CA2606673A1

CA2606673A1 - Mutant f. tularensis strain and uses thereof

Info

Publication number: CA2606673A1
Application number: CA002606673A
Authority: CA
Inventors: Anders Sjostedt; Joseph Wayne Conlan
Original assignee: Individual
Current assignee: National Research Council of Canada
Priority date: 2005-04-20
Filing date: 2006-04-19
Publication date: 2006-10-26

Abstract

A mutant strain of Francisella tularensis has attenuated virulence and has a mutation in the gene coding for a putative peroxynitrite resistance protein A
(prpA) which prevents normal function of the protein. The mutant is useful as a vaccine against type A and B virulent strains of F. tularensis, and is produced by obtaining a virulent F. tularensis strain and mutating the gene, FTT0918, that codes for prpA.

Description

Mutant F. tularensis strain and uses thereof Field of the Invention The invention relates to attenuated F. tularensis useful as live vaccines against tularemia in humans and other mammals.

Background of the Invention Francisella tularensis is a pathogenic intracellular bacterium capable of causing infectious disease in more than 150 mammalian species. Arthropod vectors, such as ticks, flies and mosquitoes, are frequently involved in the transmission of the pathogen to mammals but it can be transmitted also via contaminated food and water, and aerosols. There are four subspecies of F.
tularensis, but only two, subspecies tularensis (type A), and subspecies holarctica (type B), are commonly infectious for humans. Only type A strains of F. tularensis may cause lethal infection in humans, in particular untreated respiratory tularemia has a high mortality rate if left untreated.

Because of its high infectivity, ease of dissemination by aerosol, and capacity to cause severe morbidity and mortality, type A F. tularensis has long been considered a potential biological warfare agent. However, to date no specific virulence factors that explain the high virulence of type A strains have been identified. A comparative genomic analysis showed that the proportion of genes conserved among the four subspecies of F. tularensis is high, >97%, and that less than 30 of a total of 1,800 genes are unique to type A versus type B F. tularensis.

Live attenuated F. tularensis vaccines were developed in Russia in the 1950's from a type B strain. One of these strains, designated as the live vaccine strain, LVS, was transferred to the US. Vaccine studies conducted on volunteers in the 1960's demonstrated that it protected humans against systemic inoculation or inhalation of a type A strain of the pathogen.
Epidemiological studies of tularemia cases among Francisella researchers before and after the introduction of LVS vaccination confirmed its utility.
However, despite having been developed almost 50 years ago, the nature of the genetic lesion responsible for its attenuation, the protective antigens, and the immunological basis for its efficacy remain unknown.

Moreover, in both human and animal studies, systemic vaccination with LVS
provided sub-optimal protection against aerosol challenge with type A F.
tularensis. For these reasons, LVS has never been licensed as a vaccine. In the past, it was granted investigational new drug (IND) status, but this was revoked by the FDA several years ago. These problems with LVS have motivated a search for better-defined vaccines of equal or greater efficacy.

Because the protective protein antigens of F. tularensis are completely unknown, a sub-unit vaccine is currently inconceivable, especially as it would need to be formulated with an adjuvant system able to elicit robust CD4+ and CD8+ T cell responses, both of which are known to be required to control tularemia. Although experimental adjuvants with these properties exist, none have yet been approved for clinical use.

The identities and characteristics of the virulence factors and protective antigens of the subspecies of Francisella are essentially unknown. Although recent comparative genomics analyses have begun to demonstrate genetic differences among the subspecies, these alone have been insufficient to explain their relative virulence. Moreover, it is known that sublethal infection of mice with subspecies novicida fails to confer protection against subsequent challenge with subspecies holarctica or tularensis suggesting that the protective antigens are highly restricted. It has also been observed that only certain mouse strains can be protected by LVS. On this basis, it seems unlikely that defined mutants of the holarctica subspecies would be more effective vaccines than LVS.

Thus, it would be desirable to generate a defined type A strain mutant lacking the minimum number of genes required to render it a safe and effective live vaccine. However, no successful strategy has been disclosed in the prior art.
Summary of the Invention A first object of the present invention is to provide mutant Francisella tularensis cells that have attenuated virulence and a mutated FTT0918 gene encoding for a putative peoroxynitirite resistance protein (prpA) such that the cells are substantially lacking functional prpA. These cells are useful as vaccines in that they provide protection in immunized humans and other mammals against virulent type A and B strains of F. tularensis.

A further object of the invention is to provide for a method of obtaining mutant F. tularensis cells for use as a vaccine. Virulent F. tularensis cells are treated to delete or mutate the FTT0918 gene, then viable mutant cells substantially lacking in functional prpA are selected and isolated.

A further object of the invention is to provide for a method for immunizing humans or other mammals against virulent type A and B strains of F.
tularensis. The subject human or mammal is inoculated with the mutant F.
tularensis lacking prpA function, resulting in a reduced susceptibility to virulent F. tularensis.

A first aspect of the invention provides for a mutant of Francisella tularensis that has attenuated virulence and that has a mutation in the nucleotide sequence that encodes FTT0918.

A further aspect of the invention provides for a mutant of Francisella tularensis wherein the nucleotide sequence that encodes the putative peroxynitrite resistance protein A (prpA) in wild-type Francisella tularensis is mutated, resulting in attenuated virulence.

A further aspect of the invention provides for an immunogenic composition or vaccine comprising a mutant of Francisella tularensis that has attenuated virulence and that has a mutation in the nucleotide sequence FTT0918, and a pharmaceutically acceptable diluent, carrier, vehicle or excipient.

A further aspect of the invention provides for a method of producing a mutant of Francisella tularensis that has attenuated virulence and that has a mutation in the nucleotide sequence FTT0918, comprising the steps of obtaining cells of a virulent F. tularensis strain; mutating the nucleotide sequence FTT0918;
selecting for viable cells with attenuated virulence and FTT0918 mutations;
and isolating said cells with attenuated virulence and FTT0918 mutations.

A further aspect of the invention provides for a method of producing a mutant of Francisella tularensis that has a mutation in the nucleotide sequence that encodes the putative peroxynitrite resistance protein A (prpA) in wild-type Francisella tularensis, resulting in attenuated virulence, comprising the steps of obtaining cells of a virulent F. tularensis strain; mutating the nucleotide sequence that encodes prpA, selecting for viable cells with attenuated virulence and mutations in the nucleotide sequence that encodes prpA; and isolating said cells with attenuated virulence and mutations in the nucleotide sequence that encodes prpA.

Brief Description of the Drawings Table 1 illustrates the number of bacteria in PEC cells infected with various strains of F. tularensis.

Table 2 illustrates the number of bacteria in mouse tissues infected through intradermal inoculation with various strains of F. tularensis.

Table 3 illustrates the number of bacteria in mouse tissues infected through intravenous inoculation with various strains of F. tularensis.
Table 4 illustrates the degree of protective immunity against FSC033 F.
tularensis elicited by intradermal immunization with LVS and FSCO43/SCHU
AV strains of F. tularensis.

Table 5 illustrates the growth of virulent F. tularensis in mice vaccinated with LVS and FSCO43/SCHU AV strains of F. tularensis.

Table 6 illustrates differentially expressed proteins in FSCO43/SCHU AV
strain of F. tularensis as compared to FSC033 strain.
Table 7 illustrates the degree of protective immunity against FSC033 F.
tularensis elicited by intradermal immunization with LVS and defined FSCO43/SCHU S4 mutant strains of F. tularensis.

