CA2540103A1 - Selective inhibition of nf-kappab activation by peptides designed to disrupt nemo oligomerization - Google Patents
Selective inhibition of nf-kappab activation by peptides designed to disrupt nemo oligomerization Download PDFInfo
- Publication number
- CA2540103A1 CA2540103A1 CA002540103A CA2540103A CA2540103A1 CA 2540103 A1 CA2540103 A1 CA 2540103A1 CA 002540103 A CA002540103 A CA 002540103A CA 2540103 A CA2540103 A CA 2540103A CA 2540103 A1 CA2540103 A1 CA 2540103A1
- Authority
- CA
- Canada
- Prior art keywords
- seq
- polypeptide
- nemo
- fusion construct
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 373
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 256
- 238000006384 oligomerization reaction Methods 0.000 title claims abstract description 42
- 230000005764 inhibitory process Effects 0.000 title claims description 45
- 230000034190 positive regulation of NF-kappaB transcription factor activity Effects 0.000 title 1
- 229920001184 polypeptide Polymers 0.000 claims abstract description 147
- 238000000034 method Methods 0.000 claims abstract description 57
- 102000040430 polynucleotide Human genes 0.000 claims abstract description 36
- 108091033319 polynucleotide Proteins 0.000 claims abstract description 36
- 239000002157 polynucleotide Substances 0.000 claims abstract description 36
- 230000019491 signal transduction Effects 0.000 claims abstract description 24
- 208000005623 Carcinogenesis Diseases 0.000 claims abstract description 9
- 210000003719 b-lymphocyte Anatomy 0.000 claims abstract description 9
- 230000036952 cancer formation Effects 0.000 claims abstract description 9
- 231100000504 carcinogenesis Toxicity 0.000 claims abstract description 9
- 208000036142 Viral infection Diseases 0.000 claims abstract description 8
- 230000007503 antigenic stimulation Effects 0.000 claims abstract description 8
- 230000028709 inflammatory response Effects 0.000 claims abstract description 8
- 230000009385 viral infection Effects 0.000 claims abstract description 8
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 6
- 210000004027 cell Anatomy 0.000 claims description 99
- 230000000694 effects Effects 0.000 claims description 50
- 230000004927 fusion Effects 0.000 claims description 49
- 150000001413 amino acids Chemical class 0.000 claims description 39
- 239000000203 mixture Substances 0.000 claims description 36
- 235000001014 amino acid Nutrition 0.000 claims description 35
- 241000282414 Homo sapiens Species 0.000 claims description 29
- 230000037361 pathway Effects 0.000 claims description 28
- 238000010361 transduction Methods 0.000 claims description 19
- 230000026683 transduction Effects 0.000 claims description 19
- 230000002401 inhibitory effect Effects 0.000 claims description 16
- 238000001943 fluorescence-activated cell sorting Methods 0.000 claims description 14
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 14
- 230000001105 regulatory effect Effects 0.000 claims description 13
- 239000003814 drug Substances 0.000 claims description 12
- 239000003937 drug carrier Substances 0.000 claims description 11
- 238000002372 labelling Methods 0.000 claims description 10
- 238000002360 preparation method Methods 0.000 claims description 10
- 125000006850 spacer group Chemical group 0.000 claims description 9
- 230000006907 apoptotic process Effects 0.000 claims description 8
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims description 8
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 8
- 238000004113 cell culture Methods 0.000 claims description 7
- 230000001419 dependent effect Effects 0.000 claims description 7
- 238000012544 monitoring process Methods 0.000 claims description 7
- 230000004700 cellular uptake Effects 0.000 claims description 6
- 230000000699 topical effect Effects 0.000 claims description 6
- 238000007912 intraperitoneal administration Methods 0.000 claims description 5
- 210000004698 lymphocyte Anatomy 0.000 claims description 5
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 4
- 230000004663 cell proliferation Effects 0.000 claims description 4
- 230000000295 complement effect Effects 0.000 claims description 4
- 238000000338 in vitro Methods 0.000 claims description 4
- 238000005406 washing Methods 0.000 claims description 4
- 108700008625 Reporter Genes Proteins 0.000 claims description 3
- 239000013598 vector Substances 0.000 claims description 3
- 210000003527 eukaryotic cell Anatomy 0.000 claims description 2
- 244000005700 microbiome Species 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 16
- 238000011282 treatment Methods 0.000 abstract description 15
- 230000025915 regulation of apoptotic process Effects 0.000 abstract description 5
- 230000033228 biological regulation Effects 0.000 abstract description 4
- 230000025053 regulation of cell proliferation Effects 0.000 abstract description 4
- 101710090077 NF-kappa-B essential modulator Proteins 0.000 description 202
- 102100022219 NF-kappa-B essential modulator Human genes 0.000 description 202
- 238000001994 activation Methods 0.000 description 49
- 230000004913 activation Effects 0.000 description 48
- 108090000623 proteins and genes Proteins 0.000 description 34
- 239000002158 endotoxin Substances 0.000 description 31
- 229920006008 lipopolysaccharide Polymers 0.000 description 31
- 229940024606 amino acid Drugs 0.000 description 30
- 230000000875 corresponding effect Effects 0.000 description 25
- 108700031308 Antennapedia Homeodomain Proteins 0.000 description 24
- 235000018102 proteins Nutrition 0.000 description 23
- 102000004169 proteins and genes Human genes 0.000 description 23
- 241001529936 Murinae Species 0.000 description 20
- 230000035772 mutation Effects 0.000 description 17
- 238000009396 hybridization Methods 0.000 description 16
- 230000030833 cell death Effects 0.000 description 15
- 239000000463 material Substances 0.000 description 15
- 239000000243 solution Substances 0.000 description 14
- 230000027455 binding Effects 0.000 description 13
- 230000004044 response Effects 0.000 description 13
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 12
- 150000001875 compounds Chemical class 0.000 description 12
- 238000002474 experimental method Methods 0.000 description 12
- 239000012634 fragment Substances 0.000 description 11
- 239000003112 inhibitor Substances 0.000 description 11
- 108091028043 Nucleic acid sequence Proteins 0.000 description 10
- MCYTYTUNNNZWOK-LCLOTLQISA-N penetratin Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CC=CC=C1 MCYTYTUNNNZWOK-LCLOTLQISA-N 0.000 description 10
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 10
- 101100107610 Arabidopsis thaliana ABCF4 gene Proteins 0.000 description 9
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 9
- 101100068078 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GCN4 gene Proteins 0.000 description 9
- 238000003556 assay Methods 0.000 description 9
- 239000000872 buffer Substances 0.000 description 9
- 239000000523 sample Substances 0.000 description 9
- 230000001413 cellular effect Effects 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- 239000002552 dosage form Substances 0.000 description 8
- 230000003834 intracellular effect Effects 0.000 description 8
- 239000002609 medium Substances 0.000 description 8
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 7
- 210000004899 c-terminal region Anatomy 0.000 description 7
- 230000003993 interaction Effects 0.000 description 7
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- 108020004414 DNA Proteins 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 206010028980 Neoplasm Diseases 0.000 description 6
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 230000002209 hydrophobic effect Effects 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 6
- 239000002773 nucleotide Substances 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 238000006366 phosphorylation reaction Methods 0.000 description 6
- 239000000843 powder Substances 0.000 description 6
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 6
- 239000000725 suspension Substances 0.000 description 6
- 239000003826 tablet Substances 0.000 description 6
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 201000000582 Retinoblastoma Diseases 0.000 description 5
- 229920002472 Starch Polymers 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 201000011510 cancer Diseases 0.000 description 5
- 239000002775 capsule Substances 0.000 description 5
- -1 fatty acid esters Chemical class 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 239000008101 lactose Substances 0.000 description 5
- 235000005772 leucine Nutrition 0.000 description 5
- 230000007246 mechanism Effects 0.000 description 5
- 230000001404 mediated effect Effects 0.000 description 5
- 239000003921 oil Substances 0.000 description 5
- 235000019198 oils Nutrition 0.000 description 5
- 230000026731 phosphorylation Effects 0.000 description 5
- 229920001223 polyethylene glycol Polymers 0.000 description 5
- 230000000770 proinflammatory effect Effects 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- 235000019698 starch Nutrition 0.000 description 5
- 239000001993 wax Substances 0.000 description 5
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 4
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- 101000663002 Homo sapiens TNFAIP3-interacting protein 3 Proteins 0.000 description 4
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 4
- 238000000719 MTS assay Methods 0.000 description 4
- 231100000070 MTS assay Toxicity 0.000 description 4
- 102100031822 Optineurin Human genes 0.000 description 4
- 108091000080 Phosphotransferase Proteins 0.000 description 4
- 229930006000 Sucrose Natural products 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 102100037666 TNFAIP3-interacting protein 3 Human genes 0.000 description 4
- 238000010521 absorption reaction Methods 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 230000003110 anti-inflammatory effect Effects 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 238000000423 cell based assay Methods 0.000 description 4
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 4
- 238000010494 dissociation reaction Methods 0.000 description 4
- 230000005593 dissociations Effects 0.000 description 4
- 230000005284 excitation Effects 0.000 description 4
- 239000012894 fetal calf serum Substances 0.000 description 4
- 238000001914 filtration Methods 0.000 description 4
- 230000014509 gene expression Effects 0.000 description 4
- 239000008187 granular material Substances 0.000 description 4
- 239000003701 inert diluent Substances 0.000 description 4
- 239000000314 lubricant Substances 0.000 description 4
- 239000011159 matrix material Substances 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 238000002844 melting Methods 0.000 description 4
- 230000008018 melting Effects 0.000 description 4
- 230000003278 mimic effect Effects 0.000 description 4
- 238000002156 mixing Methods 0.000 description 4
- 231100000252 nontoxic Toxicity 0.000 description 4
- 230000003000 nontoxic effect Effects 0.000 description 4
- 239000008194 pharmaceutical composition Substances 0.000 description 4
- 102000020233 phosphotransferase Human genes 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 238000003752 polymerase chain reaction Methods 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 238000012552 review Methods 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 239000007909 solid dosage form Substances 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 239000005720 sucrose Substances 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- 239000000454 talc Substances 0.000 description 4
- 235000012222 talc Nutrition 0.000 description 4
- 229910052623 talc Inorganic materials 0.000 description 4
- 238000011144 upstream manufacturing Methods 0.000 description 4
- 239000000080 wetting agent Substances 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 101710149776 TNFAIP3-interacting protein 1 Proteins 0.000 description 3
- 102100037667 TNFAIP3-interacting protein 1 Human genes 0.000 description 3
- 102100037668 TNFAIP3-interacting protein 2 Human genes 0.000 description 3
- 101710149774 TNFAIP3-interacting protein 2 Proteins 0.000 description 3
- 108091023040 Transcription factor Proteins 0.000 description 3
- 102000040945 Transcription factor Human genes 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 238000002835 absorbance Methods 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 235000010443 alginic acid Nutrition 0.000 description 3
- 229920000615 alginic acid Polymers 0.000 description 3
- 235000003704 aspartic acid Nutrition 0.000 description 3
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 3
- 239000006172 buffering agent Substances 0.000 description 3
- 230000003833 cell viability Effects 0.000 description 3
- 229920002678 cellulose Polymers 0.000 description 3
- 239000001913 cellulose Substances 0.000 description 3
- 235000010980 cellulose Nutrition 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000008878 coupling Effects 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 238000005859 coupling reaction Methods 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 231100000135 cytotoxicity Toxicity 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 230000003111 delayed effect Effects 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 238000010828 elution Methods 0.000 description 3
- 239000002702 enteric coating Substances 0.000 description 3
- 238000009505 enteric coating Methods 0.000 description 3
- 239000000945 filler Substances 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 239000008297 liquid dosage form Substances 0.000 description 3
- 235000019359 magnesium stearate Nutrition 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 210000004897 n-terminal region Anatomy 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- 239000006187 pill Substances 0.000 description 3
- 229960004063 propylene glycol Drugs 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 238000011084 recovery Methods 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical compound O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 3
- 235000012239 silicon dioxide Nutrition 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 239000008247 solid mixture Substances 0.000 description 3
- 239000007921 spray Substances 0.000 description 3
- 239000008107 starch Substances 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 239000000829 suppository Substances 0.000 description 3
- 239000000375 suspending agent Substances 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 238000004448 titration Methods 0.000 description 3
- 239000013638 trimer Substances 0.000 description 3
- 238000005829 trimerization reaction Methods 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 108010039627 Aprotinin Proteins 0.000 description 2
- 244000105624 Arachis hypogaea Species 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 241000416162 Astragalus gummifer Species 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 229920002261 Corn starch Polymers 0.000 description 2
- 239000004606 Fillers/Extenders Substances 0.000 description 2
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 2
- 102000002464 Galactosidases Human genes 0.000 description 2
- 108010093031 Galactosidases Proteins 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 101000992283 Homo sapiens Optineurin Proteins 0.000 description 2
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 238000003820 Medium-pressure liquid chromatography Methods 0.000 description 2
- 101710131459 Optineurin Proteins 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 239000012979 RPMI medium Substances 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- 108010028723 SN50 peptide Proteins 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 239000012505 Superdex™ Substances 0.000 description 2
- 229920001615 Tragacanth Polymers 0.000 description 2
- 101800001690 Transmembrane protein gp41 Proteins 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 2
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 2
- XLOMVQKBTHCTTD-UHFFFAOYSA-N Zinc monoxide Chemical compound [Zn]=O XLOMVQKBTHCTTD-UHFFFAOYSA-N 0.000 description 2
- 239000002250 absorbent Substances 0.000 description 2
- 230000002745 absorbent Effects 0.000 description 2
- 239000003655 absorption accelerator Substances 0.000 description 2
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 235000010419 agar Nutrition 0.000 description 2
- 239000000783 alginic acid Substances 0.000 description 2
- 229960001126 alginic acid Drugs 0.000 description 2
- 150000004781 alginic acids Chemical class 0.000 description 2
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 229940124599 anti-inflammatory drug Drugs 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 229940041181 antineoplastic drug Drugs 0.000 description 2
- 229960004405 aprotinin Drugs 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 235000012216 bentonite Nutrition 0.000 description 2
- SESFRYSPDFLNCH-UHFFFAOYSA-N benzyl benzoate Chemical compound C=1C=CC=CC=1C(=O)OCC1=CC=CC=C1 SESFRYSPDFLNCH-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 229920002988 biodegradable polymer Polymers 0.000 description 2
- 239000004621 biodegradable polymer Substances 0.000 description 2
- 235000019437 butane-1,3-diol Nutrition 0.000 description 2
- 238000004422 calculation algorithm Methods 0.000 description 2
- 238000004364 calculation method Methods 0.000 description 2
- 239000001768 carboxy methyl cellulose Substances 0.000 description 2
- 238000010822 cell death assay Methods 0.000 description 2
- 238000001516 cell proliferation assay Methods 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 101150116749 chuk gene Proteins 0.000 description 2
- 229940110456 cocoa butter Drugs 0.000 description 2
- 235000019868 cocoa butter Nutrition 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 235000012343 cottonseed oil Nutrition 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 230000000368 destabilizing effect Effects 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- VHJLVAABSRFDPM-ZXZARUISSA-N dithioerythritol Chemical compound SC[C@H](O)[C@H](O)CS VHJLVAABSRFDPM-ZXZARUISSA-N 0.000 description 2
- 238000009510 drug design Methods 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- 235000019441 ethanol Nutrition 0.000 description 2
- MMXKVMNBHPAILY-UHFFFAOYSA-N ethyl laurate Chemical compound CCCCCCCCCCCC(=O)OCC MMXKVMNBHPAILY-UHFFFAOYSA-N 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 238000002875 fluorescence polarization Methods 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 239000007903 gelatin capsule Substances 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000002523 gelfiltration Methods 0.000 description 2
- 102000034238 globular proteins Human genes 0.000 description 2
- 108091005896 globular proteins Proteins 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 239000003906 humectant Substances 0.000 description 2
- 239000007943 implant Substances 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 2
- 239000007972 injectable composition Substances 0.000 description 2
- 230000008863 intramolecular interaction Effects 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 239000012139 lysis buffer Substances 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 239000004530 micro-emulsion Substances 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 238000002887 multiple sequence alignment Methods 0.000 description 2
- VMGAPWLDMVPYIA-HIDZBRGKSA-N n'-amino-n-iminomethanimidamide Chemical compound N\N=C\N=N VMGAPWLDMVPYIA-HIDZBRGKSA-N 0.000 description 2
- 239000000346 nonvolatile oil Substances 0.000 description 2
- 239000002674 ointment Substances 0.000 description 2
- 239000004006 olive oil Substances 0.000 description 2
- 239000006072 paste Substances 0.000 description 2
- 108010043655 penetratin Proteins 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 239000002304 perfume Substances 0.000 description 2
- 239000008363 phosphate buffer Substances 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 239000013615 primer Substances 0.000 description 2
- 230000001902 propagating effect Effects 0.000 description 2
- 239000003380 propellant Substances 0.000 description 2
- 230000004853 protein function Effects 0.000 description 2
- BOLDJAUMGUJJKM-LSDHHAIUSA-N renifolin D Natural products CC(=C)[C@@H]1Cc2c(O)c(O)ccc2[C@H]1CC(=O)c3ccc(O)cc3O BOLDJAUMGUJJKM-LSDHHAIUSA-N 0.000 description 2
- 239000003340 retarding agent Substances 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 239000008159 sesame oil Substances 0.000 description 2
- 235000011803 sesame oil Nutrition 0.000 description 2
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- 229910001415 sodium ion Inorganic materials 0.000 description 2
- 238000001179 sorption measurement Methods 0.000 description 2
- 239000008223 sterile water Substances 0.000 description 2
- 239000003206 sterilizing agent Substances 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 239000007929 subcutaneous injection Substances 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 239000003765 sweetening agent Substances 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 239000012049 topical pharmaceutical composition Substances 0.000 description 2
- 235000010487 tragacanth Nutrition 0.000 description 2
- 239000000196 tragacanth Substances 0.000 description 2
- 229940116362 tragacanth Drugs 0.000 description 2
- 239000011701 zinc Substances 0.000 description 2
- 235000016804 zinc Nutrition 0.000 description 2
- 229910052725 zinc Inorganic materials 0.000 description 2
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical compound OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- 229940058015 1,3-butylene glycol Drugs 0.000 description 1
- ODVRLSOMTXGTMX-UHFFFAOYSA-N 1-(2-aminoethyl)pyrrole-2,5-dione Chemical compound NCCN1C(=O)C=CC1=O ODVRLSOMTXGTMX-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- VDJKJPMLWJWQIH-UHFFFAOYSA-M 5-ethylphenazin-5-ium;ethyl sulfate Chemical compound CCOS([O-])(=O)=O.C1=CC=C2[N+](CC)=C(C=CC=C3)C3=NC2=C1 VDJKJPMLWJWQIH-UHFFFAOYSA-M 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- 206010001497 Agitation Diseases 0.000 description 1
- 239000005995 Aluminium silicate Substances 0.000 description 1
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 1
- 239000005695 Ammonium acetate Substances 0.000 description 1
- 108090000672 Annexin A5 Proteins 0.000 description 1
- 102000004121 Annexin A5 Human genes 0.000 description 1
- 235000003276 Apios tuberosa Nutrition 0.000 description 1
- 235000003911 Arachis Nutrition 0.000 description 1
- 235000010777 Arachis hypogaea Nutrition 0.000 description 1
- 235000010744 Arachis villosulicarpa Nutrition 0.000 description 1
- 241000282461 Canis lupus Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 229920000623 Cellulose acetate phthalate Polymers 0.000 description 1
- 108010038061 Chymotrypsinogen Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- 102000018832 Cytochromes Human genes 0.000 description 1
- 108010052832 Cytochromes Proteins 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 1
- BVTJGGGYKAMDBN-UHFFFAOYSA-N Dioxetane Chemical class C1COO1 BVTJGGGYKAMDBN-UHFFFAOYSA-N 0.000 description 1
- 101100508533 Drosophila melanogaster IKKbeta gene Proteins 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 1
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 1
- 241000206672 Gelidium Species 0.000 description 1
- 206010056740 Genital discharge Diseases 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Polymers OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 1
- 239000004705 High-molecular-weight polyethylene Substances 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000958041 Homo sapiens Musculin Proteins 0.000 description 1
- 101000973618 Homo sapiens NF-kappa-B essential modulator Proteins 0.000 description 1
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 1
- 241000725303 Human immunodeficiency virus Species 0.000 description 1
- 208000011612 Hypohidrotic ectodermal dysplasia with immunodeficiency Diseases 0.000 description 1
- 102000001284 I-kappa-B kinase Human genes 0.000 description 1
- 108060006678 I-kappa-B kinase Proteins 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 206010022680 Intestinal ischaemia Diseases 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 235000019759 Maize starch Nutrition 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 240000003183 Manihot esculenta Species 0.000 description 1
- 235000016735 Manihot esculenta subsp esculenta Nutrition 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 101000663001 Mus musculus TNFAIP3-interacting protein 1 Proteins 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- 108010057466 NF-kappa B Proteins 0.000 description 1
- 102000003945 NF-kappa B Human genes 0.000 description 1
- 240000007817 Olea europaea Species 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 108010058846 Ovalbumin Proteins 0.000 description 1
- 108020002230 Pancreatic Ribonuclease Proteins 0.000 description 1
- 102000005891 Pancreatic ribonuclease Human genes 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 239000004264 Petrolatum Substances 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 229940079156 Proteasome inhibitor Drugs 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 235000004443 Ricinus communis Nutrition 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 235000019485 Safflower oil Nutrition 0.000 description 1
- 241000607729 Salmonella enterica subsp. enterica serovar Abortus Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- SSZBUIDZHHWXNJ-UHFFFAOYSA-N Stearinsaeure-hexadecylester Natural products CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCCCC SSZBUIDZHHWXNJ-UHFFFAOYSA-N 0.000 description 1
- 101710192266 Tegument protein VP22 Proteins 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102100040247 Tumor necrosis factor Human genes 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- 239000001089 [(2R)-oxolan-2-yl]methanol Substances 0.000 description 1
- 238000000862 absorption spectrum Methods 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 235000012211 aluminium silicate Nutrition 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 229940043376 ammonium acetate Drugs 0.000 description 1
- 235000019257 ammonium acetate Nutrition 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 238000011319 anticancer therapy Methods 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 239000000440 bentonite Substances 0.000 description 1
- 229910000278 bentonite Inorganic materials 0.000 description 1
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 1
- 229960002903 benzyl benzoate Drugs 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 235000010216 calcium carbonate Nutrition 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 239000003560 cancer drug Substances 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical class OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000036978 cell physiology Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 229940081734 cellulose acetate phthalate Drugs 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 238000002983 circular dichroism Methods 0.000 description 1
- 239000004927 clay Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000010835 comparative analysis Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical class NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 229960001760 dimethyl sulfoxide Drugs 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical class CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 239000003221 ear drop Substances 0.000 description 1
- 229940047652 ear drops Drugs 0.000 description 1
- 208000034336 ectodermal dysplasia and immune deficiency Diseases 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 1
- 230000001804 emulsifying effect Effects 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 229940093499 ethyl acetate Drugs 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 239000003885 eye ointment Substances 0.000 description 1
- 210000000887 face Anatomy 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 238000012921 fluorescence analysis Methods 0.000 description 1
- 238000000198 fluorescence anisotropy Methods 0.000 description 1
- 230000004907 flux Effects 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 238000003167 genetic complementation Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 1
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 1
- 231100000086 high toxicity Toxicity 0.000 description 1
- 102000057373 human IKBKG Human genes 0.000 description 1
- 102000046949 human MSC Human genes 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 229940031704 hydroxypropyl methylcellulose phthalate Drugs 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 229940102213 injectable suspension Drugs 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 230000009878 intermolecular interaction Effects 0.000 description 1
- 230000010189 intracellular transport Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 238000012933 kinetic analysis Methods 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 150000002614 leucines Chemical class 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- VTHJTEIRLNZDEV-UHFFFAOYSA-L magnesium dihydroxide Chemical compound [OH-].[OH-].[Mg+2] VTHJTEIRLNZDEV-UHFFFAOYSA-L 0.000 description 1
- 239000000347 magnesium hydroxide Substances 0.000 description 1
- 229910001862 magnesium hydroxide Inorganic materials 0.000 description 1
- 238000004890 malting Methods 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 230000034217 membrane fusion Effects 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- CQDGTJPVBWZJAZ-UHFFFAOYSA-N monoethyl carbonate Chemical compound CCOC(O)=O CQDGTJPVBWZJAZ-UHFFFAOYSA-N 0.000 description 1
- 210000000214 mouth Anatomy 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 210000003928 nasal cavity Anatomy 0.000 description 1
- 229940097496 nasal spray Drugs 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 231100000344 non-irritating Toxicity 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 230000005937 nuclear translocation Effects 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 239000003883 ointment base Substances 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 239000000668 oral spray Substances 0.000 description 1
- 229940041678 oral spray Drugs 0.000 description 1
- 229940092253 ovalbumin Drugs 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 235000019271 petrolatum Nutrition 0.000 description 1
- 229940066842 petrolatum Drugs 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920002647 polyamide Polymers 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 230000006659 positive regulation of apoptotic process Effects 0.000 description 1
- 231100000683 possible toxicity Toxicity 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000002987 primer (paints) Substances 0.000 description 1
- 210000001948 pro-b lymphocyte Anatomy 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 239000003207 proteasome inhibitor Substances 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 125000001453 quaternary ammonium group Chemical group 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000007076 release of cytoplasmic sequestered NF-kappaB Effects 0.000 description 1
- 238000012827 research and development Methods 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 239000003813 safflower oil Substances 0.000 description 1
- 235000005713 safflower oil Nutrition 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 108091006024 signal transducing proteins Proteins 0.000 description 1
- 102000034285 signal transducing proteins Human genes 0.000 description 1
- 150000004760 silicates Chemical class 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 235000011083 sodium citrates Nutrition 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- FRGKKTITADJNOE-UHFFFAOYSA-N sulfanyloxyethane Chemical compound CCOS FRGKKTITADJNOE-UHFFFAOYSA-N 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000057 synthetic resin Substances 0.000 description 1
- 229920003002 synthetic resin Polymers 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- BSYVTEYKTMYBMK-UHFFFAOYSA-N tetrahydrofurfuryl alcohol Chemical compound OCC1CCCO1 BSYVTEYKTMYBMK-UHFFFAOYSA-N 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- JLEXUIVKURIPFI-UHFFFAOYSA-N tris phosphate Chemical compound OP(O)(O)=O.OCC(N)(CO)CO JLEXUIVKURIPFI-UHFFFAOYSA-N 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 230000009750 upstream signaling Effects 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 235000019871 vegetable fat Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 239000011800 void material Substances 0.000 description 1
- 239000011787 zinc oxide Substances 0.000 description 1
- 235000014692 zinc oxide Nutrition 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Chemical & Material Sciences (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Immunology (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Virology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention relates to polypeptides that inhibit the NF-&kgr;B
signaling pathway and polynucleotides encoding the same. The present invention further provides methods for the modulation of and/or treatment of inflammatory responses, oncogenesis, viral infection; the regulation of cell proliferation and apoptosis; and regulation of B or T lymphocytes in antigenic stimulation, by administering the polypeptides of the present invention to a subject in need thereof. Finally, the present invention provides a method of identifying polypeptides that modulate oligomerization of NEMO.
signaling pathway and polynucleotides encoding the same. The present invention further provides methods for the modulation of and/or treatment of inflammatory responses, oncogenesis, viral infection; the regulation of cell proliferation and apoptosis; and regulation of B or T lymphocytes in antigenic stimulation, by administering the polypeptides of the present invention to a subject in need thereof. Finally, the present invention provides a method of identifying polypeptides that modulate oligomerization of NEMO.
Description
DEMANDES OU BREVETS VOLUMINEUX
LA PRESENTE PARTIE I)E CETTE DEMANDE OU CE BREVETS
COMPRI~:ND PLUS D'UN TOME.
CECI EST ~.E TOME 1 DE 2 NOTE: Pour les tomes additionels, veillez contacter 1e Bureau Canadien des Brevets.
JUMBO APPLICATIONS / PATENTS
THIS SECTION OF THE APPLICATION / PATENT CONTAINS MORE
THAN ONE VOLUME.
NOTE: For additional vohxmes please contact the Canadian Patent Oi~ice.
LA PRESENTE PARTIE I)E CETTE DEMANDE OU CE BREVETS
COMPRI~:ND PLUS D'UN TOME.
CECI EST ~.E TOME 1 DE 2 NOTE: Pour les tomes additionels, veillez contacter 1e Bureau Canadien des Brevets.
JUMBO APPLICATIONS / PATENTS
THIS SECTION OF THE APPLICATION / PATENT CONTAINS MORE
THAN ONE VOLUME.
NOTE: For additional vohxmes please contact the Canadian Patent Oi~ice.
2 in the non-canonical NF-KB signaling pathway (Senftleben, 2001, Science).
IKKa plays also a role in keratinocyte differentiation but this process is independent of its lcinase activity (Hu, 2001, Nature).
The NEMO protein (NF-oB essential modulator) plays a key role in the NF-~cB pathway activation. The NEMO protein is associated with IKKa and IKK(3 protein kinases in a high molecular weight complex called the IKK complex. The IKK
kinases are activated by phosphorylation upon an unknown mechanism, which is believed to be a result of NEMO oligomerization (Agou et al., 2004, J. Biol.
Chem.).
The presence of the NEMO protein underlies IKK activation since NEMO-deficient cells are unable to activate NF-oB in response to many stimuli. NEMO is composed of an N-terminal IKK-binding domain including a large coiled-coil (CC1). The C-terminal domain functions as the regulatory part of the protein, which has often been reported as a binding template to link many upstream signaling molecules or viral proteins (Ghosh, 1998, Annu. Rev. Immunol.; Santoro, 2003, EMBO J.) Interestingly, mutations responsible for IP and EDA-ID pathologies were mainly found in this part of the molecules (Doffinger, 2001, Nature Gen.; Zonana, 2000, Am. J. Hum.
Genet.).
The C-terminal domain is composed of the minimal oligomerization domain including two sucessives coiled-coil motifs, CC2 (residues 246-286) and LZ (residues 390-412) (Tegethoff, 2003, Mol. Cell Biol.; Agou et al., 2004, J. Biol. Chem.), and a zinc finger 2o motif at the extremity of the C-terminus.
The biochemical mechanisms triggering the activation of IKK in response to pro-inflammatory stimuli remain unclear. It has been demonstrated that phosphorylation on two serine residues in the activation T-loop induces activation of the IKK(3. However, the mechanism that leads to this phosphorylation event is still unknown. One possible mechanism consists of the conformation change of the kinase induced by NEMO oligomerization (Agou et al., 2004, J. Biol. Chem.). This change of the oligomeric state may induce the T-loop activation by a mechanism of trans-auto-phosphorylation (Zandi, 1997, Cell; Tang, 2003, J. Biol. Chem.). Consistent with the role of NEMO oligomerization in IKK activation, mutations in the minimal oligomerization domain failed to rescue NF-oB by genetic complementation in NEMO-deficient cells activation in responses to many stimuli. Moreover, enforced oligomerization of NEMO lead to full activation of IKK complex. (Inohara, 2000, J.
IKKa plays also a role in keratinocyte differentiation but this process is independent of its lcinase activity (Hu, 2001, Nature).
The NEMO protein (NF-oB essential modulator) plays a key role in the NF-~cB pathway activation. The NEMO protein is associated with IKKa and IKK(3 protein kinases in a high molecular weight complex called the IKK complex. The IKK
kinases are activated by phosphorylation upon an unknown mechanism, which is believed to be a result of NEMO oligomerization (Agou et al., 2004, J. Biol.
