CA2485976A1 - Increased delivery of a nucleic acid construct in vivo by the poly-l-glutamate (plg) system - Google Patents
Increased delivery of a nucleic acid construct in vivo by the poly-l-glutamate (plg) system Download PDFInfo
- Publication number
- CA2485976A1 CA2485976A1 CA002485976A CA2485976A CA2485976A1 CA 2485976 A1 CA2485976 A1 CA 2485976A1 CA 002485976 A CA002485976 A CA 002485976A CA 2485976 A CA2485976 A CA 2485976A CA 2485976 A1 CA2485976 A1 CA 2485976A1
- Authority
- CA
- Canada
- Prior art keywords
- seqid
- nucleic acid
- acid expression
- expression construct
- polypeptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 150000007523 nucleic acids Chemical class 0.000 title claims description 181
- 108020004707 nucleic acids Proteins 0.000 title claims description 174
- 102000039446 nucleic acids Human genes 0.000 title claims description 174
- 229920002643 polyglutamic acid Polymers 0.000 title claims description 27
- 230000001965 increasing effect Effects 0.000 title abstract description 17
- 238000012384 transportation and delivery Methods 0.000 title description 20
- 238000001727 in vivo Methods 0.000 title description 10
- 230000014509 gene expression Effects 0.000 claims abstract description 152
- 210000004027 cell Anatomy 0.000 claims abstract description 55
- 210000001519 tissue Anatomy 0.000 claims abstract description 45
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 44
- 210000000663 muscle cell Anatomy 0.000 claims abstract description 6
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 150
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 148
- 229920001184 polypeptide Polymers 0.000 claims description 145
- 101710142969 Somatoliberin Proteins 0.000 claims description 99
- 102100022831 Somatoliberin Human genes 0.000 claims description 89
- 238000000034 method Methods 0.000 claims description 89
- 239000000203 mixture Substances 0.000 claims description 72
- 150000001413 amino acids Chemical group 0.000 claims description 61
- 229940024606 amino acid Drugs 0.000 claims description 50
- 235000001014 amino acid Nutrition 0.000 claims description 50
- 239000013604 expression vector Substances 0.000 claims description 38
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 21
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 21
- 235000004279 alanine Nutrition 0.000 claims description 21
- 230000000694 effects Effects 0.000 claims description 20
- 239000000095 Growth Hormone-Releasing Hormone Substances 0.000 claims description 18
- 239000002773 nucleotide Substances 0.000 claims description 15
- 125000003729 nucleotide group Chemical group 0.000 claims description 15
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 claims description 13
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 claims description 12
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 12
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 12
- 229960000310 isoleucine Drugs 0.000 claims description 12
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 claims description 12
- 210000003205 muscle Anatomy 0.000 claims description 12
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 claims description 11
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 claims description 11
- 235000009582 asparagine Nutrition 0.000 claims description 11
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 11
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 11
- 239000004474 valine Substances 0.000 claims description 11
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 claims description 10
- 239000004471 Glycine Substances 0.000 claims description 10
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 claims description 10
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims description 10
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 10
- 229960001230 asparagine Drugs 0.000 claims description 10
- 229930182817 methionine Natural products 0.000 claims description 10
- 238000006731 degradation reaction Methods 0.000 claims description 6
- 230000015556 catabolic process Effects 0.000 claims description 4
- 238000000338 in vitro Methods 0.000 claims description 4
- 238000002156 mixing Methods 0.000 claims description 4
- 239000000463 material Substances 0.000 claims description 3
- 210000004602 germ cell Anatomy 0.000 claims description 2
- 210000001082 somatic cell Anatomy 0.000 claims description 2
- 210000000130 stem cell Anatomy 0.000 claims description 2
- 239000013612 plasmid Substances 0.000 abstract description 93
- 108020004414 DNA Proteins 0.000 abstract description 74
- 238000004520 electroporation Methods 0.000 abstract description 68
- 238000002347 injection Methods 0.000 abstract description 35
- 239000007924 injection Substances 0.000 abstract description 35
- 241001465754 Metazoa Species 0.000 abstract description 17
- 210000002027 skeletal muscle Anatomy 0.000 abstract description 12