Table 8 illustrates the number of bacteria surviving in PBS cells after exposure to SIN-1 for various strains of F. tularensis.

Table 9 illustrates the nucleotide sequence of gene FTT0918 and putative amino acid sequence of the protein, prpA, it encodes.
Figure 1 illustrates skin lesion development at sites of intradermal inoculation of F. tularensis strains. Representative skin reaction observed in mice inoculated with A, 102 CFU of SCHU S4 or 106 CFU LVS; B, 102 CFU 12A or 106 SCHU AV; C, nothing or 102 CFU LVS or 106 CFU mutant AigIC.

Figure 2 illustrates proteomic comparisons of F. tularensis strains. X 2D-PAGE
of Francisella tularensis strains (a) SCHU S4, (b) SCHU AV and (c) mutant NprpA
visualized by staining with sypro ruby. Replicate gels within experimental groups were compared. Boxed regions in large gels correspond to enlarged areas below.
Protein sequences for FTT0918 (spot 30) and FTT0919 (spot 35) are shown on the bottom right. Amino acid sequences underlined correspond to those peptides detected by LC-MSMS of a tryptic digest of spot 35 from SCHU AV, whilst those in bold are those detected from a tryptic digest of spot 30.

Detailed Description of the Invention While possible F. tularensis vaccines have been explored in the prior art, the genetic mutations responsible for attenuation have not been identified.
Further, vaccines such as LVS (live vaccine strain) have not proven to be efficacious under all circumstances, such as aerosol challenge by type A F. tularensis. In addition, LVS causes an obvious skin reaction at the site of inoculation in the skin (fig 1), which is undesirable. Others have examined spontaneously mutated type A strains as live vaccines in the past, but concluded they were more virulent than LVS, and not therefore suitable for this purpose. Accordingly, a better understanding of the genetic mutations causing F. tularensis attenuation is needed. In addition, an efficacious and safe F. tularensis vaccine is required.
In order to explore the genetic mutations responsible for attenuated virulence, two mutant strains of F. tularensis, FSCO43/SCHU AV and LVS, were analysed.
One such mutation was found to be in the gene FTT0918 which encodes a putative peroxynitrite resistance protein A (prpA). The identification of this gene is a significant step towards developing a safe and efficacious vaccine for F.
tularensis, as it is now possible to create mutants in which the gene is intentionally mutated.

A F. tularensis strain mutant AFTT0918 is the foundation strain for a new defined live vaccine against tularemia. It will be understood that one or a few additional genes may also be deleted or mutated. Although spontaneous SUBSTITUTE SHEET (RULE 26) mutants of F. tularensis, most notably LVS, have been used as live vaccines already, it is not obvious that the absence of gene FTT0918 was responsible for the attenuation of this strain since it lacks several additional genes present in clinical type B strains. Further, it is shown that the mutant strain is effective as a vaccine, in that mice inoculated with the mutant survived both intradermal and aerosol challenges with virulent type A F. tularensis.
Identification of Genetic Mutations Responsible for Attenuation A spontaneous mutant with attenuated virulence, designated FSC043 or SCHU AV (hereinafter referred to as SCHU AV), of Francisella tularensis subsp. tularensis is known. The virulence of the mutant is severely attenuated; its intradermal LD50 in mice was > 108 CFU compared to< 10 CFU
for SCHU S4. SCHU AV proteins were compared with those of the wild-type strain, SCHU S4, a prototypic strain known to be highly virulent for humans and multiple species of experimentally infected mammals including mice. It was demonstrated by proteomic analysis that SCHU AV expressed several proteins at significantly different levels than the wild-type strain, SCHU S4.
A proteomic comparison of SCHU AV and the wild type virulent parental strain, SCHU S4, revealed the absence or lower expression of 9 proteins from the former versus latter (Table 6). Intriguingly, SCHU AV and LVS expressed a specific protein (spot 35 in Fig 2 panel b) not expressed by the parental strain. Proteomic analysis of this protein revealed it to be a hybrid protein consisting of the N-terminal domain of one wild-type protein encoded by gene FTT0918 and the C-terminal domain of another encoded by gene FTT0919. A
genomic analysis confirmed the presence of the hybrid gene responsible for this fusion protein in both spontaneous mutants LVS and SCHU AV.

Analysis of Role of dFTT0918 and aFTT0919 Genes To better assess the potential role of the two wild-type genes (designated as FTT0918 and FTT0919) in virulence, they were individually targeted for deletion from SCHU S4 using an allelic replacement method previously used to generate defined mutations in LVS. The method incorporated a counter-selection step to ensure that the antibiotic resistance genes as well as all other DNA present in the plasmid used to generate the crossover mutations were absent from the ensuing mutant strain. Deletion of one of the targeted genes, FTT0919, had no obvious effect on virulence. (However, because mice are highly sensitive to infection by F. tularensis, any subtle decrease in virulence caused by this mutation could be overlooked by this screening procedure. For instance, decreasing the virulence of SCHU S4 to that of a type B strain would not be detected in the murine model, since mice are highly susceptible to both subspecies whereas higher mammals such as rabbits, monkeys, and humans would be far less susceptible to the latter than the former.) Regardless, the AFTT0919 strain is clearly far more virulent than LVS
or SCHU AV, and unlikely, therefore, to be acceptable as a vaccine candidate.

In contrast to the OFTT0919 strain, the OFTT0918 mutant showed significantly reduced virulence for mice. Moreover, mice that recovered from infection with this mutant were protected from subsequent challenge with a highly virulent type A strain. Despite its attenuation, OFTT0918 retained a greater residual virulence for mice than either LVS or SCHU AV. This is unsurprising since the latter two spontaneous mutants are missing additional genes some of which must encode additional virulence factors. By selectively deleting some of the latter genes from mutant OFTT0918 it should be possible to attenuate it to the same degree as SCHU AV to thereby produce a rationally attenuated strain with superior vaccine properties (safer and more effective) compared to LVS.
Of course, the same technique used to generate mutant OFTT0918 can be used to delete additional genes from it.

OFTT0918 encodes for a 58-kDa protein with no close homology to any other known proteins. In its absence, strain OFTT0918 and LVS are rendered highly susceptible to in vitro killing by peroxynitrite. In an earlier examination of the host killing mechanisms of the LVS strain, it was observed that iNOS and to a minor degree phox, contributed to the bactericidal activity in vitro. However, on a molar basis, peroxynitrite was identified as a much more bactericidal molecule than nitric oxide or hydrogen peroxide. Thus, resistance to peroxynitrite may be an important factor for the virulence of wild-type F.
tularensis strains. The fact that SCHU AV, which like LVS contains a defective FTT0918 gene, appears to be more resistant to this type of killing than AFTT0918 indicates that the mechanisms affecting the resistance are quite complicated. A simple explanation is that the hybrid gene product of the chimeric FTT0918 and FTT0919 gene that is expressed in SCHU AV has a residual function and explains the difference. However, since LVS also produces a similar hybrid protein but is susceptible to peroxynitrite-mediated killing it must be presumed that other strain-specific factors must also contribute to this phenomenon.

Effectiveness of dFTT0918 Mutant as Vaccine Mice inoculated with the dFTT0918 mutant survived longer than those that were not inoculated, or those that were inoculated with the LVS mutant or a diglC attenuated mutant, indicating that the dFTT0918 mutant has utility as a vaccine (Table 7). Further, the dFTT0918 mutant was disseminated to liver and spleen tissues more efficiently than the diglC mutant (Table 2).

