP) (Attaching to CRE-like 1) (ATCE1) (Cyclic AMP-responsive element-binding protein 4) (CREB-4) (cAMP-responsive element-binding protein 4) (Transcript induced in spermiogenesis protein 40) (Tisp40) (hJAL) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 4] CREB3L4AIBZIP CREB4JAL 395 Q68CJ9 CR3L3.HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 3 (cAMP-responsive element¬ binding protein 3-like protein 3) (Transcription factor CREB-H) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 3] CREB3L3CREBH HYST1481 461 P37059 DHB2_HUMAN Estradiol 17-beta-dehydrogenase 2 (EC 1.1.1.62) (17-beta-hydroxysteroid dehydrogenase type 2) (17-beta-HSD 2) (20 alpha-hydroxysteroid dehydrogenase) (20-alpha-HSD) (E2DH) (Microsomal 17-beta-hydroxysteroid dehydrogenase) (Short chain dehydrogenase/reductase family 9C member 2) (Testosterone 17-beta-dehydrogenase) (EC 1.1.1.239) HSD17B2EDH17B2 SDR9C2 387 P27487 DPP4_HUMAN Dipeptidyl peptidase 4 (EC 3.4.14.5) (ADABP) (Adenosine deaminase complexing protein 2) (ADCP-2) (Dipeptidyl peptidase IV) (DPP IV) (T-cell activation antigen CD26) (TP103) (CD DPP4ADCP2CD26 766 Os © th a © 2018-03-20Date Re^ue/Date Received 2023-02-27 antigen CD26) [Cleaved into: Dipeptidyl peptidase 4 membrane form (Dipeptidyl peptidase IV membrane form); Dipeptidyl peptidase 4 soluble form (Dipeptidyl peptidase IV soluble form)) P28845 DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 (EC 1.1.1.146) (11-beta-hydroxysteroid dehydrogenase 1) (11-DH) (11-beta-HSD1) (Short chain dehydrogenase/reductase family 26C member 1) HSD11B1 HSD11 HSD11LSDR26C1 292 P09172 D0P0_HUMAN Dopamine beta-hydroxylase (EC 1.14.17.1) (Dopamine beta-monooxygenase) [Cleaved into: Soluble dopamine beta-hydroxylase] DBH 617 Q8N608 DPP10_HUMAN Inactive dipeptidyl peptidase 10 (Dipeptidyl peptidase IV-related protein 3) (DPRP-3) (Dipeptidyl peptidase X) (DPPX) (Dipeptidyl peptidase-like protein 2) (DPL2) DPP10DPRP3 KIAA1492 796 P42658 DPP6_HUMAN Dipeptidyl aminopeptidase-like protein 6 (DPPX) (Dipeptidyl aminopeptidase-related protein) (Dipeptidyl peptidase 6) (Dipeptidyl peptidase IV-like protein) (Dipeptidyl peptidase VI) (DPP VI) DPP6 865 Q6IAN0 DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B (EC 1.1.-.-) (Short-chain dehydrogenase/reductase family 32C member 1) DHRS7BSDR32C1 CGI-93 UNQ212/PRO238 325 060344 ECE2_HUMAN Endothelin-converting enzyme 2 (ECE-2) [Includes: Methyltransferase-like region (EC 2.1.1.-); Endothelin-converting enzyme 2 region (EC 3.4.24.71)] ECE2 KIAA0604 UNQ403/PRO740 883 075923 DYSF_HUMAN Dysferlin (Dystrophy-associated fer-1-like protein) (Fer-1-like protein 1) DYSF FER1L1 2080 095672 ECEL1_HUMAN Endothelin-converting enzyme-like 1 (EC 3.4.24.-) (Xce protein) ECEL1 XCE UNQ2431/PRO4991 775 Q92838 EDA_HUMAN Ectodysplasin-A (Ectodermal dysplasia protein) (EDA protein) [Cleaved into: Ectodysplasin-A, membrane form; Ectodysplasin-A, secreted form] EDA ED1 EDA2 391 P42892 ECE1_HUMAN Endothelin-converting enzyme 1 (ECE-1) (EC 3.4.24.71) ECE1 770 Q92611 EDEM1_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 1 EDEM1 EDEM KIAA0212 657 075354 ENTP6_HUMAN Ectonudeoside triphosphate diphosphohydrolase 6 (NTPDase 6) (EC 3.6.1.6) (CD39 antigen¬ like 2) ENTPD6CD39L2 IL6ST2 484 P98073 ENTKHUMAN Enteropeptidase (EC 3.4.21.9) (Enterokinase) (Serine protease 7) (Transmembrane protease serine 15) [Cleaved into: Enteropeptidase non-catalytic heavy chain; Enteropeptidase catalytic light chain] TMPRSS15 ENTK PRSS7 1019 P22413 ENPP1_HUMAN Ectonudeotide pyrophosphatase/phosphodiesterase family member 1 (E-NPP 1) (Membrane component chromosome 6 surface marker 1) (Phosphodiesterase l/nucleotide pyrophosphatase 1) (Plasma-cell membrane glycoprotein PC-1) [Includes: Alkaline phosphodiesterase I (EC 3.1.4.1); Nudeotide pyrophosphatase (NPPase) (EC 3.6.1.9)] ENPP1 M6S1 NPPS PC1 PDNP1 925 014638 ENPP3_HUMAN Ectonudeotide pyrophosphatase/phosphodiesterase family member 3 (E-NPP 3) ENPP3 PDNP3 875 2018-03-20Date ReQue/Date Received 2023-02-27 (Phosphodiesterase I beta) (PD-lbeta) (Phosphodiesterase l/nucleotide pyrophosphatase 3) (CD antigen CD203c) [Includes: Alkaline phosphodiesterase I (EC 3.1.4.1); Nucleotide pyrophosphatase (NPPase) (EC 3.6.1.9)] 043909 EXTL3_HUMAN Exostosin-like 3 (EC 2.4.1.223) (EXT-related protein 1) (Glucuronyl-galactosyl-proteoglycan 4- alpha-N-acetylglucosaminyltransferase) (Hereditary multiple exostoses gene isolog) (Multiple exostosis-like protein 3) (Putative tumor suppressor protein EXTL3) EXTL3 EXTL1L EXTR1 KIAA0519 919 Q6UWH4 F198B_HUMAN Protein FAM198B (Expressed in nerve and epithelium during development) FAM198BC4orf18 ENEDAD021 UNQ2512/PRO6001 519 Q9H0X4 F234A_HUMAN Protein FAM234A (Protein ITFG3) FAM234AC16orf9 ITFG3 552 Q5VUD6 FA69B_HUMAN Protein FAM69B FAM69B C9orf136 PP6977 431 Q8IUS5 EPHX4_HUMAN Epoxide hydrolase 4 (EC 3.3.-.-) (Abhydrolase domain-containing protein 7) (Epoxide hydrolaserelated protein) EPHX4ABHD7 EPHXRP 362 094905 ERLN2_HUMAN Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HfIC/K domain-containing protein 2) (SPFH domain-containing protein 2) ERLIN2 C8orf2 SPFH2 UNQ2441/PRO5003/P RO9924 339 Q93063 EXT2_HUMAN Exostosin-2 (EC 2.4.1.224) (EC 2.4.1.225) (Glucuronosyl-N-acetylglucosaminyl-proteoglycan/Nacetylglucosaminyl-proteoglycan 4-alpha-N-aceiylglucosaminyltransferase) (Multiple exostoses protein 2) (Putative tumor suppressor protein EXT2) EXT2 718 Q9NZ08 ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1 (EC 3.4.11.-) (ARTS-1) (Adipocyte-derived leucine aminopeptidase) (A-LAP) (Aminopeptidase PILS) (Puromycin-insensitive leucyl-specific aminopeptidase) (PILS-AP) (Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator) ERAP1 APPILS ARTS1 KIAA0525 UNQ584/PRO1154 941 Q6P179 ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2 (EC 3.4.11.-) (Leukocyte-derived arginine aminopeptidase) (L-RAP) ERAP2 LRAP 960 075477 ERLN1_HUMAN Erlin-1 (Endoplasmic reticulum lipid raft-associated protein 1) (Protein KE04) (Stomatinprohibitin-flotillin-HflC/K domain-containing protein 1) (SPFH domain-containing protein 1) ERLIN1 C10orf69 KE04KEO4SPFH1 346 Q92935 EXTL1_HUMAN Exostosin-like 1 (EC 2.4.1.224) (Exostosin-L) (Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) (Multiple exostosis-like protein) EXTL1 EXTL 676 Q16394 EXT1_HUMAN Exostosin-1 (EC 2.4.1.224) (EC 2.4.1.225) (Glucuronosyl-N-acetylglucosaminyl-proteoglycan/Nacetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) (Multiple exostoses protein 1) (Putative tumor suppressor protein EXT1) EXT1 746 Ul © Ui a © VI 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9UBQ6 EXTL2_HUMAN Exostosin-like 2 (EC 2.4.1.223) (Alpha-1,4-N-acetylhexosaminyltransferase EXTL2) (AlphaGalNAcT EXTL2) (EXT-related protein 2) (Glucuronyl-galactosyl-proteoglycan 4-alpha-Nacetylglucosaminyltransferase) [Cleaved into: Processed exostosin-like 2] EXTL2 EXTR2 330 Q0P6D2 FA69CJ4UMAN Protein FAM69C FAM69C C18orf51 419 Q5T7M9 FA69A_HUMAN Protein FAM69A FAM69A 428 Q9H9S5 FKRP_HUMAN Fukutin-related protein (EC 2.-.-.-) FKRP 495 Q8N539 FBCD1_HUMAN Fibrinogen C domain-containing protein 1 FIBCD1 UNQ701/PRO1346 461 P06734 FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor (BLAST-2) (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor) (CD antigen CD23) [Cleaved into: Low affinity immunoglobulin epsilon Fc receptor membrane-bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form! FCER2CD23A CLEC4J FCE2 IGEBF 321 075072 FKTN_HUMAN Fukutin (EC 2.-.-.-) (Fukuyama-type congenital muscular dystrophy protein) FKTN FCMD 461 Q04609 FOLH1_HUMAN Glutamate carboxypeptidase 2 (EC 3.4,17,21) (Cell growth-inhibiting gene 27 protein) (Folate hydrolase 1) (Folylpoly-gamma-glutamate carboxypeptidase) (FGCP) (Glutamate carboxypeptidase II) (GCPII) (Membrane glutamate carboxypeptidase) (mGCP) (N-acetylatedalpha-linked acidic dipeptidase I) (NAALADase I) (Prostate-specific membrane antigen) (PSM) (PSMA) (Pteroylpoly-gamma-glutamate carboxypeptidase) F0LH1 FOLH NAALAD1 PSM PSMAGIG27 750 Q9BYC5 FUT8_HUMAN Alpha-(1,6)-fucosyltransferase (Alpha1-6FucT) (EC 2.4.1.68) (Fucosyltransferase 8) (GDP-LFuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase) (GDP-fucose-glycoprotein fucosyltransferase) (Glycoprotein 6-alpha-L-fucosyltransferase) FUT8 575 P19526 FUT1_HUMAN Galactoside 2-alpha-L-fucosyltransferase 1 (EC 2.4.1.69) (Alpha(1,2)FT 1) (Blood group H alpha 2-fucosyltransferase) (Fucosyltransferase 1) (GDP-L-fucose:beta-D-galactoside 2-alpha-Lfucosyltransferase 1) FUT1 H HSC 365 P51993 FUT6_HUMAN Alpha-(1,3)-fucosyltransferase 6 (EC 2.4.1.65) (Fucosyltransferase 6) (Fucosyltransferase VI) (Fuc-TVI) (FucT-VI) (Galactoside 3-L-fucosyltransferase) FUT6 FCT3A 359 Q9H3Q3 G3ST2_HUMAN Galactose-3-O-sulfotransferase 2 (Gal3ST-2) (EC 2.8.2.-) (Beta-galactose-3-O-sulfotransferase 2) (Gal-beta-1, 3-GalNAc 3'-sulfotransferase 2) (Glycoprotein beta-Gal 3'-sulfotransferase 2) GAL3ST2GP3ST 398 Q10981 FUT2_HUMAN Galactoside 2-alpha-L-fucosyltransferase 2 (EC 2.4.1.69) (Alpha(1,2)FT 2) (Fucosyltransferase 2) (GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2) (SE2) (Secretor blood group alpha-2-fucosyltransferase) (Secretor factor) (Se) FUT2SEC2 343 P22083 FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 (EC 2.4.1.-) (ELAM-1 ligand fucosyltransferase) (Fucosyltransferase 4) (Fucosyltransferase IV) (Fuc-TIV) (FucT-IV) (Galactoside 3-Lfucosyltransferase) FUT4 ELFT FCT3A 530 2018-03-20Date Re^ue/Date Received 2023-02-27 Q96A11 G3ST3_HUMAN Galactose-3-O-sulfotransferase 3 (Gal3ST-3) (EC 2.8.2.-) (Beta-galactose-3-O-sulfotransferase 3) (Gal3ST3) (Gal-beta-1, 3-GalNAc 3'-sulfotransferase 3) GAL3ST3 431 Q10472 GALT1_HUMAN Polypeptide N-acetylgalactosaminyltransferase 1 (EC 2.4.1.41) (Polypeptide GalNAc transferase 1) (GalNAc-T1) (pp-GaNTase 1) (Protein-UDP acetylgalactosaminyltransferase 1) (UDPGalNAc:polypeptide N-acetylgalactosaminyltransferase 1) [Cleaved into: Polypeptide Nacetylgalactosaminyltransferase 1 soluble form] GALNT1 559 Q10471 GALT2_HUMAN Polypeptide N-acetylgalactosaminyltransferase 2 (EC 2.4.1.41) (Polypeptide GalNAc transferase 2) (GalNAc-T2) (pp-GaNTase 2) (Protein-UDP acetylgalactosaminyltransferase2) (UDPGalNAc:polypeptide N-acetylgalactosaminyltransferase2) [Cleaved into: Polypeptide Nacetylgalactosaminyltransferase 2 soluble form] GALNT2 571 Q14435 GALT3_HUMAN Polypeptide N-acetylgalactosaminyltransferase 3 (EC 2.4.1.41) (Polypeptide GalNAc transferase 3) (GalNAc-T3) (pp-GaNTase 3) (Protein-UDP acetylgalactosaminyltransferase 3) (UDPGalNAc:polypeptide N-acetylgalactosaminyltransferase 3) GALNT3 633 Q8NCL4 GALT6_HUMAN Polypeptide N-acetylgalactosaminyltransferase 6 (EC 2.4.1.41) (Polypeptide GalNAc transferase 6) (GalNAc-T6) (pp-GaNTase 6) (Protein-UDP acetylgalactosaminyltransferase 6) (UDPGalNAc:polypeptide N-acetylgalactosaminyltransferase 6) GALNT6 622 Q6P4F1 FUT10_HUMAN Alpha-(1,3)-fucosyltransferase 10 (EC 2.4.1.-) (Fucosyltransferase X) (Fuc-TX) (FucT-X) (Galactoside 3-L-fucosyltransferase 10) (Fucosyltransferase 10) FUT10 479 Q99999 G3ST1_HUMAN Galactosylceramide sulfotransferase (GalCer sulfotransferase) (EC 2,8.2,11) (3- phosphoadenosine-5'-phosphosulfate:GalCer sulfotransferase) (3- phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase) (Cerebroside sulfotransferase) GAL3ST1 CST 423 Q96RP7 G3ST4_HUMAN Galactose-3-O-sulfotransferase 4 (Gal3ST-4) (EC 2.8.2.