- 108700019146 Transgenes Proteins 0.000 abstract description 7
- 150000001875 compounds Chemical class 0.000 abstract description 6
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical class OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 abstract description 5
- 230000006378 damage Effects 0.000 abstract description 4
- 108091061960 Naked DNA Proteins 0.000 abstract description 3
- 230000002035 prolonged effect Effects 0.000 abstract description 3
- 230000006641 stabilisation Effects 0.000 abstract description 3
- 238000011105 stabilization Methods 0.000 abstract description 3
- 231100000331 toxic Toxicity 0.000 abstract description 3
- 230000002588 toxic effect Effects 0.000 abstract description 3
- 238000003860 storage Methods 0.000 abstract description 2
- 238000001890 transfection Methods 0.000 description 26
- 239000013598 vector Substances 0.000 description 19
- 241000699670 Mus sp. Species 0.000 description 13
- 102000004169 proteins and genes Human genes 0.000 description 12
- 241000282472 Canis lupus familiaris Species 0.000 description 11
- 235000018102 proteins Nutrition 0.000 description 11
- 230000001225 therapeutic effect Effects 0.000 description 11
- 102000038461 Growth Hormone-Releasing Hormone Human genes 0.000 description 10
- 108091028043 Nucleic acid sequence Proteins 0.000 description 10
- 241000282887 Suidae Species 0.000 description 10
- 210000002966 serum Anatomy 0.000 description 10
- 230000005684 electric field Effects 0.000 description 9
- 238000002474 experimental method Methods 0.000 description 9
- 230000009469 supplementation Effects 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 7
- 238000012546 transfer Methods 0.000 description 7
- QCTFKEJEIMPOLW-JURCDPSOSA-N Ala-Ile-Phe Chemical compound C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 QCTFKEJEIMPOLW-JURCDPSOSA-N 0.000 description 6
- 108020004705 Codon Proteins 0.000 description 6
- 102000018997 Growth Hormone Human genes 0.000 description 6
- 108010051696 Growth Hormone Proteins 0.000 description 6
- OJRNZRROAIAHDL-LKXGYXEUSA-N Thr-Asn-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O OJRNZRROAIAHDL-LKXGYXEUSA-N 0.000 description 6
- GFZQWWDXJVGEMW-ULQDDVLXSA-N Tyr-Arg-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)O)N)O GFZQWWDXJVGEMW-ULQDDVLXSA-N 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 239000000122 growth hormone Substances 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 241000894007 species Species 0.000 description 6
- KBBKCNHWCDJPGN-GUBZILKMSA-N Arg-Gln-Gln Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O KBBKCNHWCDJPGN-GUBZILKMSA-N 0.000 description 5
- NNMUHYLAYUSTTN-FXQIFTODSA-N Asn-Gln-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O NNMUHYLAYUSTTN-FXQIFTODSA-N 0.000 description 5
- VSXBYIJUAXPAAL-WDSKDSINSA-N Gln-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](N)CCC(N)=O VSXBYIJUAXPAAL-WDSKDSINSA-N 0.000 description 5
- DHDOADIPGZTAHT-YUMQZZPRSA-N Gly-Glu-Arg Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N DHDOADIPGZTAHT-YUMQZZPRSA-N 0.000 description 5
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 5
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 108010078144 glutaminyl-glycine Proteins 0.000 description 5
- 238000010438 heat treatment Methods 0.000 description 5
- 239000005556 hormone Substances 0.000 description 5
- 229940088597 hormone Drugs 0.000 description 5
- 229920002521 macromolecule Polymers 0.000 description 5
- 239000013600 plasmid vector Substances 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 238000013518 transcription Methods 0.000 description 5
- 230000035897 transcription Effects 0.000 description 5
- CLICCYPMVFGUOF-IHRRRGAJSA-N Arg-Lys-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O CLICCYPMVFGUOF-IHRRRGAJSA-N 0.000 description 4
- TWYOYAKMLHWMOJ-ZPFDUUQYSA-N Ile-Leu-Asn Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O TWYOYAKMLHWMOJ-ZPFDUUQYSA-N 0.000 description 4
- MJOZZTKJZQFKDK-GUBZILKMSA-N Leu-Ala-Gln Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(N)=O MJOZZTKJZQFKDK-GUBZILKMSA-N 0.000 description 4
- ZYLJULGXQDNXDK-GUBZILKMSA-N Leu-Gln-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O ZYLJULGXQDNXDK-GUBZILKMSA-N 0.000 description 4
- IRMLZWSRWSGTOP-CIUDSAMLSA-N Leu-Ser-Ala Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O IRMLZWSRWSGTOP-CIUDSAMLSA-N 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000030833 cell death Effects 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 239000011148 porous material Substances 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 238000007920 subcutaneous administration Methods 0.000 description 4
- 238000011282 treatment Methods 0.000 description 4
- 239000013603 viral vector Substances 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- 108020005345 3' Untranslated Regions Proteins 0.000 description 3