These results suggest that the ability to disseminate from sites of entry into the body to lymphoid tissues and to multiply intracellularly may be critical for priming of an effective, long-lasting protection, as evidenced by the marginal protection afforded by strain dig/C versus the other mutant strains of SCHU
S4 examined herein.

Examples:

Bacteria. F. tularensis LVS was originally obtained from the American Type Culture Collection. (ATCC 29684). The F. tularensis strain FSC033 /snMF
(subspecies tularensis) was originally isolated from a squirrel in Georgia USA, the strains SCHU S4 (subspecies tularensis), FSC237, and a spontaneous mutant of the SCHU S4 strain, SCHU AV (abbreviation for AVirulent) (also designated as FSC 043), were all obtained from the Francisella Strain Collection (FSC) of the Swedish Defence Research Agency, Umea. The mutant strains OFTT0918, AFTT0919, and Aig/C were all derived from the SCHU S4 strain as detailed below. For the present study, stock cultures of all strains were prepared by growing them as confluent lawns on cysteine heart agar supplemented with 1 /a (w/v) hemoglobin (CHAH). Bacteria were harvested after 48-72 h incubation at 37 C in an atmosphere of 5% CO2 into freezing medium consisting of modified Mueller Hinton broth containing 10%
w/v sucrose. Stocks were aliquoted in a volume of 1 ml and stored at -80 C.
Construction of mutagenesis plasmids. Regions approximately 1,500-base pairs upstream and downstream of each targeted gene were amplified by PCR. The 5'-primers contained Sall restriction sites and the 3'-primers a BamHl site or a Pstl site.

Each upstream fragment included the first 80 nucleotides and the downstream fragments the last 15 nucleotides of the respective gene. They were ligated to Sa/l/BamHl or Sa/l/Pstl-digested plasmid pBlue-ScriptKS+ (Stratagene, La Jolla, CA). From the recombinant plasmids, the cloned DNA fragments were excised with Sa/l and BamHl and both fragments ligated simultaneously to Sa/l-digested pPV.

Conjugal transfer of plasmids. Early log cultures of 10' CFU/mI of E. coli S17-1 carrying pPV-AFTT0918 or pPV-AFTT0919 or pPV-DigIC and 109 CFU/mi of F. tularensis LVS were concentrated by centrifugation and resuspended in 50 NI of culture medium, mixed, and plated on either Luria agar (LA) or modified Gc-agar base plates. After incubation, cells were resuspended in PBS and plated on modified GC agar base plates containing 100 Ng/mi of polymyxin B for counterselection of the donor E. coli strain (Golovliov, 2003) and 2.5 Ng/mi of chloramphenicol. To select for a second recombination event, recombinant bacteria were plated on medium containing 5% sucrose. All sucrose-resistant colonies that were sensitive to chloramphenicol were selected for further analysis.

Exposure of F. tularensis to reactive molecular species in a cell-free system. Peroxynitrite (ONOO-) is generated from 3-morpholinosydnonimine hydrochloride (SIN-1) (Molecular Probes, Oregon, USA). Under physiological conditions, 1 mM SIN-1 generates 10 mM of ONOO-/min. F. tularensis bacteria were cultivated overnight and diluted to a density of approximately 2 x 106 bacteria/mi in PBS and to some tubes SIN-1 was added to a final concentration of 0.8 mM. The tubes were incubated at 37 C and viable counts performed at 4 h.

Infection of macrophages.

Peritoneal exudate cells (PEC) were obtained from mice three days after intraperitoneal injection of 2 ml of 10 % proteose peptone. PEC were washed with DMEM (GIBCO BRL, Grand Islands, N. Y.) and resuspended at a density of 3 x 106 cells/ml in culture medium consisting of DMEM with 10% heat-inactivated fetal calf serum. The suspension was aliquotted in 100-LtI volumes in 96-well tissue culture plates. After incubation for 2 h at 37 C, non-adherent cells were removed by washing and after an additional 24 h, F. tularensis bacteria were added to give a multiplicity of infection of 50 bacteria/PEC.
The actual MOI was determined by retrospective plating, thus there were slight variations between experiments. After allowing uptake of bacteria to occur for 1.5 h, the macrophages were washed to remove extracellular bacteria.
Macrophages were reconstituted in culture medium supplemented with 2 tl,g/ml of gentamicin to kill any remaining extracellular bacteria and incubated for indicated periods of time. Then, PEC were lysed with 0.1 %
dodeoxycholate and the number of intracellular bacteria determined by plating 10-fold serial dilutions.

Proteomic analysis of strains SCHU S4, SCHU AV and OFTT0918.
Francisella strains were plated for single colony growth on CHAH agar. At 72 h of incubation 200 colonies of one or other strain were resuspended in 12 times the estimated pellet volume of lysis solution (7 M urea, 2 M thiourea, 1 % (w/v) DTT, 4 % (w/v) CHAPS and 0.5 % (w/v) ASB-14. Cell pellets were resuspended by vortexing, then were shaken for 30 minutes at room temperature and then incubated for at least four hours at 4 C. Unlysed cells and cell debris were removed by centrifugation at 14,000 g for 10 min. The supernatants were checked for sterility and stored at -20 C until required.
Protein concentrations of the extracts were determined using the RC-DC
protein assay (Bio-Rad) or a modified Bradford Assay.

The extracted proteins were separated in the first dimension using either linear pH 4-7 gradient Ready Strips, 17 cm (Biorad, California, USA) or linear pH 6-11 gradient Immobiline drystrips, 18 cm (Amersham Biosciences, Uppsala, Sweden). In each case 100-300 pg of each protein solution was diluted in 350 pl of rehydration buffer (7 M urea, 2 M thiourea, 4 % CHAPS, 0.5 % ASB-1 4, 1 % DTT, 1 % v/v Pharmalyte pH 3-10 or pH 6-11, 0.003 %
Orange G). For ioselectric focusing in the basic pH range (pH 6-11) protein solutions were treated with Destreak Rehydration Solution (Amersham Biosciences) as per the manufacturer's instructions, prior to rehydration of the immobilized pH gradient strips (IPG). The samples were incubated for 1 hour with shaking, and then centrifuged at 10,000g for 10 minutes. Proteins were loaded onto the IPG strips by in-gel rehydration overnight. Isoelectric focusing was conducted using a Protean IEF Cell (Bio-Rad). Proteins were focused at 200 V for 1 h, 500 V for 1 h, 5000 V for 5 h and then 5000 V for a total of 80 kVh. Next, IPG strips were equilibrated in 6 M urea, 50 mM Tris, pH 8.8, 30 %
w/v glycerol, 2 % w/v SDS and 1 w/v % DTT for 20 minutes. The IPG strips were then equilibrated for another 20 minutes in the same solution containing 4 % w/v iodoacetamide instead of DTT. Strips were then embedded on top of an SDS-PAGE gel (12 % polyacrylamide; 190 x 190 x 1.5 mm gel) using 0.5 % w/v agarose 0.003 % w/v bromophenol blue. Electrophoresis was then carried out using the Protean Ilxi System with XL conversion kit (Bio-Rad) at 24 mA per gel for 5 hours. Following second dimension electrophoresis, gels were fixed for 1 hour in 10 % v/v methanol, 7 % v/v acetic acid, then stained overnight with Sypro Ruby (Bio-Rad). Background staining was removed by two 30 minute washes in 10 % v/v methanol, 7 % v/v acetic acid, prior to imaging with the Fluor-S Multilmager (Bio-Rad). The gels were then stained with silver nitrate, scanned and analyzed a second time.