-) (Beta-galactose-3-O-sulfotransferase 4) (Gal-beta-1,3-GalNAc 3'-sulfotransferase) GAL3ST4 PP6968 486 Q9NY28 GALT8_HUMAN Probable polypeptide N-acetylgalactosaminyltransferase 8 (EC 2.4.1.41) (Polypeptide GalNAc transferase 8) (GalNAc-T8) (pp-GaNTase 8) (Protein-UDP acetylgalactosaminyltransferase 8) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 8) GALNT8 637 Q9HCQ5 GALT9_HUMAN Polypeptide N-acetylgalactosaminyltransferase 9 (EC 2.4.1.41) (Polypeptide GalNAc transferase 9) (GalNAc-T9) (pp-GaNTase 9) (Protein-UDP acetylgalactosaminyltransferase9) (UDPGalNAc:polypeptide N-acetylgalactosaminyltransferase 9) GALNT9 603 Q495W5 FUT11_HUMAN Alpha-(1,3)-fucosyltransferase 11 (EC 2.4.1.-) (Fucosyltransferase XI) (Fuc-TXI) (FucT-XI) (Galactoside 3-L-fucosyltransferase 11) (Fucosyltransferase 11) FUT11 492 P21217 FUT3_HUMAN Galactoside 3(4)-L-fucosyltransferase (EC 2.4.1.65) (Blood group Lewis alpha-4- fucosyltransferase) (Lewis FT) (Fucosyltransferase 3) (Fucosyltransferase III) (FucT-lll) FUT3 FT3B LE 361 Q9Y231 FUT9_HUMAN Alpha-(1,3)-fucosyltransferase 9 (EC 2.4.1.-) (Fucosyltransferase 9) (Fucosyltransferase IX) (Fuc-TIX) (FucT-IX) (Galactoside 3-L-fucosyltransferase) FUT9 359 2018-03-20Date Re^ue/Date Received 2023-02-27 Q7Z7M9 GALT5_HUMAN Polypeptide N-acetylgalactosaminyltransferase 5 (EC 2.4.1.41) (Polypeptide GalNAc transferase 5) (GalNAc-T5) (pp-GaNTase 5) (Protein-UDP acetylgalactosaminyltransferase 5) (UDPGalNAc:polypeptide N-acetylgalactosaminyltransferase 5) GALNT5 940 Q9P109 GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 (EC 2.4.1.102) (Core 2-branching enzyme 3) (Core2-GlcNAc-transferase 3) (C2GnT3) GCNT4 453 Q6ZNI0 GCNT7_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7 (EC 2.4.1.-) GCNT7C20orf105 430 Q11128 FUT5_HUMAN Alpha-(1,3)-fucosyltransferase 5 (EC 2.4.1.65) (Fucosyltransferase 5) (Fucosyltransferase V) (Fuc-TV) (FucT-V) (Galactoside 3-L-fucosyltransferase) FUT5 374 Q11130 FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 (EC 2.4.1.-) (Fucosyltransferase 7) (Fucosyltransferase VII) (Fuc-TVIl) (FucT-VII) (Galactoside 3-L-fucosyltransferase) (Selectin ligand synthase) FUT7 342 Q02742 GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase (EC 2.4.1.102) (Core 2-branching enzyme) (Core2-GlcNAc-transferase) (C2GNT) (Core 2 GNT) GCNT1 NACGT2 428 Q8N5D6 GBGT1_HUMAN Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 (EC 2.4.1,-) (Forssman glycolipid synthase-like protein) GBGT1 UNQ2513/PRO6002 347 Q5T4J0 GCNT6_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 6 (EC 2.4.1.-) GCNT6 391 Q4G0N0 GGTA1_HUMAN Inactive N-acetyllactosaminide alpha-1,3-galactosyltransferase (Glycoprotein alpha¬ galactosyltransferase 1 pseudogene) GGTA1P GGTA1 100 Q68CQ7 GL8D1_HUMAN Glycosyltransferase 8 domain-containing protein 1 (EC 2.4.1.-) GLT8D1 GALA4AAD- 017MSTP137 UNQ572/PRO1134 371 Q8N4A0 GALT4_HUMAN Polypeptide N-acetylgalactosaminyltransferase 4 (EC 2.4.1.41) (Polypeptide GalNAc transferase 4) (GalNAc-T4) (pp-GaNTase 4) (Protein-UDP acetylgalactosaminyltransferase4) (UDPGalNAc:polypeptide N-acetylgalactosaminyltransferase 4) GALNT4 578 Q86SF2 GALT7_HUMAN N-acetylgalactosaminyltransferase 7 (EC 2.4.1,-) (Polypeptide GalNAc transferase 7) (GalNAcT7) (pp-GaNTase 7) (Protein-UDP acetylgalactosaminyltransferase 7) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7) GALNT7 657 095395 GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (EC 2.4.1.102) (EC 2.4.1.150) (C2GnT-mucin type) (C2GnT-M) (hC2GnT-M) (Core2/core4 beta-1,6- N-acetylglucosaminyltransferase) (C2/4GnT) GCNT3 438 P19440 GGT1_HUMAN Gamma-glutamyltranspeptidase 1 (GGT 1) (EC 2.3.2.2) (Gamma-glutamyltransferase 1) (Glutathione hydrolase 1) (EC 3.4.19.13) (Leukotriene-C4 hydrolase) (EC 3.4.19.14) (CD antigen CD224) [Cleaved into: Gamma-glutamyltranspeptidase 1 heavy chain; Gammaglutamyltranspeptidase 1 light chain] GGT1 GGT 569 2018-03-20Date Re^ue/Date Received 2023-02-27 Q7Z4J2 GL6D1_HUMAN Glycosyltransferase 6 domain-containing protein 1 (EC 2.4.1,-) (Galactosyltransferase family 6 domain-containing 1) GLT6D1 GLTDC1 GT6M7 308 094923 GLCE_HUMAN D-glucuronyl C5-epimerase (EC 5.1.3,17) (Heparan sulfate C5-epimerase) (Hsepi) (Heparin/heparan sulfate:glucuronic acid C5-epimerase) (Heparosan-N-sulfate-glucuronate 5- epimerase) GLCE KIAA0836 617 Q86SR1 GLT10_HUMAN Polypeptide N-acetylgalactosaminyltransferase 10 (EC 2.4.1.41) (Polypeptide GalNAc transferase 10) (GalNAc-T10) (pp-GaNTase 10) (Protein-UDP acetylgalactosaminyltransferase 10) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10) GALNT10 603 Q8IXK2 GLT12_HUMAN Polypeptide N-acetylgalactosaminyltransferase 12 (EC 2.4.1.41) (Polypeptide GalNAc transferase 12) (GalNAc-T12) (pp-GaNTase 12) (Protein-UDP acetylgalactosaminyltransferase 12) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12) GALNT12 581 Q96FL9 GLT14_HUMAN Polypeptide N-acetylgalactosaminyltransferase 14 (EC 2.4.1.41) (Polypeptide GalNAc transferase 14) (GalNAc-T14) (pp-GaNTase 14) (Protein-UDP acetylgalactosaminyltransferase 14) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14) GALNT14 UNQ2434/PRO4994 552 Q8N428 GLT16_HUMAN Polypeptide N-acetylgalactosaminyltransferase 16 (EC 2.4.1.41) (Polypeptide GalNAc transferase 16) (GalNAc-T16) (Polypeptide GalNAc transferase-like protein 1) (GalNAc-T-like protein 1) (pp-GaNTase-like protein 1) (Polypeptide N-acetylgalactosaminyltransferase-like protein 1) (Protein-UDP acetylgalactosaminyltransferase-like protein 1) (UDPGalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 1) GALNT16GALNTL1 KIAA1130 558 P36269 GGT5_HUMAN Gamma-glutamyltransferase 5 (GGT 5) (EC 2.3.2.2) (Gamma-glutamyl transpeptidase-related enzyme) (GGT-rel) (Gamma-glutamyltransferase-like activity 1) (Gamma-glutamyltranspeptidase 5) (Glutathione hydrolase 5) (EC 3.4.19.13) (Leukotriene-C4 hydrolase) (EC 3.4.19.14) [Cleaved into: Gamma-glutamyltransferase 5 heavy chain; Gamma-glutamyltransferase 5 light chain] GGT5GGTLA1 586 Q6P531 GGT6_HUMAN Gamma-glutamyltransferase 6 (GGT 6) (EC 2.3.2.2) (Gamma-glutamyltranspeptidase 6) (Glutathione hydrolase 6) (EC 3.4.19.13) [Cleaved into: Gamma-glutamyltransferase 6 heavy chain; Gamma-glutamyltransferase 6 light chain] GGT6 493 Q9UJ14 GGT7_HUMAN Gamma-glutamyltransferase 7 (GGT 7) (EC 2.3.2.2) (Gamma-glutamyltransferase-like 3) (Gamma-glutamyltransferase-like 5) (Gamma-glutamyltranspeptidase 7) (Glutathione hydrolase 7) (EC 3.4.19.13) [Cleaved into: Gamma-glutamyltransferase 7 heavy chain; Gammaglutamyltransferase 7 light chain] GGT7GGTL3GGTL5 662 Q6ZMI3 GLDN_HUMAN Gliomedin [Cleaved into: Gliomedin shedded ectodomain] GLDN COLM UNQ9339/PRO34011 551 Q8IUC8 GLT13_HUMAN Polypeptide N-acetylgalactosaminyltransferase 13 (EC 2.4.1.41) (Polypeptide GalNAc transferase 13) (GalNAc-T13) (pp-GaNTase 13) (Protein-UDP acetylgalactosaminyltransferase 13) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13) GALNT13KIAA1918 556 2018-03-20Date Re^ue/Date Received 2023-02-27 Q6P9A2 GLT18_HUMAN Polypeptide N-acetylgalactosaminyltransferase 18 (EC 2.4.1,41) (Polypeptide GalNAc transferase 18) (GalNAc-T18) (Polypeptide GalNAc transferase-like protein 4) (GalNAc-T-like protein 4) (pp-GaNTase-like protein 4) (Polypeptide N-acetylgalactosaminyltransferase-like protein 4) (Protein-UDP acetylgalactosaminyltransferase-like protein 4) (UDPGalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 4) GALNT18GALNTL4 607 Q49A17 GLTL6_HUMAN Polypeptide N-acetylgalactosaminyltransferase-like 6 (EC 2.4.1.41) (Polypeptide GalNAc transferase 17) (GalNAc-T17) (pp-GaNTase 17) (Protein-UDP acetylgalactosaminyltransferase 17) (Putative polypeptide N-acetylgalactosaminyltransferase 17) (UDP-GalNAc:polypeptide Nacetylgalactosaminyltransferase 17) GALNTL6GALNT17 601 Q3T906 GNPTA_HUMAN N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (EC 2.7.8.17) (GlcNAc-1- phosphotransferase subunits alpha/beta) (Stealth protein GNPTAB) (UDP-N-acetylglucosamine- 1-phosphotransferase subunits alpha/beta) [Cleaved into: N-acetylglucosamine-1- phosphotransferase subunit alpha; N-acetylglucosamine-1-phosphotransferase subunit beta] GNPTAB GNPTA KIAA1208 1256 A6NGU5 GGT3_HUMAN Putative gamma-glutamyltranspeptidase 3 (GGT 3) (EC 2.3.2.2) (Gamma-glutamyltransferase 3) (Glutathione hydrolase 3) (EC 3.4.19.13) [Cleaved into: Putative gamma-glutamyltranspeptidase 3 heavy chain; Putative gamma-glutamyltranspeptidase 3 light chain] GGT3P GGT3 568 Q9H1C3 GL8D2_HUMAN Glycosyltransferase 8 domain-containing protein 2 (EC 2.4.1.-) GLT8D2GALA4A UNQ1901/PRO4347 349 Q8N3T1 GLT15_HUMAN Polypeptide N-acetylgalactosaminyltransferase 15 (EC 2.4.1,41) (Polypeptide GalNAc transferase-like protein 2) (GalNAc-T-like protein 2) (pp-GaNTase-like protein 2) (Polypeptide Nacetylgalactosaminyltransferase-like protein 2) (Protein-UDP acetylgalactosaminyltransferaselike protein 2) (UDP-GalNAc:polypeptide N-acetylgaiactosaminyltransferase-like protein 2) GALNT15GALNTL2 UNQ770/PRO1564 639 Q6IS24 GLTL3_HUMAN Putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 (EC 2.4.1.41) (Polypeptide GalNAc transferase-like protein 3) (GalNAc-T-like protein 3) (pp-GaNTase-like protein 3) (Protein-UDP acetylgalactosaminyltransferase-like protein 3) (UDP-GalNAc:polypeptide Nacetylgalactosaminyltransferase-like protein 3) (Williams-Beuren syndrome chromosomal region 17 protein) WBSCR17 GALNTL3 598 Q8NCW6 GLT11_HUMAN Polypeptide N-acetylgalactosaminyltransferase 11 (EC 2.4.1,41) (Polypeptide GalNAc transferase 11) (GalNAc-T11) (pp-GaNTase 11) (Protein-UDP acetylgalactosaminyltransferase 11) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 11) GALNT11 608 Q7Z4T8 GLTL5_HUMAN Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5 (Polypeptide GalNAc transferase 15) (GalNAc-T15) (pp-GaNTase 15) (Protein-UDP acetylgalactosaminyltransferase 15) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 15) GALNTL5GALNT15 443 Q8N0V5 GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase (Nacetylglucosaminyltransferase) (EC 2.4.1.150) (l-branching enzyme) (IGNT) GCNT2GCNT5II NACGT1 402 2018-03-20Date Re^ue/Date Received 2023-02-27 000461 GOU4_HUMAN Golgi integral membrane protein 4 (Golgi integral membrane protein, cis) (GIMPc) (Golgi phosphoprotein 4) (Golgi-localized phosphoprotein of 130 kDa) (Golgi phosphoprotein of 130 kDa) GOLIM4 GIMPC GOLPH4GPP130 696 Q8NBJ4 GOLM1_HUMAN Golgi membrane protein 1 (Golgi membrane protein GP73) (Golgi phosphoprotein 2) GOLM1 C9orf155 GOLPH2 PSEC0242 UNQ686/PRO1326 401 A0PJZ3 GXLT2_HUMAN Glucoside xylosyltransferase 2 (EC 2.4.2.n2) (Glycosyltransferase 8 domain-containing protein 4) GXYLT2GLT8D4 443 Q4G148 GXLT1_HUMAN Glucoside xylosyltransferase 1 (EC 2.4.2.n2) (Glycosyltransferase 8 domain-containing protein 3) GXYLT1 GLT8D3 440 Q96MM7 H6ST2_HUMAN Heparan-sulfate 6-O-sulfotransferase 2 (HS6ST-2) (EC 2.8.2.-) HS6ST2 PSEC0092 605 060243 H6ST1_HUMAN Heparan-sulfate 6-O-sulfotransferase 1 (HS6ST-1) (EC 2.8.2.-) HS6ST1 HS6ST 411 Q8IZP7 H6ST3_HUMAN Heparan-sulfate 6-O-sulfotransferase 3 (HS6ST-3) (EC 2.8.2.