Chem.).
The presence of the NEMO protein underlies IKK activation since NEMO-deficient cells are unable to activate NF-oB in response to many stimuli. NEMO is composed of an N-terminal IKK-binding domain including a large coiled-coil (CC1). The C-terminal domain functions as the regulatory part of the protein, which has often been reported as a binding template to link many upstream signaling molecules or viral proteins (Ghosh, 1998, Annu. Rev. Immunol.; Santoro, 2003, EMBO J.) Interestingly, mutations responsible for IP and EDA-ID pathologies were mainly found in this part of the molecules (Doffinger, 2001, Nature Gen.; Zonana, 2000, Am. J. Hum.
Genet.).
The C-terminal domain is composed of the minimal oligomerization domain including two sucessives coiled-coil motifs, CC2 (residues 246-286) and LZ (residues 390-412) (Tegethoff, 2003, Mol. Cell Biol.; Agou et al., 2004, J. Biol. Chem.), and a zinc finger 2o motif at the extremity of the C-terminus.
The biochemical mechanisms triggering the activation of IKK in response to pro-inflammatory stimuli remain unclear. It has been demonstrated that phosphorylation on two serine residues in the activation T-loop induces activation of the IKK(3. However, the mechanism that leads to this phosphorylation event is still unknown. One possible mechanism consists of the conformation change of the kinase induced by NEMO oligomerization (Agou et al., 2004, J. Biol. Chem.). This change of the oligomeric state may induce the T-loop activation by a mechanism of trans-auto-phosphorylation (Zandi, 1997, Cell; Tang, 2003, J. Biol. Chem.). Consistent with the role of NEMO oligomerization in IKK activation, mutations in the minimal oligomerization domain failed to rescue NF-oB by genetic complementation in NEMO-deficient cells activation in responses to many stimuli. Moreover, enforced oligomerization of NEMO lead to full activation of IKK complex. (Inohara, 2000, J.
3 Biol. Chem.; Poyet, 2000, J. Biol. Chem.; Poyet, 2001, J. Biol. Chem.).
Recently, the phosphorylation and the ubiquitination of NEMO in response to TNF-a have been reported, (Carter, 2001, J. Biol. Chem.; Trompouky, 2003, Nature; Kovalenko, 2003, Nature). However, these NEMO modifications have not been demonstrated yet as a crucial step to activate IKK complex in response to several pro-inflammatory stimuli.
Inhibition of NF-oB activation constitutes a privileged target for development of new anti-inflammatory and anti-cancer drugs (May, 2000, Science;
Poulalci, 2002, Am J Pathol..). Among many protein actors in NF-xB signaling pathway, IKK complex represents one of the most promising molecular targets for to discoveries of the new specific NF-xB inhibitors. To minimize the potential toxicity effects ifz vivo, therapeutical success will greatly depend on the abilities of the NF-~cB
inhibitors to block activating signals without modifying the basal level of NF-oB
activity. May et al. described a cell-permeable peptidic inhibitor that block specifi-cally the pro-inflammatory NF-~cB activation by disrupting the constitutive NEMO
interaction with IKK kinases (May, 2000, Science; May, 2002, J. Biol. Chem.).
Modulating protein-protein interactions by the rational design of peptide that alter protein's function provides an important tool for both basic research and development of new classes of therapeutic drugs (Souroujon, 1998, Nat Biotechnol.), especially with signaling proteins that exhibit flexible and dynamic binding properties (Pawson, 2003, Science). Numerous studies of peptide modulators have been described in the literature where peptides mediate protein's function by interfering with localization (translocation) (Lin, 1995, J. Biol. Chem.), recruitment to receptor (Chang, 2000, J.
Biol. Chem.), intramolecular interactions (Souroujon, 1998, Nat Biotechnol.) and oligomerization (Judice, 1997, P.N.A.S.). In the latter, inhibition of HIV-1 gp41 fusion protein with various peptides provides a clear proof of concept (for a review see Chan, 1998, Cell and Eckert, 2001, Ann. Rev. Biochem.).
Under this theory that inhibition of NF-xB activation provides a desirable target for the development of new anti-inflammatory and anti-cancer drugs, the present inventors have set forth to discover candidate anti-inflammatory and anti 3o cancer drugs, as well as to provide a method of screening for the same.
Recently, the phosphorylation and the ubiquitination of NEMO in response to TNF-a have been reported, (Carter, 2001, J. Biol. Chem.; Trompouky, 2003, Nature; Kovalenko, 2003, Nature). However, these NEMO modifications have not been demonstrated yet as a crucial step to activate IKK complex in response to several pro-inflammatory stimuli.
Inhibition of NF-oB activation constitutes a privileged target for development of new anti-inflammatory and anti-cancer drugs (May, 2000, Science;
Poulalci, 2002, Am J Pathol..). Among many protein actors in NF-xB signaling pathway, IKK complex represents one of the most promising molecular targets for to discoveries of the new specific NF-xB inhibitors. To minimize the potential toxicity effects ifz vivo, therapeutical success will greatly depend on the abilities of the NF-~cB
inhibitors to block activating signals without modifying the basal level of NF-oB
activity. May et al. described a cell-permeable peptidic inhibitor that block specifi-cally the pro-inflammatory NF-~cB activation by disrupting the constitutive NEMO
interaction with IKK kinases (May, 2000, Science; May, 2002, J. Biol. Chem.).
Modulating protein-protein interactions by the rational design of peptide that alter protein's function provides an important tool for both basic research and development of new classes of therapeutic drugs (Souroujon, 1998, Nat Biotechnol.), especially with signaling proteins that exhibit flexible and dynamic binding properties (Pawson, 2003, Science). Numerous studies of peptide modulators have been described in the literature where peptides mediate protein's function by interfering with localization (translocation) (Lin, 1995, J. Biol. Chem.), recruitment to receptor (Chang, 2000, J.
Biol. Chem.), intramolecular interactions (Souroujon, 1998, Nat Biotechnol.) and oligomerization (Judice, 1997, P.N.A.S.). In the latter, inhibition of HIV-1 gp41 fusion protein with various peptides provides a clear proof of concept (for a review see Chan, 1998, Cell and Eckert, 2001, Ann. Rev. Biochem.).
Under this theory that inhibition of NF-xB activation provides a desirable target for the development of new anti-inflammatory and anti-cancer drugs, the present inventors have set forth to discover candidate anti-inflammatory and anti 3o cancer drugs, as well as to provide a method of screening for the same.
4 It is an object of the present invention to provide polypeptides derived from NEMO that are useful for the regulation andlor inhibition of the NF-xB
signaling pathway.
To this end, the present invention provides NEMO-derived poly-peptides that inhibit the NF-KB signaling pathway.
In one embodiment of the present invention, the NEMO-derived polypeptide is the CC2 domain (murine: SEQ ID NO: 3 or human: SEQ ID NO: 14).
In another embodiment of the present invention, the NEMO-derived polypeptide is the LZ domain (murine: SEQ ID NO: 7 or human: SEQ ID NO: 16).
to In a preferred embodiment of the present invention, the NEMO-derived polypeptides are fused via a spacer sequence to a polypeptide having a high transduction potential.
Further, in another embodiment of the present invention are polynucleotides that encode for the NEMO-derived polypeptides either with or without the spacer sequence and the polypeptide having a high transduction potential.
In yet another embodiment of the present invention is methods of modulating or treating disorders regulated by the NF-~cB signaling pathway by administering the NEMO-derived polypeptides to a subject in need thereof. The disorders regulated by the NF-KB signaling pathway include: inflammatory responses, oncogenesis, and viral infection.
The present invention also provides a method of regulating cell proliferation or apoptosis by administering the NEMO-derived polypeptides to a subject in need thereof.
In still another embodiment of the present invention is a method of regulating B or T lymphocytes in antigenic stimulation by administering the NEMO-derived polypeptides to a subject in need thereof.
In yet another embodiment, the present invention fiu-ther provides a method of identifying polypeptides that modulate oligomerization of NEMO by a) identifying a candidate polypeptide sequence;
3o b) creating a polypeptide fusion construct by linking said candidate polypeptide sequence to a polypeptide having a high transduction potential via a spacer sequence;
c) contacting a cell culture with the polypeptide fusion construct;
and d) monitoring the activity of the NF-KB signaling pathway;
e) comparing the activity of the NF-xB signaling pathway in the
signaling pathway.
To this end, the present invention provides NEMO-derived poly-peptides that inhibit the NF-KB signaling pathway.
In one embodiment of the present invention, the NEMO-derived polypeptide is the CC2 domain (murine: SEQ ID NO: 3 or human: SEQ ID NO: 14).
In another embodiment of the present invention, the NEMO-derived polypeptide is the LZ domain (murine: SEQ ID NO: 7 or human: SEQ ID NO: 16).
to In a preferred embodiment of the present invention, the NEMO-derived polypeptides are fused via a spacer sequence to a polypeptide having a high transduction potential.
Further, in another embodiment of the present invention are polynucleotides that encode for the NEMO-derived polypeptides either with or without the spacer sequence and the polypeptide having a high transduction potential.
In yet another embodiment of the present invention is methods of modulating or treating disorders regulated by the NF-~cB signaling pathway by administering the NEMO-derived polypeptides to a subject in need thereof. The disorders regulated by the NF-KB signaling pathway include: inflammatory responses, oncogenesis, and viral infection.
The present invention also provides a method of regulating cell proliferation or apoptosis by administering the NEMO-derived polypeptides to a subject in need thereof.
In still another embodiment of the present invention is a method of regulating B or T lymphocytes in antigenic stimulation by administering the NEMO-derived polypeptides to a subject in need thereof.
In yet another embodiment, the present invention fiu-ther provides a method of identifying polypeptides that modulate oligomerization of NEMO by a) identifying a candidate polypeptide sequence;
3o b) creating a polypeptide fusion construct by linking said candidate polypeptide sequence to a polypeptide having a high transduction potential via a spacer sequence;
c) contacting a cell culture with the polypeptide fusion construct;
and d) monitoring the activity of the NF-KB signaling pathway;
e) comparing the activity of the NF-xB signaling pathway in the
5 presence of said polypeptide fusion construct to the activity of the NF-xB
signaling pathway in the absence of said polypeptide fusion construct to determine the relative inhibition by said polypeptide fusion construct; and f) correlating relative inhibition by said polypeptide fusion construct to NEMO oligomerization.
to The above objects highlight certain aspects of the invention.
Additional objects, aspects and embodiments of the invention are found in the following detailed description of the invention.
A more complete appreciation of the invention and many of the attendant advantages thereof will be readily obtained as the same becomes better understood by reference to the following Figures in conjunction with the detailed description below.
Figure I : Functional domains of the NEMO protein.
(A) The murine NEMO protein contains 412 amino acids and multiple domains including the N-terminal IKK binding domain and the oligomeriza-2o tion domain, the proline rich motif (PPP) and the zinc finger motif (ZF) at the C-terminus. The coiled-coil predictions (open boxes) using the algorithm developed by Wolf et al. (1997, Protein Sei.) and the NLM conserved motif (black bar) is shown.
The sequence of NEMO2s3-33~ (residues 253-337 of SEQ ID NO: 12) corresponding to the second coiled-coil (CC2) and leucine zipper (LZ) motifs, which contains all determinants required for NEMO oligomerization (Agou et al., 2004, J. Biol.
Chem.), is indicated with the NLM conserved motif (residues 293-322 of SEQ ID NO: 12) underlined and with the coiled-coil sequences showed as cylinders below the sequence. Letters immediately above the sequence indicate the heptad repeat 'a' and 'd' positions which is a key feature of coiled-coil sequences (Vinson, 2002, Mol.
Cell.
Biol.). (B) Multiple sequence alignment of NEMO proteins from Mus nzusculus (Mm), Homo Sapiens (Hs), Bos taurus (Bt) and Dr~osophila fnelanogaster (Dm), showing the NEMO lilce motif (NLM) shared with NRP/optineurin, ABIN-1/Naf 1, ABIN-2 and
signaling pathway in the absence of said polypeptide fusion construct to determine the relative inhibition by said polypeptide fusion construct; and f) correlating relative inhibition by said polypeptide fusion construct to NEMO oligomerization.
to The above objects highlight certain aspects of the invention.
Additional objects, aspects and embodiments of the invention are found in the following detailed description of the invention.
A more complete appreciation of the invention and many of the attendant advantages thereof will be readily obtained as the same becomes better understood by reference to the following Figures in conjunction with the detailed description below.
Figure I : Functional domains of the NEMO protein.
(A) The murine NEMO protein contains 412 amino acids and multiple domains including the N-terminal IKK binding domain and the oligomeriza-2o tion domain, the proline rich motif (PPP) and the zinc finger motif (ZF) at the C-terminus. The coiled-coil predictions (open boxes) using the algorithm developed by Wolf et al. (1997, Protein Sei.) and the NLM conserved motif (black bar) is shown.
The sequence of NEMO2s3-33~ (residues 253-337 of SEQ ID NO: 12) corresponding to the second coiled-coil (CC2) and leucine zipper (LZ) motifs, which contains all determinants required for NEMO oligomerization (Agou et al., 2004, J. Biol.
Chem.), is indicated with the NLM conserved motif (residues 293-322 of SEQ ID NO: 12) underlined and with the coiled-coil sequences showed as cylinders below the sequence. Letters immediately above the sequence indicate the heptad repeat 'a' and 'd' positions which is a key feature of coiled-coil sequences (Vinson, 2002, Mol.
Cell.
Biol.). (B) Multiple sequence alignment of NEMO proteins from Mus nzusculus (Mm), Homo Sapiens (Hs), Bos taurus (Bt) and Dr~osophila fnelanogaster (Dm), showing the NEMO lilce motif (NLM) shared with NRP/optineurin, ABIN-1/Naf 1, ABIN-2 and
6 ABIN-3/LIND of different species (SEQ ID NOs:l9-29, respectively). The multiple sequence alignment was constructed by parsing PSI-BLAST-generated highest-scoring pairs of sequence segments and realigning the same using with CLUSTAL
W
(Thompson, 1994, N.A.R.). Identical and similar amino acid residues (shaded) are indicated by (!) or (*), respectively.
Figure 2: Flow cytometry analysis of NEMO peptide uptake (A) Cellular delivery of NEMO peptides mediated by conjugation with the Antennapedia peptide. 70Z/3 cells were incubated for 2 h at 37°C in the absence (W/O) or in the presence of 2 ~M BODIPY-tagged Ant-CC2 wild type (WT), to or Ant-CC2 mutant (Mu), or Ant-LZ wild type (WT) or Ant-LZ mutant (Mu) peptide as indicated, or with controls corresponding to 2 pM BODIPY-conjugated BSA
(BODIPY-BSA) or BODIPY-FL alone. (B) Concentration dependence of antennapedia-mediated uptake of 0, 0.2, 2 and 20 ~M Ant-CC2 at 37°C for 5 h in 70Z/3-C3 cells (left panel) and FACS kinetic analysis of BODIPY-conjugated Ant CC2 at 0, 0.5, l, 2 or 5 h after addition of 20 ~M Ant-CC2 at 37°C.
Figure 3: Inhibition of LPS-induced NF-xB activation by cell-permeable Ant-CCZ and Ant-LZ peptide (A) 7023 lymphocyte B were stably transfected with pILl-~3 galactosidase, which bears the (3-galactosidase gene under the control of the NF-xB
(see "Materials and methods"). The resulting cell line, 7023-C3, was incubated for 2 hours in the absence or in the presence of 20 ~M of antennapedia peptide (Ant), or BODIPY-labeled antennapedia peptide (BODIPY-Ant), or BODIPY-labeled antennapedia peptide coupled to CC2 (BODIPY-Ant-CC2) or LZ (BODIPY-Ant-LZ) peptides, After peptide internalization, cells were treated for 5 hours with LPS (3 ~,g/ml, (+) in left panel) or untreated (right panel and (-) in left panel) and the NF-xB
activity was measured by (3-galactosidase assay. Error bars represent the standard deviation of three separate experiments. (B) Concentration dependence of inhibition of LPS-induced NF-xB activation by BODIPY-Ant-CC2 peptide (left panel) or BODIPY-Ant-LZ peptide (right panel). Cells were treated as in (A) but with different 3o concentration of peptide as indicated. The potential of each peptide to inhibit LPS-induced NF-tcB activation was measured by determining the ICSO value that
W
(Thompson, 1994, N.A.R.). Identical and similar amino acid residues (shaded) are indicated by (!) or (*), respectively.
Figure 2: Flow cytometry analysis of NEMO peptide uptake (A) Cellular delivery of NEMO peptides mediated by conjugation with the Antennapedia peptide. 70Z/3 cells were incubated for 2 h at 37°C in the absence (W/O) or in the presence of 2 ~M BODIPY-tagged Ant-CC2 wild type (WT), to or Ant-CC2 mutant (Mu), or Ant-LZ wild type (WT) or Ant-LZ mutant (Mu) peptide as indicated, or with controls corresponding to 2 pM BODIPY-conjugated BSA
(BODIPY-BSA) or BODIPY-FL alone. (B) Concentration dependence of antennapedia-mediated uptake of 0, 0.2, 2 and 20 ~M Ant-CC2 at 37°C for 5 h in 70Z/3-C3 cells (left panel) and FACS kinetic analysis of BODIPY-conjugated Ant CC2 at 0, 0.5, l, 2 or 5 h after addition of 20 ~M Ant-CC2 at 37°C.
Figure 3: Inhibition of LPS-induced NF-xB activation by cell-permeable Ant-CCZ and Ant-LZ peptide (A) 7023 lymphocyte B were stably transfected with pILl-~3 galactosidase, which bears the (3-galactosidase gene under the control of the NF-xB
(see "Materials and methods"). The resulting cell line, 7023-C3, was incubated for 2 hours in the absence or in the presence of 20 ~M of antennapedia peptide (Ant), or BODIPY-labeled antennapedia peptide (BODIPY-Ant), or BODIPY-labeled antennapedia peptide coupled to CC2 (BODIPY-Ant-CC2) or LZ (BODIPY-Ant-LZ) peptides, After peptide internalization, cells were treated for 5 hours with LPS (3 ~,g/ml, (+) in left panel) or untreated (right panel and (-) in left panel) and the NF-xB
activity was measured by (3-galactosidase assay. Error bars represent the standard deviation of three separate experiments. (B) Concentration dependence of inhibition of LPS-induced NF-xB activation by BODIPY-Ant-CC2 peptide (left panel) or BODIPY-Ant-LZ peptide (right panel). Cells were treated as in (A) but with different 3o concentration of peptide as indicated. The potential of each peptide to inhibit LPS-induced NF-tcB activation was measured by determining the ICSO value that
7 correspond to 50% inhibition of LPS-induced NF-KB activation as compared to the control (no peptide) (C). (D) Effect of the N-fusion sequence of antennapedia on the inhibition of NF-oB activation. Control (no peptide) or CC2, or LZ peptides, with (BODIPY-ANT-CC2, BODIPY-ANT-LZ) or without the antennapedia sequence at the N-terminus (CC2, LZ) were incubated for 2 hours with 7023-C3 cells followed with (+) or without (-) the LPS-treatment for 3 hours. NF-~cB activity was then measured by (3-galactosidase assay.
Figure 4: Specific inhibition of NF-KB activation in response to LPS depends on a few mutations in the hydrophobic core of CCZ and LZ coiled-coils 1 o Left panels show a helical wheel diagram of CC2 (A) and LZ (B) peptides. The view is from the top the molecule. The (a) through (g) positions, which are an essential feature of coiled coil sequence (Vinson, 2002, Mol. Cell.
Biol.) represent sequential positions in each peptide sequence. The first (a) and fourth (d) positions that are generally occupied by hydrophobic amino acids constitute the hydrophobic core for parallel as well as antiparallel-coiled coils. Mutations that were introduced in (a) positions of the CC2 variant (BODIPY-Ant-CC2 (Mu); shown as residues 6-40 of SEQ ID N0:3, with glycine mutations corresponding to residues of SEQ ID NO:S) or in (d) positions of the LZ variant (BODIPY-Ant-(Mu) are shown.
In the right panels, 7023-C3 cells were incubated for 2 hours in the absence (control) or in the presence of 10 ~M of cell permeable wild type (BODIPY-Ant-CC2 (WT)) or mutant (BODIPY-Ant-CC2 (Mu)) CC2 peptides (A) or wild type (BODIPY-Ant-LZ
(WT)) or mutant (BODIPY-Ant-(Mu)) LZ peptides (B). The cells were then exten-sively washed to remove the excess peptide which had not been internalized and the cells were then diluted three times and allowed to grow for for 24 hours before treat-ment for 5 hours with (+) or without LPS (-). NF-~cB activity was measured using the /3-galactosidase assay. Error bars represent the standard deviation of two independent experiments.
Figure 5: Inhibition of NF-icB activation by the LZ peptide occurs through the formation of specific coiled-coil strands.
3o (A) Sequence alignement of the NEMO-derived LZ (residues 301-336 of SEQ ID N0:12) and the GCN4 peptides (residues 23-55 of SEQ ID NO:~).
Figure 4: Specific inhibition of NF-KB activation in response to LPS depends on a few mutations in the hydrophobic core of CCZ and LZ coiled-coils 1 o Left panels show a helical wheel diagram of CC2 (A) and LZ (B) peptides. The view is from the top the molecule. The (a) through (g) positions, which are an essential feature of coiled coil sequence (Vinson, 2002, Mol. Cell.
Biol.) represent sequential positions in each peptide sequence. The first (a) and fourth (d) positions that are generally occupied by hydrophobic amino acids constitute the hydrophobic core for parallel as well as antiparallel-coiled coils. Mutations that were introduced in (a) positions of the CC2 variant (BODIPY-Ant-CC2 (Mu); shown as residues 6-40 of SEQ ID N0:3, with glycine mutations corresponding to residues of SEQ ID NO:S) or in (d) positions of the LZ variant (BODIPY-Ant-(Mu) are shown.
In the right panels, 7023-C3 cells were incubated for 2 hours in the absence (control) or in the presence of 10 ~M of cell permeable wild type (BODIPY-Ant-CC2 (WT)) or mutant (BODIPY-Ant-CC2 (Mu)) CC2 peptides (A) or wild type (BODIPY-Ant-LZ
(WT)) or mutant (BODIPY-Ant-(Mu)) LZ peptides (B). The cells were then exten-sively washed to remove the excess peptide which had not been internalized and the cells were then diluted three times and allowed to grow for for 24 hours before treat-ment for 5 hours with (+) or without LPS (-). NF-~cB activity was measured using the /3-galactosidase assay. Error bars represent the standard deviation of two independent experiments.
Figure 5: Inhibition of NF-icB activation by the LZ peptide occurs through the formation of specific coiled-coil strands.
3o (A) Sequence alignement of the NEMO-derived LZ (residues 301-336 of SEQ ID N0:12) and the GCN4 peptides (residues 23-55 of SEQ ID NO:~).
8 Both coiled-coil motifs were aligned using clustalX. Identical and similar amino acid residues (shaded) are indicated by (!) or (*), respectively. (B) Overview and helical wheel diagram of the GCN4 coiled-coil (top view). The amino-acid sequence of GCN4 is shown with its corresponding [a - g] positions and residues that differ from the corresponding NEMO-derived LZ sequence are boxed according to their degree of conservation. Identical (open square) and similar residues (open triangle) are indicated. (C) Comparison of the cell permeable NEMO-derived LZ and GCN4 peptide on the inhibition of LPS-induced NF-xB activation. 7023-C3 cells were incu-bated for 2 hours in the absence (no peptide) or in the presence of 10 ~M of the to antennapedia fusion LZ (BODIPY-Ant-LZ) or GCN4 (BODIPY-Ant-GCN4) peptide.
Cells were then extensively washed to remove any peptide excess which was not internalized, and diluted three times to facilitate 24 hours of growth before treatment for 5 hours with (+) or without LPS (-). NF-KB activity was measured using the (3 galactosidase assay. Error bars represent the standard deviation of two independent experiments.
Figure 6: Oligomerization properties of NEMO-derived polypeptides with or without the antennapedia sequence All peptides were loaded at a 10 ~M concentration on a superdex 75 HR10/30 column equilibrated in a buffer containing 0.1 mM DDM to improve recovery (see "Materials and methods"). Chromatographic profiles of the CC2 mutant (dashed line) and the CC2 wild type (solid line) fused (BODIPY-Ant-CC2 (WT), BODIPY-Ant-CC2 (Mu), or not fused to the antennapedia sequence (CC2 (WT), CC2 (Mu)) are shown in left panels, and elution profiles of the LZ mutant (dashed line) and the wild type (solid line) fused (BODIPY-Ant-LZ (WT), BODIPY-Ant-LZ (Mu), or not fused to the antennapedia sequence (LZ (WT), LZ (Mu)) are represented in right panels. Elution volumes of globular protein markers are indicated by arrows :
Oval, ovalbumin (43 lcDa); Chym, chymotrypsinogene A (25 kDa); Ribo, Ribonuclease (13.4 kDa) and Apro, aprotinin (6.5 kDa).
Figure 7: : Association of Ant-CC2 and Ant-LZ peptides to the CC2 peptide (A) Direct titration of BODIPY-Ant-CC2 (1 qM) with CCZ by fluorescence anitropy. The concentration of CC2 was determined by amino acid analysis. Anisotropy values of BODIPY-Ant-CC2 in milliunits (mA) were plotted
Cells were then extensively washed to remove any peptide excess which was not internalized, and diluted three times to facilitate 24 hours of growth before treatment for 5 hours with (+) or without LPS (-). NF-KB activity was measured using the (3 galactosidase assay. Error bars represent the standard deviation of two independent experiments.
Figure 6: Oligomerization properties of NEMO-derived polypeptides with or without the antennapedia sequence All peptides were loaded at a 10 ~M concentration on a superdex 75 HR10/30 column equilibrated in a buffer containing 0.1 mM DDM to improve recovery (see "Materials and methods"). Chromatographic profiles of the CC2 mutant (dashed line) and the CC2 wild type (solid line) fused (BODIPY-Ant-CC2 (WT), BODIPY-Ant-CC2 (Mu), or not fused to the antennapedia sequence (CC2 (WT), CC2 (Mu)) are shown in left panels, and elution profiles of the LZ mutant (dashed line) and the wild type (solid line) fused (BODIPY-Ant-LZ (WT), BODIPY-Ant-LZ (Mu), or not fused to the antennapedia sequence (LZ (WT), LZ (Mu)) are represented in right panels. Elution volumes of globular protein markers are indicated by arrows :
Oval, ovalbumin (43 lcDa); Chym, chymotrypsinogene A (25 kDa); Ribo, Ribonuclease (13.4 kDa) and Apro, aprotinin (6.5 kDa).
Figure 7: : Association of Ant-CC2 and Ant-LZ peptides to the CC2 peptide (A) Direct titration of BODIPY-Ant-CC2 (1 qM) with CCZ by fluorescence anitropy. The concentration of CC2 was determined by amino acid analysis. Anisotropy values of BODIPY-Ant-CC2 in milliunits (mA) were plotted
9 PCT/IB2004/003352 against an increasing concentration of the CC2 peptide. Data points were fitted (solid line) to the binding isotherm equation with a KD of 15.2 ~,M (Materials and Methods).
The two dashed lines represent a stoichiometric titration and intersect at an concentration of 16 ~.M. Given the 1 ~M concentration of the BODIPY-Ant-CC2, this gives a complex stoechiometrie of 0.8. (B) Direct titration of BODIPY-Ant-LZ
(0.1 ~,M) with CC2 by fluorescence anitropy. The anisotropy values of the BODIPY-Ant-LZ alone (white bar) or in the presence of the CC2 peptide (30~M, grey bar;
100 ~.M, black bar) are given in milliunits (mA).
Figure 8: Cell death induced in the retinoblastoma cell line Y79 by Ant-CC2 and Ant-LZ peptides Rb cell line Y79 were treated with various concentration of the Ant-CC2 (WT) (filled squares) or Ant-CC2 (Mu) (open squares) (A), or Ant-LZ (WT) (filled circles), or Ant-LZ (Mu) (open circles) (B), or Ant peptide (open triangle) (C) for 3 hours (A, B) or 16 hours (C). Cell survival was then evaluated using the MTS
assay as described in "Materials and methods"
Unless specifically defined, all technical and scientific terms used herein have the same meaning as commonly understood by a skilled artisan in enzymology, biochemistry, cellular biology, molecular biology, and the medical sciences.
~ All methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, with suitable methods and materials being described herein. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. Further, the materials, methods, and examples are illustrative only and are not intended to be limiting, unless otherwise specified.
In this application, the present inventors studied the inhibition of NF-KB activation by peptides designed to disrupt NEMO oligomerization. The present inventors have previously shown that the minimal trimerization domain comprises the 3o CC2-LZ coiled-coil subdomain and that the isolated and/or purified CC2 and LZ
domains bind to each other to form a stable trimer of heterodimers. This structural model is reminiscent of the fold of the gp41 ectodomain from HIV-1 (Agou et al., 2004, J. Biol. Chem.). It consist of a central three-stranded coiled coil (formed by the CC2 coiled coil motif of NEMO) which is surrounded by the LZ helical motif derived from the C-terminal end of NEMO, packed in an antiparallel manner around the outside of the CC2 coiled-coil. On the basis of this model, the present inventors 5 rationally designed two cell-permeable peptides corresponding to optimal portions of CC2 or LZ subdomains that mimic the contact area between NEMO subunits.
Peptide transduction was monitored by FACS and their effect on LPS-induced NF-oB
activa-tion was quantified using a NF-oB dependent (3-galactosidase assay in stably transfected pre-B 70213 lymphocytes. The present inventors have also demonstrated 1 o that the LZ peptide and, to a lesser extent the CC2 peptide, inhibit specifically NF-oB
activation with ICSO values in the ~.M range. The effects were specific because control peptides including mutated CC2 and LZ peptides as well as heterologous coiled-coil peptides (GCN4), had no inhibitory effect on NF-oB activation. Furthermore, the present inventors have shown that these NF-oB peptidic inhibitors induced the cell death in the human retinoblastoma cell lines Y79 that exhibit constitutive NF-oB
activity. Collectively, the present inventors have provided a new and promising strategy to inhibit the NF-KB pathway by targeting NEMO's oligomerization.
The present inventors have proven that NEMO constitutes a preferential target for the search for drugs inhibiting the NF-~cB signaling path, 2o because this protein acts upstream from the NF-KB activation path. The role of NEMO and its various domains was partially studied and published in the following article, "NEMO trime~izes through its coiled coil C-terminal domain. " J Biol Chem, 2002 May 17;277(20):17464-75. Agou F. et al., a copy of which is incorporated by reference.
In the present invention, the inventors have synthesized peptides that mimic either the oligomerization domain (CC2 domain = approx. 40 residues), or the LZ motif (L2 domain = approx. 40 residues). The combination of these peptides alters either the oligomerization of NEMO or the combining thereof with the proteinic effector, in both cases inhibiting the NF-KB pathway.
3o In an aspect of the present invention, peptide drugs have been chemically combined with a peptide of 16 amino acids in length (penetratin/antennapedia), thereby enabling intracellular transport thereof possible.
The resulting peptides also may be chemically coupled with a fluorescent tracer in order to monitor internalization into B lymphocyte cell lines through FACS.
The action of these peptides was tested directly on B lymphocytes having stably integrated the beta-galactosidase carrier gene also bearing upstream from its promoter several NF-~cB transcription factor (Clone C3) activation sites (see Examples herein below).
The present inventors have successfully been able to monitor the inhibitory effect of these peptides by measuring the same following stimulation of the B lymphocytes by LPS.