- LWUWMHIOBPTZBA-DCAQKATOSA-N Ala-Arg-Lys Chemical compound NC(=N)NCCC[C@H](NC(=O)[C@@H](N)C)C(=O)N[C@@H](CCCCN)C(O)=O LWUWMHIOBPTZBA-DCAQKATOSA-N 0.000 description 3
- 208000017667 Chronic Disease Diseases 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- YPMDZWPZFOZYFG-GUBZILKMSA-N Gln-Leu-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YPMDZWPZFOZYFG-GUBZILKMSA-N 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- JNDYEOUZBLOVOF-AVGNSLFASA-N Leu-Leu-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O JNDYEOUZBLOVOF-AVGNSLFASA-N 0.000 description 3
- 206010028980 Neoplasm Diseases 0.000 description 3
- BURPTJBFWIOHEY-UWJYBYFXSA-N Tyr-Ala-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 BURPTJBFWIOHEY-UWJYBYFXSA-N 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 230000001276 controlling effect Effects 0.000 description 3
- 230000001186 cumulative effect Effects 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 230000005611 electricity Effects 0.000 description 3
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 3
- 239000013613 expression plasmid Substances 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 239000008194 pharmaceutical composition Substances 0.000 description 3
- 229960005486 vaccine Drugs 0.000 description 3
- 241000251468 Actinopterygii Species 0.000 description 2
- CPSHGRGUPZBMOK-CIUDSAMLSA-N Arg-Asn-Gln Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O CPSHGRGUPZBMOK-CIUDSAMLSA-N 0.000 description 2
- LDLZOAJRXXBVGF-GMOBBJLQSA-N Asp-Ile-Met Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CC(=O)O)N LDLZOAJRXXBVGF-GMOBBJLQSA-N 0.000 description 2
- 108010006654 Bleomycin Proteins 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 241000287828 Gallus gallus Species 0.000 description 2
- MFJAPSYJQJCQDN-BQBZGAKWSA-N Gln-Gly-Glu Chemical compound NC(=O)CC[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O MFJAPSYJQJCQDN-BQBZGAKWSA-N 0.000 description 2
- PXHABOCPJVTGEK-BQBZGAKWSA-N Glu-Gln-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O PXHABOCPJVTGEK-BQBZGAKWSA-N 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 102000002265 Human Growth Hormone Human genes 0.000 description 2
- 108010000521 Human Growth Hormone Proteins 0.000 description 2
- 239000000854 Human Growth Hormone Substances 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 102000018697 Membrane Proteins Human genes 0.000 description 2
- 101000574441 Mus musculus Alkaline phosphatase, germ cell type Proteins 0.000 description 2
- 108091092724 Noncoding DNA Proteins 0.000 description 2
- 241000283903 Ovis aries Species 0.000 description 2
- 102100034784 Protein TANC2 Human genes 0.000 description 2
- QWZIOCFPXMAXET-CIUDSAMLSA-N Ser-Arg-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(O)=O QWZIOCFPXMAXET-CIUDSAMLSA-N 0.000 description 2
- 241000364021 Tulsa Species 0.000 description 2
- UMPVMAYCLYMYGA-ONGXEEELSA-N Val-Leu-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O UMPVMAYCLYMYGA-ONGXEEELSA-N 0.000 description 2
- 206010052428 Wound Diseases 0.000 description 2
- 208000027418 Wounds and injury Diseases 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 238000000540 analysis of variance Methods 0.000 description 2
- 208000007502 anemia Diseases 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 229960001561 bleomycin Drugs 0.000 description 2
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 230000001955 cumulated effect Effects 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 210000002745 epiphysis Anatomy 0.000 description 2
- 210000003722 extracellular fluid Anatomy 0.000 description 2
- 230000004907 flux Effects 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 238000001476 gene delivery Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 229960002989 glutamic acid Drugs 0.000 description 2
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 208000026278 immune system disease Diseases 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 239000012188 paraffin wax Substances 0.000 description 2
- OXNIZHLAWKMVMX-UHFFFAOYSA-N picric acid Chemical compound OC1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1[N+]([O-])=O OXNIZHLAWKMVMX-UHFFFAOYSA-N 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 230000004850 protein–protein interaction Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 230000000392 somatic effect Effects 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 230000001052 transient effect Effects 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 108020003589 5' Untranslated Regions Proteins 0.000 description 1
- 206010000599 Acromegaly Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- XBQSLMACWDXWLJ-GHCJXIJMSA-N Asp-Ala-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O XBQSLMACWDXWLJ-GHCJXIJMSA-N 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- KDDKJKKQODQQBR-NHCYSSNCSA-N His-Val-Asp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CC1=CN=CN1)N KDDKJKKQODQQBR-NHCYSSNCSA-N 0.000 description 1