-) HS6ST3 471 P04233 HG2A_HUMAN HLA class II histocompatibility antigen gamma chain (HLA-DR antigens-associated invariant chain) (la antigen-associated invariant chain) (li) (p33) (CD antigen CD74) CD74DHLAG 296 Q7LGA3 HS2STHUMAN Heparan sulfate 2-O-sulfotransferase 1 (2-O-sulfotransferase) (2OST) (EC 2.8.2.-) HS2ST1 HS2ST KIAA0448 356 Q8IZT8 HS3S5_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 5 (EC 2.8.2.23) (Heparan sulfate Dglucosaminyl 3-O-sulfotransferase 5) (3-OST-5) (Heparan sulfate 3-O-sulfotransferase 5) (h3- OST-5) HS3ST53OST5 HS3OST5 346 P05981 HEPS_HUMAN Serine protease hepsin (EC 3.4.21.106) (Transmembrane protease serine 1) [Cleaved into: Serine protease hepsin non-catalytic chain; Serine protease hepsin catalytic chain] HPN TMPRSS1 417 Q9Y663 HS3SA_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 (EC 2.8.2.30) (Heparan sulfate Dglucosaminyl 3-O-sulfotransferase 3A1) (3-OST-3A) (Heparan sulfate 3-O-sulfotransferase 3A1) (h3-OST-3A) HS3ST3A1 3OST3A1 HS3ST3A UNQ2551/PRO6180 406 Q9Y278 HS3S2_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 2 (EC 2,8.2.29) (Heparan sulfate Dglucosaminyl 3-O-sulfotransferase 2) (3-OST-2) (Heparan sulfate 3-O-sulfotransferase 2) (h3- OST-2) HS3ST23OST2 UNQ2442/PRO5004 367 Q9Y661 HS3S4_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 4 (EC 2.8.2.23) (Heparan sulfate Dglucosaminyl 3-O-sulfotransferase 4) (3-OST-4) (Heparan sulfate 3-O-sulfotransferase 4) (h3- OST-4) HS3ST4 3OST4 456 Q96QI5 HS3S6_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 6 (EC 2.8.2.23) (Heparan sulfate Dglucosaminyl 3-O-sulfotransferase 6) (3-OST-6) (Heparan sulfate 3-O-sulfotransferase 6) (h3- OST-6) HS3ST6 HS3ST5 342 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9Y662 HS3SB_HUMAN Heparan sulfate glucosamine 3-0-sulfotransferase 3B1 (EC 2.8.2.30) (Heparan sulfate Dglucosaminyl 3-0-sulfotransferase 3B1) (3-OST-3B) (Heparan sulfate 3-0-sulfotransferase 3B1) (h3-OST-3B) HS3ST3B1 3OST3B1 HS3ST3B 390 P07099 HYEP_HUMAN Epoxide hydrolase 1 (EC 3.3.2.9) (Epoxide hydratase) (Microsomal epoxide hydrolase) EPHX1 EPHX EPOX 455 P46695 IEX1_HUMAN Radiation-inducible immediate-early gene IEX-1 (Differentiation-dependent gene 2 protein) (Protein DIF-2) (Immediate early protein GLY96) (Immediate early response 3 protein) (PACAPresponsive gene 1 protein) (Protein PRG1) IER3DIF2 IEX1 PRG1 156 P55073 IOD3_HUMAN Thyroxine 5-deiodinase (EC 1.21.99.3) (5DIII) (DIOIII) (Type 3 DI) (Type III iodothyronine deiodinase) DIO3 ITDI3TXDI3 304 Q9NX62 IMPA3_HUMAN Inositol monophosphatase 3 (IMP 3) (IMPase 3) (EC 3.1.3.25) (EC 3.1.3.7) (Golgi 3-prime phosphoadenosine 5-prime phosphate 3-prime phosphatase) (Golgi-resident PAP phosphatase) (gPAPP) (Inositol monophosphatase domain-containing protein 1) (Inositol-1(or 4)- monophosphatase 3) (Myo-inositol monophosphatase A3) IMPAD1 IMPA3 359 Q01628 IFM3_HUMAN Interferon-induced transmembrane protein 3 (Dispanin subfamily A member 2b) (DSPA2b) (Interferon-inducible protein 1-8U) IFITM3 133 Q9NQX7 ITM2C_HUMAN Integral membrane protein 2C (Cerebral protein 14) (Transmembrane protein BRI3) [Cleared into: CT-BRI3] ITM2C BRI3 hucep-14 NPD018 PSEC0047 267 043736 ITM2A_HUMAN Integral membrane protein 2A (Protein E25) ITM2A UNQ603/PRO1189 263 Q6NSJ0 K1161_HUMAN Uncharacterized family 31 glucosidase KIAA1161 (EC 3.2.1.-) KIAA1161 714 Q9Y287 ITM2B_HUMAN Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C-terminal peptide) (P23 peptide)] ITM2B BRI BRI2 266 Q9NZS2 KLRF1_HUMAN Killer cell lectin-like receptor subfamily F member 1 (Lectin-like receptor F1) (Activating coreceptor NKp80) (C-type lectin domain family 5 member C) KLRF1 CLEC5C ML 232 P23276 KELL_HUMAN Kell blood group glycoprotein (EC 3.4.24.-) (CD antigen CD238) KEL 732 Q5H943 KKLC1_HUMAN Kita-kyushu lung cancer antigen 1 (KK-LC-1) (Cancer/testis antigen 83) CT83CXorf61 KKLC1 113 Q13241 KLRD1_HUMAN Natural killer cells antigen CD94 (KP43) (Killer cell lectin-like receptor subfamily D member 1) (NK cell receptor) (CD antigen CD94) KLRD1 CD94 179 Q8N3Y3 LARG2_HUMAN Glycosyltransferase-like protein LARGE2 (EC 2.4.-.-) (Glycosyltransferase-like 1B) [Includes: Xylosyltransferase LARGE2 (EC 2.4.2.-); Beta-1,3-glucuronyltransferase LARGE2 (EC 2.4.1.-)] GYLTL1B LARGE2 PP5656 721 Q12918 KLRB1_HUMAN Killer cell lectin-like receptor subfamily B member 1 (C-type lectin domain family 5 member B) (HNKR-P1a) (NKR-P1A) (Natural killer cell surface protein P1A) (CD antigen CD161) KLRB1 CLEC5B NKRP1A 225 2018-03-20Date Re^ue/Date Received 2023-02-27 Q96E93 KLRG1_HUMAN Killer cell lectin-like receptor subfamily G member 1 (C-type lectin domain family 15 member A) (ITIM-containing receptor MAFA-L) (MAFA-like receptor) (Mast cell function-associated antigen) KLRG1 CLEC15A MAFA MAFAL 195 Q9UIQ6 LCAP_HUMAN Leucyl-cystinyl aminopeptidase (Cystinyl aminopeptidase) (EC 3.4.11.3) (Insulin-regulated membrane aminopeptidase) (Insulin-responsive aminopeptidase) (IRAP) (Oxytocinase) (OTase) (Placental leucine aminopeptidase) (P-LAP) [Cleaved into: Leucyl-cystinyl aminopeptidase, pregnancy serum form] LNPEP OTASE 1025 095461 LARGE_HUMAN Glycosyltransferase-like protein LARGE1 (EC 2.4.-.-) (Acetylglucosaminyltransferase-like 1A) [Includes: Xylosyltransferase LARGE (EC 2.4.2.-); Beta-1,3-glucuronyltransferase LARGE (EC 2.4.1.-)] LARGE KIAA0609 LARGE1 756 D3W0D1 KLRF2_HUMAN Killer cell lectin-like receptor subfamily F member 2 (Lectin-like receptor F2) (Activating coreceptor NKp65) KLRF2 207 Q86UP2 KTN1_HUMAN Kinectin (CG-1 antigen) (Kinesin receptor) KTN1 CG1 KIAA0004 1357 P42167 LAP2B_HUMAN Lamina-associated polypeptide 2, isoforms beta/gamma (Thymopoietin, isoforms beta/gamma) (TP beta/gamma) (Thymopoietin-related peptide isoforms beta/gamma) (TPRP isoforms beta/gamma) [Cleaved into: Thymopoietin (TP) (Splenin); Thymopentin (TP5)] TMPC LAP2 454 Q8NES3 LFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe (EC 2.4.1.222) (O-fucosylpeptide 3- beta-N-acetylglucosaminyltransferase) LFNG 379 Q96AG4 LRC59_HUMAN Leucine-rich repeat-containing protein 59 (Ribosome-binding protein p34) (p34) LRRC59 PRO1855 307 Q5SRI9 MANEA.HUMAN Glycoprotein endo-alpha-1,2-mannosidase (Endo-alpha mannosidase) (Endomannosidase) (hEndo) (EC 3.2.1.130) (Mandaselin) MANEA 462 Q5VSG8 MANELHUMAN Glycoprotein endo-alpha-1,2-mannosidase-like protein (EC 3.2.1.-) MANEAL 457 Q5VT66 MARC1_HUMAN Mitochondrial amidoxime-reducing component 1 (mARC1) (EC 1.-.-.-) (Molybdenum cofactor sulfurase C-terminal domain-containing protein 1) (MOSC domain-containing protein 1) (Moco sulfurase C-terminal domain-containing protein 1) MARC1 MOSC1 337 Q9UKM7 MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase (EC 3.2.1.113) (ER alpha-1,2-mannosidase) (ER mannosidase 1) (ERManl) (Man9GlcNAc2-spedfic-processing alpha-mannosidase) (Mannosidase alpha class 1B member 1) MAN1B1 UNQ747/PRO1477 699 Q16706 MA2A1_HUMAN Alpha-mannosidase 2 (EC 3.2.1.114) (Golgi alpha-mannosidase II) (AMan II) (Man II) (Mannosidase alpha class 2A member 1) (Mannosyl-oligosaccharide 1,3-1,6-alphamannosidase) MAN2A1 MANA2 1144 P49641 MA2A2_HUMAN Alpha-mannosidase 2x (EC 3.2.1.114) (Alpha-mannosidase llx) (Man llx) (Mannosidase alpha class 2A member 2) (Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) MAN2A2MANA2X 1150 P33908 MA1A1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (EC 3.2.1.113) (Man(9)-alphamannosidase) (Man9-mannosidase) (Mannosidase alpha class 1A member 1) (Processing MAN1A1 653 2018-03-20Date Re^ue/Date Received 2023-02-27 alpha-1,2-mannosidase IA) (Alpha-1,2-mannosidase IA) 060476 MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidaselB (EC 3.2.1.113) (Mannosidase alpha class 1A member 2) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB) MAN1A2 MAN1B 641 Q9NR34 MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC (EC 3.2.1.113) (HMIC) (Mannosidase alpha class 1C member 1) (Processing alpha-1,2-mannosidase IC) (Alpha-1,2-mannosidase IC) MAN1C1 MAN1A3 MAN1C 630 Q9UEW3 MARCO_HUMAN Macrophage receptor MARCO (Macrophage receptor with collagenous structure) (Scavenger receptor class A member 2) MARCO SCARA2 520 000587 MFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase manic fringe (EC 2.4.1.222) (O-fucosylpeptide 3-betaN-acetylglucosaminyltransferase) MFNG 321 Q09327 MGAT3_HUMAN Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase (EC 2.4.1.144) (Nglycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III) (GNT-III) (GIcNAc-T III) (N-acetylglucosaminyltransferase III) MGAT3GGNT3 533 Q3V5L5 MGT5B„HUMAN Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B (EC 2.4.1.-) (EC 2.4.1.155) (Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B) (GIcNAc-T Vb) (GNTVb) (hGnTVb) (Mannoside acetylglucosaminyltransferase 5B) (N-acetylglucosaminyl-transferase Vb) (N-acetylglucosaminyltransferase IX) (GNT-IX) MGAT5B KIAA2008 792 Q8IX19 MCEM1_HUMAN Mast cell-expressed membrane protein 1 MCEMP1 C19orf59 187 043451 MGA_HUMAN Maltase-glucoamylase, intestinal [Includes: Maltase (EC 3.2.1.20) (Alpha-glucosidase); Glucoamylase (EC 3.2.1.3) (Glucan 1,4-alpha-glucosidase)] MGAM MGA MGAML 1857 Q9UBM8 MGT4C_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C (EC 2.4.1.145) (Nacetylglucosaminyltransferase IV homolog) (hGnT-IV-H) (N-glycosyl-oligosaccharideglycoprotein N-acetylglucosaminyltransferase IVc) (GIcNAc-T IVc) (GnT-IVc) (Nacetylglucosaminyitransferase IVc) (UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta- 1,4-N-acetylglucosaminyltransferase IVc) MGAT4C 478 Q10469 MGAT2_HUMAN Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (EC 2.4.1.143) (Beta- 1,2-N-acetylglucosaminyltransferase II) (GIcNAc-T II) (GNT-II) (Mannoside acetylglucosaminyltransferase 2) (N-glycosyl-oligosaccharide-glycoprotein Nacetylglucosaminyltransferase II) MGAT2 447 P26572 MGAT1_HUMAN Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (EC 2.4.1.101) (Nglycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I) (GNT-I) (GIcNAc-T I) MGAT1 GGNT1 GLCT1 GLYT1 MGAT 445 Q9UM21 MGT4A_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A (EC 2.4.1.145) (Nglycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa) (GIcNAc-T IVa) (GnT-IVaj (N-acetylglucosaminyltransferase IVa) (UDP-N-acetylglucosamine: alpha-1,3-Dmannoside beta-1,4-N-acetylglucosaminyltransferase IVa) [Cleaved into: Alpha-1,3-mannosylMGAT4A 535 2018-03-20Date Re^ue/Date Received 2023-02-27 glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form] Q9UQ53 MGT4B_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B (EC 2.4.1.145) (Nglycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb) (GIcNAc-T IVb) (GnT-IVb) (N-acetylglucosaminyltransferase IVb) (UDP-N-acetylglucosamine: alpha-1,3-Dmannoside beta-1,4-N-acetylglucosaminyltransferase IVb) MGAT4B UNQ906/PRO1927 548 Q9BY79 MFRP_HUMAN Membrane frizzled-related protein (Membrane-type frizzled-related protein) MFRP 579 Q495T6 MMEL1_HUMAN Membrane metallo-endopeptidase4ike 1 (EC 3.4.24.11) (Membrane metallo-endopeptidase4ike 2) (NEP2(m)) (Neprilysin II) (NEPII) (Neprilysin-2) (NEP2) (NL2) [Cleaved into: Membrane metallo-endopeptidase-like 1, soluble form (Neprilysin-2 secreted) (NEP2(s))l MMEL1 MELL1 MMEL2 NEP2 779 075900 MMP23_HUMAN Matrix metalloproteinase-23 (MMP-23) (EC 3.4.24.