The results as a whole reveal that the presence of the peptide mimicking the "CC2" motif reduces the NF-KB activity by 70% as compared with a control peptide at a relatively low dose of 20 ~M. At this concentration, the effect of the "Leucine zipper" peptide is still more significant, since its presence in the medium completely eliminates cell response.
These new inhibitors of the NF-xB cellular signalling path offer a major advantage as anti-inflammatory compounds and also as anti-tumor compounds, which may be used for the treatment and/or prevention of cancers and other disorders.
The present invention relates to compounds, peptides, or composi-2o dons that are used for modulating the oligomerization of NEMO. In particular, the peptide compounds described herein below may be in an isolated and/or purified or coupled form with or without a vectorizing agent. It is to be understood that the present invention also embraces peptides having at least 70% homology with the NEMO-derived polypeptides, so long as the homologs possess said inhibitory activity.
Methods for assessing inhibitory activity of the NEMO-derived polypeptides, and homologs thereof, are provided below and exemplified in the Examples of the present application. The peptides of the present invention and the doses thereof are deemed to possess inhibitory activity when the NF-KB activity is reduced by at least 50%
as compared with a control peptide.
The present invention also relates to pharmaceutical compositions containing said peptides, especially for the preparation of medicines used for the treatment of inflammatory responses, oncogenesis, viral infection, the regulation of cell proliferation and apoptosis and antigenic stimulation. In a preferred embodiment, the pharmaceutical compositions containing said peptides are useful for the treatment of cancer.
Also embraced by the present invention are methods of obtaining, s malting, and identifying peptides and compounds that inhibit the NF-KB
signaling pathway, in particular by means of the 70Z/3-C3 cell line filed with the CNCM
(Collection Nationale de Cultures de Microorganismes), 28 rue du Docteur Roux, 75724 PARIS Cedex 15, France, on April 1st, 2003 under number I-3004.
As used herein, the term "reduced" or "inhibited" means decreasing l0 the intracellular activity of one or more enzymes in the NF-~cB pathway either directly or indirectly. The phrase "inhibiting the NF-oB pathway" preferably means that the NF-~cB pathway is inhibited by disruption of NEMO oligomerization.
The term "enhanced" as used herein means increasing the intra-cellular activity or concentration of the NEMO derived peptides, which are encoded 1s by the corresponding DNA. Enhancement can be achieved with the aid of various manipulations of the bacterial cell. In order to achieve enhancement, particularly over-expression, the number of copies of the corresponding gene can be increased, a strong promoter can be used, or the promoter- and regulation region or the ribosome binding site which is situated upstream of the structural gene can be mutated.
2o Expression cassettes which are incorporated upstream of the structural gene act in the same manner. In addition, it is possible to increase expression by employing inducible promoters. A gene can also be used which encodes a corresponding enzyme with a high activity. Expression can also be improved by measures for extending the life of the mRNA. Furthermore, preventing the degradation of the enzyme increases enzyme 2s activity as a whole. Moreover, these measures can optionally be combined in any desired manner. These and other methods for altering gene activity in a plant are known as described, for example, in Methods in Plant Molecular Biology, Maliga et al, Eds., Cold Spring Harbor Laboratory Press, New Yorlc (1995).
A gene can also be used which encodes a corresponding or variant 3o NEMO derived peptide with a high activity of inhibiting the NF-xB pathway.
Prefera-bly the corresponding enzyme has a greater ability than the native form of the NEMO
protein to inhibit the NF-xB pathway, more preferably at least in the range of 5, 10, 25% or 50% more inhibition. Most preferably the NEMO derived peptides of the present invention reduce the NF-KB pathway by at least 50%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, as compared to the pathway in the presence of the native NEMO protein.
In the context of the present Application, a polynucleotide sequence is "homologous" with the sequence according to the invention if at least 70%, prefera-bly at least 80%, most preferably at least 90% of its base composition and base sequence corresponds to the sequence according to the invention. According to the invention, a "homologous protein" or "homologous peptide" is to be understood to l0 comprise proteins (peptides) which contain an amino acid sequence at least 70 % of which, preferably at least 80 % of which, most preferably at least 90 % of which, corresponds to the amino acid sequence of the CC2 region of NEMO (SEQ ID NO:
3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO:
16) in the case of human-derived NEMO, wherein corresponds is to be understood to mean that the corresponding amino acids are either identical or are mutually homolo-gous amino acids. It is further to be understood that, as evinced by the Examples of the present invention, the homologous peptide of CC2 preferably retains the coiled-coil motif structure and the homologous peptide of LZ preferably retains the helical 2o motif structure. With the guidance proffered by the identification of SEQ
ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 14, and SEQ ID NO: 16 and the detailed description in the Examples below, screening of theoretical mutations within the scope of the present invention would require nothing more than a technicians level of skill in the art. More specifically, as is routine in the art, with the identification of a candidate sequence (i.e., the regions corresponding to SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 14, and SEQ ID NO: 16) the artisan would assay and screen one or all possible permuta-tions of the said sequence to identify mutants possessing the same or better therapeutic efficacy.
The expression "homologous amino acids" denotes those that have 3o corresponding properties, particularly with regard to their charge, hydrophobic character, steric properties, etc.
Homology, sequence similarity or sequence identity of nucleotide or amino acid sequences may be determined conventionally by using known software or computer programs such as the BestFit or Gap pairwise comparison programs (GCG
Wisconsin Package, Genetics Computer Group, 575 Science Drive, Madison, Wisconsin 53711). BestFit uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2: 482-489 (1981), to find the best segment of identity or similarity between two sequences. Gap performs global alignments: all of one sequence with all of another similar sequence using the method of Needleman and Wunsch, J. Mol. Biol. 48:443-453 (1970). When using a sequence 1o alignment program such as BestFit, to determine the degree of sequence homology, similarity or identity, the default setting may be used, or an appropriate scoring matrix may be selected to optimize identity, similarity or homology scores.
Similarly, when using a program such as BestFit to determine sequence identity, similarity or homology between two different amino acid sequences, the default settings may be used, or an appropriate scoring matrix, such as blosum45 or blosum~0, may be selected to optimize identity, similarity or homology scores.
The present invention also relates to polynucleotides which encode the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO:
7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO:
14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, and which can be obtained by screening by means of the hybridization of a corresponding gene bank with a probe which contains the sequence of said polynucleotide that encodes the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, and isolation of said DNA
sequence.
Polynucleotide sequences according to the invention are suitable as hybridization probes for RNA, cDNA and DNA, in order to isolate those cDNAs or genes that exhibit a high degree of similarity to the sequence that encodes the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof.
Polynucleotide sequences according to the invention are also suitable as primers for polymerase chain reaction (PCR) for the production of DNA, 5 which encodes a NEMO-derived polypeptide having an ability to inhibit the NF-~cB
pathway.
Oligonucleotides such as these, which serve as probes or primers, can contain more than 30, preferably up to 30, more preferably up to 20, most prefera bly at least 15 successive nucleotides. Oligonucleotides with a length of at least 40 or to 50 nucleotides are also suitable.
The term "isolated and/or purified" means separated from its natural environment.
The term "polynucleotide" refers in general to polyribonucleotides and polydeoxyribonucleotides, and can denote an unmodified RNA or DNA or a 15 modified RNA or DNA. ' The term "polypeptides" is to be understood to mean peptides or proteins that contain two or more amino acids that are bound via peptide bonds.
The polypeptides according to invention include polypeptides corresponding to the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of 2o NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, particularly those with the biological activity of inhibition the NF-oB pathway, and also includes those, at least 70 % of which, preferably at least 80% of which, are homologous with the polypeptide corresponding to the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, and most preferably those which exhibit a homology of at least 90 % to 95 % with the polypeptide corresponding to the 3o region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, and which have the cited activity.
The invention also relates to coding DNA sequences that encode the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, by degeneration of the genetic code. One of skill in the art would appreciate that the aforementioned DNA sequences may be based on the full-length DNA sequences for the murine-derived NEMO (SEQ ID NO: 11) and the human-1 o derived NEMO (SEQ ID NO: 17) and thereby these sequences may be used to ascertain the scope of these sequences in accordance with the present invention.
In the same manner, the invention further relates to DNA sequences that hybridize with DNA sequences that encode the CC2 region of NEMO (SEQ ID
N0: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO
(SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof.
Moreover, one skilled in the art is also aware of conservative amino acid replacements such as the replacement of glycine by alanine or of aspartic acid by glutamic acid in proteins as "sense mutations" which do not result in any fundamental 2o change in the activity of the protein, i.e. which are functionally neutral.
It is also known that changes at the N- and/or C-terminus of a protein do not substantially impair the function thereof, and may even stabilize said function.
In the same manner, the present invention also relates to DNA
sequences that hybridize with the DNA sequence that encodes the CC2 region of NEMO (SEQ ID N0: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ
region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof. The present invention also relates to DNA sequences that are produced by polymerase chain reaction (PCR) using oligonucleotide primers that 3o result from the DNA sequence that encodes the CC2 region of NEMO (SEQ ID
NO:
3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO
and the CC2 region of NEMO (SEQ ID N0: 14) or the LZ region of NEMO (SEQ ID
NO: 16) in the case of human-derived NEMO, or fragments thereof.
Oligonucleotides of this type typically have a length of at least 15 nucleotides.
The terms "stringent conditions" or "stringent hybridization condi-tions" includes reference to conditions under which a polynucleotide will hybridize to its target sequence, to a detectably greater degree than other sequences (e.g., at least 2-fold over background). Stringent conditions are sequence-dependent and will be different in different circumstances. By controlling the stringency of the hybridization and/or washing conditions, target sequences can be identified which are 100%
complementary to the probe (homologous probing). Alternatively, stringency condi-to tions can be adjusted to allow some mismatching in sequences so that lower degrees of similarity are detected (heterologous probing).
Typically, stringent conditions will be those in which the salt concentration is less than about 1.5 M Na ion, typically about 0.01 to 1.0 M
Na ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., 10 to 50 nucleotides) and at least about 60°C for long probes (e.g., greater than 50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. Exemplary low strin-gency conditions include hybridization with a buffer solution of 30 to 35%
formamide, 1 M NaCI, 1% SDS (sodium dodecyl sulphate) at 37°C, and a wash in 1X
2o to 2X SSC (20X SSC=3.0 M NaCI/0.3 M trisodium citrate) at 50 to 55°C
Exemplary moderate stringency conditions include hybridization in 40 to 45% formamide, 1 M
NaCI, I% SDS at 37°C, and a wash in O.SX to 1X SSC at 55 to 60°C
Exemplary high stringency conditions include hybridization in 50% formamide, 1 M NaCI, 1% SDS
at 37°C, and a wash in O.1X SSC at 60 to 65°C.
Specificity is typically the function of post-hybridization washes, the critical factors being the ionic strength and temperature of the final wash solution. For DNA--DNA hybrids, the Tm can be approximated from the equation of Meinkoth and Wahl, Anal. Biochem., 138:267-284 (1984): Tm =81.5°C +16.6 (log M)+0.41 (%GC)-0.61 (% form)-500/L; where M is the molarity of monovalent cations, %GC is the 3o percentage of guanosine and cytosine nucleotides in the DNA, % form is the percentage of formamide in the hybridization solution, and L is the length of the hybrid in base pairs. The Tm is the temperature (under defined ionic strength and pH) at which 50% of a complementary target sequence hybridizes to a perfectly.
matched probe. Tm is reduced by about 1 °C for each 1 % of mismatching; thus, Tm, hybridiza-tion and/or wash conditions can be adjusted to hybridize to sequences of the desired identity. For example, if sequences with approximately 90% identity are sought, the Tm can be decreased 10°C. Generally, stringent conditions are selected to be about 5°C lower than the thermal melting point (Tm) for the specific sequence and its complement at a defined ionic strength and pH. However, severely stringent condi-tions can utilize a hybridization and/or wash at 1, 2, 3, or 4°C lower than the thermal melting point (Tm); moderately stringent conditions can utilize a hybridization andlor to wash at 6, 7, 8, 9, or 10°C lower than the thermal melting point (Tm); low stringency conditions can utilize a hybridization and/or wash at 11, 12, 13, 14, 15, or 20°C lower than the thermal melting point (Tm). Using the equation, hybridization and wash compositions, and desired Tm, those of ordinary skill will understand that variations in the stringency of hybridization and/or wash solutions are inherently described. If the desired degree of mismatching results in a Tm of less than 45°C
(aqueous solution) or 32°C (formamide solution) it is preferred to increase the SSC
concentration so that a higher temperature can be used. An extensive guide to the hybridization of nucleic acids is found in Current Protocols in Molecular Biology, Chapter 2, Ausubel, et al., Eds., Greene Publishing and Wiley-Interscience, New York (2000).
2o Thus, with the foregoing information, the skilled artisan can identify and isolated and/or purified polynucleotides, which are substantially similar to the present polynucleotides. In so isolating such a polynucleotide, the polynucleotide can be used as the present polynucleotide in, for example, inhibiting the NF-KB
pathway.
One embodiment of the present invention is methods of screening for polynucleotides, which have substantial homology to the polynucleotides of the present invention, preferably those polynucleotides encoding a protein having an ability of inhibiting the NF-oB pathway.
The polynucleotide sequences of the present invention can be carried on one or more suitable plasmid vectors, as known in the art for plants or the like.
3o In one embodiment, it may be advantageous for propagating the polynucleotide to carry it in a bacterial or fungal strain with the appropriate vector suitable for the cell type. Common methods of propagating polynucleotides and producing proteins in these cell types are known in the art and are described, for example, in Maniatis et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York (1982) and Sambrook et al., Molecular Cloning:
A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York (1989).
The aforementioned embodiments are described in the context of SEQ ID NO: 3 (CC2 region of the NEMO protein; i.e., amino acids 246-286 of SEQ
ID NO: 12) and SEQ ID NO: 7 (LZ region of the NEMO protein; i.e., amino acids 390-412 of SEQ ID NO: 12), where SEQ ID NO: 12 is murine-derived NEMO. The aforementioned embodiments have been further described based on SEQ ID NO: 14 and SEQ ID NO: 16, which are derived from SEQ ID NO: 18 (human-derived NEMO). However, it is understood that the present invention preferably provides peptide derivatives of the NEMO protein that may be internalized into eukaryotic cells. Internalization of the NEMO peptide derivatives may be imparted by fusing the NEMO peptide derivative(s), or homologues thereof, to a polypeptide having a high transduction potential. The skilled artisan would readily appreciate that the term "high transduction potential" as used herein means that the polypeptide, and the fusion protein thereof, readily transverses the cellular membrane resulting in the internaliza-tion of fusion peptide into the cellular milieu. Examples of peptides having a high transduction potential include: the third helix of the Antennapedia/penetratin protein (Ant) (Prochiantz, 2000,Curr. Opin. Cell Biol.), TAT derived peptides (Fawel, 1994, P.N.A.S.), VP22 from HSV-1 (Stroh C. 2003, Oncogene), Pep. 1 (Morris, 2001, Nature Biotech.).
To exemplify the present invention and the utility thereof, the present inventors have fused SEQ ID NO: 3 and SEQ ID NO: 7 to the internalization peptide Ant (SEQ ID NO: 1) separated by a short SKGMQ linker (SEQ ID NO: 9) or by a LKAQADI linlcer (SEQ ID NO: 10). The resultant Ant-CC2 construct has the sequence: CRQIKIWFQNRRMKWKKSKGMQLEDLRQQLQQAEEALVAKQELI
DKLKEEAEQHKIV (SEQ ID NO: 2), where the N-terminal cysteine has been added for coupling to a flurophore to facilitate detection of internalization and/or inhibition.
The resultant Ant-LZ construct has the sequence:
CRQIKIWFQNRRMKWKKLKAQADIYKADFQAERHAREKLVEKKEYLQEQLE
QLQREFNKL, (SEQ ID NO: 6), where the N-terminal cysteine has been added for coupling to a flurophore to facilitate detection of internalization and/or inhibition.
In the present invention the N-terminal cysteine is an optional addi-tion and, as such, this residue may be omitted from the final inhibitory peptide.
5 Further, in the present invention the linker between the peptide having a high transduction potential (e.g., Ant) and the CC2 or LZ peptide can be of a variable sequence andlor length, so long as the linker sequence does not significantly diminish the inhibitory property of CC2 or LZ peptide. To this end, the linker may be of a length ranging from 1-35 amino acids, preferably 2-25 amino acids, more preferably 1o 3-15 amino acids, most preferably 4-10 amino acids. In a particularly preferred embodiment, the linker sequence is that of SEQ ID NO: 9 or SEQ ID NO: 10.
As set forth hereinabove, it is to be understood that the homologous peptide of CC2 preferably retains the coiled-coil motif structure and the homologous peptide of LZ preferably retains the helical motif structure, even when in the fusion 15 construct set forth above. As such, the present invention embraces homologous peptides, within the homology constraints above, of SEQ ID NO: 2 and SEQ ID
NO:
6 (murine-derived) and SEQ ID NO: 13 and SEQ ID NO: 15 (human-derived) with the caveat that said homologous peptides retain the structure of CC2 and LZ
respec-tively, as well as the ability to inhibit the NF-~cB pathway.
2o In an embodiment of the present invention, the inventors explored the N-terminal region of the wild-type NEMO, in particular the NLM conserved motif (residues 293-322 of SEQ ID NO: 12) appearing in Figure 1A. To this end, the following sequences were produced (see Table 1 for the corresponding sequence):
NLM-DR (SEQ ID NO : 30) Ant.NLM-DR (SEQ ID NO : 31) Tat NLM-DR (SEQ ID NO : 32) R7-NLM-DR (SEQ ID NO : 33) R9-NLM-DR (SEQ ID NO : 34) NLM-DR is a 21 amino acid "motif' (and the corresponding wild 3o type NLM covering the same amino acid range) derived from the larger 30 amino acid conserved NLM motif set forth in Figure 1A. The NLM-DR has been mutated from the wild type NLM sequence in that the aspartic acid at residue 11 in the wild type sequence has been replaced by an arginine (see Table l and SEQ ID NO: 30).
This mutation was selected because, as confirmed by structural studies, the resulting polypeptide would facilitate an intramolecular salt bridge allowing the stabilization of the peptide in its helicoidal form.
From circular dichroism studies (CD), it appears that CC2 and LZ
peptides adopt a helicoidal structure, depending on their concentration. CC2 creates a helix more stable than LZ. RMN and Rayon X Diffraction studies have confirmed the structure of CC2. Always, by CD studies, the NLM-DR peptide is structured as a helix more stable than the wild-type peptide.
Although, the polypeptides utilized in this example are 21 amino acids long, it is contemplated in the present invention that the operable size of the NLM fragment may be as short as 15 amino acids. In addition, any mutation in the sequence of the NLM polypeptides that are able to reinforce the helicity and the intermolecular interactions between the peptides and their molecular target would be of particular interest and is within the scope of the present invention.
In the present invention it is speculated that Antennapedia mediated monomerization of peptides may be crucial. Specifically, it is speculated that monomerization allows them to interfer with NEMO oligomerization.
Nuclear factor-kB (NF-oB) signaling is an essential signal transduc-2o tion pathway involved in inflammatory responses, oncogenesis, viral infection, the regulation of cell proliferation and apoptosis; and in the case of B and T
lymphocytes in antigenic stimulation (Ghosh, 1998, Annu. Rev. Immunol.; I~arin, 1999, J.
BioI.
Chem.; Israel, 2000, Trends Cell Biol.; Santoro, 2003, EMBO J..). As such, the inventive peptides are useful for the modulation of and/or treatment of inflammatory responses, oncogenesis, viral infection; the regulation of cell proliferation and apoptosis; and regulation of B or T lymphocytes in antigenic stimulation.
Therefore, the present invention provides for a method of treating the same by administering to a subject in need thereof a peptide in accordance with the present invention.
In the present invention, the "subj ect in need thereof' may be a human, a domestic animal, a farm animal, or an animal that is generally found in the wild. For example, the subject may be selected from a human, a dog, a cat, a horse, a cow, a mouse, a guinea pig, a sheep, a pig, etc.
Clearly, the amount of the peptide to be administered will depend on the subject to which it is to be administered. In the case where the subject is a human, the amount of the peptide to be administered will depend on a number of factors including the age of the patient, the severity of the condition and the past medical history of the patient and always lies within the sound discretion of the administering physician. Generally, the total daily dose of the compounds of this invention administered to a human or other mammal in single or in divided doses can be in amounts, for example, of from 0.1 mg/Kglday to 30 mg/Kg/day of the peptide, preferably from 0.1 mg/Kg/day to 20 mg/Kg/day of the peptide, more preferably from 2 mg/Kg/day to 10 mg/Kg/day of the peptide, in single or multiple doses.
Single dose compositions may contain such amounts or submultiples thereof to make up the daily dose. In a preferred embodiment, the preferred dose is 10 mg/patient to be administered twice a day. In a particularly preferred embodiment, the administration route is intravenous.
The peptides of the present invention may also be administered as a component of a pharmaceutically administrable composition. In other words, the peptide may be present in a formulation for administration to a subject in need thereof.
The inventive peptide may be the sole active ingredient for NF-xB pathway inhibition or for treatment of inflammatory responses, oncogenesis, viral infection, the regula-2o tion of cell proliferation and apoptosis and antigenic stimulation.
Alternatively, the composition may also contain one or more additional compounds that may be used to treat the same. In addition, the peptide of the present invention may be in a composi-tion that contains one or more compounds that are useful for treatment of a disorder not caused by the NF-~cB pathway.
A therapeutically effective amount of the peptides suitable for administration in the present invention may be administered alone or in combination with one or more pharmaceutically acceptable carriers. As used herein, the term "pharmaceutically acceptable carrier" means a non-toxic, inert solid, semi-solid or liquid filer, diluent, encapsulating material or formulation auxiliary of any type. Some 3o examples of materials which can serve as pharmaceutically acceptable carriers are sugars such as lactose, glucose and sucrose; starches such as corn starch and potato starch; cellulose and its derivatives such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc;
excipients such as cocoa butter and suppository waxes; oils such as peanut oil, cottonseed oil;
safflower oil; sesame oil; olive oil; corn oil and soybean oil; glycols; such a propylene glycol; esters such as ethyl oleate and ethyl laurate; agar; buffering agents such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water;
isotonic saline; Ringer's solution; ethyl alcohol, and phosphate buffer solutions, as well as other non-toxic compatible lubricants such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, releasing agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also to be present in the composition, according to the judgment of the formulator.
The pharmaceutical compositions suitable for administration in the invention can be administered to humans and other animals orally, rectally, nasally, parenterally (e.g., intramuscular, intraperitoneal, intravenous or subcutaneous injec-tion, or implant), intracisternally, intravaginally, intraperitoneally, sublingually, topi-cally (e.g., as a powder, ointment, or drop), bucally, as an oral spray, or a nasal spray.
The pharmaceutical compositions can be formulated in dosage forms appropriate for each route of administration.
Liquid dosage forms for oral administration include pharmaceuti-cally acceptable emulsions, microemulsions, solutions, suspensions, syrups and 2o elixirs. In addition to the active NEMO-derived polypeptides, the liquid dosage forms may contain inert diluents commonly used in the art. The inert diluents may include, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetra-hydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. The liquid dosage form for oral administration may also contain adjuvants, which include wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents. Other dosage forms for oral 3o administration include, for example, aqueous suspensions containing the active NEMO-derived polypeptides in an aqueous medium in the presence of a non-toxic suspending agent such as sodium carboxy-methylcellulose, and oily suspensions containing a NEMO-derived polypeptides of the present invention in a suitable vegetable oil, for example arachis oil.
Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution, suspension or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol.
Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution, U.S.P. and isotonic sodium chloride solution. In addition, sterile, fixed oils to are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid are used in the preparation of injectables.
The injectable formulations can be sterilized, for example, by filtra-tion through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
In order to prolong the effect of the inventive NEMO-derived polypeptides, it is often desirable to slow the absorption of the peptides from subcuta-neous or intramuscular injection. This may be accomplished by the use of a liquid 2o suspension of crystalline or amorphous material with poor water solubility.
The rate of absorption of the NEMO-derived polypeptides then depends upon its rate of dissolu-tion, which, in turn, may depend upon crystal size and crystalline form.
Alternatively, dissolving or suspending the drug in an oil vehicle accomplishes delayed absorption of a parenterally administered NEMO-derived polypeptides form. Injectable depot forms are made by forming microencapsulated matrices of the NEMO-derived polypeptides in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of NEMO-derived polypeptides to polymer and the nature of the particular polymer employed, the rate of NEMO-derived polypeptides release can be controlled.
Examples of other biodegradable polymers include poly(orthoesters) and 3o poly(anhydrides) Depot injectable formulations are also prepared by entrapping the NEMO-derived polypeptides in liposomes or microemulsions which are compatible with body tissues.
Compositions for rectal or vaginal administration are preferably suppositories which can be prepared by mixing the NEMO-derived polypeptides of this invention with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but 5 liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the peptide.
Solid dosage forms for oral administration include capsules, tablets, pills, grills, powders, and granules. In such solid dosage forms, the peptide is mixed with at least one inert, pharmaceutically acceptable excipient or carrier. In addition, 1 o the solid dosage form may contain one or more fillers, extenders, binders, humectants, disintegrating agents, retarding agents, absorption accelerators, wetting agents, absor-bents, or lubricants. Examples of suitable fillers or extenders include, starches, lactose, sucrose, glucose, mannitol, and silicic acid, sodium citrate and dicalcium phosphate.
Examples of suitable binders include, microcrystalline cellulose, carboxymethyl-15 cellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia.
Glycerol is an example of a suitable humectant. Examples of suitable disintegrating agents include, agar-agar, calcium carbonate, potato or tapioca starch, maize starch, alginic acid, certain silicates, and sodium carbonate. Paraffin is an example of a suitable solu-tion-retarding agent. As absorption accelerators, any quaternary ammonium 2o compound may be used. Examples of suitable wetting agents include, cetyl alcohol and glycerol monostearate. Examples of suitable absorbents include, kaolin and bentonite clay. Examples of suitable lubricants include, talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate. In the case of capsules, tablets and pills, the dosage form may also comprise buffering agents.
25 The tablets may, if desired, be coated using known methods and excipients that may include enteric coating using for example hydroxypropylmethyl-cellulose phthalate. The tablets may be formulated in a manner known to those skilled in the art so as to give a sustained release of the NEMO-derived polypeptides of the present invention. Such tablets may, if desired, be provided with enteric coatings by known methods, for example by the use of cellulose acetate phthalate. They may optionally contain opacifying agents and can also be of a composition that they release the active ingredients) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions that can be used include polymeric substances and waxes.
Similarly, capsules, for example hard or soft gelatin capsules, containing the active peptide with or without added excipients, may be prepared by known methods and, if desired, provided with enteric coatings in a known manner.
The contents of the capsule may be formulated using known methods so as to give sustained release of the active NEMO-derived polypeptides. In such solid dosage forms the active NEMO-derived polypeptides may be admixed with at least one inert diluent such as sucrose, lactose or starch. Such dosage forms may also comprise, as is 1 o normal practice, additional substances other than inert diluents, e.g., tableting lubri-cants and other tableting aids such a magnesium stearate and microcrystalline celIu-lose. In the case of capsules, tablets and pills, the dosage forms may also comprise buffering agents. They may optionally contain opacifying agents and can also be of a composition that they release the active ingredients) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner.
Examples of embedding compositions that can be used include polymeric substances and waxes.
Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
2o If desired, the NEMO-derived polypeptides of the present invention can be incorporated into slow release or targeted delivery systems such as polymer matrices, liposomes and microspheres. They may be sterilized, for example, by filtra tion through a bacteria-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions that can dissolve in sterile water, or some other sterile injectable medium immediately before use.
The NEMO-derived polypeptides may be formulated into granules with or without additional excipients. The granules may be ingested directly by the patient or they may be added to a suitable liquid carrier (for example, water) before ingestion. The granules may contain disintegrates, e.g. an effervescent couple formed 3o from an acid and a carbonate or bicarbonate salt to facilitate dispersion in the liquid medium.
Dosage forms for topical or transdermal administration of the peptide of this invention include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants or patches. Transdermal patches have the added advantage of providing controlled delivery of a peptide to the body. The rate can be controlled by either providing a rate controlling membrane or by dispersing the peptide in a polymer matrix or gel. The active component is admixed under sterile conditions with a pharmaceutically acceptable carrier and any needed preservatives or buffers as may be required. Dissolving or dispensing the peptide in the proper medium can make such dosage forms. Absorption enhancers can also be used to increase the flux of the to peptide across the skin. Ophthalmic formulation, eardrops, eye ointments, powders and solutions are also contemplated as being within the scope of this invention.
Dosage forms for topical administration may comprise a matrix in which the pharmacologically NEMO-derived polypeptides of the present invention are dispersed so that the peptides are held in contact with the skin in order to administer the peptides transdermally. A suitable transdermal composition may be prepared by mixing the pharmaceutically active NEMO-derived polypeptides with a topical vehicle, such as animal and vegetable fats, oils, petrolatum, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof, together with a potential transdermal accelerant such as dimethyl sulphoxide or propylene glycol. Alternatively the active NEMO-derived polypeptides may be dispersed in a pharmaceutically acceptable paste, cream, gel or ointment base. The amount of active NEMO-derived polypeptides contained in a topical formulation should be such that a therapeutically effective amount of the peptides are delivered during the period of time for which the topical formulation is intended to be on the skin.
Powders and sprays can contain, in addition to the NEMO-derived polypeptides of this invention, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates and polyamide powder, or mixtures of these substances.
Sprays can additionally contain customary propellants such as chlorofluorohydro-3o carbons. The therapeutically active NEMO-derived polypeptides may be formulated into a composition, which is dispersed as an aerosol into the patient's oral or nasal cavity. Such aerosols may be administered from a pump pack or from a pressurized pack containing a volatile propellant.
The therapeutically active NEMO-derived polypeptides used in the method of the present invention may also be administered by continuous infusion either from an external source, for example by intravenous infusion or from a source of the NEMO-derived polypeptides placed within the body. Internal sources include implanted reservoirs containing the NEMO-derived polypeptides to be infused which is continuously released for example by osmosis and implants which may be (a) liquid such as an oily suspension of the peptides to be infused for example in the form of a to very sparingly water-soluble derivative such as a dodecanoate salt or a lipophilic ester or (b) solid in the form of an implanted support, for example of a synthetic resin or waxy material, for the NEMO-derived polypeptides to be infused. The support may be a single body containing the entire quantity of the peptides or a series of several bodies each containing part of the quantity of the peptides to be delivered.
The amount of active peptides present in an internal source should be such that a therapeutically effective amount of the peptides are delivered over a long period of time.
The invention also relates to the use of an effective amount of a composition comprising a polypeptide fusion construct according to the invention and one or more pharmaceutically acceptable carriers or excipients, for the preparation of a medicament for modulating or treating a disorder regulated by the NF-xB
signaling pathway in a subject in need thereof.
According to an advantageous embodiment of said use, said disorder regulated by the NF-xB signaling pathway is selected from the group consisting of inflammatory responses, oncogenesis, and viral infection.
The invention also relates to the use of an effective amount of a composition comprising a polypeptide fusion construct according to the invention and one or more pharmaceutically acceptable carriers or excipients, for the preparation of a medicament for regulating cell proliferation or apoptosis in a subject in need thereof.
The invention also relates to the use of an effective amount of a composition comprising a polypeptide fusion construct according to the invention one or more pharmaceutically acceptable carriers or excipients, for the preparation of a medicament for regulating B or T lymphocytes in antigenic stimulation in a subject in need thereof.
According to an advantageous embodiment of said uses, said subject in need thereof is a human.