Images of the scanned gels were made using PDQuest software (Bio-Rad). At least 4 replicate gel sets were run for each bacterial strain. Spot positions were matched between replicate gel sets and both matched and unmatched spots checked manually. Spots were considered absent if unmatched in all gel sets. Differential expression was considered greater than two-fold spot intensity difference after normalization of spot intensities. Protein spots consistently identified as being differentially expressed between strains were excised and cut into 1 mm cubes and placed in microcentrifuge tubes. Gel pieces were destained with 30 mM ferricyanide, 100 mM sodium thiosulphate for 5 minutes, and then washed three times with water. The gel pieces were dehydrated repeatedly with 100 % acetonitrile, until the pieces blanched and became hard. Acetonitrile was then removed and gel pieces air-dried under a laminar flow hood. 20 pL of 20 ng/mL trypsin in 50 mM ammonium bicarbonate was then added to each tube and gel pieces incubated at 37 C

for 16 hours. Peptides were extracted from the gel pieces by sonication for 10 minutes.

The in-gel digests were analysed by nano-liquid chromatography-MS/MS
using a 'CapLC' capillary chromatography system (Waters) coupled to a 'QTOF Ultima' hybrid quadrupole time-of-flight mass spectrometer (Waters).
Peptide extracts were injected on a 75 pm internal diameter x 150 mm PepMap C18 nanocolumn (Dionex/LC packings) and resolved by gradient elution (5-75 % acetonitrile, 0.12 % formic acid in 30 minutes, 350 nI/min).
MS/MS spectra were acquired on doubly, triply and quadruply charged ions.
The experimentally collected MS/MS spectra were matched against the Francisella strain Schu 4 genome sequence using Mascot DaemonTM
Results were evaluated according to the Mascot score, number of peptides identified and quality of MS/MS matching. A protein identification was considered positive if at least one peptide, with a Mascot score greater than was matched.

Genomic characterization of strain SCHU AV. The chromosomal regions that contained the genes encoding the proteins altered or missing in strain 20 SCHU AV were analyzed in detail by a combination of bioinformatic analysis of the published genome of the SCHU S4 strain and by PCR amplification and sequencing of the regions in strains SCHU AV and SCHU S4.
Administration of bacteria to mice. Specific-pathogen-free female BALB/c 25 mice were purchased from Charles River Laboratories (St. Constant, Que.).
Mice were maintained and used in accordance with the recommendations of the Canadian Council on Animal Care Guide to the Care and Use of Experimental Animals. Strain FSC 033 was found to be more virulent for mice than the SCHU S4 isolate used to generate the mutants of the present study since a 10 CFU intradermal (i.d.) challenge of the former kills mice 1-2 days earlier than the same challenge with the latter strain. Therefore, strain FSC033 was used as the wild-type challenge strain for all of the efficacy studies conducted herein. For aerosol exposure, thawed F. tularensis strain FSC033 was diluted in Mueller Hinton broth containing 20% (w/v) glycerol to a concentration of approximately 10$/CFU ml; for intradermal inoculations stocks were diluted in sterile saline. Actual concentrations of inocula were determined by plating 10-fold serial dilutions on CHAH.

Intradermal inocula (50 NI / mouse) were injected into the shaved mid-belly.
Aerosols containing strain FSC033 were generated with a LovelaceTM
nebuliser operating at a pressure of 40 p.s.i. to produce particles in the 4-6 pm range required for inhalation and retention in the alveoli. Mice were exposed to these aerosols for 7 min using a commercial nose-only exposure apparatus (In-tox Products, Albuquerque, NM). In each experiment, the generated aerosol was delivered to the exposure ports at a flow rate of 15 I/
min, and at 80% relative humidity. This protocol results in the delivery of -CFU to the lower airways of BALB/c mice. Aerosol exposures and i.d.
challenges were performed in a federally-Iicensed small animal containment level 3 facility. Strain FSC033 was routinely lethal for naive BALB/c mice following intradermal or aerosol challenge with 10 or fewer CFU. In the present study, mice were examined daily for signs of infection. Whenever feasible, mice were euthanized by CO2 asphyxiation as soon as they displayed signs of irreversible morbidity. In our experience such mice were at most 24 hours from death, and time to death of these animals was estimated on this premise.

A spontaneous mutant, SCHU AV of strain SCHU S4 is attenuated in vitro and in vivo but affords effective protection against challenge with virulent type A strain, FSC033. Screening of the Francisella Strain Collection (FSC) revealed an attenuated strain, FSC043, derived from the prototypic subspecies tularensis strain, SCHU S4. This strain, henceforth designated SCHU AV (avirulent), was found to be markedly attenuated for multiplication in PEC (Table 1) and J774 cells. In fact, a rapid decline was observed within h of exposure to these macrophage populations, but thereafter some intracellular multiplication occurred up to 12 h. Eradication occurred within h. In contrast, the number of intracellular SCHU S4 bacteria increased 2 log,o within 12 h. Thereafter, a decline was seen. However, during this phase of the infection with virulent but not attenuated F. tularensis, a cytopathogenic effect was observed morphologically. Thus, the rapid intracellular multiplication of the strain confers a rapid cytopathogenic effect and most likely, this explains the decrease in intracellular numbers of virulent bacteria after 12 h.

In several separate experiments BALB/c mice were challenged intradermally with 102-10$ CFU of SCHU AV or LVS. All LVS challenged BALB/c mice displayed overt signs of illness between days 4-11 (hunched gait, pilo-erection, lethargy) and some mice inoculated with 10' or 108 CFU died by day 8 of infection. No other mice died during the next 28 days. In contrast, only mice challenged with >106 CFU of SCHU AV displayed such signs of infection and no mice inoculated with this strain died at any test dose.

To further examine the relative virulence of LVS and SCHU AV, BALB/c mice were intradermally challenged with 106 CFU of one or other strain, killed on day 4 of infection and bacterial burdens in the skin, liver, and spleen determined (Table 2). By this time, LVS was present at higher levels than SCHU AV in the skin, liver, and spleen. Moreover, large macroscopic skin lesions were visible at the site of inoculation of LVS, but not SCHU AV by this time (Fig 1). Similarly, when inoculated intravenously, SCHU AV grew less than virulent type A or B strains or LVS in the livers, spleens, and lungs of mice (Table 3).

BALB/c mice were intradermally inoculated with 106 CFU of LVS or SCHU AV.
The former mice showed overt signs of disease between days 3-6 of infection whereas the latter mice remained healthy. All immunized mice survived and were challenged 77 days later intradermally or by aerosol with subsp.
tularensis strain FSC 033 (Table 4). It has been shown that immunization of BALB/c mice with LVS leads to excellent protection against intradermal challenge but only weak protection against low dose aerosol challenge (see also Table 4). The SCHU AV immunization afforded as good protection as LVS against intradermal challenge and better protection against aerosol challenge.

Groups of mice (n=3) were challenged intradermally with 150 CFU of strain FSC033 120 days after immunization with LVS or SCHU AV. Mice were killed on day 3 of infection and Francisella burdens in livers, spleens, and lungs determined (Table 5). Numbers in parentheses show the proportion of organs infected. Again, this study showed that SCHU AV immunization was at least as effective as LVS immunization at controlling disseminated infection with a type A strain.

Proteomic analysis of strain SCHU AV.