- 101000825742 Homo sapiens Somatoliberin Proteins 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- DRRXXZBXDMLGFC-IHRRRGAJSA-N Lys-Val-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN DRRXXZBXDMLGFC-IHRRRGAJSA-N 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 208000029549 Muscle injury Diseases 0.000 description 1
- 206010067482 No adverse event Diseases 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- CBENFWSGALASAD-UHFFFAOYSA-N Ozone Chemical compound [O-][O+]=O CBENFWSGALASAD-UHFFFAOYSA-N 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- JHSRGEODDALISP-XVSYOHENSA-N Phe-Thr-Asn Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O JHSRGEODDALISP-XVSYOHENSA-N 0.000 description 1
- 102000006877 Pituitary Hormones Human genes 0.000 description 1
- 108010047386 Pituitary Hormones Proteins 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 102100024819 Prolactin Human genes 0.000 description 1
- 108010057464 Prolactin Proteins 0.000 description 1
- 108010002519 Prolactin Receptors Proteins 0.000 description 1
- 102100029000 Prolactin receptor Human genes 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- FGBLCMLXHRPVOF-IHRRRGAJSA-N Ser-Tyr-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FGBLCMLXHRPVOF-IHRRRGAJSA-N 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102000044209 Tumor Suppressor Genes Human genes 0.000 description 1
- 108700025716 Tumor Suppressor Genes Proteins 0.000 description 1
- KIJLSRYAUGGZIN-CFMVVWHZSA-N Tyr-Ile-Asp Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O KIJLSRYAUGGZIN-CFMVVWHZSA-N 0.000 description 1
- SQUMHUZLJDUROQ-YDHLFZDLSA-N Tyr-Val-Asp Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O SQUMHUZLJDUROQ-YDHLFZDLSA-N 0.000 description 1
- 108091023045 Untranslated Region Proteins 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- -1 analogs Substances 0.000 description 1
- 230000001147 anti-toxic effect Effects 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 108010062796 arginyllysine Proteins 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 150000001508 asparagines Chemical class 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- GINJFDRNADDBIN-FXQIFTODSA-N bilanafos Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCP(C)(O)=O GINJFDRNADDBIN-FXQIFTODSA-N 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000005779 cell damage Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000006800 cellular catabolic process Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 239000004020 conductor Substances 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 230000001066 destructive effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 238000009791 electrochemical migration reaction Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000001667 episodic effect Effects 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 210000001723 extracellular space Anatomy 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000012637 gene transfection Methods 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 239000003292 glue Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 102000045304 human GHRH Human genes 0.000 description 1
- 239000000960 hypophysis hormone Substances 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 230000004941 influx Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000010189 intracellular transport Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- 150000002605 large molecules Chemical class 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 231100000053 low toxicity Toxicity 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 230000004660 morphological change Effects 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000001114 myogenic effect Effects 0.000 description 1
- 210000001087 myotubule Anatomy 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 231100000957 no side effect Toxicity 0.000 description 1
- 239000012811 non-conductive material Substances 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 238000013021 overheating Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000000149 penetrating effect Effects 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 230000008823 permeabilization Effects 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 230000001817 pituitary effect Effects 0.000 description 1
- 239000004584 polyacrylic acid Substances 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 229940097325 prolactin Drugs 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 230000001172 regenerating effect Effects 0.000 description 1
- 238000009256 replacement therapy Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000284 resting effect Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 210000002363 skeletal muscle cell Anatomy 0.000 description 1