-) (Femalysin) (MIFR-1) (Matrix metalloproteinase-21) (MMP-21) (Matrix metalloproteinase-22) (MMP-22) [Cleaved into: Matrix metalloproteinase-23, soluble form) MMP23A MMP21; MMP23B MMP21 MMP22 390 Q09328 MGT5A_HUMAN Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A (EC 2.4.1.155) (Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase) (GIcNAc-T V) (GNT-V) (Mannoside acetylglucosaminyltransferase 5) (N-acetylglucosaminyl-transferase V) MGAT5GGNT5 741 Q13724 MOGS_HUMAN Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106) (Processing A-glucosidase I) MOGSGCS1 837 P21757 MSRE_HUMAN Macrophage scavenger receptor types I and II (Macrophage acetylated LDL receptor I and II) (Scavenger receptor class A member 1) (CD antigen CD204) MSR1 SCARA1 451 Q9NZM1 MYOF_HUMAN Myoferlin (Fer-1-like protein 3) MYOF FER1L3 KIAA1207 2061 Q58DX5 NADL2_HUMAN Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 (NAALADase L2) NAALADL2 795 Q9Y3Q0 NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 (EC 3.4.17.21) (Glutamate carboxypeptidase III) (GCPIII) (N-acetylated-alpha-linked acidic dipeptidase II) (NAALADase II) NAALAD2 740 095803 NDST3_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 (EC 2.8.2.8) (Glucosaminyl Ndeacetylase/N-sulfotransferase 3) (NDST-3) (hNDST-3) (N-heparan sulfate sulfotransferase 3) (N-HSST 3) [Includes: Heparan sulfate N-deacetylase 3 (EC 3.-.-.-); Heparan sulfate Nsulfotransferase 3 (EC 2.8.2.-)! NDST3 HSST3 UNQ2544/PRO4998 873 Q9UQQ1 NALDL_HUMAN N-acetylated-alpha-linked acidic dipeptidase-like protein (NAALADase L) (EC 3.4.17.21) (100 kDa ileum brush border membrane protein) (MOO) (Ileal dipeptidylpeptidase) NAALADL1 NAALADASEL NAALADL 740 Q9UHE5 NAT8.HUMAN N-acetyltransferase 8 (EC 2.3.1.-) (Acetyltransferase 2) (ATase2) (Camello-like protein 1) (Cysteinyl-conjugate N-acetyltransferase) (CCNAT) (EC 2.3.1.80) NAT8CML1 GLA TSC501 227 Q6PIU2 NCEH1_HUMAN Neutral cholesterol ester hydrolase 1 (NCEH) (EC 3.1.1.-) (Arylacetamide deacetylase-like 1) NCEH1 AADACL1 KIAA1363 408 2018-03-20Date Re^ue/Date Received 2023-02-27 P52848 NDST1_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 (EC 2.8.2.8) (Glucosaminyl Ndeacetylase/N-sulfotransferase 1) (NDST-1) (N-heparan sulfate sulfotransferase 1) (N-HSST 1) ([Heparan sulfate]-glucosamine N-sulfotransferase 1) (HSNST 1) [Includes: Heparan sulfate Ndeacetylase 1 (EC 3.-.-.-); Heparan sulfate N-sulfotransferase 1 (EC 2.8.2.-)] NDST1 HSST HSST1 882 P52849 NDST2_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 (EC 2.8.2.8) (Glucosaminyl Ndeacetylase/N-sulfotransferase 2) (NDST-2) (N-heparan sulfate sulfotransferase 2) (N-HSST 2) [Includes: Heparan sulfate N-deacetylase 2 (EC 3.-.-.-); Heparan sulfate N-sulfotransferase 2 (EC 2.8.2.-)] NDST2 HSST2 883 Q9H3R1 NDST4_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 (EC 2.8.2.8) (Glucosaminyl Ndeacetylase/N-sulfotransferase 4) (NDST-4) (N-heparan sulfate sulfotransferase 4) (N-HSST 4) [Includes: Heparan sulfate N-deacetylase 4 (EC 3.-.-.-); Heparan sulfate N-sulfotransferase 4 (EC 2.8.2.-)] NDST4 HSST4 872 P26717 NKG2C_HUMAN NKG2-C type II integral membrane protein (CD159 antigen-like family member C) (NK cell receptor C) (NKG2-C-activating NK receptor) (CD antigen CD159c) KLRC2 NKG2C 231 P26718 NKG2D_HUMAN NKG2-D type II integral membrane protein (Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NKG2-D-activating NK receptor) (CD antigen CD314) KLRK1 D12S2489E NKG2D 216 Q9UHF3 NAT8B_HUMAN Putative N-acetyltransferase 8B (EC 2.3.1.-) (Acetyltransferase 1) (ATasel) (Camello-like protein 2) NAT8BCML2 227 P08473 NEP_HUMAN Neprilysin (EC 3.4.24.11) (Atriopeptidase) (Common acute lymphocytic leukemia antigen) (CALLA) (Enkephalinase) (Neutral endopeptidase 24.11) (NEP) (Neutral endopeptidase) (Skin fibroblast elastase) (SFE) (CD antigen CD10) MME EPN 750 P26715 NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein (CD159 antigen-like family member A) (NK cell receptor A) (NKG2-A/B-activating NK receptor) (CD antigen CD159a) KLRC1 NKG2A 233 Q14494 NF2L1_HUMAN Nuclear factor erythroid 2-related factor 1 (NF-E2-related factor 1) (NFE2-related factor 1) (Locus control region-factor 1) (Nuclear factor, erythroid derived 2, like 1) (Transcription factor 11) (TCF-11) (Transcription factor HBZ17) (Transcription factor LCR-F1) NFE2L1 HBZ17 NRF1 TCF11 772 043908 NKG2F_HUMAN NKG2-F type II integral membrane protein (NK cell receptor F) (NKG2-F-activating NK receptor) KLRC4 NKG2F 158 P42857 NSG1_HUMAN Neuron-specific protein family member 1 (Brain neuron cytoplasmic protein 1) NSG1 D4S234 185 Q07444 NKG2E_HUMAN NKG2-E type II integral membrane protein (NK cell receptor E) (NKG2-E-activating NK receptor) KLRC3 NKG2E 240 Q9Y328 NSG2_HUMAN Neuron-specific protein family member 2 (Protein p19) (Hmp19) NSG2 171 095502 NPTXR_HUMAN Neuronal pentraxin receptor NPTXR 500 Q6PK18 OGFD3_HUMAN 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3 (EC 1.14.11.-) OGFOD3C17orf101 319 Q9NXG6 P4HTM_HUMAN Transmembrane prolyl 4-hydroxylase (P4H-TM) (EC 1.14.11.-) (Hypoxia-inducible factor prolyl P4HTM PH4 502 2018-03-20Date Re^ue/Date Received 2023-02-27 hydroxylase 4) (HIF-PH4) (HIF-prolyl hydroxylase 4) (HPH-4) Q9HC10 OTOF_HUMAN Otoferlin (Fer-1-like protein 2) OTOF FER1L2 1997 P78380 0LR1_HUMAN Oxidized low-density lipoprotein receptor 1 (Ox-LDL receptor 1) (C-type lectin domain family 8 member A) (Lectin-like oxidized LDL receptor 1) (LOX-1) (Lectin-like oxLDL receptor 1) (hLOX- 1) (Lectin-type oxidized LDL receptor 1) [Cleaved into: Oxidized low-density lipoprotein receptor 1, soluble form] 0LR1 CLEC8A L0X1 273 Q8NF37 PCAT1_HUMAN Lysophosphatidylcholine acyltransferase 1 (LPC acyltransferase 1) (LPCAT-1) (LysoPC acyltransferase 1) (EC 2.3.1.23) (1-acylglycerophosphocholine O-acyltransferase) (1- alkylglycerophosphocholine O-acetyltransferase) (EC 2.3.1.67) (Acetyl-CoA:lyso-plateletactivating factor acetyltransferase) (Acetyl-CoA:lyso-PAF acetyltransferase) (Lyso-PAF acetyltransferase) (LysoPAFAT) (Acyltransferase-like 2) (Phosphonoformate immuno-associated protein 3) LPCAT1 AYTL2 PFAAP3 534 Q7L5N7 PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 (LPC acyltransferase 2) (LPCAT-2) (LysoPC acyltransferase 2) (EC 2.3.1.23) (1-acylglycerol-3-phosphate O-acyltransferase 11) (1-AGP acyltransferase 11) (1-AGPAT 11) (EC 2.3.1.51) (1-acylglycerophosphocholine 0- acyltransferase) (1-alkylglycerophosphocholine O-acetyltransferase) (EC 2.3.1.67) (AcetylCoA:lyso-platelet-activating factor acetyltransferase) (Acetyl-CoA:lyso-PAF acetyltransferase) (Lyso-PAF acetyltransferase) (LysoPAFAT) (Acyltransferase-like 1) (Lysophosphatidic acid acyltransferase alpha) (LPAAT-alpha) LPCAT2AGPAT11 AYTL1 544 Q7Z412 PEX26_HUMAN Peroxisome assembly protein 26 (Peroxin-26) PEX26 305 Q9NST1 PLPL3_HUMAN Patatin-like phospholipase domain-containing protein 3 (EC 3.1.1.3) (Acylglycerol 0- acyltransferase) (EC 2.3.1.-) (Adiponutrin) (Calcium-independent phospholipase A2-epsilon) (iPLA2-epsilon) PNPLA3ADPN C22orf20 481 Q9NRQ2 PLS4_HUMAN Phospholipid scramblase 4 (PL scramblase 4) (Ca(2+)-dependent phospholipid scramblase 4) (Cell growth-inhibiting gene 43 protein) (TRA1) PLSCR4GIG43 329 P78562 PHEXHUMAN Phosphate-regulating neutral endopeptidase (EC 3.4.24.-) (Metalloendopeptidase homolog PEX) (Vitamin D-resistant hypophosphatemic rickets protein) (X-linked hypophosphatemia protein) (HYP) PHEX PEX 749 015162 PLS1_HUMAN Phospholipid scramblase 1 (PL scramblase 1) (Ca(2+)-dependent phospholipid scramblase 1) (Erythrocyte phospholipid scramblase) (MmTRAIb) PLSCR1 318 Q8NAT1 PMGT2_HUMAN Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 (P0MGnT2) (EC 2.4.1.-) (Extracellular O-linked N-acetylglucosamine transferase-like) (Glycosyltransferase-like domain¬ containing protein 2) POMGNT2AGO61 C3orf39 EOGTL GTDC2 580 Q8IV08 PLD3_HUMAN Phospholipase D3 (PLD 3) (EC 3.1.4.4) (Choline phosphatase 3) (Hindi11 K4L homolog) (Hu-K4) PLD3 490 2018-03-20Date Re^ue/Date Received 2023-02-27 (Phosphatidylcholine-hydrolyzing phospholipase D3) Q9NRY6 PLS3_HUMAN Phospholipid scramblase 3 (PL scramblase 3) (Ca(2+)-dependent phospholipid scramblase 3) PLSCR3 295 Q9NRY7 PLS2_HUMAN Phospholipid scramblase 2 (PL scramblase 2) (Ca(2+)-dependent phospholipid scramblase 2) PLSCR2 297 Q96AD5 PLPL2_HUMAN Patatin-like phospholipase domain-containing protein 2 (EC 3.1.1.3) (Adipose triglyceride lipase) (Calcium-independent phospholipase A2) (Desnutrin) (IPLA2-zeta) (Pigment epithelium-derived factor) (TTS2.2) (Transport-secretion protein 2) (TTS2) PNPLA2ATGL FP17548 504 Q9BX97 PLVAP_HUMAN Plasmalemma vesicle-associated protein (Fenestrated endothelial-linked structure protein) (Plasmalemma vesicle protein 1) (PV-1) PLVAP FELS PV1 442 Q8WZA1 PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 (POMGnTI) (EC 2.4.1.-) (UDP-GlcNAc:alpha-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I.2) (GnT I.2) POMGNT1 MGAT1.2 UNQ746/PRO1475 660 Q8TE99 PXYP1_HUMAN 2-phosphoxylose phosphatase 1 (EC 3.1.3.-) (Acid phosphatase-like protein 2) (Xylosyl phosphatase) (epididymis luminal protein 124) PXYLP1 ACPL2 HEL124XYLP UNQ370/PRO706 480 Q8TC12 RDH11_HUMAN Retinol dehydrogenase 11 (EC 1.1.1.300) (Androgen-regulated short-chain dehydrogenase/reductase 1) (HCV core-binding protein HCBP12) (Prostate short-chain dehydrogenase/reductase 1) (Retinal reductase 1) (RalRI) (Short chain dehydrogenase/reductase family 7C member 1) RDH11ARSDR1 PSDR1 SDR7C1 CGI- 82 318 Q9Y644 RFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase radical fringe (EC 2.4.1.222) (O-fucosylpeptide 3- beta-N-acetylglucosaminyltransferase) RFNG 331 Q6AZY7 SCAR3_HUMAN Scavenger receptor class A member 3 (Cellular stress response gene protein) SCARA3CSR 606 Q6ZMJ2 SCAR5_HUMAN Scavenger receptor class A member 5 (Scavenger receptor hlg) SCARA5 UNQ2938/PRO28700 495 P67812 SC11A_HUMAN Signal peptidase complex catalytic subunit SEC11A (EC 3.4.21.89) (Endopeptidase SP18) (Microsomal signal peptidase 18 kDa subunit) (SPase 18 kDa subunit) (SEC11 homolog A) (SEC11-like protein 1) (SPC18) SEC11ASEC11L1 SPC18SPCS4A 179 Q9BY50 SC11C_HUMAN Signal peptidase complex catalytic subunit SEC11C (EC 3.4.21.89) (Microsomal signal peptidase 21 kDa subunit) (SPase 21 kDa subunit) (SEC11 homolog C) (SEC11-like protein 3) (SPC21) SEC11CSEC11L3 SPC21 SPCS4C 192 Q8IXA5 SACA3_HUMAN Sperm acrosome membrane-associated protein 3 (Cancer/testis antigen 54) (CT54) (Lysozyme¬ like acrosomal sperm-specific secretory protein ALLP-17) (Lysozyme-like protein 3) (Sperm lysozyme-like protein 1) (Sperm protein reactive with antisperm antibodies) (Sperm protein reactive with ASA) [Cleaved into: Sperm acrosome membrane-associated protein 3, membrane form; Sperm acrosome membrane-associated protein 3, processed form] SPACA3 LYC3 LYZL3 SLLP1 SPRASA UNQ424/PRO862 215 P0C7V7 SC11B_HUMAN Putative signal peptidase complex catalytic subunit SEC11B (EC 3.4.21.89) (SEC11 homolog B) SEC11BSEC11L2 166 2018-03-20Date Re^ue/Date Received 2023-02-27 (SEC11-like protein 2) SPCS4B Q9NSC7 SIA7A_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 (EC 2.4.99.3) (GalNAc alpha-2,6- sialyltransferase I) (ST6GaiNAc I) (ST6GalNAcl) (Sialyltransferase 7A) (SIAT7-A) ST6GALNAC1 SIAT7A UNQ543/PRO848 600 Q9H4F1 SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminlde alpha-2,6- sialyltransferase (EC 2.4.99.7) (NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6- sialyltransferase) (ST6GalNAc IV) (ST6GalNAclV) (Sialyltransferase 3C) (SIAT3-C) (Sialyltransferase 7D) (SIAT7-D) ST6GALNAC4 SIAT3C SIAT7D 302 Q92186 SIA8B_HUMAN Alpha-2,8-sialyltransferase 8B (EC 2.4.99.