Two-dimensional gel electrophoresis (2D-PAGE) was used to compare the proteomes of the virulent SCHU S4, and attenuated SCHU AV. Protein spots that exhibited an intensity difference of at least two-fold between strains were excised and identified by mass spectrometric analysis of their in-gel tryptic digests. Gels in the pH ranges 4-7 and 6-11 were run. The majority of the protein spots resolved in the pH range 4-7, and within this range a total 10 spots were identified in SCHU AV as differing in abundance or absent when compared to the virulent SCHU S4. Six spots were undetectable and three were decreased in abundance in comparison to SCHU S4. The putative identities of these proteins are shown in Table 6. In contrast, one spot (35) was observed only in SCHU AV (Fig 2). The protein spot was found to contain peptides corresponding to two proteins, FTT0918 and FTT 0919, found in the parental strain. Both are identified as hypothetical proteins with no known homology to other proteins and no assigned function. FTT0918 was also identified as spot 30 in the parental strain (Fig 2). MS analysis for spot 30 showed a good peptide coverage throughout the protein sequence (Fig 2). In contrast, MS analysis of SCHU AV spot 35 identified peptides confined to the first half of FTT0919 amino acid sequence and the second half of FTT0918 amino acid sequence. The genes corresponding to these two proteins are in close proximity on the chromosome; FTT0918 is coded from 927667-929340 b.p. and FTT0919 from 9292357-930802 b.p. Thus, it appears that a deletion mutation overlapping these genes resulted in the creation of a novel gene coding for a hybrid protein corresponding to the N terminus of FTT0918 and the C terminus of FTT019. We have found evidence for the presence of a similar hybrid protein in LVS, and the hybrid gene for this protein is reported in the current LVS genome sequence database.

Characteristics of defined mutants of strain SCHU S4. The two genes found to be partially missing in both strains LVS and SCHU AV were subjected to the deletion strategy using plasmid pPV and both mutants were obtained in strain SCHU S4. Additionally, the AiglC gene that when deleted from LVS resulted in its further attenuation to complete aviruience for mice was deleted from SCHU S4.

Defined mutant OFTT0919 missing the gene coding for protein FTT0919 remained highly virulent for mice by the i.d. route (i.d. LD50 <50 CFU), and so was not further evaluated as a live vaccine candidate. In contrast, mutant AFTT0918 missing the gene encoding for protein FTT0918 was highly attenuated compared to the parental strain (i.d. LD50 -105 CFU versus <10 CFU respectively based on accumulated data from 4 separate experiments).
Proteomic analysis confirmed that it lacked the expected protein spot 30 in SCHU S4 (Fig 2). When inoculated intradermally at a dose of 100 CFU, mutant AFTT0918 multiplied less than the parental strain and caused a much less overt tissue reaction at this site, and disseminated less to internal organs (Table 2; fig 1). Indeed, at this test dose, it appeared as attenuated as LVS
(Table 2), though the lower LD50 of the former strain indicated it was more virulent than the latter or SCHU AV at higher doses. Likewise the fact that mutant AFTT0918 persisted and multiplied in PEC whereas SCHU AV was killed by these host cells suggests that the former is more virulent than the latter (Table 1). At the opposite end of the spectrum from mutant 4FTT0919, mutant AigIC appears to be totally aviruient in that it failed to induce any overt disease in mice even at an i.d. dose of 108 CFU. Interestingly, this mutant persisted at least as well as SCHU AV in the skin, but appeared less able to disseminate to internal organs (Table 2). Mice immunized intradermally with defined mutants of F. tularensis were challenged 8 - 9 weeks later with virulent strain FSC033 by the intradermal or aerosol route respectively and their survival monitored (Table 7). Mutant OFTT0918 was at least as effective a live vaccine as LVS in these studies at combating a systemic challenge with virulent type A F. tularensis whereas mutant AigIC performed poorly. The fact a Dig/C mutant of SCHU S4 was unable to act as a protective vaccine despite being severely attenuated and persisting at the site of inoculation in the skin demonstrates that attenuation per se is not a sufficient criterion by which to determine utility. Against an aerosol challenge, all mice immunized with mutant OFTT0918 survived longer than any of those immunized with LVS.

In vitro, mutant OFTT0918 was better able to survive and replicate in PEC
than SCHU AV (Table 1). However, it was much more susceptible than the latter to peroxynitrite-mediated killing (Table 8).

It is understood that the examples described above in no way serve to limit the true scope of this invention, but rather are presented for illustrative purposes.

References:

Inclusion of a reference is neither an admission nor a suggestion that it is relevant to the patentability of anything disclosed herein Sjostedt A. Virulence determinants and protective antigens of Francisella tularensis. Curr OpinMicrobiol 2003;6: 66-71.

Eigelsbach HT, Downs C. Prophylactic effectiveness of live and killed tularemia vaccines. I. Production of vaccine and evaluation in the white mouse and guinea pig. J Immunol 1961; 87:415-25.

Saslaw S, Eigelsbach HT, Prior JA, Wilson HE, Carhart S. Tularemia vaccine study II. Respiratory challenge. Arch Int Med 1961;107: 702-14.

Saslaw S, Eigelsbach HT, Wilson HE, Prior JA, Carhart S. Tularemia vaccine study. I. Intracutaneous challenge. Arch Int Med 1961;107: 689-701.

Burke D S. Immunization against tularemia: Analysis of the effectiveness of live Francisella tularensis vaccine in prevention of laboratory-acquired tularemia. J Infect Dis 1977;135:55-60.

Conlan JW. 2004. Vaccines against Francisella tularensis-past, present and future. Expert Review of Vaccines. 3: 307-314.

Eigelsbach HT, Tulis J, Overholt EL, Griffith WR. Aerogenic immunization of the monkey and guinea pig with live tularemia vaccine. Proc. Soc Exptl Biol Med 1961;108: 732-34.

Hornick RB, Eigelsbach HT. Aerogenic immunization of man with live tularemia vaccine. Bact Revs1966; 30:532-38.

Conlan JW, Shen H, KuoLee R, Zhao X, and Chen W. 2005. Aerosol-, but not intradermal- immunization with the live vaccine strain of Francisella tularensis protects mice against subsequent aerosol challenge with a highly virulent type A strain of the pathogen by an a(3 T cell- and interferon gamma- dependent mechanism. Vaccine 2005; 23: 2477-2485.

Johansson A, Ibrahim A, Goransson I, Eriksson U, Gurycova D, Clarridge JE, Sjostedt A. Evaluation of PCR-based methods for discrimination of Francisella species and subspecies and development of a specific PCR that distinguishes the two major subspecies of Francisella tularensis. J Clin Micro 2000; 38: 4180-85.

Golovliov I, Sjostedt A, Mokrievich A, Pavlov V. A method for allelic replacement in Francisella tularensis. FEMS Microbiol Lett 2003; 222: 273-280.

Conlan JW, Chen W, Shen H, Webb A, KuoLee R. Experimental tularemia in mice challenged by aerosol or intradermally with virulent strains of Franciselia tularensis: Bacteriologic and histopathologic studies. Microb Pathog 2003;34:
239-48.

Golovliov, I., Ericsson, M., Sandstrom, G., Tarnvik, A., and Sj6stedt, A.
Identification of proteins of Francisella tularensis induced during growth in macrophages and cloning of the gene encoding a prominently induced 23-kilodalton protein. Infect Immun 1997; 65, 2183-2189.

Lai X, Golovliov I, Sjostedt A. Expression of IgIC is necessary for intracellular growth and induction of apoptosis in murine macrophages by Francisella tularensis. Microbial Pathogenesis 2004; 37: 225-30.