According to another advantageous embodiment of said uses, said effective amount ranges from 0.1 mg/Kg/day to 30 mg/Kg/day.
According to another advantageous embodiment of said uses, said composition is administered in a form selected from the group consisting of oral, rectal, nasal, parenteral, intracisternal, intravaginal, intraperitoneal, sublingual, 1 o topical, and bucal administration.
According to another advantageous embodiment of said uses, said composition is administered preferably intravenously.
The present invention further provides a method of identifying polypeptides that modulate oligomerization of NEMO by:
a) identifying a candidate polypeptide sequence;
b) creating a polypeptide fusion construct by linking said candidate polypeptide sequence to a polypeptide having a high transduction potential via a spacer sequence;
c) contacting a cell culture with the polypeptide fusion construct; and 2o d) monitoring the activity of the NF-KB signaling pathway;
e) comparing the activity of the NF-KB signaling pathway in the presence of said polypeptide fusion construct to the activity of the NF-KB
signaling pathway in the absence of said polypeptide fusion construct to determine the relative inhibition by said polypeptide fusion construct; and f) correlating relative inhibition by said polypeptide fusion construct to NEMO oligomerization.
In this method, the candidate polypeptide sequence preferably has a coiled-coil or helical structure. More preferably, the candidate polypeptide sequence has 20-60 amino acids. It is also preferred that the candidate polypeptide sequence be 3o derived from NEMO.
As stated in the embodiments above, the spacer sequence may have a length ranging from 1-35 amino acids, but shorter lengths may also be employed (sups°a). Examples of the spacer sequence includes: SEQ ID NO: 9 and SEQ ID NO:
The two dashed lines represent a stoichiometric titration and intersect at an concentration of 16 ~.M. Given the 1 ~M concentration of the BODIPY-Ant-CC2, this gives a complex stoechiometrie of 0.8. (B) Direct titration of BODIPY-Ant-LZ
(0.1 ~,M) with CC2 by fluorescence anitropy. The anisotropy values of the BODIPY-Ant-LZ alone (white bar) or in the presence of the CC2 peptide (30~M, grey bar;
100 ~.M, black bar) are given in milliunits (mA).
Figure 8: Cell death induced in the retinoblastoma cell line Y79 by Ant-CC2 and Ant-LZ peptides Rb cell line Y79 were treated with various concentration of the Ant-CC2 (WT) (filled squares) or Ant-CC2 (Mu) (open squares) (A), or Ant-LZ (WT) (filled circles), or Ant-LZ (Mu) (open circles) (B), or Ant peptide (open triangle) (C) for 3 hours (A, B) or 16 hours (C). Cell survival was then evaluated using the MTS
assay as described in "Materials and methods"
Unless specifically defined, all technical and scientific terms used herein have the same meaning as commonly understood by a skilled artisan in enzymology, biochemistry, cellular biology, molecular biology, and the medical sciences.
~ All methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, with suitable methods and materials being described herein. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. Further, the materials, methods, and examples are illustrative only and are not intended to be limiting, unless otherwise specified.
In this application, the present inventors studied the inhibition of NF-KB activation by peptides designed to disrupt NEMO oligomerization. The present inventors have previously shown that the minimal trimerization domain comprises the 3o CC2-LZ coiled-coil subdomain and that the isolated and/or purified CC2 and LZ
domains bind to each other to form a stable trimer of heterodimers. This structural model is reminiscent of the fold of the gp41 ectodomain from HIV-1 (Agou et al., 2004, J. Biol. Chem.). It consist of a central three-stranded coiled coil (formed by the CC2 coiled coil motif of NEMO) which is surrounded by the LZ helical motif derived from the C-terminal end of NEMO, packed in an antiparallel manner around the outside of the CC2 coiled-coil. On the basis of this model, the present inventors 5 rationally designed two cell-permeable peptides corresponding to optimal portions of CC2 or LZ subdomains that mimic the contact area between NEMO subunits.
Peptide transduction was monitored by FACS and their effect on LPS-induced NF-oB
activa-tion was quantified using a NF-oB dependent (3-galactosidase assay in stably transfected pre-B 70213 lymphocytes. The present inventors have also demonstrated 1 o that the LZ peptide and, to a lesser extent the CC2 peptide, inhibit specifically NF-oB
activation with ICSO values in the ~.M range. The effects were specific because control peptides including mutated CC2 and LZ peptides as well as heterologous coiled-coil peptides (GCN4), had no inhibitory effect on NF-oB activation. Furthermore, the present inventors have shown that these NF-oB peptidic inhibitors induced the cell death in the human retinoblastoma cell lines Y79 that exhibit constitutive NF-oB
activity. Collectively, the present inventors have provided a new and promising strategy to inhibit the NF-KB pathway by targeting NEMO's oligomerization.
The present inventors have proven that NEMO constitutes a preferential target for the search for drugs inhibiting the NF-~cB signaling path, 2o because this protein acts upstream from the NF-KB activation path. The role of NEMO and its various domains was partially studied and published in the following article, "NEMO trime~izes through its coiled coil C-terminal domain. " J Biol Chem, 2002 May 17;277(20):17464-75. Agou F. et al., a copy of which is incorporated by reference.
In the present invention, the inventors have synthesized peptides that mimic either the oligomerization domain (CC2 domain = approx. 40 residues), or the LZ motif (L2 domain = approx. 40 residues). The combination of these peptides alters either the oligomerization of NEMO or the combining thereof with the proteinic effector, in both cases inhibiting the NF-KB pathway.
3o In an aspect of the present invention, peptide drugs have been chemically combined with a peptide of 16 amino acids in length (penetratin/antennapedia), thereby enabling intracellular transport thereof possible.
The resulting peptides also may be chemically coupled with a fluorescent tracer in order to monitor internalization into B lymphocyte cell lines through FACS.
The action of these peptides was tested directly on B lymphocytes having stably integrated the beta-galactosidase carrier gene also bearing upstream from its promoter several NF-~cB transcription factor (Clone C3) activation sites (see Examples herein below).
The present inventors have successfully been able to monitor the inhibitory effect of these peptides by measuring the same following stimulation of the B lymphocytes by LPS.
The results as a whole reveal that the presence of the peptide mimicking the "CC2" motif reduces the NF-KB activity by 70% as compared with a control peptide at a relatively low dose of 20 ~M. At this concentration, the effect of the "Leucine zipper" peptide is still more significant, since its presence in the medium completely eliminates cell response.
These new inhibitors of the NF-xB cellular signalling path offer a major advantage as anti-inflammatory compounds and also as anti-tumor compounds, which may be used for the treatment and/or prevention of cancers and other disorders.
The present invention relates to compounds, peptides, or composi-2o dons that are used for modulating the oligomerization of NEMO. In particular, the peptide compounds described herein below may be in an isolated and/or purified or coupled form with or without a vectorizing agent. It is to be understood that the present invention also embraces peptides having at least 70% homology with the NEMO-derived polypeptides, so long as the homologs possess said inhibitory activity.
Methods for assessing inhibitory activity of the NEMO-derived polypeptides, and homologs thereof, are provided below and exemplified in the Examples of the present application. The peptides of the present invention and the doses thereof are deemed to possess inhibitory activity when the NF-KB activity is reduced by at least 50%
as compared with a control peptide.
The present invention also relates to pharmaceutical compositions containing said peptides, especially for the preparation of medicines used for the treatment of inflammatory responses, oncogenesis, viral infection, the regulation of cell proliferation and apoptosis and antigenic stimulation. In a preferred embodiment, the pharmaceutical compositions containing said peptides are useful for the treatment of cancer.
Also embraced by the present invention are methods of obtaining, s malting, and identifying peptides and compounds that inhibit the NF-KB
signaling pathway, in particular by means of the 70Z/3-C3 cell line filed with the CNCM
(Collection Nationale de Cultures de Microorganismes), 28 rue du Docteur Roux, 75724 PARIS Cedex 15, France, on April 1st, 2003 under number I-3004.
As used herein, the term "reduced" or "inhibited" means decreasing l0 the intracellular activity of one or more enzymes in the NF-~cB pathway either directly or indirectly. The phrase "inhibiting the NF-oB pathway" preferably means that the NF-~cB pathway is inhibited by disruption of NEMO oligomerization.
The term "enhanced" as used herein means increasing the intra-cellular activity or concentration of the NEMO derived peptides, which are encoded 1s by the corresponding DNA. Enhancement can be achieved with the aid of various manipulations of the bacterial cell. In order to achieve enhancement, particularly over-expression, the number of copies of the corresponding gene can be increased, a strong promoter can be used, or the promoter- and regulation region or the ribosome binding site which is situated upstream of the structural gene can be mutated.
2o Expression cassettes which are incorporated upstream of the structural gene act in the same manner. In addition, it is possible to increase expression by employing inducible promoters. A gene can also be used which encodes a corresponding enzyme with a high activity. Expression can also be improved by measures for extending the life of the mRNA. Furthermore, preventing the degradation of the enzyme increases enzyme 2s activity as a whole. Moreover, these measures can optionally be combined in any desired manner. These and other methods for altering gene activity in a plant are known as described, for example, in Methods in Plant Molecular Biology, Maliga et al, Eds., Cold Spring Harbor Laboratory Press, New Yorlc (1995).
A gene can also be used which encodes a corresponding or variant 3o NEMO derived peptide with a high activity of inhibiting the NF-xB pathway.
Prefera-bly the corresponding enzyme has a greater ability than the native form of the NEMO
protein to inhibit the NF-xB pathway, more preferably at least in the range of 5, 10, 25% or 50% more inhibition. Most preferably the NEMO derived peptides of the present invention reduce the NF-KB pathway by at least 50%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, as compared to the pathway in the presence of the native NEMO protein.
In the context of the present Application, a polynucleotide sequence is "homologous" with the sequence according to the invention if at least 70%, prefera-bly at least 80%, most preferably at least 90% of its base composition and base sequence corresponds to the sequence according to the invention. According to the invention, a "homologous protein" or "homologous peptide" is to be understood to l0 comprise proteins (peptides) which contain an amino acid sequence at least 70 % of which, preferably at least 80 % of which, most preferably at least 90 % of which, corresponds to the amino acid sequence of the CC2 region of NEMO (SEQ ID NO:
3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO:
16) in the case of human-derived NEMO, wherein corresponds is to be understood to mean that the corresponding amino acids are either identical or are mutually homolo-gous amino acids. It is further to be understood that, as evinced by the Examples of the present invention, the homologous peptide of CC2 preferably retains the coiled-coil motif structure and the homologous peptide of LZ preferably retains the helical 2o motif structure. With the guidance proffered by the identification of SEQ
ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 14, and SEQ ID NO: 16 and the detailed description in the Examples below, screening of theoretical mutations within the scope of the present invention would require nothing more than a technicians level of skill in the art. More specifically, as is routine in the art, with the identification of a candidate sequence (i.e., the regions corresponding to SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 14, and SEQ ID NO: 16) the artisan would assay and screen one or all possible permuta-tions of the said sequence to identify mutants possessing the same or better therapeutic efficacy.
The expression "homologous amino acids" denotes those that have 3o corresponding properties, particularly with regard to their charge, hydrophobic character, steric properties, etc.
Homology, sequence similarity or sequence identity of nucleotide or amino acid sequences may be determined conventionally by using known software or computer programs such as the BestFit or Gap pairwise comparison programs (GCG
Wisconsin Package, Genetics Computer Group, 575 Science Drive, Madison, Wisconsin 53711). BestFit uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2: 482-489 (1981), to find the best segment of identity or similarity between two sequences. Gap performs global alignments: all of one sequence with all of another similar sequence using the method of Needleman and Wunsch, J. Mol. Biol. 48:443-453 (1970). When using a sequence 1o alignment program such as BestFit, to determine the degree of sequence homology, similarity or identity, the default setting may be used, or an appropriate scoring matrix may be selected to optimize identity, similarity or homology scores.
Similarly, when using a program such as BestFit to determine sequence identity, similarity or homology between two different amino acid sequences, the default settings may be used, or an appropriate scoring matrix, such as blosum45 or blosum~0, may be selected to optimize identity, similarity or homology scores.
The present invention also relates to polynucleotides which encode the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO:
7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO:
14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, and which can be obtained by screening by means of the hybridization of a corresponding gene bank with a probe which contains the sequence of said polynucleotide that encodes the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, and isolation of said DNA
sequence.
Polynucleotide sequences according to the invention are suitable as hybridization probes for RNA, cDNA and DNA, in order to isolate those cDNAs or genes that exhibit a high degree of similarity to the sequence that encodes the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof.
Polynucleotide sequences according to the invention are also suitable as primers for polymerase chain reaction (PCR) for the production of DNA, 5 which encodes a NEMO-derived polypeptide having an ability to inhibit the NF-~cB
pathway.
Oligonucleotides such as these, which serve as probes or primers, can contain more than 30, preferably up to 30, more preferably up to 20, most prefera bly at least 15 successive nucleotides. Oligonucleotides with a length of at least 40 or to 50 nucleotides are also suitable.
The term "isolated and/or purified" means separated from its natural environment.
The term "polynucleotide" refers in general to polyribonucleotides and polydeoxyribonucleotides, and can denote an unmodified RNA or DNA or a 15 modified RNA or DNA. ' The term "polypeptides" is to be understood to mean peptides or proteins that contain two or more amino acids that are bound via peptide bonds.
The polypeptides according to invention include polypeptides corresponding to the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of 2o NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, particularly those with the biological activity of inhibition the NF-oB pathway, and also includes those, at least 70 % of which, preferably at least 80% of which, are homologous with the polypeptide corresponding to the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, and most preferably those which exhibit a homology of at least 90 % to 95 % with the polypeptide corresponding to the 3o region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, and which have the cited activity.
The invention also relates to coding DNA sequences that encode the CC2 region of NEMO (SEQ ID NO: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof, by degeneration of the genetic code. One of skill in the art would appreciate that the aforementioned DNA sequences may be based on the full-length DNA sequences for the murine-derived NEMO (SEQ ID NO: 11) and the human-1 o derived NEMO (SEQ ID NO: 17) and thereby these sequences may be used to ascertain the scope of these sequences in accordance with the present invention.
In the same manner, the invention further relates to DNA sequences that hybridize with DNA sequences that encode the CC2 region of NEMO (SEQ ID
N0: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ region of NEMO
(SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof.
Moreover, one skilled in the art is also aware of conservative amino acid replacements such as the replacement of glycine by alanine or of aspartic acid by glutamic acid in proteins as "sense mutations" which do not result in any fundamental 2o change in the activity of the protein, i.e. which are functionally neutral.
It is also known that changes at the N- and/or C-terminus of a protein do not substantially impair the function thereof, and may even stabilize said function.
In the same manner, the present invention also relates to DNA
sequences that hybridize with the DNA sequence that encodes the CC2 region of NEMO (SEQ ID N0: 3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO and the CC2 region of NEMO (SEQ ID NO: 14) or the LZ
region of NEMO (SEQ ID NO: 16) in the case of human-derived NEMO, or fragments thereof. The present invention also relates to DNA sequences that are produced by polymerase chain reaction (PCR) using oligonucleotide primers that 3o result from the DNA sequence that encodes the CC2 region of NEMO (SEQ ID
NO:
3) or the LZ region of NEMO (SEQ ID NO: 7) in the case of murine-derived NEMO
and the CC2 region of NEMO (SEQ ID N0: 14) or the LZ region of NEMO (SEQ ID
NO: 16) in the case of human-derived NEMO, or fragments thereof.
Oligonucleotides of this type typically have a length of at least 15 nucleotides.
The terms "stringent conditions" or "stringent hybridization condi-tions" includes reference to conditions under which a polynucleotide will hybridize to its target sequence, to a detectably greater degree than other sequences (e.g., at least 2-fold over background). Stringent conditions are sequence-dependent and will be different in different circumstances. By controlling the stringency of the hybridization and/or washing conditions, target sequences can be identified which are 100%
complementary to the probe (homologous probing). Alternatively, stringency condi-to tions can be adjusted to allow some mismatching in sequences so that lower degrees of similarity are detected (heterologous probing).
Typically, stringent conditions will be those in which the salt concentration is less than about 1.5 M Na ion, typically about 0.01 to 1.0 M
Na ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., 10 to 50 nucleotides) and at least about 60°C for long probes (e.g., greater than 50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. Exemplary low strin-gency conditions include hybridization with a buffer solution of 30 to 35%
formamide, 1 M NaCI, 1% SDS (sodium dodecyl sulphate) at 37°C, and a wash in 1X
2o to 2X SSC (20X SSC=3.0 M NaCI/0.3 M trisodium citrate) at 50 to 55°C
Exemplary moderate stringency conditions include hybridization in 40 to 45% formamide, 1 M
NaCI, I% SDS at 37°C, and a wash in O.SX to 1X SSC at 55 to 60°C
Exemplary high stringency conditions include hybridization in 50% formamide, 1 M NaCI, 1% SDS
at 37°C, and a wash in O.1X SSC at 60 to 65°C.
Specificity is typically the function of post-hybridization washes, the critical factors being the ionic strength and temperature of the final wash solution. For DNA--DNA hybrids, the Tm can be approximated from the equation of Meinkoth and Wahl, Anal. Biochem., 138:267-284 (1984): Tm =81.5°C +16.6 (log M)+0.41 (%GC)-0.61 (% form)-500/L; where M is the molarity of monovalent cations, %GC is the 3o percentage of guanosine and cytosine nucleotides in the DNA, % form is the percentage of formamide in the hybridization solution, and L is the length of the hybrid in base pairs. The Tm is the temperature (under defined ionic strength and pH) at which 50% of a complementary target sequence hybridizes to a perfectly.
matched probe. Tm is reduced by about 1 °C for each 1 % of mismatching; thus, Tm, hybridiza-tion and/or wash conditions can be adjusted to hybridize to sequences of the desired identity. For example, if sequences with approximately 90% identity are sought, the Tm can be decreased 10°C. Generally, stringent conditions are selected to be about 5°C lower than the thermal melting point (Tm) for the specific sequence and its complement at a defined ionic strength and pH. However, severely stringent condi-tions can utilize a hybridization and/or wash at 1, 2, 3, or 4°C lower than the thermal melting point (Tm); moderately stringent conditions can utilize a hybridization andlor to wash at 6, 7, 8, 9, or 10°C lower than the thermal melting point (Tm); low stringency conditions can utilize a hybridization and/or wash at 11, 12, 13, 14, 15, or 20°C lower than the thermal melting point (Tm). Using the equation, hybridization and wash compositions, and desired Tm, those of ordinary skill will understand that variations in the stringency of hybridization and/or wash solutions are inherently described. If the desired degree of mismatching results in a Tm of less than 45°C
(aqueous solution) or 32°C (formamide solution) it is preferred to increase the SSC
concentration so that a higher temperature can be used. An extensive guide to the hybridization of nucleic acids is found in Current Protocols in Molecular Biology, Chapter 2, Ausubel, et al., Eds., Greene Publishing and Wiley-Interscience, New York (2000).
2o Thus, with the foregoing information, the skilled artisan can identify and isolated and/or purified polynucleotides, which are substantially similar to the present polynucleotides. In so isolating such a polynucleotide, the polynucleotide can be used as the present polynucleotide in, for example, inhibiting the NF-KB
pathway.
One embodiment of the present invention is methods of screening for polynucleotides, which have substantial homology to the polynucleotides of the present invention, preferably those polynucleotides encoding a protein having an ability of inhibiting the NF-oB pathway.
The polynucleotide sequences of the present invention can be carried on one or more suitable plasmid vectors, as known in the art for plants or the like.
3o In one embodiment, it may be advantageous for propagating the polynucleotide to carry it in a bacterial or fungal strain with the appropriate vector suitable for the cell type. Common methods of propagating polynucleotides and producing proteins in these cell types are known in the art and are described, for example, in Maniatis et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York (1982) and Sambrook et al., Molecular Cloning:
A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York (1989).
The aforementioned embodiments are described in the context of SEQ ID NO: 3 (CC2 region of the NEMO protein; i.e., amino acids 246-286 of SEQ
ID NO: 12) and SEQ ID NO: 7 (LZ region of the NEMO protein; i.e., amino acids 390-412 of SEQ ID NO: 12), where SEQ ID NO: 12 is murine-derived NEMO. The aforementioned embodiments have been further described based on SEQ ID NO: 14 and SEQ ID NO: 16, which are derived from SEQ ID NO: 18 (human-derived NEMO). However, it is understood that the present invention preferably provides peptide derivatives of the NEMO protein that may be internalized into eukaryotic cells. Internalization of the NEMO peptide derivatives may be imparted by fusing the NEMO peptide derivative(s), or homologues thereof, to a polypeptide having a high transduction potential. The skilled artisan would readily appreciate that the term "high transduction potential" as used herein means that the polypeptide, and the fusion protein thereof, readily transverses the cellular membrane resulting in the internaliza-tion of fusion peptide into the cellular milieu. Examples of peptides having a high transduction potential include: the third helix of the Antennapedia/penetratin protein (Ant) (Prochiantz, 2000,Curr. Opin. Cell Biol.), TAT derived peptides (Fawel, 1994, P.N.A.S.), VP22 from HSV-1 (Stroh C. 2003, Oncogene), Pep. 1 (Morris, 2001, Nature Biotech.).
To exemplify the present invention and the utility thereof, the present inventors have fused SEQ ID NO: 3 and SEQ ID NO: 7 to the internalization peptide Ant (SEQ ID NO: 1) separated by a short SKGMQ linker (SEQ ID NO: 9) or by a LKAQADI linlcer (SEQ ID NO: 10). The resultant Ant-CC2 construct has the sequence: CRQIKIWFQNRRMKWKKSKGMQLEDLRQQLQQAEEALVAKQELI
DKLKEEAEQHKIV (SEQ ID NO: 2), where the N-terminal cysteine has been added for coupling to a flurophore to facilitate detection of internalization and/or inhibition.
The resultant Ant-LZ construct has the sequence:
CRQIKIWFQNRRMKWKKLKAQADIYKADFQAERHAREKLVEKKEYLQEQLE
QLQREFNKL, (SEQ ID NO: 6), where the N-terminal cysteine has been added for coupling to a flurophore to facilitate detection of internalization and/or inhibition.
In the present invention the N-terminal cysteine is an optional addi-tion and, as such, this residue may be omitted from the final inhibitory peptide.
5 Further, in the present invention the linker between the peptide having a high transduction potential (e.g., Ant) and the CC2 or LZ peptide can be of a variable sequence andlor length, so long as the linker sequence does not significantly diminish the inhibitory property of CC2 or LZ peptide. To this end, the linker may be of a length ranging from 1-35 amino acids, preferably 2-25 amino acids, more preferably 1o 3-15 amino acids, most preferably 4-10 amino acids. In a particularly preferred embodiment, the linker sequence is that of SEQ ID NO: 9 or SEQ ID NO: 10.
As set forth hereinabove, it is to be understood that the homologous peptide of CC2 preferably retains the coiled-coil motif structure and the homologous peptide of LZ preferably retains the helical motif structure, even when in the fusion 15 construct set forth above. As such, the present invention embraces homologous peptides, within the homology constraints above, of SEQ ID NO: 2 and SEQ ID
NO:
6 (murine-derived) and SEQ ID NO: 13 and SEQ ID NO: 15 (human-derived) with the caveat that said homologous peptides retain the structure of CC2 and LZ
respec-tively, as well as the ability to inhibit the NF-~cB pathway.
2o In an embodiment of the present invention, the inventors explored the N-terminal region of the wild-type NEMO, in particular the NLM conserved motif (residues 293-322 of SEQ ID NO: 12) appearing in Figure 1A. To this end, the following sequences were produced (see Table 1 for the corresponding sequence):
NLM-DR (SEQ ID NO : 30) Ant.NLM-DR (SEQ ID NO : 31) Tat NLM-DR (SEQ ID NO : 32) R7-NLM-DR (SEQ ID NO : 33) R9-NLM-DR (SEQ ID NO : 34) NLM-DR is a 21 amino acid "motif' (and the corresponding wild 3o type NLM covering the same amino acid range) derived from the larger 30 amino acid conserved NLM motif set forth in Figure 1A. The NLM-DR has been mutated from the wild type NLM sequence in that the aspartic acid at residue 11 in the wild type sequence has been replaced by an arginine (see Table l and SEQ ID NO: 30).
This mutation was selected because, as confirmed by structural studies, the resulting polypeptide would facilitate an intramolecular salt bridge allowing the stabilization of the peptide in its helicoidal form.
From circular dichroism studies (CD), it appears that CC2 and LZ
peptides adopt a helicoidal structure, depending on their concentration. CC2 creates a helix more stable than LZ. RMN and Rayon X Diffraction studies have confirmed the structure of CC2. Always, by CD studies, the NLM-DR peptide is structured as a helix more stable than the wild-type peptide.
Although, the polypeptides utilized in this example are 21 amino acids long, it is contemplated in the present invention that the operable size of the NLM fragment may be as short as 15 amino acids. In addition, any mutation in the sequence of the NLM polypeptides that are able to reinforce the helicity and the intermolecular interactions between the peptides and their molecular target would be of particular interest and is within the scope of the present invention.
In the present invention it is speculated that Antennapedia mediated monomerization of peptides may be crucial. Specifically, it is speculated that monomerization allows them to interfer with NEMO oligomerization.
Nuclear factor-kB (NF-oB) signaling is an essential signal transduc-2o tion pathway involved in inflammatory responses, oncogenesis, viral infection, the regulation of cell proliferation and apoptosis; and in the case of B and T
lymphocytes in antigenic stimulation (Ghosh, 1998, Annu. Rev. Immunol.; I~arin, 1999, J.
BioI.
Chem.; Israel, 2000, Trends Cell Biol.; Santoro, 2003, EMBO J..). As such, the inventive peptides are useful for the modulation of and/or treatment of inflammatory responses, oncogenesis, viral infection; the regulation of cell proliferation and apoptosis; and regulation of B or T lymphocytes in antigenic stimulation.
Therefore, the present invention provides for a method of treating the same by administering to a subject in need thereof a peptide in accordance with the present invention.
In the present invention, the "subj ect in need thereof' may be a human, a domestic animal, a farm animal, or an animal that is generally found in the wild. For example, the subject may be selected from a human, a dog, a cat, a horse, a cow, a mouse, a guinea pig, a sheep, a pig, etc.
Clearly, the amount of the peptide to be administered will depend on the subject to which it is to be administered. In the case where the subject is a human, the amount of the peptide to be administered will depend on a number of factors including the age of the patient, the severity of the condition and the past medical history of the patient and always lies within the sound discretion of the administering physician. Generally, the total daily dose of the compounds of this invention administered to a human or other mammal in single or in divided doses can be in amounts, for example, of from 0.1 mg/Kglday to 30 mg/Kg/day of the peptide, preferably from 0.1 mg/Kg/day to 20 mg/Kg/day of the peptide, more preferably from 2 mg/Kg/day to 10 mg/Kg/day of the peptide, in single or multiple doses.
Single dose compositions may contain such amounts or submultiples thereof to make up the daily dose. In a preferred embodiment, the preferred dose is 10 mg/patient to be administered twice a day. In a particularly preferred embodiment, the administration route is intravenous.
The peptides of the present invention may also be administered as a component of a pharmaceutically administrable composition. In other words, the peptide may be present in a formulation for administration to a subject in need thereof.
The inventive peptide may be the sole active ingredient for NF-xB pathway inhibition or for treatment of inflammatory responses, oncogenesis, viral infection, the regula-2o tion of cell proliferation and apoptosis and antigenic stimulation.
Alternatively, the composition may also contain one or more additional compounds that may be used to treat the same. In addition, the peptide of the present invention may be in a composi-tion that contains one or more compounds that are useful for treatment of a disorder not caused by the NF-~cB pathway.
A therapeutically effective amount of the peptides suitable for administration in the present invention may be administered alone or in combination with one or more pharmaceutically acceptable carriers. As used herein, the term "pharmaceutically acceptable carrier" means a non-toxic, inert solid, semi-solid or liquid filer, diluent, encapsulating material or formulation auxiliary of any type. Some 3o examples of materials which can serve as pharmaceutically acceptable carriers are sugars such as lactose, glucose and sucrose; starches such as corn starch and potato starch; cellulose and its derivatives such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc;
excipients such as cocoa butter and suppository waxes; oils such as peanut oil, cottonseed oil;
safflower oil; sesame oil; olive oil; corn oil and soybean oil; glycols; such a propylene glycol; esters such as ethyl oleate and ethyl laurate; agar; buffering agents such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water;
isotonic saline; Ringer's solution; ethyl alcohol, and phosphate buffer solutions, as well as other non-toxic compatible lubricants such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, releasing agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also to be present in the composition, according to the judgment of the formulator.
The pharmaceutical compositions suitable for administration in the invention can be administered to humans and other animals orally, rectally, nasally, parenterally (e.g., intramuscular, intraperitoneal, intravenous or subcutaneous injec-tion, or implant), intracisternally, intravaginally, intraperitoneally, sublingually, topi-cally (e.g., as a powder, ointment, or drop), bucally, as an oral spray, or a nasal spray.
The pharmaceutical compositions can be formulated in dosage forms appropriate for each route of administration.
Liquid dosage forms for oral administration include pharmaceuti-cally acceptable emulsions, microemulsions, solutions, suspensions, syrups and 2o elixirs. In addition to the active NEMO-derived polypeptides, the liquid dosage forms may contain inert diluents commonly used in the art. The inert diluents may include, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetra-hydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. The liquid dosage form for oral administration may also contain adjuvants, which include wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents. Other dosage forms for oral 3o administration include, for example, aqueous suspensions containing the active NEMO-derived polypeptides in an aqueous medium in the presence of a non-toxic suspending agent such as sodium carboxy-methylcellulose, and oily suspensions containing a NEMO-derived polypeptides of the present invention in a suitable vegetable oil, for example arachis oil.
Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution, suspension or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol.
Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution, U.S.P. and isotonic sodium chloride solution. In addition, sterile, fixed oils to are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid are used in the preparation of injectables.
The injectable formulations can be sterilized, for example, by filtra-tion through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
In order to prolong the effect of the inventive NEMO-derived polypeptides, it is often desirable to slow the absorption of the peptides from subcuta-neous or intramuscular injection. This may be accomplished by the use of a liquid 2o suspension of crystalline or amorphous material with poor water solubility.
The rate of absorption of the NEMO-derived polypeptides then depends upon its rate of dissolu-tion, which, in turn, may depend upon crystal size and crystalline form.
Alternatively, dissolving or suspending the drug in an oil vehicle accomplishes delayed absorption of a parenterally administered NEMO-derived polypeptides form. Injectable depot forms are made by forming microencapsulated matrices of the NEMO-derived polypeptides in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of NEMO-derived polypeptides to polymer and the nature of the particular polymer employed, the rate of NEMO-derived polypeptides release can be controlled.
Examples of other biodegradable polymers include poly(orthoesters) and 3o poly(anhydrides) Depot injectable formulations are also prepared by entrapping the NEMO-derived polypeptides in liposomes or microemulsions which are compatible with body tissues.
Compositions for rectal or vaginal administration are preferably suppositories which can be prepared by mixing the NEMO-derived polypeptides of this invention with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but 5 liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the peptide.
Solid dosage forms for oral administration include capsules, tablets, pills, grills, powders, and granules. In such solid dosage forms, the peptide is mixed with at least one inert, pharmaceutically acceptable excipient or carrier. In addition, 1 o the solid dosage form may contain one or more fillers, extenders, binders, humectants, disintegrating agents, retarding agents, absorption accelerators, wetting agents, absor-bents, or lubricants. Examples of suitable fillers or extenders include, starches, lactose, sucrose, glucose, mannitol, and silicic acid, sodium citrate and dicalcium phosphate.