-) (Sialyltransferase 8B) (SIAT8-B) (Sialyltransferase St8Sia II) (ST8Siall) (Sialyltransferase X) (STX) ST8SIA2 SIAT8B STX 375 P15907 SIAT1_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 1 (Alpha 2,6-ST 1) (EC 2.4.99.1) (B-cell antigen CD75) (CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1) (ST6Gal I) (ST6Gall) (Sialyltransferase 1) ST6GAL1 SIAT1 406 Q16585 SGCB_HUMAN Beta-sarcoglycan (Beta-SG) (43 kDa dystrophin-associated glycoprotein) (43DAG) (A3b) SGCB 318 Q13326 SGCG_HUMAN Gamma-sarcoglycan (Gamma-SG) (35 kDa dystrophin-associated glycoprotein) (35DAG) SGCG 291 Q96LD1 SGCZ_HUMAN Zeta-sarcoglycan (Zeta-SG) (ZSG1) SGCZ 299 Q92185 SIA8A_HUMAN Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase (EC 2.4.99.8) (Alpha-2,8-sialyltransferase 8A) (Ganglioside GD3 synthase) (Ganglioside GT3 synthase) (Sialyltransferase 8A) (SIAT8-A) (Sialyltransferase St8Sia 1) (ST8Sial) ST8SIA1 SIAT8 SIAT8A 356 Q92187 SIA8D_HUMAN CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase (EC 2.4.99.-) (Alpha-2,8- sialyltransferase 8D) (Polysialyltransferase-1) (Sialyltransferase 8D) (SIAT8-D) (Sialyltransferase St8Sia IV) (ST8SialV) ST8SIA4 PST PST1 SIAT8D 359 P61647 SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F (EC 2.4.99.-) (Sialyltransferase 8F) (SIAT8-F) (Sialyltransferase St8SiaVI)(ST8SiaVI) ST8SIA6 SIAT8F 398 Q96JF0 SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 (Alpha 2,6-ST 2) (EC 2.4.99.1) (CMP-Nacetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2) (ST6Gal II) (ST6Galll) (hST6Gal II) (Sialyltransferase 2) ST6GAL2 KIAA1877 SIAT2 529 A6NLE4 SIM23_HUMAN Small integral membrane protein 23 SMIM23C5orf50 156 Q07837 SLC31_HUMAN Neutral and basic amino acid transport protein rBAT (NBAT) (D2h) (Solute carrier family 3 member 1) (b(0,+)-type amino acid transport protein) SLC3A1 RBAT 685 043173 SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase (EC 2.4.99.-) (Alpha-2,8- sialyltransferase 8C) (Alpha-2,8-sialyltransferase III) (ST8 alpha-N-acetyl-neuraminide alpha-2,8- sialyltransferase 3) (Sialyltransferase 8C) (SIAT8-C) (Sialyltransferase St8Sia III) (ST8Sialll) ST8SIA3 SIAT8C 380 2018-03-20Date Re^ue/Date Received 2023-02-27 Q11201 SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 (Alpha2,3-ST 1) (Beta-galactoside alpha-2,3-sialyltransferase 1) (EC 2.4.99.4) (Gal-NAc6S) (Gal-beta-1,3- GalNAc-alpha-2,3-sialyltransferase) (SIATFL) (ST3Gal I) (ST3Gall) (ST3GalA.1) (ST3O) (Sialyltransferase 4A) (SIAT4-A) ST3GAL1 SIAT4 SIAT4A 340 Q969X2 SIA7F_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (EC 2.4.99.-) (GalNAc alpha-2,6- sialyltransferase VI) (ST6GalNAc VI) (ST6GalNAcVI) (hST6GalNAc VI) (Sialyltransferase 7F) (SIAT7-F) ST6GALNAC6 SIAT7F UNQ708/PRO1359 333 Q9UNP4 SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase (EC 2.4.99.9) (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase) (Ganglioside GM3 synthase) (ST3Gal V) (ST3GalV) (Sialyltransferase 9) ST3GAL5SIAT9 UNQ2510/PRO5998 418 Q9H5K3 SG196_HUMAN Protein 0-mannose kinase (POMK) (EC 2.7.1.183) (Protein kinase-like protein SgK196) (Sugen kinase 196) POMKSGK196 350 Q9Y274 SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase (EC 2.4.99.-) (CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI) (ST3Gal VI) (ST3GalVI) (Sialyltransferase 10) ST3GAL6SIAT10 331 Q16842 SIA4B_HUMAN CMP-N-acetylneuraminate-bete-galactosamide-alpha-2,3-sialyltransferase 2 (Alpha 2,3-ST 2) (Beta-galactoside alpha-2,3-sialyltransferase 2) (EC 2.4.99.4) (Gal-NAc6S) (Gal-beta-1,3- GalNAc-alpha-2,3-sialyltransferase) (ST3Gal II) (ST3Galll) (ST3GalA.2) (Sialyltransferase 4B) (SIAT4-B) ST3GAL2SIAT4B 350 Q11206 SIA4CHUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (Alpha 2,3-ST 4) (Beta-galactoside alpha-2,3-sialyltransferase 4) (EC 2.4.99.-) (Alpha 2,3-sialyltransferase IV) (Gal-NAc6S) (Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase) (SAT-3) (ST-4) (ST3Gal IV) (ST3GallV) (ST3GalA.2) (STZ) (Sialyltransferase 4C) (SIAT4-C) ST3GAL4CGS23 NANTA3SIAT4C STZ 333 Q9UJ37 SIA7B_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 (EC 2.4.99.-) (GalNAc alpha-2,6- sialyltransferase II) (ST6GalNAc II) (ST6GalNAcll) (SThM) (Sialyltransferase 7B) (SIAT7-B) ST6GALNAC2 SIAT7BSIATL1 STHM 374 Q9BVH7 SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 (EC 2.4.99.-) (GD1 alpha synthase) (GalNAc alpha-2,6-sialyltransferase V) (ST6GalNAc V) (ST6GalNAcV) (Sialyltransferase 7E) (SIAT7-E) ST6GALNAC5 SIAT7E 336 Q11203 SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (EC 2.4.99.6) (Beta¬ galactoside alpha-2,3-sialyltransferase 3) (Alpha 2,3-ST 3) (Gal beta-1,3(4) GIcNAc alpha-2,3 sialyltransferase) (N-acetyllactosaminide alpha-2,3-sialyltransferase) (ST3Gal III) (ST3Gallll) (ST3N) (Sialyltransferase 6) ST3GAL3SIAT6 375 Q12884 SEPRHUMAN Prolyl endopeptidase FAP (EC 3.4.21.26) (170 kDa melanoma membrane-bound gelatinase) (Dipeptidyl peptidase FAP) (EC 3.4.14.5) (Fibroblast activation protein alpha) (FAPalpha) (Gelatine degradation protease FAP) (EC 3.4.21.-) (Integral membrane serine protease) (PostFAP 760 2018-03-20Date Re^ue/Date Received 2023-02-27 proline cleaving enzyme) (Serine integral membrane protease) (SIMP) (Surface-expressed protease) (Seprase) [Cleaved into: Antiplasmin-deaving enzyme FAP, soluble form (APCE) (EC 3.4.14.5) (EC 3.4.21.-) (EC 3.4.21.26)] Q8NDV1 SIA7C_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 (EC 2.4.99.-) (GalNAc alpha-2,6- sialyltransferase III) (ST6GalNAc III) (ST6GalNAclII) (STY) (Sialyltransferase 7C) (SIAT7-C) ST6GALNAC3 SIAT7C UNQ2787/PRO7177 305 015466 SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E (EC 2.4.99.-) (Sialyltransferase 8E) (SIAT8-E) (Sialyltransferase St8Sia V) (ST8SiaV) ST8SIA5 SIAT8E 376 Q92629 SGCD_HUMAN Delta-sarcoglycan (Delta-SG) (35 kDa dystrophin-associated glycoprotein) (35DAG) SGCD 289 Q86WD7 SPA9_HUMAN Serpin A9 (Centerin) (Germinal center B-cell-expressed transcript 1 protein) SERPINA9GCET1 SERPINA11 UNQ692/PRO1337 417 P61009 SPCS3_HUMAN Signal peptidase complex subunit 3 (EC 3.4.-.-) (Microsomal signal peptidase 22/23 kDa subunit) (SPC22/23) (SPase 22/23 kDa subunit) SPCS3SPC22 UNQ1841/PRO3567 180 Q9UH99 SUN2_HUMAN SUN domain-containing protein 2 (Protein unc-84 homolog B) (Rab5-interacting protein) (Rab5IP) (Sad1/unc-84 protein-like 2) SUN2 FRIGG KIAA0668 RAB5IP UNC84B 717 Q9Y5Y6 ST14_HUMAN Suppressor of tumorigenicity 14 protein (EC 3.4.21.109) (Matriptase) (Membrane-type serine protease 1) (MT-SP1) (Prostamin) (Serine protease 14) (Serine protease TADG-15) (Tumorassociated differentially-expressed gene 15 protein) ST14PRSS14SNC19 TADG15 855 P14410 SUIS_HUMAN Sucrase-isomaltase, intestinal [Cleaved into: Sucrase (EC 3.2,1.48); Isomaltase (EC 3.2.1.10)] SI 1827 094901 SUN1_HUMAN SUN domain-containing protein 1 (Protein unc-84 homolog A) (Sad1/unc-84 protein-like 1) SUN1 KIAA0810 UNC84A 812 Q9NUM4 T106B_HUMAN Transmembrane protein 106B TMEM106B 274 Q9H7V2 SYNG1_HUMAN Synapse differentiation-inducing gene protein 1 (SynDIGI) (Dispanin subfamily C member 2) (DSPC2) (Transmembrane protein 90B) SYNDIG1 C20orf39 TMEM90B 258 P02786 TFR1_HUMAN Transferrin receptor protein 1 (TR) (TfR) (TfR1) (Trfr) (T9) (p90) (CD antigen CD71) [Cleaved into: Transferrin receptor protein 1, serum form (sTfR)l TFRC 760 Q9UP52 TFR2_HUMAN Transferrin receptor protein 2 (TfR2) TFR2 801 Q9NRS4 TMPS4_HUMAN Transmembrane protease serine 4 (EC 3.4.21.-) (Channel-activating protease 2) (CAPH2) (Membrane-type serine protease 2) (MT-SP2) TMPRSS4TMPRSS3 UNQ776/PRO1570 437 P50591 TNF10_HUMAN Tumor necrosis factor ligand superfamily member 10 (Apo-2 ligand) (Apo-2L) (TNF-related apoptosis-inducing ligand) (Protein TRAIL) (CD antigen CD253) TNFSF10APO2L TRAIL 281 043508 TNF12_HUMAN Tumor necrosis factor ligand superfamily member 12 (APO3 ligand) (TNF-related weak inducer TNFSF12APO3L 249 2018-03-20Date Re^ue/Date Received 2023-02-27 of apoptosis) (TWEAK) [Cleaved into: Tumor necrosis factor ligand superfamily member 12, membrane form; Tumor necrosis factor ligand superfamily member 12, secreted form) DR3LG UNQ181/PRO207 Q06643 TNFC_HUMAN Lymphotoxin-beta (LT-beta) (Tumor necrosis factor C) (TNF-C) (Tumor necrosis factor ligand superfamily member 3) LTB TNFCTNFSF3 244 P41273 TNFL9_HUMAN Tumor necrosis factor ligand superfamily member 9 (4-1BB ligand) (4-1BBL) TNFSF9 254 Q6ZMR5 TM11A_HUMAN Transmembrane protease serine 11A (EC 3.4.21.-) (Airway trypsin-like protease 1) (Epidermal type-ll transmembrane serine protease) (Esophageal cancer-susceptibility gene 1 protein) TMPRSS11AECRG1 HATL1 HESP 421 Q6ZWK6 TM11F_HUMAN Transmembrane protease serine 11F (EC 3.4.21.-) (Airway trypsin-like protease 4) TMPRSS11F HATL4 438 P23510 TNFL4_HUMAN Tumor necrosis factor ligand superfamily member 4 (Glycoprotein Gp34) (0X40 ligand) (OX40L) (TAX transcriptionally-activated glycoprotein 1) (CD antigen CD252) TNFSF4 TXGP1 183 P01375 TNFA_HUMAN Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form] TNFTNFATNFSF2 233 015393 TMPS2_HUMAN Transmembrane protease serine 2 (EC 3,4.21.-) (Serine protease 10) [Cleaved into: Transmembrane protease serine 2 non-catalytic chain; Transmembrane protease serine 2 catalytic chain] TMPRSS2 PRSS10 492 Q9H3S3 TMPS5_HUMAN Transmembrane protease serine 5 (EC 3.4.21.-) (Spinesin) TMPRSS5 457 Q7RTY8 TMPS7_HUMAN Transmembrane protease serine 7 (EC 3.4.21.-) (Matriptase-3) TMPRSS7 843 043557 TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 (Herpes virus entry mediator ligand) (HVEM-L) (Herpesvirus entry mediator ligand) (CD antigen CD258) [Cleaved into: Tumor necrosis factor ligand superfamily member 14, membrane form; Tumor necrosis factor ligand superfamily member 14, soluble form] TNFSF14 HVEML LIGHT UNQ391/PRO726 240 P48023 TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 (Apoptosis antigen ligand) (APTL) (CD95 ligand) (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD antigen CD178) [Cleaved into: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble form (Receptor-binding FasL ectodomain) (Soluble Fas ligand) (sFasL); ADAM1O-processed FasL form (APL); FasL intracellular domain (FasL ICD) (SPPL2A-processed FasL form) (SPA)] FASLGAPT1LG1 CD95LFASLTNFSF6 281 Q86T26 TM11B_HUMAN Transmembrane protease serine 11B (EC 3.4.21.-) (Airway trypsin-like protease 5) TMPRSS11BHATL5 416 095150 TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 (TNF ligand-related molecule 1) (Vascular endothelial cell growth inhibitor) [Cleaved into: Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily member 15, secreted form] TNFSF15TL1 VEGI 251 2018-03-20Date Re^ue/Date Received 2023-02-27 Q9UL52 TM11E_HUMAN Transmembrane protease serine 11E (EC 3.4,21.-) (Serine protease DESC1) (Transmembrane protease serine 11E2) [Cleaved into: Transmembrane protease serine 11E non-catalytic chain; Transmembrane protease serine 11E catalytic chain] TMPRSS11EDESC1 TMPRSS11E2 UNQ742/PRO1461 423 Q8IU80 TMPS6_HUMAN Transmembrane protease serine 6 (EC 3.4.21.-) (Matriptase-2) TMPRSS6 UNQ354/PRO618 811 Q7Z410 TMPS9_HUMAN Transmembrane protease serine 9 (EC 3.4.21.