Lindgren H, Golovliov I, Baranov V, Ernst RK, Telepnev M, Sjostedt A.
Factors affecting the escape of Francisella tularensis from the phagolysosome. J Med Micro 2004; 53: 1-6.

Lauriano CM, Barker JR, Yoon S-S, Nano FE, Arulanandam BP, Hassett DJ, Klose KE. MgIA regulates transcription of virulence factors necessary for Francisella tularensis intraamoebae and intramacrophage survival. PNAS
2004; 101: 4246-4249.

Table 1. Viable counts in PEC infected with the indicated F. tularensis straina.

Bacterial strain a No. of bacteria (Iogio SD)b Oh 6h 12h 24h SCHU S4 2.5 2.4 4.6 3.1 FSCO43/SCHU AV 2.4 0.8* 1.9* < 0.5'' AFTT0918 2.7 2.6 3.6 3.3 a The indicated F. tularensis strain was allowed to infect the cells at MOI
100.
b Data represent the mean logio CFU SD of 3 cultures.
* Indicates that the CFU is significantly higher (p<0.05, Wilcoxon asymptotic test) than the value at 0 h.

Table 2. Growth of F. tularensis strains in host tissues following intradermal inoculation of the pathogen.

F. tularensis Intradermal Log,o SD CFU of Francisella in tissues on day strain inoculum 4 of infection (n=3)a skin liver spleen SCHU AV 106 CFU 4.00 0.48 3.81 0.08 4.57 0.09 LVS 106 CFU 6.28 0.21 5.76 0.50 5.88 0.47 AigIC mutant 106 CFU 5.31 0.43 2.30 (1/3)b 3.09 0.69 SCHU S4 102 CFU 7.37 0.40 7.09 0.83 7.77 0.91 LVS 102 CFU 6.65 0.58 3.65 1.10 4.37 (2/3)c OFTT0918 102 CFU 5.66 0.73 3.50 0.29 4.36 1.33 mutant a In separate experiments, mice were inoculated intradermally with either 106 or 102 CFU of the stated F. tularensis strain. Mice were killed on day 4 of infection and bacterial burdens determined.
b, Bacteria only detected in 1/3 organs;
, Bacteria only detected in 2/3 organs (lower detection limit = 200 CFU
/organ).

Table 3. Growth of F. tularensis strains in host tissues following intravenous inoculation of the pathogen.

Logio SD CFU F. tularensis/organ (n=3) F. tularensis strain lung liver spleen blood*
FSC033 (type A) >8.0 >9.0 >9.0 >8.0 FSC108 (type B) 3.97 7.26 7.35 3.58 0.77 0.34 0.32 0.20 LVS (attenuated type B) 2.31 5.03 5.18 <2.00 (0/3) 1.02 0.12 0.12 SCHU AV (attenuated type A) <1.3 (0/3) <2.3 (2/3) 3.16 <2.00 (0/3) 0.66 aApproximately 100 CFU of the indicated strains of F. tularensis were intravenously inoculated into BALB/c mice (n=3 per group), and bacterial burdens in organs on day 3 of infection were determined.
b CFU/mi of blood. Numbers in parentheses indicate proportion of organs infected.

Table 4. Protective immunity against strain FSC033 (type A; subsp.
tularensis) elicited by intradermal immunization with LVS or SCHU W.
Immunizing Challenge route Individual times Median time strain and dose to death (days) to death (days) None i.d. 10 CFU 5,5,6,6,6 6 LVS i.d. 1000 CFU 5,>35,>35,>35,> >35 SCHU AV i.d. 1000 CFU 11,12,>35,>35,> >35 None aerosol -10 CFU 5,5,5,5,6 5 LVS aerosol -10 CFU 6,6,11,13, >35 11 SCHU AV aerosol -10 CFU 5,7,>35,>35,>35 >35 5 aMice immunized 77 days earlier by id inoculation with 106 CFU LVS or SCHU
AV and age-matched controls were challenged intradermally or by aerosol with various doses of virulent type A F. tularensis strain 33, and survival monitored.

Table 5. Growth of virulent strain FSC033 in organs of control mice and mice vaccinated with LVS or SCHU W.

Immunizing Francisella burden on day 3 of infection (mean logio strain SD) Lungs liver Spleen None 5.18 2.03 7.49 0.86 8.33 1.13 LVS <1.30 (0/3) 2.91 0.41 3.62 0.25 SCHU AV <1.3 (0/3) <2.25 (1/3) 2.63 1.74 a, mice (n=3 / group) immunized 120 days earlier with 106 CFU of LVS or SCHU AV were challenged intradermally 120 days later with 150 CFU of F.
tularensis type A strain FSC033. Mice were killed on day 3 of infection and Francisella burdens in livers, spleens, and lungs determined. Numbers in parentheses show the proportion of organs infected.

Table 6. Differentially expressed proteins Spot No.a MW, p/ Observ Masco Seque Protein Product (FTT No.) Theoretic ed MW, t nce b aic pid Score Cover e agef Protein Spots Not Observed in SCHU AV

Protein Name9 Protein i.d..h 2(1355) 22.1, 6.77 18.2, 132 20 Conserved YP 170 6.05 hypothetical protein 307.1 6 (0049 / 55.1, 4.49 61.4, 774 41 N utilization YP 169 0192) 66.2, 5.55 4.85 60 3 substance protein A 124.1 61.4, Lysyl-tRNA YP_169 4.85 synthetase 253.1 22 (0655) 26.8,4.68 34.9, 450 41 Hypothetical protein YP_169 4.70 673.1 28 (0409) 49.6,5.77 50.0, 108 18 Glycine cleavage YP_169 system P protein, 6.16 subunit 1 454.1 30 (0918) 58.7,4.75 56.6,4. 263 14 Hypothetical protein YP_169 45 915.1 31 66.9,5.49 67.0,5. 826 42 Aspartyl-tRNA YP_169 (0007/112 63.0,5.46 85 493 35 synthetase 088.1 9c) 67.0,5. Cyanophycin YP_170 85 synthetase 102.1 Protein S ots with de reased bundanc in SC U AV

19 82.4, 5.37 83.0, 709 35 Peroxidase/catalas P 1697 (0721c) 5.61 e 5.1 21 25.8, 5.36 26.2, 202 27 Lactam utilization P 1692 (0223c) 5.72 protein 8.1 29 (0036 / 46.2,5.61 47.5,5. 431 27 NADH P 1691 0438) 51.5,5.58 99 167 10 dehydrogenase I, F 2.1 47.5,5. subunit P 1694 99 U D P-N- 8.1 acetylmuramate: L-alanyl-gamma-D-glutamyl- me so-diaminopimelate ligase Protein S ots Unique y expres ed in S HU AV

35 (0918 / 58.7,4.75 55.0,5. 211 11 Hypothetical protein P_1699 0919) 52.8,5.16 02 252 14 Hypothetical protein 15.1 55.0,5. YP 1699 02 16.1 Proteins were identified by LC-MS/MS. Mascot (Matrix Science, London, UK) was then used to match the MS/MS spectra against the translated Francisella genome sequence (Refseq : NC_006570). Proteins listed are those that were observed to be differentially expressed when comparing the proteome maps of strains SCHU S4 and SCHU AV.

a Number used to annotate spot on 2DE proteome maps b Francisella genome locus tag (FTTxxxx) c Theoretical molecular mass (kDa) and pl, calculated from the amino acid sequence of the translated open reading frame d Experimental molecular mass (kDa) and pl, estimated using PDQuest software e Total Mascot Score for peptides identified. A score of >30 was required for positive identification each individual polypeptide f Sequence coverage, based on the peptides identified 9 Name of identified protein, based upon Francisella genome sequence h Accession number according to the NCBI

Table 7. Protective immunity against strain FSC033 (type A; subsp.
tularensis) elicited by intradermal immunization with LVS or defined mutants of SCHU S4.