Examples of suitable binders include, microcrystalline cellulose, carboxymethyl-15 cellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia.
Glycerol is an example of a suitable humectant. Examples of suitable disintegrating agents include, agar-agar, calcium carbonate, potato or tapioca starch, maize starch, alginic acid, certain silicates, and sodium carbonate. Paraffin is an example of a suitable solu-tion-retarding agent. As absorption accelerators, any quaternary ammonium 2o compound may be used. Examples of suitable wetting agents include, cetyl alcohol and glycerol monostearate. Examples of suitable absorbents include, kaolin and bentonite clay. Examples of suitable lubricants include, talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate. In the case of capsules, tablets and pills, the dosage form may also comprise buffering agents.
25 The tablets may, if desired, be coated using known methods and excipients that may include enteric coating using for example hydroxypropylmethyl-cellulose phthalate. The tablets may be formulated in a manner known to those skilled in the art so as to give a sustained release of the NEMO-derived polypeptides of the present invention. Such tablets may, if desired, be provided with enteric coatings by known methods, for example by the use of cellulose acetate phthalate. They may optionally contain opacifying agents and can also be of a composition that they release the active ingredients) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions that can be used include polymeric substances and waxes.
Similarly, capsules, for example hard or soft gelatin capsules, containing the active peptide with or without added excipients, may be prepared by known methods and, if desired, provided with enteric coatings in a known manner.
The contents of the capsule may be formulated using known methods so as to give sustained release of the active NEMO-derived polypeptides. In such solid dosage forms the active NEMO-derived polypeptides may be admixed with at least one inert diluent such as sucrose, lactose or starch. Such dosage forms may also comprise, as is 1 o normal practice, additional substances other than inert diluents, e.g., tableting lubri-cants and other tableting aids such a magnesium stearate and microcrystalline celIu-lose. In the case of capsules, tablets and pills, the dosage forms may also comprise buffering agents. They may optionally contain opacifying agents and can also be of a composition that they release the active ingredients) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner.
Examples of embedding compositions that can be used include polymeric substances and waxes.
Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
2o If desired, the NEMO-derived polypeptides of the present invention can be incorporated into slow release or targeted delivery systems such as polymer matrices, liposomes and microspheres. They may be sterilized, for example, by filtra tion through a bacteria-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions that can dissolve in sterile water, or some other sterile injectable medium immediately before use.
The NEMO-derived polypeptides may be formulated into granules with or without additional excipients. The granules may be ingested directly by the patient or they may be added to a suitable liquid carrier (for example, water) before ingestion. The granules may contain disintegrates, e.g. an effervescent couple formed 3o from an acid and a carbonate or bicarbonate salt to facilitate dispersion in the liquid medium.
Dosage forms for topical or transdermal administration of the peptide of this invention include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants or patches. Transdermal patches have the added advantage of providing controlled delivery of a peptide to the body. The rate can be controlled by either providing a rate controlling membrane or by dispersing the peptide in a polymer matrix or gel. The active component is admixed under sterile conditions with a pharmaceutically acceptable carrier and any needed preservatives or buffers as may be required. Dissolving or dispensing the peptide in the proper medium can make such dosage forms. Absorption enhancers can also be used to increase the flux of the to peptide across the skin. Ophthalmic formulation, eardrops, eye ointments, powders and solutions are also contemplated as being within the scope of this invention.
Dosage forms for topical administration may comprise a matrix in which the pharmacologically NEMO-derived polypeptides of the present invention are dispersed so that the peptides are held in contact with the skin in order to administer the peptides transdermally. A suitable transdermal composition may be prepared by mixing the pharmaceutically active NEMO-derived polypeptides with a topical vehicle, such as animal and vegetable fats, oils, petrolatum, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof, together with a potential transdermal accelerant such as dimethyl sulphoxide or propylene glycol. Alternatively the active NEMO-derived polypeptides may be dispersed in a pharmaceutically acceptable paste, cream, gel or ointment base. The amount of active NEMO-derived polypeptides contained in a topical formulation should be such that a therapeutically effective amount of the peptides are delivered during the period of time for which the topical formulation is intended to be on the skin.
Powders and sprays can contain, in addition to the NEMO-derived polypeptides of this invention, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates and polyamide powder, or mixtures of these substances.
Sprays can additionally contain customary propellants such as chlorofluorohydro-3o carbons. The therapeutically active NEMO-derived polypeptides may be formulated into a composition, which is dispersed as an aerosol into the patient's oral or nasal cavity. Such aerosols may be administered from a pump pack or from a pressurized pack containing a volatile propellant.
The therapeutically active NEMO-derived polypeptides used in the method of the present invention may also be administered by continuous infusion either from an external source, for example by intravenous infusion or from a source of the NEMO-derived polypeptides placed within the body. Internal sources include implanted reservoirs containing the NEMO-derived polypeptides to be infused which is continuously released for example by osmosis and implants which may be (a) liquid such as an oily suspension of the peptides to be infused for example in the form of a to very sparingly water-soluble derivative such as a dodecanoate salt or a lipophilic ester or (b) solid in the form of an implanted support, for example of a synthetic resin or waxy material, for the NEMO-derived polypeptides to be infused. The support may be a single body containing the entire quantity of the peptides or a series of several bodies each containing part of the quantity of the peptides to be delivered.
The amount of active peptides present in an internal source should be such that a therapeutically effective amount of the peptides are delivered over a long period of time.
The invention also relates to the use of an effective amount of a composition comprising a polypeptide fusion construct according to the invention and one or more pharmaceutically acceptable carriers or excipients, for the preparation of a medicament for modulating or treating a disorder regulated by the NF-xB
signaling pathway in a subject in need thereof.
According to an advantageous embodiment of said use, said disorder regulated by the NF-xB signaling pathway is selected from the group consisting of inflammatory responses, oncogenesis, and viral infection.
The invention also relates to the use of an effective amount of a composition comprising a polypeptide fusion construct according to the invention and one or more pharmaceutically acceptable carriers or excipients, for the preparation of a medicament for regulating cell proliferation or apoptosis in a subject in need thereof.
The invention also relates to the use of an effective amount of a composition comprising a polypeptide fusion construct according to the invention one or more pharmaceutically acceptable carriers or excipients, for the preparation of a medicament for regulating B or T lymphocytes in antigenic stimulation in a subject in need thereof.
According to an advantageous embodiment of said uses, said subject in need thereof is a human.
According to another advantageous embodiment of said uses, said effective amount ranges from 0.1 mg/Kg/day to 30 mg/Kg/day.
According to another advantageous embodiment of said uses, said composition is administered in a form selected from the group consisting of oral, rectal, nasal, parenteral, intracisternal, intravaginal, intraperitoneal, sublingual, 1 o topical, and bucal administration.
According to another advantageous embodiment of said uses, said composition is administered preferably intravenously.
The present invention further provides a method of identifying polypeptides that modulate oligomerization of NEMO by:
a) identifying a candidate polypeptide sequence;
b) creating a polypeptide fusion construct by linking said candidate polypeptide sequence to a polypeptide having a high transduction potential via a spacer sequence;
c) contacting a cell culture with the polypeptide fusion construct; and 2o d) monitoring the activity of the NF-KB signaling pathway;
e) comparing the activity of the NF-KB signaling pathway in the presence of said polypeptide fusion construct to the activity of the NF-KB
signaling pathway in the absence of said polypeptide fusion construct to determine the relative inhibition by said polypeptide fusion construct; and f) correlating relative inhibition by said polypeptide fusion construct to NEMO oligomerization.
In this method, the candidate polypeptide sequence preferably has a coiled-coil or helical structure. More preferably, the candidate polypeptide sequence has 20-60 amino acids. It is also preferred that the candidate polypeptide sequence be 3o derived from NEMO.
As stated in the embodiments above, the spacer sequence may have a length ranging from 1-35 amino acids, but shorter lengths may also be employed (sups°a). Examples of the spacer sequence includes: SEQ ID NO: 9 and SEQ ID NO:
10. Additionally, an example of the polypeptide having a high transduction potential is a polypeptide having the amino acid sequence of SEQ ID NO: 1.
In a preferred embodiment, the cell culture contains pre-B 70Z/3 5 lymphocytes that have been transfected with NF-xB dependent (3-glactosidase reporter gene.
In order to ensure that the polypeptide fusion construct is actually incorporated into the cells contained in the cell culture it is desired that the poly-peptide fusion construct have an N-terminal cysteine residue. In this manner, the 10 polypeptide fusion construction may be labeled by chemically reacting the cysteine residue with a fluorophore (e.g., BODIPY) thus enabling monitoring of cellular uptake by a technique such as FACS.
Accordingly, the method of identifying polypeptides that modulate oligomerization of NEMO may also include the following steps:
15 b-1) labeling said polypeptide fusion construct; and c-1) monitoring cellular uptake of the labeled polypeptide fusion construct.
Further, one of skill in the art may also be able to correlate NF-~cB
pathway inhibition with modulation of NEMO oligomerization by a pull down 2o experiment with tagged peptides to show that NEMO associates ih vivo with the peptides. The oligomeric state of this peptide associated NEMO protein could be characterized (cross-linking, gel filtration). In vitro, Inhibition of the anisotropy increase resulting from the association of fluorescent antennapedia labelled CC2 or LZ peptides with CC2 or LZ peptides, mimicking NEMO oligomerization, could be 25 used to test compounds inhibiting NF-~cB pathway in vivo.
Having generally described this invention, a further understanding can be obtained by reference to certain specific examples, which are provided herein for purposes of illustration only, and are not intended to be limiting unless otherwise specified.
EXAMPLES
Materials and methods Cell culture, stable transfections a~zd Bell li~zes The grow conditions of the murine pre-B 70Z/3 were as described in Courtois et al., 1997 Mol. cell. Biol. 7023-C3 stable cell lines were prepared by electroporation as described in Courtois et al. with the plasmid cx121acZ-kB
(a kind gift from G.R. Crabtree), bearing three tandem copies of NF-KB sites in the IL-promoter (Fiering et al., 1990), The human retinoblastoma cell lines Y79 were purchased from the American Type Culture Collection (Manassas, VA) and grown in 1o RPMI 1640 medium supplemented with 100 U/ml penicillin, 100 ~g/ml streptomycin, and 10 % fetal calf serum (FCS).
FRCS analysis 0.5 x 106 70Z/3-C3 cells in 0.5 ml were incubated at 37°C for different times and with various concentrations of peptides as indicated in the Figure legends. The cell suspension was centrifugated at 1,000 x g at room temperature and the cell pellet was then washed three times with PBS buffer (1 ml), and finally was resuspended with 500 ~l of PBS buffer containing 0.1 % sodium azide.
Fluorescence analysis was performed with a FACSCalibur (BD Biosciences) and a minimum of 15,000 events per sample was selected. All experiments were performed in duplicates.
Peptide synthesis and purificatiojz Peptides were synthesized as described in Mousson et al. 2002 (Biochemistry, 41 p13611- p13616), by using continuous-flow Fmoc/tBu chemistry (Chan, WC, and White, P.D. (2000); Fmoc Solid Phase Peptide Synthesis. A
pratical approach) on an Applied Biosystems (Foster City, CA) Pioneer peptide synthesiser.
All chemical reagents were purchased from Applied Biosystems. All peptides were blocked at the N-terminus with an acetyl group and at the C-terminus with an amide.
A single extra-cysteine residue was incorporated at the N-terminus of the peptides for subsequent specific labeling (see Table 1).
w w a W d w w a ~ a ~1 a o' ~ w w xw w w d ~a x ~w w 'l a w O zw z z a~~ xa a~~ a o ~>°z ~~ ~~,~z° ~~z U ~ aj oa~L~ ~,~~.,C~
a~ ~ ~
a ~~°~ ~x ~a .. ~ as ,J a a .~
N v0 cn W v'W O
id ~ ~Y p c~ ~n ~ N N
C~ ~ ~ O O O O O ~ o O
-I-I +I -I-I +I -I-1 .~~ '~~ +I
,..0 . y0 c~W O ~Y cn ~ N o0 fn O r1 0~ O ~ O~
f~. ~ ~n c~ ~n ,ri r W ~ O M ~_ ~D o0 p c~1 N Nr d'~r~n°~ '~ opo U ~ O\ ~ V'1 00 M N 00 'd' O h ~ d: O O
~n M vi Vi t ~ o~
o cn ~_n ~ oo 'fl ,-.
p O ,~ ~ N Wt' ~ ~i °~ ~ opo N
U
w a a.. W W
v~ a N ~ ao w d w a p w O'~ ~ w a ., z ~ °' ~ ~ w .-. x -, ~ r~ a ~ a H z ~ o, c~ ~ a al a w ~> a > ~a xw a xQ W~ ~w x w w a M C~71 o~ aW ~°z aW ~~ a~ ~ a~
w w aq w0~ a~ ww~ ~ ~ ww~
~~z° ~~°z ~~z a as v o~m a a ~ dz~ o~
x xd ~> xd ~ x~o, awa x~a ~a ~H H
s.
H H
a~ as ~ 3 a, ~ ~ w w .J .J '.
O O U U O U U O N N O N
W f~ U U ~ U U f~ a a W a w a ca M ~ R;
d z ~ O' O' w ~, O ~ o Ca ~l ~ ~ p ~ P~ o o, o, ~ w o~ ~' w '~ W.
W
x ~ ~x >~
q o, »
'3 ~ ~ o o~
o ~ ~ ~ a M ~ .. . ~ s~ ~'' "c3 p w a z °; bn ~ ~ r~
o ~ z U 0, O' ~ Ch d M ~ o . ~ b x ~~ o ~a ~~ ~Z i'°~ ,.~'cn~o ~;
a as x c.~ w ~a ~ w _ _~,.~
0o O
N N N ~O N
' --~ by O O O O O
-I-I +I j -~f- + F + V
N N ~D N -S~.n ~ ~ '" ~~' 00 t~ ~ ~ ~ 00 øH E-I ...w W ~. ~ ~ O ~O O ,--m'ri c1-a ~ p N N
N M ~ '~ M 00 Q1 p E.., ~ ~ C~
~n n N ~ d' ~h ~V N ~ ~ ~ N
.', a~
Q, ~ ~ V~
N oo ~t oo t~ ~n N '~'' cCi , a1 d: Ov O ~-~ l0 O
O ~n ~ ,~-~ O ~-~~ O o_0 ~ N N ~r N VM1 '~t d' .~~. ~ '~ ~ ~"i H ~ ~ ~ aQ C
O ~
4-~ O Q7 ~ . S
~I
a x d a 'a~~z~.,.~
o, ~ o a M ~ ~ ~ ~ ~ >~ ~
od r~ ~
w ~ w 0' O' ~.
a ~1 ~ ° ~ ~ ~ ~° o x~ ~ a a M ~ ~ . ~ ~ ..w a r~
w ~., b aw o --WI ~ M M O N 'C3 i~
O ~ v O .1 O .;~ ~ ~ U
~~z ~ ~x z M z 0' a n a pr ~ r~ ~ ~
z ~a .~.~~~, °_s W ~ ~ I ~ ~ ~ I ~ ~ N V t0-~ V f~, ao' as>.J a m r~.~ ~~ my s~.~
~ H 'd ~ y ~ pU
°' ~3 x ax ' ~ 'fix ~x z ~ ~"
~z ~ ~~ aH a °w~ ~Z °~z ~°H~ ~z °~z Crude peptides were directly purified by reverse-phase medium-pressure liquid chromatography (MPLC) on a Nucleoprep 20 ~M C18 100 1~
preparative column, using a linear gradient of acetonitrile (1%/min) in 0.08 %
aqueous trifluoroacetic acid (TFA) (pH 2) for 60 min at a flow rate of 18 ml/min. The purity of the peptides was verified on a nucleosil 5 pM C18 300 ~ analytical column, using a linear gradient of acetonitrile (0.5 %/min) in 0.08 % aqueous TFA (pH2) for 20 min at a 1 ml/min flow rate. Conjugation of the fluorophore bodipy~FL N-(2 amino-ethyl)maleimide (Molecular Probes) to the sulfhydryl group was under equimolar conditions at pH 6 in 50 mM ammonium acetate buffer for 30 min in the dark.
The 1o mixture was then loaded on a Nucleoprep 20 qM C18 100 ~ preparative column to purify the BODIPYconjugated peptide. In cell death experiments, all peptides devoid of BODIPY-labeling were subjected to treatment with iodoacetamide to prevent any oxidation of cysteine residue. All purified peptides were then quantified by amino acid analysis and finally characterized by using positive ion electrospray ionization mass spectrometry (ES+). Once integrity of the peptides and coupling efficiency were verified by mass spectrometry, the extinction coefficients of the peptides were measured at 505 nm or at 280 nm when peptides contained aromatic residues (see Table 1). Stability of the labeling was monitored periodically by measuring the absorbance of peptides at 280 nm and at 505 nm and by calculating the absorbance 2o ratio. All peptides were dissolved in water to stocks of 2 mM.
NF xB inhibition assays In a first procedure 2.2 x 105 70Z/3-C3 cells in 220 ~l of RPMI 1640 supplemented with 10% fetal calf serum (FCS) and 50 ~M (3-mercaptoethanol were placed in a 96-well plate and incubated with various concentrations of peptide (0 to 20 ~M) at 37°C in 5% C02 incubator. After two hours an equal portion (100 ~l) of each cell sample transferred in two wells containing each 105 cells. One aliquot of cells was then treated for 5 hours with lipopolysaccharides from Salmonella abortus (Sigma) at 0.5 ~.g/ml final concentration, and the other one left-treated. After 5 hours, cells were centrifuged at 400 x g for 5 min at room temperature and the cell pellets were washed 3o three times with cold PBS (250 p1) by centrifugation. Cells were then lysed in the lysis buffer (25 mM tris-phosphate buffer at pH 7.8 containing 8 mM magnesium chloride, 1 mM dithioerythreitol, 1 % Triton X-100, 15 % glycerol and a protease inhibitor mixture (Roche)), and samples were centrifuged at 4°C for 20 min to clarify the lysate. The supernatant was then kept on ice, and 30 ~.1 was then assayed to measure the (3-galactosidase activity with a plate luminometer (Berthold) using the galacton-star as chemiluminescent substrate (BD Biosciences Clontech, Bronstein et s al., 1989). Background of reaction was measured by mixing for 1 hour 30 ~,1 of lysis buffer with the reaction buffer (196 ~1) and the galacton-star substrate (4 ~l) provided by BD Biosciences. In a second procedure and a more stringent assay, 70213-C3 cells (2.2 x 105 in 220 ~.l medium) were centrifuged at 400 x g at room temperature after peptide internalization for 2 hours, and cell pellets were washed three times with 200 10 ~.1 of PBS by centrifugation. Cells were then diluted three times with complete medium, and allowed to grow for at least 24 hours. The following steps are identical to the first procedure.
Cell death assays The detection of cell death was performed using the MTS assay 1 s provided by Promega (CellTiter 96~ AQ"eoUS one solution cell proliferation assay).
Briefly, 0.3 x 106 Y79 cells in 450 ~l were treated with 50 ~,l of the wild type Ant-CC2 and Ant-LZ peptides (0.1 to 20 ~.M) or their mutants Ant-CC2 (Mu), Ant-LZ
(Mu) or the Ant or left untreated in serum-free RPMI medium at 37°C.
After an incu-bation of 1 or 14 hours, an aliquot of the cell suspension (200 ~.1, 0.12 x 106 cells), 2o was then transferee in 96-well plates and mixed with the MTS solution (40 ~.l) containing the MTS compound and the phenazine ethosulfate. Two hours after, the quantity of formazan produced by viable cells was measured using an automated microplate reader (Bio-TeI~ Instruments, INC) at 490 mn absorbance. Cell survival was observed under microscope and was estimated as a percentage of the value of 2s untreated controls. The background of the reaction was determined by mixing the MTS solution with cell-free RPMI medium. To increase the sensitivity of the cell death assay, the present inventors used peptides devoid of BODIPY-labeling because the absorption spectra of the fluorophor overlaps with that of the formazan product.
All experiments were repeated twice and each experiment condition was repeated in 3o duplicate wells in each experiment.
Analytical Gel filtration experinzeuts The oligomeric states of peptides were determined by filtration as described in Traincard et al., 2003. In brief, 500 ~.l samples were loaded on a Superdex 75 HR 10/30 column equilibrated in 50 mM Tris-HCl pH 8.0 containing mM NaCI and 0.1 mM DDM, at a constant flow rate of 0.4 ml/min. The presence of the DDM detergent was added in the equilibrium buffer to minimize the adsorption in the column and to increase the peptide recovery. The column was calibrated in the same equilibrium buffer with blue dextran 2000 (void volume), dithioerythritol (total volume), bovine serum albumin (67 kDa, Rs = 35.2 ~), ovalbumine (43 kDa, Rs =
l0 27.5 ~), chymotrypsinogen A (25 kDa, Rs = 21.1 A), ribonuclease A (13.7 lcDa, Rs =
16.4 A), cytochrome C (12.4 kDa, Rs = 17.7 ~) and aprotinin (6.5 KDa, Rs =
13.5 A).
Fluor°escehce anisott°opy fneasurements Anisotropy measurements were performed with a PTI Quantamaster fluorometer equipped with polarizers for the excitation and emission beams.
This instrument uses a PMT in the L-configuration. All experiments were carried out in a 1 cm path-length cuvette at 22°C with excitation and emission wavelengths at 495 nm and 520 nm, respectively. The bandpass of excitation and emission monochromators was set at 2 and 4 nm, respectively. Steady-state fluorescence anisotropy was expressed as millianisotropy (mA) and was calculated according to the equations: (1) 2o A= (Ivy-GIvH)/(Ivv+2GIvH) ; (2) G=IHV/IHH.; where A is anisotropy, G is a correction factor for wavelength-dependent distortion and I is the fluorescence intensity component (subscript referring to the vertical and horizontal positioning at the excita-tion and emission polarizers, respectively). Experiments were at least performed twice and each data is the result of 20 records along a 2 min period. All measurements were carried out in 50 mM Tris-HCl buffer at pH 8 containing 150 mM KCI. The present inventors verified that at the BODIPY-Ant-CC2 and BODIPY-Ant LZ concentration used (1 ~,M and 0.1 ~,M respectively), the filter effect was negligible. The BODIPY-Ant-CC2 peptide was preincubated overnight at 22°C alone or with increasing concentrations (1-125 ~M) of CC2 prior to anisotropy measurement. The BODIPY-Ant-LZ peptide (100 nM) was preincubated overnight at 22°C alone or with 10 ~M
and 100 ~M concentrations of CC2 (see legend Fig. 7) prior to anisotropy measure-ment. The dissociation constant parameter was estimated by globally fitting the anisotropy data to binding isotherm equation as described in Agou et al.
(2004, J Biol Chem.) using Kaleidagraph nonlinear regression software (Synergy Software, reading PA). The binding stoichiometry, n, was estimated from the intersection of lines (dashed lines in Figure 7) drawn through the descending and plateau region of the anisotropy data.
Results Rational design of NEMO derived peptides that block NF xB acti-vation The present inventors previously demonstrated that the minimally to trimerization domain of NEMO comprised of the sequence 251 to 337 (Fig.
1A). This region likely contains two coiled-coil sequences of about 35 residues denoted (residue 253-285) and LZ (301-337) at the N- and C-terminus respectively.
Although the structure of the minimal oligomerization domain has not yet been determined, several biochemical studies combined with the fluorescence polarization method prompted us to propose that the CC2/LZ trimer probably forms a six-stranded helical bundle composed of closely packed CC2 and LZ coiled-coils in an antiparallel orien-tation (Traincard, 2003, submitted). Furthermore PSI-BLAST searches reveal that this domain of NEMO contains a conserved motif of 20 residues called "NEMO like Motif' (NLM) which is shared with four other proteins including ABIN-1 (Heyninck, 1999, J. Cell. Biol.), ABIN-2/NAF (Van Huffel, 2001, J. Biol. Chem), ABIN-(Staege, 2001, Immunogenetics) and NRP/optineurin (Schwamborn, 2000, J. Biol.
Chem) (Fig. 1 B). Interestingly, most of these proteins including the conserved motif of ABIN-1 (Heyninck, 2003, FEBS Letters), the C-terminal domain of NEMO (Le Page, 2001, Virology) and ABIN-2 (Liu WK, 2003, Biochemical Journal) or ABIN-3/LIND (Heyninck, 2003, FEBS letters) proteins have been shown to inhibit NF-KB
activation in a dominant-negative manner when overexpressed in cells. Two additional references that disclose ABIN peptides interacting with NF-oB also warrant mention: WO 99/57133 and WO 03/00280.
Since disrupting NEMO oligomerization represents a potential 3o therapeutic strategy for inhibiting NF-oB activation, the present inventors designed NEMO-derived partner peptides that mimic either the CC2 or the LZ sequence (Table 1). It is interesting to note that, unlike the CC2 peptide, the LZ peptide also includes the NLM motif at the N-terminal extremity. To mediate all peptide uptake into cells, the present inventors conjugated a functional analogue at the peptide N-terminus comprised of the 16-amino acid sequence derived from the third helix of the Antennapedialpenetratin protein (Ant). This amphipatic helix acts as an internalization vector (Prochiantz, 2000, Curr. Opin. Cell Biol.). Most of antennapedia fusion peptides were labeled with the BODIPY fluorophore to analyze the transduction potential of each peptide into the cells. Specific labeling was performed by adding a single cystein residue at the extremity of the N-terminus and sequence integrity was verified by mass spectrometry (see "Materials and methods" and Table 1).
l0 Cellulat~ uptake of NEN~O derived peptides mediated by the antennapedia fusion peptide The uptake of BODIPY labeled NEMO peptides into living cells were monitored by fluorescence activated cell sorting (FACS) which is a conventional tool used to quantify cellular internalization. Figure 2A shows FACS analyses of cells treated with Ant-CCZ (WT), Ant-CC2 (Mu), Ant-LZ (WT) or Ant-LZ (Mu) BODIPY-peptides for 2 h at 37°C, and were compared with those of the autofluorescence of untreated cells and control cells treated with an equal concentration of free BODIPY
or with BODIPY-conjugated BSA. Consistent with the role of antennapedia peptide to transduce peptides and proteins into mammalian cells, 100% of 7023-C3-cell line was 2o similarly transduced by the four different NEMO peptides, suggesting that all of the cells in the treated population have a near identical intracellular concentration of NEMO-derived BODIPY-peptides. Comparative analysis indicate that untreated cells and treated cells with BODIPY-BSA or free BODIPY exhibit a similar cell fluores-cence, verifying that our extensive washing protocol before FACS analysis was optimal to minimize any contribution of surface-bound peptide in measuring NEMO
peptide internalization (see "Materials and methods"). Thus, these data suggest that the observed cellular fluorescence signaling mostly reflects the intracellular concen-tration of transduced NEMO peptide and not a non-specific adsorption onto the membrane surface.
3o Then present inventors next investigated the kinetic and concentra-tion dependency of cellular uptake for the Ant-CC2 BODIPY peptide keeping in mind that the transduction of other NEMO peptides should occur in a similar fashion (Fig.
2B and 2C). FACS analysis 5 h after addition of 7023-C3 cell treated with 0.2, 2 or 20 q.M BODIPY-Ant-CC2 peptide at 37°C demonstrate the linear dependancy of the intracellular concentration as a function of the incubated concentration of the antennapedia fusion peptide as widely reported in literature (Lindsay, 2002, Current Opinion in Pharmacology). Notably, the cells treated with the Ant-CC2 at 20 qM
and at 37°C already reach maximum intracellular concentration in 30 min and remain unchanged for up to 5 h. Since the time to induce a strong NF-KB activation in response to LPS requires 3-5 hours of cell treatment, these results indicate that the intracellular concentration of each peptide remains constant during the LPS
stimula-l0 tion.
Specific i~zhibition of LPS-induced NF mB activatioyz by cell permeable CC2 and LZ
To analyze the inhibition potential of LPS-induced NF-oB activation by cell permeable BODIPY-Ant-CC2 and BODIPY-Ant-LZ peptides, the present inventors stably transfected the murine pre-B 7023 cell line with pl2XlacZ-kB, which bears the (3-galactosidase reporter gene under the control of the NF-~cB
transcription factor. When the resulting cell line 7023-C3 was treated for 5 hours with LPS
(3 p,g/ml) a 100 fold-activation of the LacZ gene was observed, indicating that our cellular assay monitors NF-KB activation in response to LPS with extreme sensitivity (Figure 3A, control "no peptide). Interestingly the incubation of cells with 20 ~M of both NEMO-derived polypeptides decreased significantly the NF-KB activation.
This lowering was stronger in the presence of BODIPY-Ant-LZ as compared to BODIPY-Ant-CC2. The inhibition effect was essentially due to the NEMO sequence because the presence of the isolated and/or purified antennapedia peptide containing or not containing a N-terminal BODIPY label (BODIPY-Ant or Ant) induces the same level of NF-~cB activation as the control (Fig. 3A). Note that the basal NF-xB
activity measured in the absence of LPS was very similar in all samples indicating that both CC2 and LZ peptides abolish the responsiveness to LPS without affecting the intrinsic basal NF-oB activity. This was essential to minimize the in vivo cytotoxity, resulting 3o mainly from apoptosis induced by inhibition of NF-~cB (Chen, 2003, Nature Med.).
To determine whether the BODIPY-Ant-LZ or the BODIPY-Ant-CC2 peptide is the most efficient inhibitor, the present inventors next measured the concentration dependent inhibition of each peptide. As shown in Figure 3B, both NEMO peptides exhibit NF-KB dose dependant inhibition of NF-~cB in response to 5 LPS. BODIPY-Ant-LZ inhibited NF-KB to a greater extent than BODIPY-Ant-CC2 did with ICSO values of 3 ~.M and 22 qM respectively (Fig. 3C). This striking difference could be explained by the NLM motif included in the LZ sequence.
Consistent with the intracellular nature of the NEMO target, both LZ and CC2 peptides not fused to the antennapedia protein transduction domain (PTD) exhibited to the same level of activation as the control (Fig. 3 D), confirming that NEMO derived peptides must cross the cell membrane for inhibition of NF-KB. Talcen together these results indicate that peptides that mimic the two coiled-coil sequences of the NEMO
oligomerization domain are potent peptide inhibitors of NF-KB activation in response to LPS.
15 Mutations in the hyd~°ophobic core of the LZ and CC2 coiled-coils disrupt their° specific ifzhibition of the NF KB signalifzg pathway Theoretically, if BODIPY-Ant-LZ or BODIPY-Ant-CC2 peptide inhibit NF-KB activation through specific binding to the NEMO oligomerization domain, mutations that disrupt the coiled-coil association should therefore exhibit 2o impaired abilities to inhibit NF-~cB inhibition. a-helical coiled-coil interactions have been extensively studied and most of the rules governing their specific assembly have been well documented (Vinson, 2002, Mol. Cell. Biol.). The coiled-coil interface that is represented by the first (a) and fourth position (d) of the heptad repeat is generally occupied by hydrophobic amino acids. Proline or glycine is largely excluded to 25 preserve the helical architecture. Core polar residues are destabilizing relative to leucine substitutions, especially when changes occur at d positions.