-) (Polyserase-I) (Polyserine protease 1) (Polyserase-1) [Cleaved into: Serase-1; Serase-2; Serase-3] TMPRSS9 1059 Q9BYE2 TMPSD_HUMAN Transmembrane protease serine 13 (EC 3.4.21.-) (Membrane-type mosaic serine protease) (Mosaic serine protease) TMPRSS13 MSP TMPRSS11 586 014788 TNF11_HUMAN Tumor necrosis factor ligand superfamily member 11 (Osteoclast differentiation factor) (ODF) (Osteoprotegerin ligand) (OPGL) (Receptor activator of nuclear factor kappa-B ligand) (RANKL) (TNF-related activation-induced cytokine) (TRANCE) (CD antigen CD254) [Cleaved into: Tumor necrosis factor ligand superfamily member 11, membrane form; Tumor necrosis factor ligand superfamily member 11, soluble form] TNFSF110PGL RANKL TRANCE 317 060507 TPST1_HUMAN Protein-tyrosine sulfotransferase 1 (EC 2.8.2.20) (Tyrosylprotein sulfotransferase 1) (TPST-1) TPST1 370 060235 TM11D_HUMAN Transmembrane protease serine 11D (EC 3.4.21.-) (Airway trypsin-like protease) [Cleaved into: Transmembrane protease serine 11D non-catalytic chain; Transmembrane protease serine 11D catalytic chain] TMPRSS11D HAT 418 Q9Y2B1 TMEM5_HUMAN Transmembrane protein 5 TMEM5 443 P57727 TMPS3_HUMAN Transmembrane protease serine 3 (EC 3.4.21,-) (Serine protease TADG-12) (Tumor-associated differentially-expressed gene 12 protein) TMPRSS3 ECHOS1 TADG12 UNQ323/PRO382 454 Q9Y275 TN13B_HUMAN Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B-celiactivating factor) (BAFF) (Dendritic cell-derived TNF-like molecule) (TNF- and APOL-related leukocyte expressed ligand 1) (TALL-1) (CD antigen CD257) [Cleaved into: Tumor necrosis factor ligand superfamily member 13b, membrane form; Tumor necrosis factor ligand superfamily member 13b, soluble form] TNFSF13BBAFF BLYS TALL1 TNFSF20ZTNF4 UNQ401/PRO738 285 P32971 TNFL8_HUMAN Tumor necrosis factor ligand superfamily member 8 (CD30 ligand) (CD30-L) (CD antigen CD153) TNFSF8CD30L CD30LG 234 Q13061 TRDN_HUMAN Triadin TRDN 729 Q9UNG2 TNF18-HUMAN Tumor necrosis factor ligand superfamily member 18 (Activation-inducible TNF-related ligand) (AITRL) (Glucocorticoid-induced TNF-related ligand) (hGITRL) TNFSF18 AITRL GITRLTL6 UNQ149/PRO175 199 Q9H2S6 TNMD_HUMAN Tenomodulin (TeM) (hTeM) (Chondromodulin-1-like protein) (ChM1L) (hChMIL) TNMD CHM1L 317 2018-03-20Date Re^ue/Date Received 2023-02-27 (Chondromodulin-l-like protein) (Myodulin) (Tendin) UNQ771/PRO1565 060704 TPST2_HUMAN Protein-tyrosine sulfotransferase 2 (EC 2.8.2.20) (Tyrosylprotein sulfotransferase 2) (TPST-2) TPST2 377 Q9UKU6 TRHDE_HUMAN Thyrotropin-releasing hormone-degrading ectoenzyme (TRH-DE) (TRH-degrading ectoenzyme) (EC 3.4.19.6) (Pyroglutamyl-peptidase II) (PAP-II) (TRH-specific aminopeptidase) (Thyroliberinase) TRHDE UNQ2507/PRO5995 1024 Q9Y2C2 UST_HUMAN Uranyl 2-sulfotransferase (EC 2.8.2.-) UST DS2ST 406 Q8NBZ7 UXS1_HUMAN UDP-glucuronic add decarboxylase 1 (EC 4.1.1.35) (UDP-glucuronate decarboxylase 1) (UGD) (UXS-1) UXS1 UNQ2538/PRO6079 420 Q86Y38 XYLT1_HUMAN Xylosyltransferase 1 (EC 2.4.2.26) (Peptide O-xylosyltransferase 1) (Xylosyltransferase I) (XT-I) (XylT-l) XYLT1 XT1 959 P17861 XBP1_HUMAN X-box-binding protein 1 (XBP-1) (Tax-responsive element-binding protein 5) (TREB-5) [Cleaved into: X-box-binding protein 1, cytoplasmic form; X-boxbinding protein 1, luminal form] XBP1 TREB5XBP2 261 075063 XYLK_HUMAN Glycosaminoglycan xylosylkinase (EC 2.7.1.-) (Xylose kinase) FAM20B KIAA0475 409 Q8NBI6 XXLT1_HUMAN Xyloside xylosyltransferase 1 (EC 2.4.2.n3) (UDP-xylose:alpha-xyloside alpha-1,3- xylosyltransferase) XXYLT1 C3orf21 PSEC0251 393 Q9H1B5 XYLT2_HUMAN Xylosyltransferase 2 (EC 2.4.2.26) (Peptide O-xylosyltransferase 1) (Xylosyltransferase II) (XTII) (XylT-ll) XYLT2XT2 UNQ3058/PRO9878 865 A8MXE2 YI036_HUMAN Putative UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase LOC100288842 (EC 2.4.1.-) (Putative UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase LOC402377) (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 pseudogene) 369 Q5STJ7 Q5STJ7_HUMAN Hexosyltransferase (EC 2.4.1.-) B3GALT4 hCG_17511 378 A0A090N 7X6 A0A090N7X6_HUM AN Polypeptide N-acetylgdactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT11 hCG_1990637 tcag7.1057 608 Q5Q0U2 Q5Q0U2_HUMAN Fucosyltransferase 9 (EC 2.4.1.152) (Fucosyltransferase 9 (Alpha (1,3) fucosyltransferase), isoform CRA_a) (cDNA, FLJ95882, Homo sapiens fucosyltransferase 9 (alpha (1,3) fucosyltransferase) (FUT9), mRNA) FUT9 hCG_16703 359 A8K9Q8 A8K9Q8_HUMAN Hexosyltransferase (EC 2.4.1.-) hCG_2018639 384 A8K737 A8K737JHUMAN Fucosyltransferase (Fucosyltransferase 3 (Galactoside 3(4)-L-fucosyltransferase, Lewis blood group)) (cDNA FLJ78078, highly similar to Human alpha (1,3/1,4) fucosyltransferase (FUT3)) FUT3 hCG_1645372 361 G3V1S6 G3V1S6_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT2hCG_15927 533 Q58A54 Q58A54_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP GalNAc-T18 607 2018-03-20Date Re^ue/Date Received 2023-02-27 acetylgalactosaminyltransferase) GALNT18GALNTL4 hCG_1991780 A0A087W Y64 A0A087WY64_HUM AN Hexosyltransferase (EC 2.4.1.-) B3GALNT2 92 A3KLL5 A3KLL5_HUMAN Sodium/potassium-transporting ATPase subunit beta ATP1B1 hCG_37798 303 Q2L4S5 Q2L4S5_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT19 WBSCR17 hCG_19354tcag7.519 598 B7ZKW0 B7ZKW0_HUMAN Sodium/potassium-transporting ATPase subunit beta ATP1B4 314 Q9P1W6 Q9P1W6_HUMAN Alpha-(1,3/1,4)-fucosyltransferase (cDNA, FLJ94139, highly similar to Homo sapiens fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group included) (FUT3), mRNA) FUT3 361 A0A024R C48 A0A024RC48_HUM AN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT1 hCG^2042960 559 D3DNF9 D3DNF9_HUMAN Sodium/potassium-transporting ATPase subunit beta ATP1B3 hCG_19938 265 A0A024R BT1 A0A024RBT1_HUM AN Hexosyltransferase (EC 2.4.1.-) hCG_2016450 378 D3DQI7 D3DQI7_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT10 hCG_36809 506 B7Z5G5 B7Z5G5HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 527 B5B9M4 B5B9M4_HUMAN Fucosyltransferase FUT3 361 Q68VJ8 Q68VJ8_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT16GALNTL1 hCG_21969 558 E7EVF0 E7EVF0_HUMAN Hexosyltransferase (EC 2.4.1.-) B3GALNT1 91 B2R8J0 B2R8J0_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 633 C9J368 C9J368_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) B3GNT5 50 B2RC53 B2RC53_HUMAN cDNA, FLJ95856, highly similar to Homo sapiens fucosyltransferase 11 (alpha (1,3) fucosyltransferase) (FUT11), mRNA 492 A8KAJ7 A8KAJ7_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 559 Q8NHI0 Q8NHI0_HUMAN Hexosyltransferase (EC 2.4.1.-) 67 B4DIE4 B4DIE4_HUMAN Hexosyltransferase (EC 2.4.1.-) 91 2018-03-20Date Re^ue/Date Received 2023-02-27 B3KT16 B3KT16_HUMAN Polypeptide N-acetylgdactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 372 B7ZKV9 B7ZKV9_HUMAN Sodium/potassium-transporting ATPase subunit beta ATP1B4 322 Q6RC02 Q6RC02_HUMAN Hexosyltransferase (EC 2.4.1.-) 102 A0A087W V18 A0A087WV18_HUM AN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) WBSCR17 519 R4X5Z0 R4X5Z0_HUMAN Hexosyltransferase (EC 2.4.1.-) B3GALNT1 83 C9JGI4 C9JGI4_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT15 617 Q24JS2 Q24JS2_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT6 622 B7ZKV8 B7ZKV8_HUMAN Sodium/potassium-transporting ATPase subunit beta ATP1B4 357 I3L1V9 I3L1V9_HUMAN Sodium/potassium-transporting ATPase subunit beta (Fragment) ATP1B2 167 B4DLS4 B4DLS4_HUMAN cDNA FLJ55721, highly similar to Homo sapiens fucosyltransferase 10 (alpha (1,3) fucosyltransferase) (FUT10), mRNA 521 Q05BM8 Q05BM8_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT1 499 A0A087X1 A0A087X115_HUMA N Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNTL6 417 J3KNN1 J3KNN1_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT9 603 B3KTQ4 B3KTQ4_HUMAN Hexosyltransferase (EC 2.4.1.-) 331 B3KY85 B3KY85_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 556 E7EVS2 E7EVS2_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) B3GALNT1 111 B7Z9S8 B7Z9S8_HUMAN Sodium/potassium-transporting ATPase subunit beta 247 B3W6H0 B3W6H0_HUMAN Fucosyltransferase FUT3 361 B3GVC1 B3GVC1_HUMAN Fucosyltransferase FUT3 361 Q8TDY1 Q8TDY1_HUMAN Hexosyltransferase (EC 2.4.1.-) OK/KNS-cl.1 204 Q6P7E6 Q6P7E6_HUMAN Fucosyltransferase 6 (Alpha (1,3) fucosyltransferase) FUT6 359 F8VUJ3 F8VUJ3_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) POC1B-GALNT4 575 2018-03-20Date Re^ue/Date Received 2023-02-27 B3KNV8 B3KNV8_HUMAN Polypeptide N-acetylgdactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 607 Q7L9G8 Q7L9G8_HUMAN Hexosyltransferase (EC 2.4.1.-) 331 Q6RC00 Q6RC00_HUMAN Hexosyltransferase (EC 2.4.1.-) 331 M0QX58 M0QX58_HUMAN Hexosyltransferase (EC 2,4.1.-) (Fragment) B3GNT3 127 B4E056 B4E056_HUMAN cDNA FLJ56031, highly similar to Homo sapiens fucosyltransferase 10 (alpha (1,3) fucosyltransferase) (FUT10), mRNA 529 Q58A70 Q58A70_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GalNAc-T10 581 B3KQP5 B3KQP5_HUMAN Hexosyltransferase (EC 2.4.1.-) 378 B3KRF8 B3KRF8_HUMAN Hexosyltransferase (EC 2.4.1.-) 378 Q6RBZ9 Q6RBZ9_HUMAN Hexosyltransferase (EC 2.4.1.-) 319 I3L3J8 I3L3J8_HUMAN Sodium/potassium-transporting ATPase subunit beta (Fragment) ATP1B2 172 D7UNW5 D7UNW5_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GALNT6 622 Q49AT3 Q49AT3_HUMAN Hexosyltransferase (EC 2.4.1.-) B3GALNT1 331 B4DL56 B4DL56HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 603 Q6RC01 Q6RC01_HUMAN Hexosyltransferase (EC 2.4.1.-) 144 B3KP58 B3KP58_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 460 E9PJ79 E9PJ79_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) B3GNT6 121 B2R7V3 B2R7V3_HUMAN cDNA, FLJ93618, highly similar to Homo sapiens fucosyltransferase 6 (alpha (1,3) fucosyltransferase) (FUT6), mRNA 359 C9J0F8 C9J0F8_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) B3GALNT1 65 E5D8G0 E5D8G0_HUMAN Polypeptide N-acetylgdactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 601 B3KQT5 B3KQT5_HUMAN Hexosyltransferase (EC 2.4.1.-) 372 C9J5K2 C9J5K2_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) B3GNT5 81 C9J8U7 C9J8U7_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) B3GALNT1 54 H0YAH3 H0YAH3_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) (Fragment) GALNT7 454 2018-03-20Date Re^ue/Date Received 2023-02-27 C9JD16 C9JD16_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) B3GALNT1 58 B7Z6K2 B7Z6K2_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 533 B7Z5C5 B7Z5C5_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) 517 Q58A53 Q58A53_HUMAN Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase) GalNAc-T17 598 C9IYY0 C9IYY0_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) B3GNT5 62 A6NGH2 A6NGH2_HUMAN Sodium/potassium-transporting ATPase subunit beta 295 V9GYR2 V9GYR2_HUMAN Sodium/potassium-transporting ATPase subunit beta (Fragment) ATP1B1 130 K7ENC0 K7ENC0_HUMAN Alpha-(1,3)-fucosyltransferase 5 FUT5 374 R4X604 R4X604_HUMAN Hexosyltransferase (EC 2.4.1.-) B3GALNT1 151 Q8NFN0 Q8NFN0_HUMAN Hexosyltransferase (EC 2.4.1.-) 181 Q58I18 Q58I18_HUMAN Sodium/potassium-transporting ATPase subunit beta (Fragment) ATP1B3 137 R4X601 R4X601_HUMAN Hexosyltransferase (EC 2.4.1,-) B3GALNT1 208 Q499Z2 Q499Z2_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) B3GALT6 304 Q6LEU2 Q6LEU2_HUMAN Sodium/potassium-transporting ATPase subunit beta (Fragment) ATP1B1 303 A0A0A0M S93 A0A0A0MS93_HUM AN Hexosyltransferase (EC 2.4.1.