Immunizing strain Challenge route Individual times to Median time (dose) and dose death (days) to death (days) None i.d. 10 CFU 4,4,5,5,5 5 LVS (106) i.d. 500 CFU >35,>35,>35,>35,>3 >35 AFTT0918 mutant i.d. 500 CFU >35,>35,>35,>35,>3 >35 (105-6) 5 Dig/C mutant i.d. 500 CFU 4,7,7,7,8 7 (106) None aerosol -10 4,5,5,5,5 5 CFU
LVS (107) aerosol -10 5,7,7,7 7 CFU
OFTT0918 mutant aerosol -10 9,11,11,19, >30,>30 15 (105-6) CFU
AigIC mutant aerosol -10 5,5,6,6,6 6 (10') CFU

aMice (n = 4 - 6) immunized by intradermal inoculation with the indicated strain and age-matched control mice were challenged intradermally 8 weeks later with -500 CFU of type A strain FSC033, or by aerosol 9 weeks later with -10 CFU of FSC033 and survival monitored.

Table 8. Survival of F. tularensis strains in PBS when exposed to SIN-1.
Bacterial strain SIN-1 No. of bacteria (logio CFU)a Oh 4h SCHU S4 - 6.9 7.0 SCHU S4 + 6.9 6.6 FSC043 - 6.9 6.9 FSC043 + 6.9 6.3 AFTT0918 - 6.7 6.4 OFTT0998 + 6.7 4.1*

' F. tularensis bacteria were exposed to SIN-1 (0.8 mM) for 4 h at 37 C.
Thereafter, viable counts were determined by plating of bacteria.

* indicates that P < 0.05 according to Wilcoxon's non-parametric test when compared to SIN-1-treated SCHU Stt bacteria.

Table 9 Nucleotide sequence of FTT0998 The gene sequence has been deposited as part of the complete genome of Francisella tularensis strain SCHU S4 (accession number AJ749949).
The deduced protein has the identification CAG45551.1.
Number of nucleotides: 1674 Number of putative encoded amino acids: 557 Molecular weight: 58713.5 The following information is contained in GenBank:
Position: 927667..929340 /locus_tag="FTT0918"
/note="ORF ftt0918"
/codon_start=1 /transl_table=11 /product="hypothetical protein"
/protei n_id="CAG45551.1 "
/db_xref="G1:56604511 "
/db xref="UniProt/TrEMBL:Q5NGCT' GTGGTGCGTAAATTTAAAAAAACCTGTTTGATAGTTAGTAGTTTATTGGCT
TGTAGTGGTTTAGCTTATTCTGAAGATTCTCCTCAAGTTGTTTCACAAGG
GGGGCCTCTTGGAGCTACTAGTATTGGTGATCAAAACCTTGGACAGCCA
GATCCAAATGCTAGTGGAGCCTCTTCAACAACACAGACTACCGGTTCAAA
TCTAAATGATAGGGAACTTTTGCTAAAATTACAGCAGCAGGTACAGCAAC
TTCAG G GACAATTACAACAG CTAAAAG CACAG G GTAATG GTG G TG G ATT
ACAGAATACCTATAATGGTAGTTCGCAGTTTACTACTTACAGCTCAAAAGT
TGATGGTAATAAAAATCCTCGTACGCTTGGAGGCAATGGTGAGAGTAAA
GATCTGAGTCAGGCTTTGATTGGTGGTCAAACGTCGTCAGATATTATGGG
GAATGTTAATGCTAGTAACTCTATCATTAATTTAGCTTCTGAGCCATTAGG
AGGCGTCTTTAACCAAAAAGGCGGTATCGACGTTGGTGGAGCTCCGGCG
ATTACAACACAAGGTCAAGTTACCTACTTAGGTTCGTACTCTGGTAACAA
CAGTATTCCAATTGGTCAGATTTCTTCTAACCTTTTTGCTTCTACATTGTT
GGGTCAAAGAGAGAAGTTTGATGACTACTCTGTATTCTTTGGTGGCTTTA
TAGAAGCAGATGCCCAAGCTTGGTTTGGTAGTGCTGTTACTAAGGTGCA
AAATGCTGGCCAGTTATCTAGCAATGGCCAAAATATATATTTAACATCAG
CTAATTTATATTTCTTATCAAATCTTGGTCATTATGTAACAGCTCAGTTTGA
TTTTGATACTAATGAGTCAGGAAGTTTTAGTTTAGGTAATGCTTTTGTAAT
TTTTGGTAACTTAGATATATCACCATTCTTCGTAACAGCAGGTAGAAACAA
GCTATCTGTTGGCTCATATGGTGGTGGTGGTACTTGGACTAGCGGTATC
ACCAAATTTCTATCACCAAATCAGGTTACTAACGTATCTATTGACTATAAA
GATCAAGTCTGGAACGCCAACATTGCAGTATTTGGCTCTGATGATAGACG
TGCAAACTTCTCAACAGGTTTATTCTATGCTGATAGCTGGACACCAAACT

TAGCGGCTGGTTTTAACGTAGGTTATGTCTTTAATATTGCTGGTGCTGGT
AACTCTTCGATTGCTAACTCATTAGCTAACTTAAATCGTAGTAGTGATAAT
GTG G G AG CTTTAAACGTTGAC G G CAACTTAACTTATG CAATTTG G GATG G
ATTTTTAAACTTAGGAGCAGGTTGGGCTAGTACTACGACAAAAGAAGATT
TTAATAATAATGGTGGTAGTGTACTTGCTGGGGCATGGTATGGAGCACTT
AACTATTCTGCGATACTTGGTGGTAGAAATACTAACTTCGGTGTGACTTA
TGGTCAATCATATAATGCTGCAGCTATCCCAATGGAGACAGCAAATGCTT
CACCAACTTTCGGTCAAACAGCATCTGGTATCAAACAGCAACTTATCTTC
TCGGCTCAGCGAGCTTACTTTGATGACAATGTTCTATTTGGTCCTGAATA
TGCGTATCAAAGACTATATACTGGCGAACATATGAATACAATTACTCTGG
ATATGTCGGTATACGTATAA

Putative amino acid sequence:
MVRKFKKTCLIVSSLLACSGLAYSEDSPQVVSQGGPLGATSIGDQNLGQPD
PNASGASSTTQTTGSNLNDRELLLKLQQQVQQLQGQLQQLKAQGNGGGLQ
NTYNGSSQFTTYSSKVDGNKNPRTLGGNGESKDLSQALIGGQTSSDIMGNV
NASNSI INLASEPLGGVFNQKGGIDVGGAPAITTQGQVTYLGSYSGNNSIPIG
QISSNLFASTLLGQREKFDDYSVFFGGFIEADAQAWFGSAVTKVQNAGQLS
SNGQNIYLTSANLYFLSNLGHYVTAQFDFDTNESGSFSLGNAFVIFGNLDISP
FFVTAGRNKLSVGSYGGGGTWTSGITKFLSPNQVTNVSIDYKDQVWNANIA
VFGSDDRRANFSTGLFYADSWTPNLAAGFNVGYVFNIAGAGNSSIANSLAN
LNRSSDNVGALNVDGNLTYAIWDGFLNLGAGWASTTTKEDFNNNGGSVLA
GAWYGALNYSAILGGRNTNFGVTYGQSYNAAAIPMETANASPTFGQTASGI
KQQLIFSAQRAYFDDNVLFGPEYAYQRLYTGEHMNTITLDMSVYV

Claims

1. A mutant of Francisella tularensis that has attenuated virulence and that has a mutation in the nucleotide sequence FTT0918.