Considering these rules, the present inventors synthesized a variant of BODIPY-Ant-LZ containing two mutations L ~ S at the d positions (BODIPY-Ant-LZ (Mu) and a variant of BODIPY-Ant-CC2 containing two mutations L -~ G and one mutation I ~ G at the a positions 30 (BODIPY-Ant-CC2 (Mu) (Fig. 4A and 4B, and Table 1). To test the effects of these mutations on the potential inhibition of NF- B activation, the present inventors developed a more stringent cellular assay that consists of the internalization of the peptides for 2 hours followed by an extensive washing of 7023-C3 cells to remove any remaining peptide in the extraeellular media. Cells were allowed to grow for at least 24 hours before LPS-induced NF-~cB activation. In this way, peptide interference with the receptor binding LPS was excluded. As with the cellular assay described above, the BODIPY-Ant-CC2 (WT) and the BODIDY-Ant-LZ (WT) also inhibited NF-KB activation with a 1.7 and 5.8 -fold reduction respectively (Fig. 4A and 4B) when used at a 10 ~M concentration. This indicates that the peptides do not competively act on the receptor binding of LPS. As expected, the presence of the CC2 1o variant (BODIPY-Ant-CC2 (Mu)) did not affect the NF-xB activation since (3-galactosidase activity was equivalent to that of the control (Fig. 4A, no peptide). In response to LPS, NF-KB is more strongly activated in the presence of the BODIPY-Ant LZ mutant than in the presence of wild type. However, unlike the BODIPY-Ant-CC2 (Mu), a slight inhibition of the LZ mutant was observed when compared to the control (15 %). When taken together, these data demonstrate that CC2 and LZ
mutants are unable to inhibit the LPS-induced NF-~cB activation as effectively the wild type did.
Inhibition of NF KB activation is mediated by a specific coiled coil iyzteractio~ of the LZ peptide.
2o Computational analyzes using the program MULTICOIL (Wolf, 1997, Protein Science) predicted that greater than 5 % of all putative ORFs found in sequenced genomes are predicted to contain coiled-coil motifs (Newman, 2000, Proc.
Natl. Acad. Sci. USA) and that approximately 2-4 % of amino acids in proteins are estimated to adopt coiled-coil folds (Bergen 1995, Proc.Natl.Acad.Sci. USA).
This abundance raises the question if the NEMO derived- LZ peptide maintains its coiled-coil interaction partnering specificity in vivo. To address this question, the present inventors synthesized another coiled-coil peptide that mimics the sequence of the GCN4 leucine zipper and tested its ability to inhibit NF-KB activation. BODIPY-Ant-GCN4 contained the antennapedia sequence at its N-terminus and a short SKGMQ
3o linker (SEQ ID NO: 9) identical to the CC2 sequence for convenience of peptide delivery (Table 1). It was also labeled at its N-terminus with BODIPY to monitor its cellular uptake by FACS (data not shown). The GCN4 peptide displays a low sequence similarity with the LZ sequence of NEMO (22 %) but identical residues are mostly represented by leucines at d positions (Figure 5). These residues contribute to most of the energy to coiled-coil oligomerization stability (Vinson, 2002, Mol. CeII.
Biol.). Note that a positions which are important for coiled-coil specificity (Vinson, 2002, Mol. Cell. Biol) are composed of a set of different amino acids. While GCN4 is composed of hydrophobic residues and the typical asparagine residue, the LZ of NEMO contains two charged amino acids R and K (Figure 4B and Fig. 5A). Thus, these residues, which are located at the coiled coil interface likely, contributes to the selectivity of coiled coil interaction.
1o Figure SB shows the effect of the BODIPY-Ant-GCN4 at a 10 qM
concentration on the inhibition of NF-KB activation in response to LPS. To compare the effects of coiled coil sequences, the present inventors used the stringent cellular assay described above. BODIPY-Ant-GCN4, unlike BODIPY-Ant-LZ, has no ability to inhibit NF-oB activation since the level of NF-KB activation was near that of the control without peptide. Taken together, these results strongly support the hypothesis that the LZ peptide of NEMO inhibits NF-oB activation through selective coiled-coil interactions.
The atZtennapedia sequefzce induces fno~ome~ization of NF KB
peptidic inhibto~s 2o The antennapedia sequence is a protein transduction domain (PTD) which adopts an alpha-helical amphiphatic structure (Prochiantz, 2000, Curr.
Opin.
Cell Biol.). When fused to the N terminus of a coiled-coil sequence like CC2 or LZ, the antennapedia could alter the coiled-coil association by covering the hydrophobic interface of the coiled-coil through intramolecular interactions. To examine the effect of N-fusion of the antennapedia peptide on the oligomerization properties of the CC2 and the LZ peptides, the present inventors analyzed peptides containing or not containing the antennapedia sequence at their N-terminus by geI filtration. As shown in Figure 6, all peptides containing an N-terminal fusion of antennapedia co-elute with an elution volume corresponding to their monomeric forms as compared to globular protein markers. Note that the present inventors had to add a detergent in the buffer below its cmc to improve peptide recoveries. When inj ected at the same 10 ~,M
concentration, CC2 wild type and LZ wild type without the antennapedia N-fusion oligomerize. CC2 (WT) forms a trimer whereas LZ (WT) forms a dimer as recently repouted (Traincard et al). As expected, when a CC2 mutant was chemically obtained with three of its aliphatic residues at positions replaced with glycine residues, it lost its ability to oligomerize (bottom panel, dashed line). The effect of the two L-~S
muta-tions at d positions was less strong with LZ (mutant). However, the present inventors still detected dimerization of the LZ mutant at a 10 ~M concentration (dashed line) although its association was markedly reduced by mutations as compared to the wild type LZ (solid line). Taken together, these data indicate that the N-fusion of the antennapedia sequence to both CC2 and LZ peptides alter homotypic coiled-coil inter-to actions, facilitating the monomerization of the NEMO derived-peptides.
Furthermore these results also show that residue changes at a and d position alter oligomerization of LZ and CC2 peptides. Thus, it is likely that the synthetic peptides form a-helical coiled-coil structures.
Homo- and heterotypic interactions of CC2 and LZ peptides with a~zd wit7zout the N--fission of afZtennapedia sequence.
Because the N-fusion of antennapedia modifies the oligomerization properties of the CC2 and LZ peptides, the present inventors next studied by fluores-cence polarization whether the Ant-CC2 and the Ant-LZ monomers labeled with BODIPY could bind to the NEMO-derived polypeptides devoid of the antennapedia 2o sequence. These peptides CC2 and LZ may be also considered as the ira vivo binding target for both cell permeable BODIPY-Ant-CC2 and BODIPY-Ant-LZ NF-~cB
inhibitors. Figure 7 shows a typical binding isotherm for the interaction of various concentrations of the CC2 peptide with a fixed concentration of the BODIPY-Ant-CC2. The shape of the binding curve is not sigmoidal, indicating that CCZ
binds to the BODIPY-Ant-CC2 peptide without cooperativity. The stoichiometry calculated from the intercept between the tangent of the initial part of the anisotropy and the asymptote is equal to 0.8. Taking into account this stoichiometry, the dissociation constant KD is 15.2 ~.M. Similar results were obtained when a fixed concentration of the BODIPY-Ant-LZ was titrated with various concentrations of the CC2 peptide as the present 3o inventors previously reported (Inset Figure 7, Traincard et al.).
Collectively, these data demonstrate that both Ant-CC2 and Ant-LZ monomers binds in vitro to the CC2 peptide composing the minimal oligomerization domain of NEMO.
Cell death in human Retihoblastoma cell is induced by NF-KB
ifzhibitors Ant-CC2 azzd Ant-LZ, but not by theif° mutants Azzt-CCZ
(Mu) and Azzt-LZ
(Mu) It has become clear that constitutively activated NF-KB transcription factors have been associated with several aspects of tumorigenesis (Karin review), including most of six essential alterations in cell physiology that dictate the conver-sion of normal human cells into cancer cells (Hanahan, 2000, Cell for review).
This led to a significant enthusiasm for the use of NF-KB inhibitors as a new anti-cancer therapy. Promising results have been reported recently using proteasome inhibitors or to the SN50 peptide that bloclcs the nuclear translocation (Orlowski, 2002, Trends in Molecular Medicine; Mitsiades, 2002, Blood). However, the specificity of these agents on NF-KB inhibition have been questioned. Poulaki et al. (2002, Am J
Pathol..) showed recently that the treatment of the human retinoblastoma (Rb) cell lines with SN50 peptide induced apoptosis of cancer cells. Sequence alignment of murine and human NEMO proteins indicate that the minimal oligomerization domain of NEMO is strictly conserved, suggesting that similar effects of NF-~cB
inhibition could be observed in rodent as well as in human cells.
Given that specific NF-KB inhibition may trigger apoptosis of cancer cells, the present inventors examined the effects of both cell-permeable Ant-LZ and 2o Ant-CC2 peptides on human retinoblastoma cell viability. In these experiments, the present inventors used NEMO-derived polypeptides without a N-terminal BODIPY
labeling to prevent any interference with the MTS assay (see "Materials and Methods"). As shown in Figure 7, the present inventors found a dose dependence of the Y79 cell viability when cells were treated for 3 hours with Ant-CC2 (Fig.
8A) or Ant-LZ (Fig 8B). The effect of the Ant-LZ peptide on cell death was stronger than that of the Ant-CC2. This induction of cell death was significant since Rb cell survival was 20% and 65 % with the Ant-LZ and the Ant-CC2 peptides respectively when cancer cells were treated for 3 hours at a 20 ~.M concentration. Remarkably, the same cell treatment with the Ant-CC2 (Mu) (Fig.BA) or with the Ant-CC2 (Mu) (Fig.8B) 3o did not induce concentration cell death as did WT peptides. These effects on cell death were essentially due to the NEMO sequence because a longer treatment of Y79 cell lines with the antennapedia peptide did not affect cell survival (Fig. 8C). In contrast, ~0 % and 55% of Y79 cell died in the presence of Ant-LZ and Ant-CC2 respectively at 5 ~.M concentration (Fig. ~C). Taken together, these results indicate that specific NF-KB inhibition by Ant-CC2 and Ant-LZ peptides induce cell death in Rb cell lines, validating the use of specific NF-xB inhibitors as anticancer chemotherapy.
5 In the absence of the pro-inflammatory signals, all peptides assayed have no detectable cytoxicity for lymphocytes B tested at a concentration up to 30 ~M
according to the MTS assay, the direct observation under microscope, and the forward scatter-FSC and side scatter-SSC parameters deduced from FACS analyses.
However, the present inventors could detect a slight cell death by FACS in a concentration-l0 dependent manner when LPS stimulated the pre-B lymphocytes in the presence of NEMO-derived polypeptides. The cellular proportion of cell death was 9 % in the absence of stimuli at a 20 ~M concentration of Ant-CC2 whereas it increased at after LPS stimulation (data not shown). This was in agreement with the role of the NF-oB pathway in protecting cells from apoptosis. The cell death was more 15 pronounced and fast on the Rb cell lines Y79 in which constitutive NF-KB
activity has been reported (Poulaki, 2002, Am J Pathol..). The present inventors did not demonstrate here by the Annexin V labeling and the TIJNEL method that the NEMO
peptides-induced cell death is indeed apoptosis. Nevertheless considering the role of the NF-KB pathway in the regulation of apoptosis, it is likely that the cell death 20 induced by NEMO-derived polypeptides is apoptotic in nature.
The results set forth above, regardless of the nature of the future NF-KB inhibitors (organic or peptidomimetic compounds), targeting NEMO's oligomeri-zation will remain a more attractive and promising strategy as compared to those of IKK kinase activity and of NEMO-kinase association because this molecular event 25 strictly depend on the pro-inflammatory signal. Therefore, such drugs would interfere less with the basal NF-KB activity in normal cells that is required for cell viability.
. Peptides derived from the N terminal region of wild-type NEMD
The present inventors explored the N-terminal region of the wild type NEMO, in particular the NLM conserved motif (residues 293-322 of SEQ ID
30 NO: 12) appearing in Figure 1A. To this end, the following sequences were produced (see Table 1 for the corresponding sequence):
NLM-DR (SEQ ID NO : 30) Ant.NLM-DR (SEQ ID NO : 31) Tat NLM-DR (SEQ ID NO : 32) R7-NLM-DR (SEQ ID NO : 33) R9-NLM-DR (SEQ ID NO : 34) NLM-DR is a 21 amino acid "motif' (and the corresponding wild type NLM covering the same amino acid range) derived from the larger 30 amino acid conserved NLM motif set forth in Figure 1A. The NLM-DR has been mutated from the wild type NLM sequence in that the aspartic acid at residue I 1 in the wild type to sequence has been replaced by an arginine (see Table 1 and SEQ ID NO: 30).
The present inventors compared NLM-DR to the corresponding NLM peptide by measuring the respective cooperativity indices, which evidence an advantage of NLM-DR mutated peptide over the wild-type.
The calculation of the "cooperativity indice" by means of Hill coef ficient is based on the following formula Boundmax x L° /(KD° + L°) Wherein Boundmax is the maximum concentration of the bound ligand, L is the concentration of the free ligand, 2o n is the cooperativity indice and KD, is the affinity constant of the ligand by the protein.
The cooperative indices calculated by means of the Hill coefficient calculation are:
~ For the mutant NLM peptide (NLM-DR) - a dissociation constant Kd of ~5 170 ~.M and a cooperativity indice of 1.4 (1326 ~.M); and ~ For the corresponding wild-type NLM peptide (NLM) - a dissociation constant Kd of 240 ~M and a cooperativity indice of 2.1 (99642 ~M).
If these values were to be compared to those obtained from the curves without accounting for cooperativity, the affinity of NLM-DR peptide would 3o be 75 times higher than the affinity of wild-type NLM peptide.
The present inventors also evaluated the biologically relevant results for the aforementioned forms of NLM-DR as they apply to the inhibition of NF-KB
activation pathway, IC50 and toxicity results (FACS). The results are presented in Table 2:
Table 2: Properties of NLM-DR derived peptides Cytotoxicity* Cellular uptakeIC 50 MTS Cell relative efficiency morphology Peptide Assay FACS Microscope(FACS) BODIPY-Ant-NLM-DR no + + + 1.1 ~.M
BODIPY-TAT-NLM-DR no no no + 1 ~cM
BODIPY-R9-NLM-DR no no no ++ 0.9 qM
BODIPY-R7-NLM-DR n.d. no no ++++ 0.9 qM
* Cytotoxicity analysed by the indicated technique is scaled from no toxicity (no) to high toxicity (++++);the MTS cell proliferation assay was from Promega; n.d. =
not determined.
Numerous modifications and variations on the present invention are possible in light of the above teachings. It is, therefore, to be understood that within the scope of the accompanying claims, the invention may be practiced otherwise than 1 o as specifically described herein.
REFERENCES
1. Agou, F., Ye, F., Goffinont, S., Courtois, G., Yaiuaoka, S., Israel, A. and Veron, M.
(2002) NEMO trimerizes through its coiled-coil C-terminal domain.
J. Biol. Chem., 20, 17464-17465 2. Agou F., Traincard F., Vinolo E., Courtois G., Yamaoka S., Israel A., Veron M.
(2004) The trimerization domain of NEMO is composed of the interacting C-terminal CC2 and LZ coiled-coil subdomains.
J Biol Chem. 2004 Jul 2;279(27):27861-9 3. Berger B, Wilson DB, Wolf E, Tonchev T, Milla M, Kim PS.(1995) Predicting coiled coils by use of pairwise residue correlations.
Proc Natl Acad Sci U S A. Aug 29;92 (18):8259-63.
4. Bronstein I, Edwards B, Voyta JC.
1,2-dioxetanes: novel chemiluminescent enzyme substrates. Applications to immunoassays.
J Biolumin Chemilumin. 1989 Jul;4(1):99-111.
5. Carter RS, Geyer BC, Xie M, Acevedo-Suarez CA, Ballard DW. (2001) Persistent activation of NF-kappa B by the tax transforming protein involves chronic phosphorylation of IkappaB kinase subunits IKKbeta and IKKgamma.
J Biol Chem. Jul 6;276(27):24445-8. Epub 2001 Apr 26.
6. Chan DC and Kim PS. (1998) HIV entry and its inhibition.
Cell. 1998 May 29;93(5):681-4. Review. No abstract available.
7. Mike Chang, Lianshan Zhang, James P. Tam, and Elaine Sanders-Bush (2000) Dissecting G Protein-coupled Receptor Signaling Pathways with Membrane-permeable Blocking Peptides. J. Biol. Chem., Mar 2000; 275: 7021 - 7029.
8. Lee-Wei Chen, Laurence Egan, Zhi-Wei Li, Florian R. Greten, Martin F.
Kagnoff, Michael Karin. (2003) The two faces of IKK and NF-kappaB inhibition: prevention of systemic inflammation but increased local injury following intestinal ischemia-reperfusion Nature Medicine9, 575 - 581 (O1 May 2003) 9. Colman, P.M. et al. (2003) The structural biology of Type I viral membrane fusion.
Nature Rev. Mol. Cell Biol., 4, 309-317 10. Courtois,G., Whiteside, S.T., Sibley, C.H. and Israel, A. (1997) Characterization of a mutant cell line that does not activate NF-KB in response to multiple stimuli.
Mol. Cell. Biol., 17, 1441-1449.
In a preferred embodiment, the cell culture contains pre-B 70Z/3 5 lymphocytes that have been transfected with NF-xB dependent (3-glactosidase reporter gene.
In order to ensure that the polypeptide fusion construct is actually incorporated into the cells contained in the cell culture it is desired that the poly-peptide fusion construct have an N-terminal cysteine residue. In this manner, the 10 polypeptide fusion construction may be labeled by chemically reacting the cysteine residue with a fluorophore (e.g., BODIPY) thus enabling monitoring of cellular uptake by a technique such as FACS.
Accordingly, the method of identifying polypeptides that modulate oligomerization of NEMO may also include the following steps:
15 b-1) labeling said polypeptide fusion construct; and c-1) monitoring cellular uptake of the labeled polypeptide fusion construct.
Further, one of skill in the art may also be able to correlate NF-~cB
pathway inhibition with modulation of NEMO oligomerization by a pull down 2o experiment with tagged peptides to show that NEMO associates ih vivo with the peptides. The oligomeric state of this peptide associated NEMO protein could be characterized (cross-linking, gel filtration). In vitro, Inhibition of the anisotropy increase resulting from the association of fluorescent antennapedia labelled CC2 or LZ peptides with CC2 or LZ peptides, mimicking NEMO oligomerization, could be 25 used to test compounds inhibiting NF-~cB pathway in vivo.
Having generally described this invention, a further understanding can be obtained by reference to certain specific examples, which are provided herein for purposes of illustration only, and are not intended to be limiting unless otherwise specified.
EXAMPLES
Materials and methods Cell culture, stable transfections a~zd Bell li~zes The grow conditions of the murine pre-B 70Z/3 were as described in Courtois et al., 1997 Mol. cell. Biol. 7023-C3 stable cell lines were prepared by electroporation as described in Courtois et al. with the plasmid cx121acZ-kB
(a kind gift from G.R. Crabtree), bearing three tandem copies of NF-KB sites in the IL-promoter (Fiering et al., 1990), The human retinoblastoma cell lines Y79 were purchased from the American Type Culture Collection (Manassas, VA) and grown in 1o RPMI 1640 medium supplemented with 100 U/ml penicillin, 100 ~g/ml streptomycin, and 10 % fetal calf serum (FCS).
FRCS analysis 0.5 x 106 70Z/3-C3 cells in 0.5 ml were incubated at 37°C for different times and with various concentrations of peptides as indicated in the Figure legends. The cell suspension was centrifugated at 1,000 x g at room temperature and the cell pellet was then washed three times with PBS buffer (1 ml), and finally was resuspended with 500 ~l of PBS buffer containing 0.1 % sodium azide.
Fluorescence analysis was performed with a FACSCalibur (BD Biosciences) and a minimum of 15,000 events per sample was selected. All experiments were performed in duplicates.
Peptide synthesis and purificatiojz Peptides were synthesized as described in Mousson et al. 2002 (Biochemistry, 41 p13611- p13616), by using continuous-flow Fmoc/tBu chemistry (Chan, WC, and White, P.D. (2000); Fmoc Solid Phase Peptide Synthesis. A
pratical approach) on an Applied Biosystems (Foster City, CA) Pioneer peptide synthesiser.
All chemical reagents were purchased from Applied Biosystems. All peptides were blocked at the N-terminus with an acetyl group and at the C-terminus with an amide.
A single extra-cysteine residue was incorporated at the N-terminus of the peptides for subsequent specific labeling (see Table 1).
w w a W d w w a ~ a ~1 a o' ~ w w xw w w d ~a x ~w w 'l a w O zw z z a~~ xa a~~ a o ~>°z ~~ ~~,~z° ~~z U ~ aj oa~L~ ~,~~.,C~
a~ ~ ~
a ~~°~ ~x ~a .. ~ as ,J a a .~
N v0 cn W v'W O
id ~ ~Y p c~ ~n ~ N N
C~ ~ ~ O O O O O ~ o O
-I-I +I -I-I +I -I-1 .~~ '~~ +I
,..0 . y0 c~W O ~Y cn ~ N o0 fn O r1 0~ O ~ O~
f~. ~ ~n c~ ~n ,ri r W ~ O M ~_ ~D o0 p c~1 N Nr d'~r~n°~ '~ opo U ~ O\ ~ V'1 00 M N 00 'd' O h ~ d: O O
~n M vi Vi t ~ o~
o cn ~_n ~ oo 'fl ,-.
p O ,~ ~ N Wt' ~ ~i °~ ~ opo N
U
w a a.. W W
v~ a N ~ ao w d w a p w O'~ ~ w a ., z ~ °' ~ ~ w .-. x -, ~ r~ a ~ a H z ~ o, c~ ~ a al a w ~> a > ~a xw a xQ W~ ~w x w w a M C~71 o~ aW ~°z aW ~~ a~ ~ a~
w w aq w0~ a~ ww~ ~ ~ ww~
~~z° ~~°z ~~z a as v o~m a a ~ dz~ o~
x xd ~> xd ~ x~o, awa x~a ~a ~H H
s.
H H
a~ as ~ 3 a, ~ ~ w w .J .J '.
O O U U O U U O N N O N
W f~ U U ~ U U f~ a a W a w a ca M ~ R;
d z ~ O' O' w ~, O ~ o Ca ~l ~ ~ p ~ P~ o o, o, ~ w o~ ~' w '~ W.
W
x ~ ~x >~
q o, »
'3 ~ ~ o o~
o ~ ~ ~ a M ~ .. . ~ s~ ~'' "c3 p w a z °; bn ~ ~ r~
o ~ z U 0, O' ~ Ch d M ~ o . ~ b x ~~ o ~a ~~ ~Z i'°~ ,.~'cn~o ~;
a as x c.~ w ~a ~ w _ _~,.~
0o O
N N N ~O N
' --~ by O O O O O
-I-I +I j -~f- + F + V
N N ~D N -S~.n ~ ~ '" ~~' 00 t~ ~ ~ ~ 00 øH E-I ...w W ~. ~ ~ O ~O O ,--m'ri c1-a ~ p N N
N M ~ '~ M 00 Q1 p E.., ~ ~ C~
~n n N ~ d' ~h ~V N ~ ~ ~ N
.', a~
Q, ~ ~ V~
N oo ~t oo t~ ~n N '~'' cCi , a1 d: Ov O ~-~ l0 O
O ~n ~ ,~-~ O ~-~~ O o_0 ~ N N ~r N VM1 '~t d' .~~. ~ '~ ~ ~"i H ~ ~ ~ aQ C
O ~
4-~ O Q7 ~ . S
~I
a x d a 'a~~z~.,.~
o, ~ o a M ~ ~ ~ ~ ~ >~ ~
od r~ ~
w ~ w 0' O' ~.
a ~1 ~ ° ~ ~ ~ ~° o x~ ~ a a M ~ ~ . ~ ~ ..w a r~
w ~., b aw o --WI ~ M M O N 'C3 i~
O ~ v O .1 O .;~ ~ ~ U
~~z ~ ~x z M z 0' a n a pr ~ r~ ~ ~
z ~a .~.~~~, °_s W ~ ~ I ~ ~ ~ I ~ ~ N V t0-~ V f~, ao' as>.J a m r~.~ ~~ my s~.~
~ H 'd ~ y ~ pU
°' ~3 x ax ' ~ 'fix ~x z ~ ~"
~z ~ ~~ aH a °w~ ~Z °~z ~°H~ ~z °~z Crude peptides were directly purified by reverse-phase medium-pressure liquid chromatography (MPLC) on a Nucleoprep 20 ~M C18 100 1~
preparative column, using a linear gradient of acetonitrile (1%/min) in 0.08 %
aqueous trifluoroacetic acid (TFA) (pH 2) for 60 min at a flow rate of 18 ml/min. The purity of the peptides was verified on a nucleosil 5 pM C18 300 ~ analytical column, using a linear gradient of acetonitrile (0.5 %/min) in 0.08 % aqueous TFA (pH2) for 20 min at a 1 ml/min flow rate. Conjugation of the fluorophore bodipy~FL N-(2 amino-ethyl)maleimide (Molecular Probes) to the sulfhydryl group was under equimolar conditions at pH 6 in 50 mM ammonium acetate buffer for 30 min in the dark.
The 1o mixture was then loaded on a Nucleoprep 20 qM C18 100 ~ preparative column to purify the BODIPYconjugated peptide. In cell death experiments, all peptides devoid of BODIPY-labeling were subjected to treatment with iodoacetamide to prevent any oxidation of cysteine residue. All purified peptides were then quantified by amino acid analysis and finally characterized by using positive ion electrospray ionization mass spectrometry (ES+). Once integrity of the peptides and coupling efficiency were verified by mass spectrometry, the extinction coefficients of the peptides were measured at 505 nm or at 280 nm when peptides contained aromatic residues (see Table 1). Stability of the labeling was monitored periodically by measuring the absorbance of peptides at 280 nm and at 505 nm and by calculating the absorbance 2o ratio. All peptides were dissolved in water to stocks of 2 mM.
NF xB inhibition assays In a first procedure 2.2 x 105 70Z/3-C3 cells in 220 ~l of RPMI 1640 supplemented with 10% fetal calf serum (FCS) and 50 ~M (3-mercaptoethanol were placed in a 96-well plate and incubated with various concentrations of peptide (0 to 20 ~M) at 37°C in 5% C02 incubator. After two hours an equal portion (100 ~l) of each cell sample transferred in two wells containing each 105 cells. One aliquot of cells was then treated for 5 hours with lipopolysaccharides from Salmonella abortus (Sigma) at 0.5 ~.g/ml final concentration, and the other one left-treated. After 5 hours, cells were centrifuged at 400 x g for 5 min at room temperature and the cell pellets were washed 3o three times with cold PBS (250 p1) by centrifugation. Cells were then lysed in the lysis buffer (25 mM tris-phosphate buffer at pH 7.8 containing 8 mM magnesium chloride, 1 mM dithioerythreitol, 1 % Triton X-100, 15 % glycerol and a protease inhibitor mixture (Roche)), and samples were centrifuged at 4°C for 20 min to clarify the lysate. The supernatant was then kept on ice, and 30 ~.1 was then assayed to measure the (3-galactosidase activity with a plate luminometer (Berthold) using the galacton-star as chemiluminescent substrate (BD Biosciences Clontech, Bronstein et s al., 1989). Background of reaction was measured by mixing for 1 hour 30 ~,1 of lysis buffer with the reaction buffer (196 ~1) and the galacton-star substrate (4 ~l) provided by BD Biosciences. In a second procedure and a more stringent assay, 70213-C3 cells (2.2 x 105 in 220 ~.l medium) were centrifuged at 400 x g at room temperature after peptide internalization for 2 hours, and cell pellets were washed three times with 200 10 ~.1 of PBS by centrifugation. Cells were then diluted three times with complete medium, and allowed to grow for at least 24 hours. The following steps are identical to the first procedure.
Cell death assays The detection of cell death was performed using the MTS assay 1 s provided by Promega (CellTiter 96~ AQ"eoUS one solution cell proliferation assay).
Briefly, 0.3 x 106 Y79 cells in 450 ~l were treated with 50 ~,l of the wild type Ant-CC2 and Ant-LZ peptides (0.1 to 20 ~.M) or their mutants Ant-CC2 (Mu), Ant-LZ
(Mu) or the Ant or left untreated in serum-free RPMI medium at 37°C.
After an incu-bation of 1 or 14 hours, an aliquot of the cell suspension (200 ~.1, 0.12 x 106 cells), 2o was then transferee in 96-well plates and mixed with the MTS solution (40 ~.l) containing the MTS compound and the phenazine ethosulfate. Two hours after, the quantity of formazan produced by viable cells was measured using an automated microplate reader (Bio-TeI~ Instruments, INC) at 490 mn absorbance. Cell survival was observed under microscope and was estimated as a percentage of the value of 2s untreated controls. The background of the reaction was determined by mixing the MTS solution with cell-free RPMI medium. To increase the sensitivity of the cell death assay, the present inventors used peptides devoid of BODIPY-labeling because the absorption spectra of the fluorophor overlaps with that of the formazan product.
All experiments were repeated twice and each experiment condition was repeated in 3o duplicate wells in each experiment.
Analytical Gel filtration experinzeuts The oligomeric states of peptides were determined by filtration as described in Traincard et al., 2003. In brief, 500 ~.l samples were loaded on a Superdex 75 HR 10/30 column equilibrated in 50 mM Tris-HCl pH 8.0 containing mM NaCI and 0.1 mM DDM, at a constant flow rate of 0.4 ml/min. The presence of the DDM detergent was added in the equilibrium buffer to minimize the adsorption in the column and to increase the peptide recovery. The column was calibrated in the same equilibrium buffer with blue dextran 2000 (void volume), dithioerythritol (total volume), bovine serum albumin (67 kDa, Rs = 35.2 ~), ovalbumine (43 kDa, Rs =
l0 27.5 ~), chymotrypsinogen A (25 kDa, Rs = 21.1 A), ribonuclease A (13.7 lcDa, Rs =
16.4 A), cytochrome C (12.4 kDa, Rs = 17.7 ~) and aprotinin (6.5 KDa, Rs =
13.5 A).
Fluor°escehce anisott°opy fneasurements Anisotropy measurements were performed with a PTI Quantamaster fluorometer equipped with polarizers for the excitation and emission beams.
This instrument uses a PMT in the L-configuration. All experiments were carried out in a 1 cm path-length cuvette at 22°C with excitation and emission wavelengths at 495 nm and 520 nm, respectively. The bandpass of excitation and emission monochromators was set at 2 and 4 nm, respectively. Steady-state fluorescence anisotropy was expressed as millianisotropy (mA) and was calculated according to the equations: (1) 2o A= (Ivy-GIvH)/(Ivv+2GIvH) ; (2) G=IHV/IHH.; where A is anisotropy, G is a correction factor for wavelength-dependent distortion and I is the fluorescence intensity component (subscript referring to the vertical and horizontal positioning at the excita-tion and emission polarizers, respectively). Experiments were at least performed twice and each data is the result of 20 records along a 2 min period. All measurements were carried out in 50 mM Tris-HCl buffer at pH 8 containing 150 mM KCI. The present inventors verified that at the BODIPY-Ant-CC2 and BODIPY-Ant LZ concentration used (1 ~,M and 0.1 ~,M respectively), the filter effect was negligible. The BODIPY-Ant-CC2 peptide was preincubated overnight at 22°C alone or with increasing concentrations (1-125 ~M) of CC2 prior to anisotropy measurement. The BODIPY-Ant-LZ peptide (100 nM) was preincubated overnight at 22°C alone or with 10 ~M
and 100 ~M concentrations of CC2 (see legend Fig. 7) prior to anisotropy measure-ment. The dissociation constant parameter was estimated by globally fitting the anisotropy data to binding isotherm equation as described in Agou et al.