-) B3GALT5 314 R4X5Z4 R4X5Z4_HUMAN Hexosyltransferase (EC 2.4.1.-) B3GALNT1 331 Q53F50 Q53F50_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) 331 M0R199 M0R199_HUMAN Hexosyltransferase (EC 2.4.1.-) (Fragment) B3GNT3 250 2018-03-20CA 02999280 2018-03-20 Table of Sequences in Appended Sequence Listing SEQ ID NO; Illustrative Description 1 DNA sequence of chimeric protein - comprising the extracellular domain of PD-1, followed by the hinge-CH2-CH3 domain of human lgG4 and short linker, followed by the extracellular domain of OX40I 2 Amino acid sequence of chimeric protein - comprising the extracellular domain of PD-1, followed by the hinge-CH2-CH3 domain of human IgG4 and short linker, followed by the extracellular domain of OX40I . 3 Codon-optimized nucleic acid sequence, which is optimized for expression by Chinese Hamster (CHO) cells 4 DNA sequence encoding the extracellular domain of PD-1 -Fc - the extracellular domain of TL1A 5 Amino acid sequence encoded by a codon optimized nucleotide sequence of SEQ ID NO: 4 6 Nucleotide sequence of construct (ex: A fusion protein encoding the extracellular domain of BTLA, linked through an Fc to OX40L) 7 Amino acid sequence encoded by nucleotide sequence of SEQ ID NO: 6 8 DNA sequence of a fusion protein incorporating the extracellular domain of TIGIT, linked via an Fc linker to OX40L 9 Amino acid sequence encoded by a codon optimized nucleotide sequence of SEQ ID NO: 8 10 DNA sequence of a fusion protein incorporating the extracellular domain of TlM3, linked through an Fc region to human OX40L 11 Amino acid sequence encoded by a codon optimized nucleotide sequence of SEQ ID NO: 10 12 Nucleotide sequence of the extracellular domain of CD172a adjoined with an Fc linker sequence to the extracellular domain of human OX40L 13 Amino acid sequence encoded by a codon optimized nucleotide sequence of SEQ ID NO: 12 14 Nucleotide sequence of the extracellular domain of TMIGD2 adjoined with an Fc linker sequence to the extracellular domain of human OX40L 15 Amino acid sequence encoded by a codon optimized nucleotide sequence of SEQ ID NO: 14 16 mRNA sequence of human OX40L 17 Amino acid sequence of human OX40L 193 Date ReQue/Date Received 2023-02-27CA 02999280 2018-03-20 18 Nucleic acid sequence of the hinge-CH2-CH3 Sequence from human IgG1 19 cDNA sequence of human PD-1 20 Nucleic acid sequence of human PD-1-Fc-OX40L codon optimized for expression by Chinese Hamster (CHO) cells 21 Nucleic acid sequence of human PD-1-Fc-OX40L 22 Amino acid sequence of SL-279252 23 Amino acid sequence of Linker 24 Amino acid sequence of Linker 25 Amino acid sequence of Linker 26 Amino acid sequence of Linker 27 Amino acid sequence of Linker 28 Amino acid sequence of Linker 29 Amino acid sequence of Linker 30 Amino acid sequence of Linker 31 Amino acid sequence of Linker 32 Amino add sequence of CD279 33 Amino add sequence of CD172a 34 Amino acid sequence of BTLA 35 Amino acid sequence of TIGIT 36 Amino acid sequence of TIM3 37 Amino add sequence of CD200 38 Amino add sequence of TMIGD2 39 Amino add sequence of VISTA 40 Amino acid sequence of VSIG8 41 Amino add sequence of BTNL2 42 Amino acid sequence of TNFRSFIb 43 Amino add sequence of CD276 44 Amino add sequence of CD244 45 Amino acid sequence of LAG3 46 Amino acid sequence of CSF1R 194 Date ReQue/Date Received 2023-02-27CA 02999280 2018-03-20 47 Amino acid sequence of TGFBR1 48 Amino add sequence of IL-10R 49 Amino acid sequence of CD40 50 Amino acid sequence of OX40 51 Amino acid sequence of 41BB 52 Amino add sequence of CTLA4 53 Amino acid sequence of PD-L1 54 Amino acid sequence of PD-L2 55 Amino acid sequence of B7-H4 56 Amino add sequence of OX40L 57 Amino add sequence of GITRL 58 Amino add sequence of 41BBL 59 Amino acid sequence of TL1A 60 Amino add sequence of CD40L 61 Amino add sequence of CD30L 62 Amino acid sequence of TRAIL 63 Amino acid sequence of CD70 64 blank 65 blank 66 blank 67 blank 68 blank 69 blank 70 Amino add sequence of Linker - lgG4 hinge-CH2-CH3 71 Amino acid sequence of Linker - 1gG4 hinge-CH2-CH3 S228P 72 Amino add sequence of Linker - lgG4 hinge-CH2-CD3 S228P FcRn 73 Amino acid sequence of Joining Linker 74 Amino acid sequence of Joining Linker 75 Amino acid sequence of Joining Linker 76 Amino acid sequence of Joining Linker 77 Amino acid sequence of Joining Linker 78 Amino acid sequence of Joining Linker 195 Date ReQue/Date Received 2023-02-275 Date ReQue/Date Received 2023-02-27 In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 32, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SKI ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino add sequence of SEQ ID NO: 33, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SKI ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino add sequence of SEQ ID NO: 34, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SKI ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be 1965 Date ReQue/Date Received 2023-02-27 substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 35, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 36, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 37, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be 1975 Date ReQue/Date Received 2023-02-27 substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 38, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 39, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 40, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be 1985 Date ReQue/Date Received 2023-02-27 substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 41, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 42, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 43, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be 1995 Date ReQue/Date Received 2023-02-27 substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 44, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 45, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 46, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be 2005 Date ReQue/Date Received 2023-02-27 substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 47, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 48, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 49, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be 2015 Date ReQue/Date Received 2023-02-27 substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 50, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 51, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 52, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be 2025 Date ReQue/Date Received 2023-02-27 substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 53, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 54, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SKI ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises: (i) the amino acid sequence of SEQ ID NO: 55, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and (ii) one of the amino add sequences of SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, and, optionally (iii) an Ig linker selected from the amino acid sequences of SEQ ID NO: 70, SEQ ID NO: 71, and SEQ ID NO: 72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto, where, also optionally, one or more of (i) and (ii) are connected to (iii) via (iv) a joining linker of SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, or variants thereof. In various embodiments, the linkers (iii) or (iv) can be 2035 Date ReQue/Date Received 2023-02-27 substituted for the amino acid sequence of SEQ ID NOs: 23-31, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises the amino acid sequence of SEQ ID NO: 2, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises the amino acid sequence of SEQ ID NO: 5, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises the amino acid sequence of SEQ ID NO: 7, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises the amino acid sequence of SEQ ID NO: 9, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises the amino acid sequence of SEQ ID NO: 11, or atleast 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises the amino acid sequence of SKI ID NO: 13, or atleast 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises the amino acid sequence of SKI ID NO: 15, or atleast 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

In some embodiments, the present chimeric protein comprises the amino acid sequence of SKI ID NO: 22, or atleast 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.

EQUIVALENTS While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure as come within known or customary practice within the art to which the invention pertains and as may be applied to the essential features hereinbefore set forth and as follows in the scope of the appended claims.

Those skilled in the art will recognize, or be able to ascertain, using no more than routine experimentation, numerous equivalents to the specific embodiments described specifically herein. Such equivalents are intended to be encompassed in the scope of the following claims. 204CA 02999280 2018-03-20 The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention.

As used herein, all headings are simply for organization and are not intended to limit the disclosure in 5 any manner. The content of any individual section may be equally applicable to all sections. 205 Date ReQue/Date Received 2023-02-27DEMANDE OU BREVET VOLUMINEUX LA PRESENTE PARTIE DE CETTE DEMANDE OU CE BREVET COMPREND PLUS D’UN TOME.

CECI EST LE TOME 2 DE 2 CONTENANT LES PAGES 144 A 205 NOTE : Pour les tomes additionels, veuillez contacter le Bureau canadien des brevets JUMBO APPLICATIONS/PATENTS THIS SECTION OF THE APPLICATION/PATENT CONTAINS MORE THAN ONE VOLUME THIS IS VOLUME 2 OF 2 CONTAINING PAGES 144 TO 205 NOTE: For additional volumes, please contact the Canadian Patent Office NOM DU FICHIER / FILE NAME : NOTE POUR LE TOME / VOLUME NOTE:

Claims (73)

1. CLAIMS What is claimed is: 1. A heterologous chimeric protein comprising the general structure: N terminus-(a)- (b)- (c) - C terminus, wherein: (a) is a first extracellular domain of a type I transmembrane protein, (c) is a second extracellular domain of a type II transmembrane protein, and (b) is a linker, wherein: the first extracellular domain is an immune inhibitory signal, and the second extracellular domain is an immune stimulatory signal, wherein the typeI transmembrane protein and the type II transmembrane protein are respectively: PD-1 and OX40L; PD-1 and 4-1BBL; PD-1 and GITRL; PD-1 and TL1A; TIM3 and OX40L; SIRPa(CD172) and OX40L; SIRPa(CD172) and CD40L; TIGIT and OX40L; BTLA and OX40L; or TMIGD2 and OX40L.
2. 2. The heterologous chimeric protein of claim 1, wherein the chimeric protein comprises (i) the extracellular domain of PD-1 and (ii) extracellular domain of OX40L.
3. 3. The heterologous chimeric protein of claim 1 or claim 2, wherein the chimeric protein comprises an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 22 and capable of binding to a PD-1 ligand and an OX40L receptor.