2. A mutant of Francisella tularensis wherein the nucleotide sequence that encodes putative peroxynitrite resistance protein A (prpA) in wild-type Francisella tularensis is mutated, resulting in attenuated virulence.

3. A mutant as claimed in claim 1 or 2 wherein the mutation is such that the mutant is substantially lacking functional prpA.

4. A mutant as claimed in claim 1 or 2 that is derived from the SCHU S4 strain of Francisella tularensis.

5. A mutant as claimed in claim 1 or 2, wherein the mutation is a deletion of at least one nucleotide, and at most all of the nucleotides, in the nucleotide sequence.

6. A mutant as claimed in claim 1 or 2, wherein the mutation is an insertion of at least one nucleotide in the nucleotide sequence.

7. A mutant as claimed in claim 1 or 2, wherein the mutation is a substitution of at least one nucleotide in the nucleotide sequence.

8. A mutant as claimed in claim 1 or 2, wherein the mutation is a shift in the reading frame of the nucleotide sequence.

9. A mutant as claimed in claim 1 or 2, further comprising at least one mutation in at least one nucleotide sequence other than FTT0918.

10. A mutant of Francisella tularensis wherein the nucleotide sequence that encodes the putative peroxynitrite resistance protein A (prpA) in wild-type Francisella tularensis is mutated, resulting in attenuated virulence.

11.An immunogenic composition or vaccine comprising a mutant according to claim 1 or 2 and a pharmaceutically acceptable diluent, carrier, vehicle or excipient.

12.An immunogenic composition or vaccine as claimed in claim 10 for the immunization of a human or other mammal against virulent strains of F.
tularensis.

13. An immunogenic composition or vaccine as claimed in claim 10 wherein the mutant is alive.

14. An immunogenic composition or vaccine as claimed in claim 11 for the immunization of a human or other mammal against intradermal challenge by virulent strains of F. tularensis.

15. An immunogenic composition or vaccine as claimed in claim 11 for the immunization of a human or other mammal against aerosol challenge by virulent strains of F. tularensis.

16. A method of reducing the susceptibility of humans or other mammals to infection by virulent strains of F. tularensis comprising the step of exposing a human or other mammal to a sufficient amount of the immunogenic composition or vaccine of claim 10 so as to reduce the susceptibility of the human or other mammal to infection by virulent F.
tularensis.

17. A method of producing a mutant as claimed in claim 1, comprising the steps of:
a) obtaining cells of a virulent F. tularensis strain;
b) mutating the FTT0918 nucleotide sequence;
c) selecting for viable cells with attenuated virulence and FTT0918 mutations; and d) isolating said cells with attenuated virulence and FTT0918 mutations.

18. A method as claimed in claim 16 wherein the virulent F. tularensis strain is SCHU S4.

19. A method as claimed in claim 16 wherein the viable cells are substantially lacking in functional prpA.

20.A method of producing a mutant as claimed in claim 2, comprising the steps of:
a) obtaining cells of a virulent F. tularensis strain;
b) mutating the nucleotide sequence that encodes putative peroxynitrite resistance protein A (prpA);
c) selecting for viable cells with attenuated virulence and mutations in the nucleotide sequence that encodes prpA; and d) isolating said cells with attenuated virulence and mutations in the nucleotide sequence that encodes prpA.

21.A method as claimed in claim 20 wherein the virulent F. tularensis strain is SCHU S4.

22. A method as claimed in claim 20 wherein the viable cells are substantially lacking in functional prpA.

23.A method as claimed in claim 20 wherein the nucleotide sequence is FTT0918.

We claim:

1. A mutant of Francisella tularensis that has a mutation in the nucleotide sequence FTT0918, resulting in a lack of functional putative peroxynitrite resistance protein A (prpA) and attenuated virulence.

2. A mutant of Francisella tularensis wherein the nucleotide sequence that encodes putative peroxynitrite resistance protein A (prpA) in wild-type Francisella tularensis is mutated, resulting in a lack of functional prpA and attenuated virulence.

3. A mutant as claimed in claim 1 or 2 that is derived from the SCHU S4 strain of Francisella fularensis.

4. A mutant as claimed in claim 1 or 2, wherein the mutation is a deletion of at least one nucleotide, and at most all of the nucleotides, in the nucleotide sequence.

5. A mutant as claimed in claim 9 or 2, wherein the mutation is an insertion of at least one nucleotide in the nucleotide sequence.

6. A mutant as claimed in claim 1 or 2, wherein the mutation is a substitution of at least one nucleotide in the nucleotide sequence.

7. A mutant as claimed in claim 1 or 2, wherein the mutation is a shift in the reading frame of the nucleotide sequence.

8. A mutant as claimed in claim 1 or 2, further comprising at least one mutation in at least one nucleotide sequence other than FTT0918.

9. An immunogenic composition or vaccine comprising a mutant according to claim 1 or 2 and a pharmaceutically acceptable diluent, carrier, vehicle or excipient.

10. An immunogenic composition or vaccine as claimed in claim 9 for the immunization of a human or other mammal against virulent strains of F.
tularensis.

11. An immunogenic composition or vaccine as claimed in claim 9 wherein the mutant is alive.

12.An immunogenic composition or vaccine as claimed in claim 9 for the immunization of a human or other mammal against intradermal challenge by virulent strains of F. tularensis.

13. An immunogenic composition or vaccine as claimed in claim 9 for the immunization of a human or other mammal against aerosol challenge by virulent strains of F. tularensis.

14. A method of reducing the susceptibility of humans or other mammals to infection by virulent strains of F. tularensis comprising the step of exposing a human or other mammal to a sufficient amount of the immunogenic composition or vaccine of claim 10 so as to reduce the susceptibility of the human or other mammal to infection by virulent F.
tularensis.

15.A method of producing a mutant as claimed in claim 1, comprising the steps of:
a) obtaining cells of a virulent F, tularensis strain;
b) mutating the FTT0918 nucleotide sequence;
c) selecting for viable cells with attenuated virulence and FTT0918 mutations: and d) isolating said cells with attenuated virulence and FTT0918 mutations.

16. A method as claimed in claim 15 wherein the virulent F. tularensis strain is SCHU S4.

17. A method as claimed in claim 15 wherein the nucleotide sequence is as shown in Table 9.

18. A method of producing a mutant as claimed in claim 2, comprising the steps of:
a) obtaining cells of a virulent F. tularensis strain;
b) mutating the nucleotide sequence that encodes putative peroxynitrite resistance protein A (prpA);
c) selecting for viable cells with attenuated virulence and mutations in the nucleotide sequence that encodes prpA; and d) isolating said cells with attenuated virulence and mutations in the nucleotide sequence that encodes prpA.

19. A method as claimed in claim 18 wherein the virulent F. tularentis strain is SCHU S4.

20.A method as claimed in claim 18 wherein the nucleotide sequence is as shown in Table 9.