(2004, J Biol Chem.) using Kaleidagraph nonlinear regression software (Synergy Software, reading PA). The binding stoichiometry, n, was estimated from the intersection of lines (dashed lines in Figure 7) drawn through the descending and plateau region of the anisotropy data.
Results Rational design of NEMO derived peptides that block NF xB acti-vation The present inventors previously demonstrated that the minimally to trimerization domain of NEMO comprised of the sequence 251 to 337 (Fig.
1A). This region likely contains two coiled-coil sequences of about 35 residues denoted (residue 253-285) and LZ (301-337) at the N- and C-terminus respectively.
Although the structure of the minimal oligomerization domain has not yet been determined, several biochemical studies combined with the fluorescence polarization method prompted us to propose that the CC2/LZ trimer probably forms a six-stranded helical bundle composed of closely packed CC2 and LZ coiled-coils in an antiparallel orien-tation (Traincard, 2003, submitted). Furthermore PSI-BLAST searches reveal that this domain of NEMO contains a conserved motif of 20 residues called "NEMO like Motif' (NLM) which is shared with four other proteins including ABIN-1 (Heyninck, 1999, J. Cell. Biol.), ABIN-2/NAF (Van Huffel, 2001, J. Biol. Chem), ABIN-(Staege, 2001, Immunogenetics) and NRP/optineurin (Schwamborn, 2000, J. Biol.
Chem) (Fig. 1 B). Interestingly, most of these proteins including the conserved motif of ABIN-1 (Heyninck, 2003, FEBS Letters), the C-terminal domain of NEMO (Le Page, 2001, Virology) and ABIN-2 (Liu WK, 2003, Biochemical Journal) or ABIN-3/LIND (Heyninck, 2003, FEBS letters) proteins have been shown to inhibit NF-KB
activation in a dominant-negative manner when overexpressed in cells. Two additional references that disclose ABIN peptides interacting with NF-oB also warrant mention: WO 99/57133 and WO 03/00280.
Since disrupting NEMO oligomerization represents a potential 3o therapeutic strategy for inhibiting NF-oB activation, the present inventors designed NEMO-derived partner peptides that mimic either the CC2 or the LZ sequence (Table 1). It is interesting to note that, unlike the CC2 peptide, the LZ peptide also includes the NLM motif at the N-terminal extremity. To mediate all peptide uptake into cells, the present inventors conjugated a functional analogue at the peptide N-terminus comprised of the 16-amino acid sequence derived from the third helix of the Antennapedialpenetratin protein (Ant). This amphipatic helix acts as an internalization vector (Prochiantz, 2000, Curr. Opin. Cell Biol.). Most of antennapedia fusion peptides were labeled with the BODIPY fluorophore to analyze the transduction potential of each peptide into the cells. Specific labeling was performed by adding a single cystein residue at the extremity of the N-terminus and sequence integrity was verified by mass spectrometry (see "Materials and methods" and Table 1).
l0 Cellulat~ uptake of NEN~O derived peptides mediated by the antennapedia fusion peptide The uptake of BODIPY labeled NEMO peptides into living cells were monitored by fluorescence activated cell sorting (FACS) which is a conventional tool used to quantify cellular internalization. Figure 2A shows FACS analyses of cells treated with Ant-CCZ (WT), Ant-CC2 (Mu), Ant-LZ (WT) or Ant-LZ (Mu) BODIPY-peptides for 2 h at 37°C, and were compared with those of the autofluorescence of untreated cells and control cells treated with an equal concentration of free BODIPY
or with BODIPY-conjugated BSA. Consistent with the role of antennapedia peptide to transduce peptides and proteins into mammalian cells, 100% of 7023-C3-cell line was 2o similarly transduced by the four different NEMO peptides, suggesting that all of the cells in the treated population have a near identical intracellular concentration of NEMO-derived BODIPY-peptides. Comparative analysis indicate that untreated cells and treated cells with BODIPY-BSA or free BODIPY exhibit a similar cell fluores-cence, verifying that our extensive washing protocol before FACS analysis was optimal to minimize any contribution of surface-bound peptide in measuring NEMO
peptide internalization (see "Materials and methods"). Thus, these data suggest that the observed cellular fluorescence signaling mostly reflects the intracellular concen-tration of transduced NEMO peptide and not a non-specific adsorption onto the membrane surface.
3o Then present inventors next investigated the kinetic and concentra-tion dependency of cellular uptake for the Ant-CC2 BODIPY peptide keeping in mind that the transduction of other NEMO peptides should occur in a similar fashion (Fig.
2B and 2C). FACS analysis 5 h after addition of 7023-C3 cell treated with 0.2, 2 or 20 q.M BODIPY-Ant-CC2 peptide at 37°C demonstrate the linear dependancy of the intracellular concentration as a function of the incubated concentration of the antennapedia fusion peptide as widely reported in literature (Lindsay, 2002, Current Opinion in Pharmacology). Notably, the cells treated with the Ant-CC2 at 20 qM
and at 37°C already reach maximum intracellular concentration in 30 min and remain unchanged for up to 5 h. Since the time to induce a strong NF-KB activation in response to LPS requires 3-5 hours of cell treatment, these results indicate that the intracellular concentration of each peptide remains constant during the LPS
stimula-l0 tion.
Specific i~zhibition of LPS-induced NF mB activatioyz by cell permeable CC2 and LZ
To analyze the inhibition potential of LPS-induced NF-oB activation by cell permeable BODIPY-Ant-CC2 and BODIPY-Ant-LZ peptides, the present inventors stably transfected the murine pre-B 7023 cell line with pl2XlacZ-kB, which bears the (3-galactosidase reporter gene under the control of the NF-~cB
transcription factor. When the resulting cell line 7023-C3 was treated for 5 hours with LPS
(3 p,g/ml) a 100 fold-activation of the LacZ gene was observed, indicating that our cellular assay monitors NF-KB activation in response to LPS with extreme sensitivity (Figure 3A, control "no peptide). Interestingly the incubation of cells with 20 ~M of both NEMO-derived polypeptides decreased significantly the NF-KB activation.
This lowering was stronger in the presence of BODIPY-Ant-LZ as compared to BODIPY-Ant-CC2. The inhibition effect was essentially due to the NEMO sequence because the presence of the isolated and/or purified antennapedia peptide containing or not containing a N-terminal BODIPY label (BODIPY-Ant or Ant) induces the same level of NF-~cB activation as the control (Fig. 3A). Note that the basal NF-xB
activity measured in the absence of LPS was very similar in all samples indicating that both CC2 and LZ peptides abolish the responsiveness to LPS without affecting the intrinsic basal NF-oB activity. This was essential to minimize the in vivo cytotoxity, resulting 3o mainly from apoptosis induced by inhibition of NF-~cB (Chen, 2003, Nature Med.).
To determine whether the BODIPY-Ant-LZ or the BODIPY-Ant-CC2 peptide is the most efficient inhibitor, the present inventors next measured the concentration dependent inhibition of each peptide. As shown in Figure 3B, both NEMO peptides exhibit NF-KB dose dependant inhibition of NF-~cB in response to 5 LPS. BODIPY-Ant-LZ inhibited NF-KB to a greater extent than BODIPY-Ant-CC2 did with ICSO values of 3 ~.M and 22 qM respectively (Fig. 3C). This striking difference could be explained by the NLM motif included in the LZ sequence.
Consistent with the intracellular nature of the NEMO target, both LZ and CC2 peptides not fused to the antennapedia protein transduction domain (PTD) exhibited to the same level of activation as the control (Fig. 3 D), confirming that NEMO derived peptides must cross the cell membrane for inhibition of NF-KB. Talcen together these results indicate that peptides that mimic the two coiled-coil sequences of the NEMO
oligomerization domain are potent peptide inhibitors of NF-KB activation in response to LPS.
15 Mutations in the hyd~°ophobic core of the LZ and CC2 coiled-coils disrupt their° specific ifzhibition of the NF KB signalifzg pathway Theoretically, if BODIPY-Ant-LZ or BODIPY-Ant-CC2 peptide inhibit NF-KB activation through specific binding to the NEMO oligomerization domain, mutations that disrupt the coiled-coil association should therefore exhibit 2o impaired abilities to inhibit NF-~cB inhibition. a-helical coiled-coil interactions have been extensively studied and most of the rules governing their specific assembly have been well documented (Vinson, 2002, Mol. Cell. Biol.). The coiled-coil interface that is represented by the first (a) and fourth position (d) of the heptad repeat is generally occupied by hydrophobic amino acids. Proline or glycine is largely excluded to 25 preserve the helical architecture. Core polar residues are destabilizing relative to leucine substitutions, especially when changes occur at d positions.
Considering these rules, the present inventors synthesized a variant of BODIPY-Ant-LZ containing two mutations L ~ S at the d positions (BODIPY-Ant-LZ (Mu) and a variant of BODIPY-Ant-CC2 containing two mutations L -~ G and one mutation I ~ G at the a positions 30 (BODIPY-Ant-CC2 (Mu) (Fig. 4A and 4B, and Table 1). To test the effects of these mutations on the potential inhibition of NF- B activation, the present inventors developed a more stringent cellular assay that consists of the internalization of the peptides for 2 hours followed by an extensive washing of 7023-C3 cells to remove any remaining peptide in the extraeellular media. Cells were allowed to grow for at least 24 hours before LPS-induced NF-~cB activation. In this way, peptide interference with the receptor binding LPS was excluded. As with the cellular assay described above, the BODIPY-Ant-CC2 (WT) and the BODIDY-Ant-LZ (WT) also inhibited NF-KB activation with a 1.7 and 5.8 -fold reduction respectively (Fig. 4A and 4B) when used at a 10 ~M concentration. This indicates that the peptides do not competively act on the receptor binding of LPS. As expected, the presence of the CC2 1o variant (BODIPY-Ant-CC2 (Mu)) did not affect the NF-xB activation since (3-galactosidase activity was equivalent to that of the control (Fig. 4A, no peptide). In response to LPS, NF-KB is more strongly activated in the presence of the BODIPY-Ant LZ mutant than in the presence of wild type. However, unlike the BODIPY-Ant-CC2 (Mu), a slight inhibition of the LZ mutant was observed when compared to the control (15 %). When taken together, these data demonstrate that CC2 and LZ
mutants are unable to inhibit the LPS-induced NF-~cB activation as effectively the wild type did.
Inhibition of NF KB activation is mediated by a specific coiled coil iyzteractio~ of the LZ peptide.
2o Computational analyzes using the program MULTICOIL (Wolf, 1997, Protein Science) predicted that greater than 5 % of all putative ORFs found in sequenced genomes are predicted to contain coiled-coil motifs (Newman, 2000, Proc.
Natl. Acad. Sci. USA) and that approximately 2-4 % of amino acids in proteins are estimated to adopt coiled-coil folds (Bergen 1995, Proc.Natl.Acad.Sci. USA).
This abundance raises the question if the NEMO derived- LZ peptide maintains its coiled-coil interaction partnering specificity in vivo. To address this question, the present inventors synthesized another coiled-coil peptide that mimics the sequence of the GCN4 leucine zipper and tested its ability to inhibit NF-KB activation. BODIPY-Ant-GCN4 contained the antennapedia sequence at its N-terminus and a short SKGMQ
3o linker (SEQ ID NO: 9) identical to the CC2 sequence for convenience of peptide delivery (Table 1). It was also labeled at its N-terminus with BODIPY to monitor its cellular uptake by FACS (data not shown). The GCN4 peptide displays a low sequence similarity with the LZ sequence of NEMO (22 %) but identical residues are mostly represented by leucines at d positions (Figure 5). These residues contribute to most of the energy to coiled-coil oligomerization stability (Vinson, 2002, Mol. CeII.
Biol.). Note that a positions which are important for coiled-coil specificity (Vinson, 2002, Mol. Cell. Biol) are composed of a set of different amino acids. While GCN4 is composed of hydrophobic residues and the typical asparagine residue, the LZ of NEMO contains two charged amino acids R and K (Figure 4B and Fig. 5A). Thus, these residues, which are located at the coiled coil interface likely, contributes to the selectivity of coiled coil interaction.
1o Figure SB shows the effect of the BODIPY-Ant-GCN4 at a 10 qM
concentration on the inhibition of NF-KB activation in response to LPS. To compare the effects of coiled coil sequences, the present inventors used the stringent cellular assay described above. BODIPY-Ant-GCN4, unlike BODIPY-Ant-LZ, has no ability to inhibit NF-oB activation since the level of NF-KB activation was near that of the control without peptide. Taken together, these results strongly support the hypothesis that the LZ peptide of NEMO inhibits NF-oB activation through selective coiled-coil interactions.
The atZtennapedia sequefzce induces fno~ome~ization of NF KB
peptidic inhibto~s 2o The antennapedia sequence is a protein transduction domain (PTD) which adopts an alpha-helical amphiphatic structure (Prochiantz, 2000, Curr.
Opin.
Cell Biol.). When fused to the N terminus of a coiled-coil sequence like CC2 or LZ, the antennapedia could alter the coiled-coil association by covering the hydrophobic interface of the coiled-coil through intramolecular interactions. To examine the effect of N-fusion of the antennapedia peptide on the oligomerization properties of the CC2 and the LZ peptides, the present inventors analyzed peptides containing or not containing the antennapedia sequence at their N-terminus by geI filtration. As shown in Figure 6, all peptides containing an N-terminal fusion of antennapedia co-elute with an elution volume corresponding to their monomeric forms as compared to globular protein markers. Note that the present inventors had to add a detergent in the buffer below its cmc to improve peptide recoveries. When inj ected at the same 10 ~,M
concentration, CC2 wild type and LZ wild type without the antennapedia N-fusion oligomerize. CC2 (WT) forms a trimer whereas LZ (WT) forms a dimer as recently repouted (Traincard et al). As expected, when a CC2 mutant was chemically obtained with three of its aliphatic residues at positions replaced with glycine residues, it lost its ability to oligomerize (bottom panel, dashed line). The effect of the two L-~S
muta-tions at d positions was less strong with LZ (mutant). However, the present inventors still detected dimerization of the LZ mutant at a 10 ~M concentration (dashed line) although its association was markedly reduced by mutations as compared to the wild type LZ (solid line). Taken together, these data indicate that the N-fusion of the antennapedia sequence to both CC2 and LZ peptides alter homotypic coiled-coil inter-to actions, facilitating the monomerization of the NEMO derived-peptides.
Furthermore these results also show that residue changes at a and d position alter oligomerization of LZ and CC2 peptides. Thus, it is likely that the synthetic peptides form a-helical coiled-coil structures.
Homo- and heterotypic interactions of CC2 and LZ peptides with a~zd wit7zout the N--fission of afZtennapedia sequence.
Because the N-fusion of antennapedia modifies the oligomerization properties of the CC2 and LZ peptides, the present inventors next studied by fluores-cence polarization whether the Ant-CC2 and the Ant-LZ monomers labeled with BODIPY could bind to the NEMO-derived polypeptides devoid of the antennapedia 2o sequence. These peptides CC2 and LZ may be also considered as the ira vivo binding target for both cell permeable BODIPY-Ant-CC2 and BODIPY-Ant-LZ NF-~cB
inhibitors. Figure 7 shows a typical binding isotherm for the interaction of various concentrations of the CC2 peptide with a fixed concentration of the BODIPY-Ant-CC2. The shape of the binding curve is not sigmoidal, indicating that CCZ
binds to the BODIPY-Ant-CC2 peptide without cooperativity. The stoichiometry calculated from the intercept between the tangent of the initial part of the anisotropy and the asymptote is equal to 0.8. Taking into account this stoichiometry, the dissociation constant KD is 15.2 ~.M. Similar results were obtained when a fixed concentration of the BODIPY-Ant-LZ was titrated with various concentrations of the CC2 peptide as the present 3o inventors previously reported (Inset Figure 7, Traincard et al.).
Collectively, these data demonstrate that both Ant-CC2 and Ant-LZ monomers binds in vitro to the CC2 peptide composing the minimal oligomerization domain of NEMO.
Cell death in human Retihoblastoma cell is induced by NF-KB
ifzhibitors Ant-CC2 azzd Ant-LZ, but not by theif° mutants Azzt-CCZ
(Mu) and Azzt-LZ
(Mu) It has become clear that constitutively activated NF-KB transcription factors have been associated with several aspects of tumorigenesis (Karin review), including most of six essential alterations in cell physiology that dictate the conver-sion of normal human cells into cancer cells (Hanahan, 2000, Cell for review).
This led to a significant enthusiasm for the use of NF-KB inhibitors as a new anti-cancer therapy. Promising results have been reported recently using proteasome inhibitors or to the SN50 peptide that bloclcs the nuclear translocation (Orlowski, 2002, Trends in Molecular Medicine; Mitsiades, 2002, Blood). However, the specificity of these agents on NF-KB inhibition have been questioned. Poulaki et al. (2002, Am J
Pathol..) showed recently that the treatment of the human retinoblastoma (Rb) cell lines with SN50 peptide induced apoptosis of cancer cells. Sequence alignment of murine and human NEMO proteins indicate that the minimal oligomerization domain of NEMO is strictly conserved, suggesting that similar effects of NF-~cB
inhibition could be observed in rodent as well as in human cells.
Given that specific NF-KB inhibition may trigger apoptosis of cancer cells, the present inventors examined the effects of both cell-permeable Ant-LZ and 2o Ant-CC2 peptides on human retinoblastoma cell viability. In these experiments, the present inventors used NEMO-derived polypeptides without a N-terminal BODIPY
labeling to prevent any interference with the MTS assay (see "Materials and Methods"). As shown in Figure 7, the present inventors found a dose dependence of the Y79 cell viability when cells were treated for 3 hours with Ant-CC2 (Fig.
8A) or Ant-LZ (Fig 8B). The effect of the Ant-LZ peptide on cell death was stronger than that of the Ant-CC2. This induction of cell death was significant since Rb cell survival was 20% and 65 % with the Ant-LZ and the Ant-CC2 peptides respectively when cancer cells were treated for 3 hours at a 20 ~.M concentration. Remarkably, the same cell treatment with the Ant-CC2 (Mu) (Fig.BA) or with the Ant-CC2 (Mu) (Fig.8B) 3o did not induce concentration cell death as did WT peptides. These effects on cell death were essentially due to the NEMO sequence because a longer treatment of Y79 cell lines with the antennapedia peptide did not affect cell survival (Fig. 8C). In contrast, ~0 % and 55% of Y79 cell died in the presence of Ant-LZ and Ant-CC2 respectively at 5 ~.M concentration (Fig. ~C). Taken together, these results indicate that specific NF-KB inhibition by Ant-CC2 and Ant-LZ peptides induce cell death in Rb cell lines, validating the use of specific NF-xB inhibitors as anticancer chemotherapy.
5 In the absence of the pro-inflammatory signals, all peptides assayed have no detectable cytoxicity for lymphocytes B tested at a concentration up to 30 ~M
according to the MTS assay, the direct observation under microscope, and the forward scatter-FSC and side scatter-SSC parameters deduced from FACS analyses.
However, the present inventors could detect a slight cell death by FACS in a concentration-l0 dependent manner when LPS stimulated the pre-B lymphocytes in the presence of NEMO-derived polypeptides. The cellular proportion of cell death was 9 % in the absence of stimuli at a 20 ~M concentration of Ant-CC2 whereas it increased at after LPS stimulation (data not shown). This was in agreement with the role of the NF-oB pathway in protecting cells from apoptosis. The cell death was more 15 pronounced and fast on the Rb cell lines Y79 in which constitutive NF-KB
activity has been reported (Poulaki, 2002, Am J Pathol..). The present inventors did not demonstrate here by the Annexin V labeling and the TIJNEL method that the NEMO
peptides-induced cell death is indeed apoptosis. Nevertheless considering the role of the NF-KB pathway in the regulation of apoptosis, it is likely that the cell death 20 induced by NEMO-derived polypeptides is apoptotic in nature.
The results set forth above, regardless of the nature of the future NF-KB inhibitors (organic or peptidomimetic compounds), targeting NEMO's oligomeri-zation will remain a more attractive and promising strategy as compared to those of IKK kinase activity and of NEMO-kinase association because this molecular event 25 strictly depend on the pro-inflammatory signal. Therefore, such drugs would interfere less with the basal NF-KB activity in normal cells that is required for cell viability.
. Peptides derived from the N terminal region of wild-type NEMD
The present inventors explored the N-terminal region of the wild type NEMO, in particular the NLM conserved motif (residues 293-322 of SEQ ID
30 NO: 12) appearing in Figure 1A. To this end, the following sequences were produced (see Table 1 for the corresponding sequence):
NLM-DR (SEQ ID NO : 30) Ant.NLM-DR (SEQ ID NO : 31) Tat NLM-DR (SEQ ID NO : 32) R7-NLM-DR (SEQ ID NO : 33) R9-NLM-DR (SEQ ID NO : 34) NLM-DR is a 21 amino acid "motif' (and the corresponding wild type NLM covering the same amino acid range) derived from the larger 30 amino acid conserved NLM motif set forth in Figure 1A. The NLM-DR has been mutated from the wild type NLM sequence in that the aspartic acid at residue I 1 in the wild type to sequence has been replaced by an arginine (see Table 1 and SEQ ID NO: 30).
The present inventors compared NLM-DR to the corresponding NLM peptide by measuring the respective cooperativity indices, which evidence an advantage of NLM-DR mutated peptide over the wild-type.
The calculation of the "cooperativity indice" by means of Hill coef ficient is based on the following formula Boundmax x L° /(KD° + L°) Wherein Boundmax is the maximum concentration of the bound ligand, L is the concentration of the free ligand, 2o n is the cooperativity indice and KD, is the affinity constant of the ligand by the protein.
The cooperative indices calculated by means of the Hill coefficient calculation are:
~ For the mutant NLM peptide (NLM-DR) - a dissociation constant Kd of ~5 170 ~.M and a cooperativity indice of 1.4 (1326 ~.M); and ~ For the corresponding wild-type NLM peptide (NLM) - a dissociation constant Kd of 240 ~M and a cooperativity indice of 2.1 (99642 ~M).
If these values were to be compared to those obtained from the curves without accounting for cooperativity, the affinity of NLM-DR peptide would 3o be 75 times higher than the affinity of wild-type NLM peptide.
The present inventors also evaluated the biologically relevant results for the aforementioned forms of NLM-DR as they apply to the inhibition of NF-KB
activation pathway, IC50 and toxicity results (FACS). The results are presented in Table 2:
Table 2: Properties of NLM-DR derived peptides Cytotoxicity* Cellular uptakeIC 50 MTS Cell relative efficiency morphology Peptide Assay FACS Microscope(FACS) BODIPY-Ant-NLM-DR no + + + 1.1 ~.M
BODIPY-TAT-NLM-DR no no no + 1 ~cM
BODIPY-R9-NLM-DR no no no ++ 0.9 qM
BODIPY-R7-NLM-DR n.d. no no ++++ 0.9 qM
* Cytotoxicity analysed by the indicated technique is scaled from no toxicity (no) to high toxicity (++++);the MTS cell proliferation assay was from Promega; n.d. =
not determined.
Numerous modifications and variations on the present invention are possible in light of the above teachings. It is, therefore, to be understood that within the scope of the accompanying claims, the invention may be practiced otherwise than 1 o as specifically described herein.
REFERENCES
1. Agou, F., Ye, F., Goffinont, S., Courtois, G., Yaiuaoka, S., Israel, A. and Veron, M.
(2002) NEMO trimerizes through its coiled-coil C-terminal domain.
J. Biol. Chem., 20, 17464-17465 2. Agou F., Traincard F., Vinolo E., Courtois G., Yamaoka S., Israel A., Veron M.
(2004) The trimerization domain of NEMO is composed of the interacting C-terminal CC2 and LZ coiled-coil subdomains.
J Biol Chem. 2004 Jul 2;279(27):27861-9 3. Berger B, Wilson DB, Wolf E, Tonchev T, Milla M, Kim PS.(1995) Predicting coiled coils by use of pairwise residue correlations.
Proc Natl Acad Sci U S A. Aug 29;92 (18):8259-63.
4. Bronstein I, Edwards B, Voyta JC.
1,2-dioxetanes: novel chemiluminescent enzyme substrates. Applications to immunoassays.
J Biolumin Chemilumin. 1989 Jul;4(1):99-111.
5. Carter RS, Geyer BC, Xie M, Acevedo-Suarez CA, Ballard DW. (2001) Persistent activation of NF-kappa B by the tax transforming protein involves chronic phosphorylation of IkappaB kinase subunits IKKbeta and IKKgamma.
J Biol Chem. Jul 6;276(27):24445-8. Epub 2001 Apr 26.
6. Chan DC and Kim PS. (1998) HIV entry and its inhibition.
Cell. 1998 May 29;93(5):681-4. Review. No abstract available.
7. Mike Chang, Lianshan Zhang, James P. Tam, and Elaine Sanders-Bush (2000) Dissecting G Protein-coupled Receptor Signaling Pathways with Membrane-permeable Blocking Peptides. J. Biol. Chem., Mar 2000; 275: 7021 - 7029.
8. Lee-Wei Chen, Laurence Egan, Zhi-Wei Li, Florian R. Greten, Martin F.
Kagnoff, Michael Karin. (2003) The two faces of IKK and NF-kappaB inhibition: prevention of systemic inflammation but increased local injury following intestinal ischemia-reperfusion Nature Medicine9, 575 - 581 (O1 May 2003) 9. Colman, P.M. et al. (2003) The structural biology of Type I viral membrane fusion.
Nature Rev. Mol. Cell Biol., 4, 309-317 10. Courtois,G., Whiteside, S.T., Sibley, C.H. and Israel, A. (1997) Characterization of a mutant cell line that does not activate NF-KB in response to multiple stimuli.
Mol. Cell. Biol., 17, 1441-1449.
11. Doffinger, R., Smahi, A., Bessia, C., Geissman, F., Feinberg, J., Durandy, A., Bodemer, C., Kenwrick, S., Dupuis-Girod, S., Blanche, S., Wood, P., Rabia, S.H., Headon, D.J., Overbeek, P.A., Le Deist, F., Holland, S., Belani, K., Kumararatne, D.S., Fisher, A., Shapiro, R., Conley, M.E., Reimund, E., Kalhoff, H., Abinun, M., Munnich, A., Israel, A., Courtois, G.and Casanova, J.-L. (2001) X-linked anhidrotic ectodermal dysplasia with immunodeficiency is caused by impaired NF-~cB signaling.
Nature Genet., 27, 277-285.
Nature Genet., 27, 277-285.
12. Eclcert, D.M., and Kim, P.S. (2001) Mechanisms of viral membrane fusion and its inhibition.
Ann. Rev. Biochem., 70, 777-810
Ann. Rev. Biochem., 70, 777-810
13. S Fawell, J Seery, Y Daikh, C Moore, LL Chen, B Pepinsky, and J Barsoum (1994) Tat-Mediated Delivery of Heterologous Proteins into Cells PNAS 1994; 91: 664-668.
14. Fiering S., Northrop J.P., Nolan G.P., Manila P.S., Crabtree G.R., Herzenberg L.A.
( 1990) Single cell assay of a transcription factor reveals a threshold in transcription activated by signals.
Genes Dev., 4,1823-34.
( 1990) Single cell assay of a transcription factor reveals a threshold in transcription activated by signals.
Genes Dev., 4,1823-34.
15. Ghosh, S., May, M.J. and Kopp, E.B. (1998) NF-KB and Rel proteins: evolutionarily conserved mediators of immune responses.
Annu. Rev. Immunol., 16, 225-260.
Annu. Rev. Immunol., 16, 225-260.
16. Hanahan D. and Weinberg R. A. (2000) The Hallmarks of Cancer.
Cell, 100, 57-70.
Cell, 100, 57-70.
17. Heyninck K, De Valck D, Vanden Berghe W, Van Criekinge W, Contreras R, Fiers W, Haegeman G, Beyaert R. (1999) The zinc finger protein A20 inhibits TNF-induced NF-kappaB-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal and directly binds to a novel NF-kappaB-inhibiting protein ABIN.
J Cell Biol. 1999 Jun 28;145(7):1471-82.
J Cell Biol. 1999 Jun 28;145(7):1471-82.
18. Heyninclc, K., Kreike, M.M. and Beyaert, R. (2003) Structure-function analysis of the A20-binding inhibitor of NF-KB activation, ABIN-1.
FEBS Lett., 26956, 1-6.
FEBS Lett., 26956, 1-6.
19. Yinling HU, Veronique BAUD, Takefumi OGA, Keun IL KIM, Kazuhiko YOSHIDA
and Michael KARIN (2001 ) IKKy controls formation of the epidermis independently of NF-~cB
Nature 410, 710 - 714
and Michael KARIN (2001 ) IKKy controls formation of the epidermis independently of NF-~cB
Nature 410, 710 - 714
20. Inohara, N., Koseki, T., Lin, J., del Peso, L., Lucas, P.C., Chen, F.F., Ogura, Y. and Nunez, G. (2000) An induced proximity model for NF-~cB activation in the Nodl/RICK and RIP
signaling pathways.
J. Biol. Chem., 275, 27823-27831.
signaling pathways.
J. Biol. Chem., 275, 27823-27831.
21. Israel, A. (2000) The IKK complex: an integrator of all signals that activate NF-KB?
Trends Cell. Biol., 10, 129-133.
Trends Cell. Biol., 10, 129-133.
22: J. Kevin Judice, Jeffrey Y. K. Tom, Wei Huang, Terri Wrin, Joann Vennari, Christos J. Petropoulos, and Robert S. McDowell (1997) Inhibition of HIV type 1 infectivity by constrained a helical peptides:
Implications for the viral fusion mechanism PNAS 94: 13426-13430.
Implications for the viral fusion mechanism PNAS 94: 13426-13430.
23. Karin, M. (I999) The beginning of the end: IKB Kinase (IKK) and NF-~cB activation.
J. Biol. Chem., 274, 27339 - 27342.
J. Biol. Chem., 274, 27339 - 27342.
24. Kovalenko, A., Chable-Bessia, C., Cantarella, G., Israel, A., Wallach, D.
and Courtois, G. (2003) The tumor suppressor CYLD negatively regulates NF-KB signalling by deubiquitination.
Nature, 424, 801-805.
and Courtois, G. (2003) The tumor suppressor CYLD negatively regulates NF-KB signalling by deubiquitination.
Nature, 424, 801-805.
25. Le Page C., Popescu O., Genin P., Lian J., Paquin A., Galipeau J. and Hiscott J.
(2001 Disruption of NF-kappa B signaling and chemokine gene activation by retroviral mediated expression of IKK gamma/NEMO mutants.
Virology, 286, 422-33.
(2001 Disruption of NF-kappa B signaling and chemokine gene activation by retroviral mediated expression of IKK gamma/NEMO mutants.
Virology, 286, 422-33.
26. Yao-Zhong Lin, SongYi Yao, Ruth Ann Veach, Troy R. Torgerson, and Jacek Hawiger (1995) Inhibition of Nuclear Translocation of Transcription Factor NF-xB by a Synthetic Peptide Containing a Cell Membrane-permeable Motif and Nuclear Localization Sequence.
J. Biol. Chem., Jun 1995; 270: 14255 - 14258.
J. Biol. Chem., Jun 1995; 270: 14255 - 14258.
27. Mark A. Lindsay (2002) Peptide-mediated cell delivery: application in protein target validation, Current Opinion in Pharmacology, Volume 2, Issue 5,1 October, Pages 587-594
28. Liu W.-K., Yen, P.-F., Chien, C.-Y., Fann, M.-J., Su, J.Y. and Chou, C.K.
(2003) ABIN-2 disrupts the interaction of RIP with IKI~y to block NF-tcB activation and potentiate apoptosis.