4. 4. The heterologous chimeric protein of claim 1, wherein the chimeric protein comprises (i) the extracellular domain of PD-1 and (ii) extracellular domain of 4-1BBL.
5. 5. The heterologous chimeric protein of claim 1, wherein the chimeric protein comprises (i) the extracellular domain of PD-1 and (ii) extracellular domain of GITRL.
6. 6. The heterologous chimeric protein of claim 1, wherein the chimeric protein comprises (i) the extracellular domain of PD-1 and (ii) extracellular domain of TL1A.
7. 7. The heterologous chimeric protein of claim 1, wherein the chimeric protein comprises (i) the extracellular domain of BTLA and (ii) extracellular domain of OX40L. 206
8. 8. The heterologous chimeric protein of claim 1, wherein the chimeric protein comprises (i) the extracellular domain of TIGIT and (ii) extracellular domain of OX40L.
9. 9. The heterologous chimeric protein of claim 1, wherein the chimeric protein comprises (i) the extracellular domain of TlM3 and (ii) extracellular domain of OX40L.
10. 10. The heterologous chimeric protein of claim 1, wherein the chimeric protein comprises (i) the extracellular domain of SIRPa(CD172a) and (ii) extracellular domain of CD40L.
11. 11. The heterologous chimeric protein of claim 1, wherein the chimeric protein comprises (i) the extracellular domain of SIRPa(CD172a) and (ii) extracellular domain of OX40L.
12. 12. The heterologous chimeric protein of claim 1, wherein the chimeric protein comprises (i) the extracellular domain of TMIGD2 and (ii) extracellular domain of OX40L.
13. 13. The heterologous chimeric protein of any one of claims 1 to 12, wherein the chimeric protein is a recombinant fusion protein.
14. 14. The heterologous chimeric protein of any one of claims 1 to 13, wherein one of the extracellular domains is capable of reducing, masking or eliminating an inhibitory immune signal.
15. 15. The heterologous chimeric protein of any one of claims 1 to 14, wherein one of the extracellular domains is capable of increasing, simulating or activating an immune stimulatory signal.
16. 16. The heterologous chimeric protein of any one of claims 1 to 15, wherein the chimeric protein is capable of both (i) reducing or eliminating an immune inhibitory signal and (ii) increasing or activating an immune stimulatory signal.
17. 17. The heterologous chimeric protein of any one of claims 1 to 16, wherein the chimeric protein is capable of increasing a ratio of effector T cells to regulatory T cells.
18. 18. The heterologous chimeric protein of any one of claims 1 to 17, wherein the chimeric protein is capable of increasing and/or preventing a decrease in a sub-population of cytotoxic T cells; effector memory T cells; central memory T cells; CD8+ stem cell memory effector cells; TH1 effector T-cells; TH2 effector T cells; TH9 effector T cells; TH17 effector T cells; and/or effector T cells secreting IL-2, IL-4 and/or IFN-y.
19. 19. The heterologous chimeric protein of any one of claims 1 to 18, wherein the chimeric protein leads to a cytokine response in the peripheral blood of an animal that can be used as a means of defining the appropriate dose of the chimeric protein.
20. 20. The heterologous chimeric protein of any one of claims 1 to 19, wherein the linker is a synthetic linker. 207
21. 21. The heterologous chimeric protein of any one of claims 1 to 19, wherein the linker is a polypeptide selected from a flexible amino acid sequence, IgG hinge region or antibody sequence.
22. 22. The heterologous chimeric protein of claim 21, wherein the linker comprises the hinge-CH2-CH3 Fc domain derived from lgG1.
23. 23. The heterologous chimeric protein of claim 21, wherein the linker comprises the hinge-CH2-CH3 Fc domain derived from lgG4.
24. 24. The heterologous chimeric protein of any one of claims 1 to 23, wherein the chimeric protein is produceable in a mammalian host cell as a secretable and fully functional single polypeptide chain.
25. 25. A nucleic acid encoding the heterologous chimeric protein of any one of claims 1 to 24.
26. 26. A pharmaceutical composition, comprising the heterologous chimeric protein of any one of claims 1 to 24 and a pharmaceutically acceptable carrier.
27. 27. An expression vector, comprising a nucleic acid encoding the heterologous chimeric protein of any one of claims 1 to 24.
28. 28. The expression vector of claim 27, wherein the expression vector is a mammalian expression vector.
29. 29. The expression vector of claim 28, wherein the expression vector comprises DNA or RNA.
30. 30. A host cell, comprising the expression vector of any one of claims 27-29.
31. 31. A virus, comprising a nucleic acid sequence encoding the chimeric protein of any one of claims 1 to 24.
32. 32. Use of the pharmaceutical composition of claim 26 for treating cancer in a subject in need thereof.
33. 33. Use of the pharmaceutical composition of claim 26 for treating an autoimmune disease or disorder in a subject in need thereof.
34. 34. Use of the pharmaceutical composition of claim 26 for modulating a patient's immune response in a subject in need thereof.
35. 35. The use of any one of claims 32-34, wherein the patient's T cells are to be activated by the extracellular domain having an immune stimulatory signal.
36. 36. The use of any one of claims 32-35, wherein the patient has a tumor and one or more tumor cells are to be prevented from transmitting an immunosuppressive signal activated by the extracellular domain having an immune inhibitory signal.
37. 37. A heterologous chimeric protein comprising: 208 (i) the amino acid sequence of SEQ IDNO: 32, or a sequence having at least 95% identity thereto and capable of binding to a PD-1 ligand; the amino acid sequence of SEQ ID NO: 56, or a sequence having at least 95% identity thereto and capable of binding to an OX40L receptor, and a linker comprising a hinge-CH2-CH3 Fc domain derived from IgG1 or lgG4; (ii) the amino acid sequence of SEQ ID NO: 32, or a sequence having at least 95% identity thereto and capable of binding to a PD-1 ligand; the amino acid sequence of SEQ ID NO: 58, or a sequence having at least 95% identity thereto and capable of binding to an 4-1BBL receptor, and a linker comprising a hingeCH2-CH3 Fc domain derived from IgG1 or lgG4; (iii) the amino add sequence of SEQ ID NO: 32, or a sequence having at least 95% identity thereto and capable of binding to a PD-1 ligand; the amino add sequence of SEQ ID NO: 57, or a sequence having at least 95% identity thereto and capable of binding to an GITRL receptor, and a linker comprising a hinge-CH2- CH3 Fc domain derived from IgG1 or lgG4; (iv) the amino add sequence of SEQ ID NO: 32, or a sequence having at least 95% identity thereto and capable of binding to a PD-1 ligand; the amino add sequence of SEQ ID NO: 59, or a sequence having at least 95% identity thereto and capable of binding to an TL1A receptor, and a linker comprising a hinge-CH2- CH3 Fc domain derived from IgG1 or lgG4; (v) the amino add sequence of SEQ ID NO: 36, or a sequence having at least 95% identity thereto and capable of binding to a TIM3 ligand; the amino acid sequence of SEQ ID NO: 56, or a sequence having at least 95% identity thereto and capable of binding to an OX40L receptor, and a linker comprising a hinge-CH2- CH3 Fc domain derived from IgG1 or lgG4; (vi) the amino add sequence of SEQ ID NO: 33, or a sequence having at least 95% identity thereto and capable of binding to a SIRPa(CD172) ligand; the amino acid sequence of SEQ ID NO: 56, or a sequence having at least 95% identity thereto and capable of binding to an OX40L receptor, and a linker comprising a hinge-CH2-CH3 Fc domain derived from lgG1 or lgG4; (vii) the amino add sequence of SEQ ID NO: 33, or a sequence having at least 95% identity thereto and capable of binding to a SIRPa(CD172) ligand; the amino acid sequence of SEQ ID NO: 60 and capable of binding to an CD40L receptor, or a sequence having at least 95% identity thereto, and a linker comprising a hinge-CH2-CH3 Fc domain derived from lgG1 or lgG4; (viii) the amino acid sequence of SEQ ID NO: 35, or a sequence having at least 95% identity thereto and capable of binding to a TIGIT ligand; the amino acid sequence of SEQ ID NO: 56, or a sequence having at least 95%identity thereto and capable of binding to an OX40L receptor, and a linker comprisinga hinge-CH2- CH3 Fc domain derived from IgG1 or lgG4; 209 (ix) the amino add sequence of SEQ ID NO: 34, or a sequence having at least 95% identity thereto and capable of binding to a BTLA ligand; the amino acid sequence of SEQ ID NO: 56, or a sequence having at least 95% identity thereto and capable of binding to an OX40L receptor, and a linker comprising a hinge-CH2- CH3 Fc domain derived from IgG1 or lgG4; or (x) the amino add sequence of SEQ ID NO: 38, or a sequence having at least 95% identity thereto and capable of binding to a TMIGD2 ligand; the amino acid sequence of SEQ ID NO: 56, or a sequence having at least 95% identity thereto and capable of binding to an OX40L receptor, and a linker comprising a hinge-CH2- CH3 Fc domain derived from IgG1 or lgG4.
38. 38. The heterologous chimericproteinof claim 37, whereinthe linker comprises the aminoacidsequence of one of SEQ ID NOs: 70-72, or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.
39. 39. The heterologous chimeric protein of daim 38, further comprising one or more of the amino acid sequence of one of SEQ ID NOs: 73-78 adjacent to SEQ ID NOs: 70-72.
40. 40. A heterologous chimeric protein comprising the amino acid sequence of SEQ ID NO: 2 or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto and capable of binding to a PD-1 ligand and an OX40L receptor.
41. 41. A heterologous chimeric protein comprising the amino acid sequence of SEQ ID NO: 5 or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto and capable of binding to a PD-1 ligand and an TL1A receptor.
42. 42. A heterologous chimeric protein comprising the amino acid sequence of SEQ ID NO: 7 or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto and capable of binding to a BTLA ligand and an OX40L receptor.
43. 43. A heterologous chimeric protein comprising the amino acid sequence of SEQ ID NO: 9 or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto and capable of binding to a TIGIT ligand and an OX40L receptor.
44. 44. A heterologous chimeric protein comprising the amino acid sequence of SEQ ID NO: 11 or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto and capable of binding to a TIM3 ligand and an OX40L receptor.
45. 45. A heterologous chimeric protein comprising the amino acid sequence of SEQ ID NO: 13 or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto and capable of binding to a SIRPa(CD172) ligand and an OX40L receptor. 210
46. 46. A heterologous chimeric protein comprising the amino acid sequence of SEQ ID NO: 15 or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto and capable of binding to a TMIGD2 ligand and an OX40L receptor.
47. 47. A heterologous chimeric protein comprising the amino acid sequence of SEQ ID NO: 22 or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto and capable of binding to a PD-1 ligand and an OX40L receptor.
48. 48. A pharmaceutical composition, comprising the heterologous chimeric protein of any one of claims 37-47 and a pharmaceutically acceptable carrier.
49. 49. Use of the pharmaceutical composition of claim 48 for treating cancer in a subject in need thereof.
50. 50. Use of the pharmaceutical composition of claim 48 for treating an autoimmune disease or disorder in a subject in need thereof.
51. 51. Use of the pharmaceutical composition of claim 48 for modulating a patient’s immune response in a subject in need thereof.
52. 52. The use of any one of claims 49-51, wherein the patient’s T cells are to be activated by the extracellular domain having an immune stimulatory signal.
53. 53. The use of any one of claims 49-52, wherein the patient has a tumor and one or more tumor cells are to be prevented from transmitting an immunosuppressive signal activated by the extracellular domain having an immune inhibitory signal.
54. 54. Use of the pharmaceutical composition of claim 48 for the manufacture of a medicament for treating cancer in a subject in need thereof.
55. 55. Use of the pharmaceutical composition of claim 48 for the manufacture of a medicament for treating an autoimmune disease or disorder in a subject in need thereof.
56. 56. Use of the pharmaceutical composition of claim 48 for the manufacture of a medicament for modulating a patient’s immune response in a subject in need thereof.
57. 57. The use of any one of claims 54-56, wherein the patient's T cells are to be activated by the extracellular domain having an immune stimulatory signal.
58. 58. The use of any one of claims 54-57, wherein the patient has a tumor and one or more tumor cells are to be prevented from transmitting an immunosuppressive signal activated by the extracellular domain having an immune inhibitory signal.
59. 59. The pharmaceutical composition of claim 48 for use in treating cancer in a subject in need thereof. 211
60. 60. The pharmaceutical composition of claim 48 for use in treating an autoimmune disease or disorder in a subject in need thereof.
61. 61. The pharmaceutical composition of claim 48 for use in modulating a patient's immune response in a subject in need thereof.
62. 62. The pharmaceutical composition for use of any one of claims 59-61, wherein the patient’s T cells are to be activated by the extracellular domain having an immune stimulatory signal.
63. 63. The pharmaceutical composition for use of any one of claims 59-62, wherein the patient has a tumor and one or more tumor cells are to be prevented from transmitting an immunosuppressive signal activated by the extracellular domain having an immune inhibitory signal.
64. 64. Use of the pharmaceutical composition of claim 26 for the manufacture of a medicament for treating cancer in a subject in need thereof.
65. 65. Use of the pharmaceutical composition of claim 26 for the manufacture of a medicament for treating an autoimmune disease or disorder in a subject in need thereof.
66. 66. Use of the pharmaceutical composition of claim 26 for the manufacture of a medicament for modulating a patient's immune response in a subject in need thereof.
67. 67. The use of any one of claims 64-66, wherein the patient’s T cells are to be activated by the extracellular domain having an immune stimulatory signal.
68. 68. The use of any one of claims 64-67, wherein the patient has a tumor and one or more tumor cells are to be prevented from transmitting an immunosuppressive signal activated by the extracellular domain having an immune inhibitory signal.
69. 69. The pharmaceutical composition of claim 26 for use in treating cancer in a subject in need thereof.
70. 70. The pharmaceutical composition of claim 26 for use in treating an autoimmune disease or disorder in a subject in need thereof.
71. 71. The pharmaceutical composition of claim 26 for use in modulating a patient’s immune response in a subject in need thereof.
72. 72. The use of any one of claims 69-71, wherein the patient’s T cells are to be activated by the extracellular domain having an immune stimulatory signal.
73. 73. The use of any one of claims 69-72, wherein the patient has a tumor and one or more tumor cells are to be prevented from transmitting an immunosuppressive signal activated by the extracellular domain having an immune inhibitory signal. 212