Biochemical Journal
(2003) ABIN-2 disrupts the interaction of RIP with IKI~y to block NF-tcB activation and potentiate apoptosis.
Biochemical Journal
29. May, M.J. et al. (2000) Selective inhibition of NF-KB activation by a peptide that blocks the interaction of NEMO with the IKB kinase complex.
Science, 289, 1550-1554
Science, 289, 1550-1554
30. May, M.J., Marienfield, R.B. and Ghosh, S. (2002) Characterization of the IoB-kinase NEMO binding domain.
J. Biol. Chem., 277, 45992-46000
J. Biol. Chem., 277, 45992-46000
31. Meinkoth J, Wahl G. (1984) Hybridization of nucleic acids immobilized on solid supports.
Anal Biochem. May 1;138(2):267-84
Anal Biochem. May 1;138(2):267-84
32. Mitsiades N, Mitsiades CS, Poulaki V, Chauhan D, Richardson PG, Hideshima T, Munshi N, Treon SP, Anderson IBC. (2002) Biologic sequelae of nuclear factor-kappaB blockade in multiple myeloma:
therapeutic applications.
Blood. 2002 Jun 1;99(11):4079-86.
therapeutic applications.
Blood. 2002 Jun 1;99(11):4079-86.
33. May C. Morris, Julien Depollier, Jean Mery, Frederic Heitz, Gilles Divita (2001) A peptide carrier for the delivery of biologically active proteins into mammalian cells Nature Biotechnologyl9, 1173 - 1176
34. Mousson, F., Coic, Y.-M., Baleux, F., Beswick, V., Sanson, A. and Neumann, J.-M.
(2002) Deciphering the role of individual acyl chains in the interaction network between phosphatidylserines and a single-spanning membrane protein.
Biochemistry 41, 13611-13616.
(2002) Deciphering the role of individual acyl chains in the interaction network between phosphatidylserines and a single-spanning membrane protein.
Biochemistry 41, 13611-13616.
35. Newman, J.R.S., Wolf E. and Kim P.S. (2000) From the cover: A computationally directed screen identifying interacting coiled coils from Saccharomyces cerevisiae. Proc. Natl. Acad. Sci. U.S.A., 97, 13203-13208.
36. Robert Z. Orlowski and Albert S. Baldwin, Jr . (2002) NF-xB as a therapeutic target in cancer Trends in Molecular Medicine, Volume 8, Issue 8, 1 August 2002, Pages 385-389
37. Pawson, T. and Nash, P. (2003) Assembly of cell regulatory systems through protein interaction domains.
Science, 300, 445-452.
Science, 300, 445-452.
38. Joel L. Pomerantz and David Baltimore. (2002) Two Pathways to NF-xB
Molecular Cell 2002 10: 693-695
Molecular Cell 2002 10: 693-695
39. Poulaki V., Mitsiades C.S., Joussen A.M., Lappas A., Kirchhof B., Mitsiades N.
(2002) Constitutive nuclear factor-kappaB activity is crucial for human retinoblastoma cell viability.
Am J Pathol., 161, 2229-2240.
(2002) Constitutive nuclear factor-kappaB activity is crucial for human retinoblastoma cell viability.
Am J Pathol., 161, 2229-2240.
40. Poyet, J.-L., Srinivasula, S.M., Lin, J-H, Fernandes-Alnmeri, T., Yamaoka, S., Tsichlis, P.N. and Alnemri, E.S. (2000) Activation of yhe hcB kinases by RIP via IKKy/NEMO-mediated oligomerization.
J. Biol. Chem., 275, 37966-37977.
J. Biol. Chem., 275, 37966-37977.
41. Poyet, J.-L., Srinivasula, S.M. and Alnemri, E.S. (2001) vClap, a caspase-recruitment domain-containing protein of equine Herpesvirus-2, persistently activates the hcB lcinases through oligomerization of IKK~y.
J. Biol. Chem., 276, 3183-3187
J. Biol. Chem., 276, 3183-3187
42. Prochiantz, A. (2000) Messenger proteins, homeoproteins, TAT and others.
Curr. Opin. Cell Biol., 12, 400-406.).
Curr. Opin. Cell Biol., 12, 400-406.).
43. Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York (1989).
44. Santoro, G., Rossi, A. and Amici, C. (2003) NF-KB and virus infection: who controls whom.
EMBO J., 22, 2552-2560.
EMBO J., 22, 2552-2560.
45. Klaus Schwamborn, Robert Weil, Gilles Courtois, Simon T. Whiteside, and Alain Israel (2000) Phorbol Esters and Cytokines Regulate the Expression of the NEMO-related Protein, a Molecule Involved in a NF-~cB-independent Pathway J. Biol. Chem., Jul 2000; 275: 22780 - 22789.
46. Uwe Senftleben, Yixue Cao, Gutian Xiao, Florian R. Greten, Gertraud Krahn, Giuseppina Bonizzi, Yi Chen, Yinling Hu, Abraham Fong, Shao-Cong Sun, and Michael Karin. (2001 ) Activation by IKI~ of a Second, Evolutionary Conserved, NF-KB Signaling Pathway Science August 24; 293: 1495-1499.
47. T. F. Smith and M. S. Waterman. (1981) Comparison of biosequences Adv. Appl. Math., 2:482-489
48. Souroujon M.C. and Mochly-Rosen D. (1998) Peptide modulators of protein-protein interactions in intracellular signaling.
Nat BiotechnoL, I6, 919-924.
Nat BiotechnoL, I6, 919-924.
49. Staege, H.; Brauchlin, A.; Schoedon, G.; Schaffner, A. (2001) Two novel genes FIND and LIND differentially expressed in deactivated and Listeria-infected human macrophages.
Immunogenetics 53: 105-113
Immunogenetics 53: 105-113
50. Stroh C, Held J, Samraj AK, Schulze-Osthoff I~.
Specific inhibition of transcription factor NF-kappaB through intracellular protein delivery of IkappaBalpha by the Herpes virus protein VP22 (2003) Oncogene. Aug 14;22(34):5367-73.
Specific inhibition of transcription factor NF-kappaB through intracellular protein delivery of IkappaBalpha by the Herpes virus protein VP22 (2003) Oncogene. Aug 14;22(34):5367-73.
51. Eric D. Tang, Naohiro Inohara, Cun-Yu Wang, Gabriel Nunez, and Kun-Liang Guan.
(2003) Roles for homotypic interactions and transautophosphorylation in B kinase (IKK) activation.
J Biol. Chem. Vol. 278, 38566-38570
(2003) Roles for homotypic interactions and transautophosphorylation in B kinase (IKK) activation.
J Biol. Chem. Vol. 278, 38566-38570
52. Tegethoff, S. et al. (2003) Tetrameric oligomerization of IKB kinase y is obligatory for IKK complex activity and NF-~cB activation Mol. Cell. Biol., 23, 2029-2041
53. Thompson, J.D., Higgins, D.G. and Gibson, T.J. (1994) CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice.
Nucl. Acids. Res., 22, 4673-4680.
Nucl. Acids. Res., 22, 4673-4680.
54. Trompouki, E., Hatzivassilou, E., Tsichritzis, T., Farmer, H., Ashworth, A. and Mosialos, G. (2003) CYLD is a deubiquitinating enzyme that negatively regulates NF-~cB activation by TNFR family members.
Nature, 424, 793-796
Nature, 424, 793-796
55. Sofie Van Huffel, Filip Delaei, Karen Heyninck, Dirk De Valck, and Rudi Beyaert.
(2001 ) Identification of a Novel A20-binding Inhibitor of Nuclear Factor-xB
Activation Termed ABIN-2 J. Biol. Chem., Aug 2001; 276: 30216 - 30223.
(2001 ) Identification of a Novel A20-binding Inhibitor of Nuclear Factor-xB
Activation Termed ABIN-2 J. Biol. Chem., Aug 2001; 276: 30216 - 30223.
56. Vinson, C., Myakishev, M., Acharya, A., Mir, A.A., Moll, J.R. and Bonovich M.
(2002) Classification of human B-Zip proteins based on dimerization properties.
Mol. Cell. Biol., 22, 6321-6335.
(2002) Classification of human B-Zip proteins based on dimerization properties.
Mol. Cell. Biol., 22, 6321-6335.
57. Wolf E., Kim, P.S. and Berger, B. (1997) MultiCoil: A program for predicting two- and three-stranded coiled coils.
Protein Sci., 6, 1179-1189.
Protein Sci., 6, 1179-1189.
58. Ebrahim Zandi, David M. Rothwarf, Mireille Delhase, Makio Hayakawa, and Michael Karin. (1997)
59 PCT/IB2004/003352 The hcB Kinase Complex (IKK) Contains Two Kinase Subunits, IKKa and IKK(3, Necessary for IoB Phosphorylation and NF-xB Activation Cell 91: 243-252.
59. Zonana, J., Elder, M.E., Schneider, L.C., Orlow, S.J., Moss, C., Golabi, M., Shapira, S.K., Farndon, P.A., Wara, D.W., Emmal,S.A. and Ferguson, B.M. (2000) A novel X-linked disorder of immune deficiency and hypohydrotic ectodermal dysplasia is allelic to incontinentia pigmenti and due to mutations in IKK-y (MEMO).
Am. J. Hum. Genet. 67, 1555-1562.
DEMANDES OU BREVETS VOLUMINEUX
LA PRESENTE PARTIE DE CETTE DEMANDE OU CE BREVETS
COMPRI~:ND PLUS D'UN TOME.
CECI EST L,E TOME 1 DE 2 NOTE: Pour les tomes additionels, veillez contacter 1e Bureau Canadien des Brevets.
JUMBO APPLICATIONS / PATENTS
THIS SECTION OF THE APPLICATION / PATENT CONTAINS MORE
THAN ONE VOLUME.
NOTE: For additional valumes please contact the Canadian Patent Office.
59. Zonana, J., Elder, M.E., Schneider, L.C., Orlow, S.J., Moss, C., Golabi, M., Shapira, S.K., Farndon, P.A., Wara, D.W., Emmal,S.A. and Ferguson, B.M. (2000) A novel X-linked disorder of immune deficiency and hypohydrotic ectodermal dysplasia is allelic to incontinentia pigmenti and due to mutations in IKK-y (MEMO).
Am. J. Hum. Genet. 67, 1555-1562.
DEMANDES OU BREVETS VOLUMINEUX
LA PRESENTE PARTIE DE CETTE DEMANDE OU CE BREVETS
COMPRI~:ND PLUS D'UN TOME.
CECI EST L,E TOME 1 DE 2 NOTE: Pour les tomes additionels, veillez contacter 1e Bureau Canadien des Brevets.
JUMBO APPLICATIONS / PATENTS
THIS SECTION OF THE APPLICATION / PATENT CONTAINS MORE
THAN ONE VOLUME.
NOTE: For additional valumes please contact the Canadian Patent Office.
Claims (45)
1. A purified polynucleotide which encodes a polypeptide that inhibits the NF-.kappa.B signaling pathway, said polynucleotide being selected in the group consisting of:
(a) a polynucleotide which encodes a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID
NO: 3, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID
NO: 15, SEQ ID NO: 16, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID
NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID
NO: 38, and SEQ ID NO: 39;
(b) a purified polynucleotide complementary to the one as defined in (a);
(c) a purified polynucleotide which is at least 70% identical to the polynucleotide as defined in (a);
(d) a purified polynucleotide which is at least 80% identical to the polynucleotide as defined in (a);
(e) a purified polynucleotide which is at least 90% identical to the polynucleotide as defined in (a) and (f) a purified polynucleotide which hybridizes under stringent conditions to the polynucleotide as defined in (a), wherein said stringent conditions comprise washing in 5X SSC at a temperature from 50 to 68°C.
(a) a polynucleotide which encodes a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID
NO: 3, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID
NO: 15, SEQ ID NO: 16, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID
NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID
NO: 38, and SEQ ID NO: 39;
(b) a purified polynucleotide complementary to the one as defined in (a);
(c) a purified polynucleotide which is at least 70% identical to the polynucleotide as defined in (a);
(d) a purified polynucleotide which is at least 80% identical to the polynucleotide as defined in (a);
(e) a purified polynucleotide which is at least 90% identical to the polynucleotide as defined in (a) and (f) a purified polynucleotide which hybridizes under stringent conditions to the polynucleotide as defined in (a), wherein said stringent conditions comprise washing in 5X SSC at a temperature from 50 to 68°C.
2. The purified polynucleotide of Claim 1, wherein said polypeptide inhibits the NF-.kappa.B pathway.
3. The purified polynucleotide of Claim 2, wherein said polypeptide disrupts NEMO oligomerization.
4. A vector comprising the purified polynucleotide of Claim 1.
5. A host cell comprising the purified polynucleotide of Claim 1.
6. A purified polypeptide that inhibits the NF-.kappa.B pathway selected in the group consisting of:
a) a NEMO type polypeptide having an amino acid sequence selected in the group consisting of SEQ ID NO:3, SEQ ID NO:7, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, and SEQ ID NO: 39;
b) a purified polypeptide which is at least 70% identical to the polypeptide as defined in a);
c) a purified polypeptide which is at least 80% identical to the polypeptide as defined in a);
(d) a purified polypeptide which is at least 90% identical to the polypeptide as defined in a);
(e) a purified polypeptide which is at least 95% identical to the polypeptide as defined in a).
a) a NEMO type polypeptide having an amino acid sequence selected in the group consisting of SEQ ID NO:3, SEQ ID NO:7, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, and SEQ ID NO: 39;
b) a purified polypeptide which is at least 70% identical to the polypeptide as defined in a);
c) a purified polypeptide which is at least 80% identical to the polypeptide as defined in a);
(d) a purified polypeptide which is at least 90% identical to the polypeptide as defined in a);
(e) a purified polypeptide which is at least 95% identical to the polypeptide as defined in a).
7. The purified polypeptide of Claim 6, wherein said polypeptide inhibits the NF-.kappa.B pathway.
8. The purified polypeptide of Claim 7, wherein said polypeptide disrupts NEMO oligomerization.
9. A polypeptide fusion construct that inhibits the NF-.kappa.B pathway, said construct comprising an amino acid sequence being selected in the group consisting of:
a) a polypeptide fusion construct comprising an amino acid sequence selected in the group consisting of SEQ ID NO: 3, SEQ ID NO:7, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, and SEQ ID NO: 39 and which is linked to a polypeptide having a high transduction potential;
b) a polypeptide fusion construct comprising an amino acid sequence at least 80% identical to an amino acid sequence as defined in a);
c) a polypeptide fusion construct comprising an amino acid sequence at least 90% identical to an amino acid sequence as defined in a);
d) a polypeptide fusion construct comprising an amino acid sequence at least 95% identical to an amino acid sequence as defined in a);
e) a polypeptide fusion construct comprising an amino acid sequence that is at least 70% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 14, SEQ ID NO: 16, SEQ
ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ
ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, and SEQ ID NO: 39;
said amino acid sequence being linked to a polypeptide having a high transduction potential.
a) a polypeptide fusion construct comprising an amino acid sequence selected in the group consisting of SEQ ID NO: 3, SEQ ID NO:7, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, and SEQ ID NO: 39 and which is linked to a polypeptide having a high transduction potential;
b) a polypeptide fusion construct comprising an amino acid sequence at least 80% identical to an amino acid sequence as defined in a);
c) a polypeptide fusion construct comprising an amino acid sequence at least 90% identical to an amino acid sequence as defined in a);
d) a polypeptide fusion construct comprising an amino acid sequence at least 95% identical to an amino acid sequence as defined in a);
e) a polypeptide fusion construct comprising an amino acid sequence that is at least 70% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 14, SEQ ID NO: 16, SEQ
ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ
ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, and SEQ ID NO: 39;
said amino acid sequence being linked to a polypeptide having a high transduction potential.
10. The polypeptide of Claim 9, wherein said polypeptide fusion construct disrupts NEMO oligomerization.
11. The polypeptide of Claim 9, wherein said linked is by an amino acid spacer sequence having a length ranging from 1-35 amino acids.
12. The polypeptide of Claim 11, wherein said amino acid spacer sequence is selected from the group consisting of SEQ ID NO: 9 and SEQ ID NO:
10.
10.
13. The polypeptide of Claim 9, wherein said polypeptide having a high transduction potential has an amino acid sequence of SEQ ID NO: 1.
14. The polypeptide of Claim 13, wherein the polypeptide fusion construct has the amino acid sequence selected in the group consisting of SEQ
ID NO:
2, SEQ ID NO: 6, SEQ ID NO:13 and SEQ ID NO:15.
ID NO:
2, SEQ ID NO: 6, SEQ ID NO:13 and SEQ ID NO:15.
15. A method of inhibiting the NF-.kappa.B signaling pathway comprising contacting in vitro an eukaryotic cell with a polypeptide fusion construct of Claims 9 to 14.
16. A method of disrupting NEMO oligomerization comprising contacting in vitro said NEMO with a polypeptide fusion construct of Claims 9 to 14.
17. Use of an effective amount of a composition comprising a polypeptide fusion construct of Claims 9 to 14 and one or more pharmaceutically acceptable carriers or excipients, for the preparation of a medicament for modulating or treating a disorder regulated by the NF-.kappa.B signaling pathway in a subject in need thereof.
18. The use of Claim 17, wherein said subject in need thereof is a human.
19. The use of Claims 17 or 18, wherein said effective amount ranges from 0.1 mg/Kg/day to 30 mg/Kg/day.
20. The use of Claims 17 to 19, wherein said disorder regulated by the NF-.kappa.B signaling pathway is selected from the group consisting of inflammatory responses, oncogenesis, and viral infection.
21. The use of Claims 17 to 20, wherein said composition is administered in a form selected from the group consisting of oral, rectal, nasal, parenteral, intracisternal, intravaginal, intraperitoneal, sublingual, topical, and bucal administration.
22. The use of Claims 17 to 21, wherein said composition is administered preferably intravenously.
23. Use of an effective amount of a composition comprising a polypeptide fusion construct of Claims 9 to 14 and one or more pharmaceutically acceptable carriers or excipients, for the preparation of a medicament for regulating cell proliferation or apoptosis in a subject in need thereof.
24. The use of Claim 23, wherein said subject in need thereof is a human.
25. The use of Claim 23 or Claim 24, wherein said effective amount ranges from 0.1 mg/Kg/day to 30 mg/Kg/day.
26. The use of Claims 23 to 25, wherein said composition is administered in a form selected from the group consisting of oral, rectal, nasal, parenteral, intracisternal, intravaginal, intraperitoneal, sublingual, topical, and bucal administration.
27. The use of Claims 23 to 26, wherein said composition is administered preferably intravenously.
28. Use of an effective amount of a composition comprising a polypeptide fusion construct of Claims 9 to 14 and one or more pharmaceutically acceptable carriers or excipients, for the preparation of a medicament for regulating B
or T lymphocytes in antigenic stimulation in a subject in need thereof.
or T lymphocytes in antigenic stimulation in a subject in need thereof.
29. The use of Claim 28, wherein said subject in need thereof is a human.
30. The use of Claim 28 or Claim 29, wherein said effective amount ranges from 0.1 mg/Kg/day to 30 mg/Kg/day.
31. The use of Claims 28 to 30, wherein said composition is administered in a form selected from the group consisting of oral, rectal, nasal, parenteral, intracisternal, intravaginal, intraperitoneal, sublingual, topical, and bucal administration.
32. The use of Claims 28 to 31, wherein said composition is administered preferably intravenously.
33. A method of identifying polypeptides that modulate oligomerization of NEMO comprising:
a) identifying a candidate polypeptide sequence;
b) creating a polypeptide fusion construct by linking said candidate polypeptide sequence to a polypeptide having a high transduction potential via a spacer sequence;
c) contacting a cell culture with the polypeptide fusion construct;
and d) monitoring the activity of the NF-.kappa.B signaling pathway;
e) comparing the activity of the NF-.kappa.B signaling pathway in the presence of said polypeptide fusion construct to the activity of the NF-.kappa.B signaling pathway in the absence of said polypeptide fusion construct to determine the relative inhibition by said polypeptide fusion construct; and f) correlating relative inhibition by said polypeptide fusion construct to NEMO oligomerization.
a) identifying a candidate polypeptide sequence;
b) creating a polypeptide fusion construct by linking said candidate polypeptide sequence to a polypeptide having a high transduction potential via a spacer sequence;
c) contacting a cell culture with the polypeptide fusion construct;
and d) monitoring the activity of the NF-.kappa.B signaling pathway;
e) comparing the activity of the NF-.kappa.B signaling pathway in the presence of said polypeptide fusion construct to the activity of the NF-.kappa.B signaling pathway in the absence of said polypeptide fusion construct to determine the relative inhibition by said polypeptide fusion construct; and f) correlating relative inhibition by said polypeptide fusion construct to NEMO oligomerization.
34. The method of Claim 33, wherein said candidate polypeptide sequence has a coiled-coil or helical structure.
35. The method of Claim 33 or Claim 34, wherein said candidate polypeptide sequence has 20-60 amino acids.
36. The method of Claims 33 to 35, wherein said candidate polypeptide sequence is derived from NEMO.
37. The method of Claims 33 to 36, wherein said spacer sequence has a length ranging from 1-35 amino acids.
38. The method of Claim 37, wherein said spacer sequence is selected from the group consisting of SEQ ID NO: 9 and SEQ ID NO: 10.
39. The method of Claim 33, wherein said polypeptide having a high transduction potential has an amino acid sequence of SEQ ID NO: 1.
40. The method of Claim 33, wherein said cell culture comprises pre-B 70Z/3 lymphocytes that have been transfected with NF-.kappa.B dependent .kappa.-glactosidase reporter gene, deposited at the CNCM (Collection Nationale de Cultures de Microorganismes), 28 rue du Docteur Roux, 75724 PARIS Cedex 15, France, on April 1st, 2003 under number I-3004.
41. The method of Claim 33, wherein said polypeptide fusion construct further comprises an N-terminal cysteine residue.
42. The method of Claim 39, further comprising:
b-1) labeling said polypeptide fusion construct; and c-1) monitoring cellular uptake of the labeled polypeptide fusion construct.
b-1) labeling said polypeptide fusion construct; and c-1) monitoring cellular uptake of the labeled polypeptide fusion construct.
43. The method of Claim 42, wherein said labeling comprises chemically reacting the cysteine residue with a fluorophore.
44. The method of Claim 43, wherein said fluorophore is BODIPY.
45. The method of Claim 42, wherein said monitoring cellular uptake is by FACS.
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US50516103P | 2003-09-24 | 2003-09-24 | |
US60/505,161 | 2003-09-24 | ||
US53041803P | 2003-12-18 | 2003-12-18 | |
US60/530,418 | 2003-12-18 | ||
PCT/IB2004/003352 WO2005027959A1 (en) | 2003-09-24 | 2004-09-24 | Selective inhibition of nf-kappab activation by peptides designed to disrupt nemo oligomerization. |
Publications (2)
Publication Number | Publication Date |
---|---|
CA2540103A1 true CA2540103A1 (en) | 2005-03-31 |
CA2540103C CA2540103C (en) | 2017-11-07 |
Family
ID=34381127
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA2540103A Expired - Fee Related CA2540103C (en) | 2003-09-24 | 2004-09-24 | Selective inhibition of nf-kappab activation by peptides designed to disrupt nemo oligomerization |
Country Status (9)
Country | Link |
---|---|
US (3) | US7390872B2 (en) |
EP (1) | EP1677815B8 (en) |
JP (1) | JP5027508B2 (en) |
KR (1) | KR20060090714A (en) |
CN (1) | CN1886148B (en) |
AU (1) | AU2004273686B2 (en) |
BR (1) | BRPI0414714A (en) |
CA (1) | CA2540103C (en) |
WO (1) | WO2005027959A1 (en) |
Families Citing this family (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20030104622A1 (en) * | 1999-09-01 | 2003-06-05 | Robbins Paul D. | Identification of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, DNA and viruses |
AU2004273686B2 (en) * | 2003-09-24 | 2011-03-03 | Centre National De La Recherche Scientifique | Selective inhibition of NF-kappaB activation by peptides designed to disrupt NEMO oligomerization. |
US20060068032A1 (en) * | 2004-09-24 | 2006-03-30 | Sunny Biodiscovery, Inc. | Compositions and methods for treating angiogenesis-related diseases, wounds and cosmetic use of components of Angelica sinensis, and methods of preparation thereof |
WO2008148016A1 (en) * | 2007-05-25 | 2008-12-04 | University Of Pittsburgh- Of The Commonwealth System Of Higher Education | Inhibiting the signs of aging by inhibiting nf-kappa b activation |
EP2006686A1 (en) * | 2007-06-22 | 2008-12-24 | Institut Pasteur | Method for screening for selective modulator of the NF-kB pathway activation |
FR2927080A1 (en) * | 2008-02-05 | 2009-08-07 | Servier Lab | CRYSTALLINE STRUCTURE OF THE NEMO CC2-LZ DOMAIN |
CN103547592A (en) | 2011-03-30 | 2014-01-29 | 埃博灵克斯股份有限公司 | Methods of treating immune disorders with single domain antibodies against TNF-alpha |
US20130210875A1 (en) * | 2012-02-10 | 2013-08-15 | Macau University Of Science And Technology | Novel binding site of IKK-beta |
EP3184541A1 (en) | 2015-12-23 | 2017-06-28 | Institut Pasteur | Stapled peptide inhibitors of nemo as potential anti-inflammatory and anti-cancer drugs |
EP3522907A4 (en) * | 2016-10-04 | 2020-05-06 | University of Florida Research Foundation, Inc. | Targeted effector proteins and uses thereof |
US11407797B2 (en) | 2017-10-11 | 2022-08-09 | University Of Florida Research Foundation, Incorporated | Modified gal-1 proteins and uses thereof |
CN111606976A (en) * | 2020-05-26 | 2020-09-01 | 中国人民解放军军事科学院军事医学研究院 | Small peptide and application thereof in inhibiting opiate addiction and tolerance |
CN114539426B (en) * | 2022-03-02 | 2023-07-07 | 山东仙普爱瑞科技股份有限公司 | Fusion protein containing interferon alpha, recombinant strain expressing fusion protein and preparation method of recombinant strain |
Family Cites Families (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
IL126024A0 (en) * | 1998-03-19 | 1999-05-09 | Yeda Res & Dev | Modulators of the function of receptors of the tnf/ngf receptor family and other proteins |
AU754434B2 (en) | 1998-05-06 | 2002-11-14 | Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw | Novel inhibitors of NF-kappaB activation |
US6680366B1 (en) * | 1999-02-22 | 2004-01-20 | Institut Pasteur | Nucleotide sequence encoding a modulator of NF-κB |
EP1157126A4 (en) * | 1999-02-24 | 2005-03-02 | Gen Hospital Corp | Method for cloning signal transduction intermediates |
US6864355B1 (en) * | 2000-05-02 | 2005-03-08 | Yale University | Inhibition of NF-κB activation by blockade of IKKβ-NEMO interactions at the NEMO binding domain |
US20060040319A1 (en) * | 2000-01-14 | 2006-02-23 | Tom Muir | Multiple sensor-containing active modified polypeptides, preparation and uses thereof |
EP1351980B1 (en) * | 2001-01-18 | 2014-12-31 | The Board Of Trustees Of The Leland Stanford Junior University | Peptides for activation and inhibition of delta pkc |
US20030165985A1 (en) * | 2001-05-08 | 2003-09-04 | Derry Jonathan M.J. | Methods for identifying compounds that antagonize cd40 signaling |
JP4252446B2 (en) | 2001-06-22 | 2009-04-08 | フラームス・インテルウニフェルシタイル・インステイチュート・フォール・ビオテヒノロヒー・ヴェーゼットウェー(ヴェーイーベー・ヴェーゼットウェー) | Hepatitis protection mediated by ABIN |
AU2004273686B2 (en) | 2003-09-24 | 2011-03-03 | Centre National De La Recherche Scientifique | Selective inhibition of NF-kappaB activation by peptides designed to disrupt NEMO oligomerization. |
US7413863B2 (en) * | 2006-06-08 | 2008-08-19 | Institut Pasteur | Identification of substances that inhibit NEMO oligomerization |
-
2004
- 2004-09-24 AU AU2004273686A patent/AU2004273686B2/en not_active Ceased
- 2004-09-24 EP EP04769635.6A patent/EP1677815B8/en not_active Expired - Lifetime
- 2004-09-24 US US10/948,649 patent/US7390872B2/en not_active Expired - Fee Related
- 2004-09-24 CN CN2004800346979A patent/CN1886148B/en not_active Expired - Fee Related
- 2004-09-24 US US10/573,161 patent/US7700553B2/en not_active Expired - Fee Related
- 2004-09-24 JP JP2006527513A patent/JP5027508B2/en not_active Expired - Fee Related
- 2004-09-24 WO PCT/IB2004/003352 patent/WO2005027959A1/en active Application Filing
- 2004-09-24 BR BRPI0414714-6A patent/BRPI0414714A/en not_active Application Discontinuation
- 2004-09-24 CA CA2540103A patent/CA2540103C/en not_active Expired - Fee Related
- 2004-09-24 KR KR1020067007920A patent/KR20060090714A/en not_active Application Discontinuation
-
2008
- 2008-04-24 US US12/108,668 patent/US8790883B2/en not_active Expired - Fee Related
Also Published As
Publication number | Publication date |
---|---|
BRPI0414714A (en) | 2006-11-21 |
JP5027508B2 (en) | 2012-09-19 |
US20080207517A1 (en) | 2008-08-28 |
EP1677815B8 (en) | 2017-08-30 |
CN1886148A (en) | 2006-12-27 |
EP1677815A1 (en) | 2006-07-12 |
US20050220792A1 (en) | 2005-10-06 |
EP1677815B1 (en) | 2017-05-31 |
JP2007506422A (en) | 2007-03-22 |
KR20060090714A (en) | 2006-08-14 |
US7390872B2 (en) | 2008-06-24 |
AU2004273686B2 (en) | 2011-03-03 |
CA2540103C (en) | 2017-11-07 |
US8790883B2 (en) | 2014-07-29 |
CN1886148B (en) | 2013-01-02 |
US7700553B2 (en) | 2010-04-20 |
US20080242601A1 (en) | 2008-10-02 |
AU2004273686A1 (en) | 2005-03-31 |
WO2005027959A1 (en) | 2005-03-31 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8790883B2 (en) | Methods of identifying NF-κB inhibitors | |
Hagen et al. | Sp1‐mediated transcriptional activation is repressed by Sp3. | |
Agou et al. | Inhibition of NF-κB activation by peptides targeting NF-κB essential modulator (nemo) oligomerization | |
JP7312948B2 (en) | ATF5 peptide variants and their uses | |
Weichselbraun et al. | Definition of the human immunodeficiency virus type 1 Rev and human T-cell leukemia virus type I Rex protein activation domain by functional exchange | |
US5656595A (en) | Peptides having GDP exchange factor activity, nucleic acid sequences coding for these peptides, preparation and use | |
AU698819B2 (en) | GRB3-3 gene, its variants and their uses | |
JP4927546B2 (en) | Interactive polypeptides containing heptapeptide patterns and cell permeation domains | |
KR101131512B1 (en) | Pharmaceutical Compositions for Preventing or Treating a Neurodegenerative Disorder | |
CN103951756A (en) | Fusion protein of TAT and PR domain and application of fusion protein in preparation of antitumor drugs | |
CN110655583A (en) | Novel Bcl10 polymerization inhibitor and application thereof | |
Gilroy et al. | Inhibition of NF | |
WO2013028527A1 (en) | Compositions and methods for treating cancer | |
Agostini | Cellular Na+, K+-ATPase mediates unconventional export of Hiv-1 Tat protein |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
MKLA | Lapsed |
Effective date: 20190924 |