- 159000000000 sodium salts Chemical class 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000012385 systemic delivery Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 231100000057 systemic toxicity Toxicity 0.000 description 1
- 230000017423 tissue regeneration Effects 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 238000009827 uniform distribution Methods 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 230000003313 weakening effect Effects 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 230000037314 wound repair Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
Plasmid DNA delivered by injection / electroporation to the skeletal muscle can be expressed, and physiologic levels of transgene could be achieved into the circulation. Nevertheless, stabilization of naked DNA may be required an d necessary in some cases, as prolonged storage at different temperatures befo re usage, injection into a large number of animals, etc. It is imperative that the associated compound should not be toxic to the cells (e.g. muscle cells) or cause breakage of plasmid DNA. It would be preferable for the coated DNA to have a similar or increased uptake into the target cells. Low molecular weig ht poly~L-glutamate compounds have all the desired properties. It was determine d that mole/mole ratio DNA/PLG is the optimum concentration for gene therapeut ic applications to the skeletal muscle, resulting in increased expression of th e transgene, with no damage to the target tissue. Furthermore, stabilization o f plasmid DNA by PLG has never been observed or described in the literature.</ SDOAB>
Description
INCREASED DELIVERY OF A NUCLEIC ACID CONSTRUCT IN YIVO BY THE
POLY-L-GLUTAMATE ("PLG") SYSTEM
RELATED APPLICATIONS
[0001] This application is a continuation-in-part of the U.S. patent application, Serial Number 10/156,670 entitled "PLASMID MEDIATED GENE SUPPLEMENTATION
AND IN VIVO EXPRESSION OF THE POLY-L-GLUTAMATE ("PLG") SYSTEM," and filed on 5/25/2002 with Draghia-Akli et al., listed as inventors, the entirety of the application which is hereby specifically incorporated by reference.
BACKGROUND
POLY-L-GLUTAMATE ("PLG") SYSTEM
RELATED APPLICATIONS
[0001] This application is a continuation-in-part of the U.S. patent application, Serial Number 10/156,670 entitled "PLASMID MEDIATED GENE SUPPLEMENTATION
AND IN VIVO EXPRESSION OF THE POLY-L-GLUTAMATE ("PLG") SYSTEM," and filed on 5/25/2002 with Draghia-Akli et al., listed as inventors, the entirety of the application which is hereby specifically incorporated by reference.
BACKGROUND
[0002] The delivery of isolated or recombinant proteins has been used for many years to correct an array of inborn or acquired deficiencies and imbalances in subjects (e.g.
insulin for diabetes). More recently, a nucleic acid expression construct having a specific encoded gene (i.e. a plasmid) was delivered to a somatic tissue and had been shown to be useful for the correction of genetic deficiencies. Although both methods of protein supplementation work well, there are a number of advantages to the nucleic acid expression construct supplementation method when compared to the administration of recombinant proteins, for example: the conservation of native protein structure; improved biological activity; avoidance of systemic toxicities; and avoidance of infectious and toxic impurities.
Additionally, the plasmid mediated gene supplementation method allows the subj ect to have prolonged exposure to a therapeutic range of the therapeutic protein, as demonstrated by the persistent levels of the therapeutic protein found in the subjects circulation system.
insulin for diabetes). More recently, a nucleic acid expression construct having a specific encoded gene (i.e. a plasmid) was delivered to a somatic tissue and had been shown to be useful for the correction of genetic deficiencies. Although both methods of protein supplementation work well, there are a number of advantages to the nucleic acid expression construct supplementation method when compared to the administration of recombinant proteins, for example: the conservation of native protein structure; improved biological activity; avoidance of systemic toxicities; and avoidance of infectious and toxic impurities.
Additionally, the plasmid mediated gene supplementation method allows the subj ect to have prolonged exposure to a therapeutic range of the therapeutic protein, as demonstrated by the persistent levels of the therapeutic protein found in the subjects circulation system.
[0003] The primary limitation of using recombinant protein is the restricted bio availability of the recombinant protein after each administration. In contrast, bio-availability of plasmid mediated gene supplementation is not an issue because a single plasmid inj ection into the subject's skeletal muscle permits physiologic expression for extensive periods of time, as disclosed in WO 99/05300 and WO 01/06988. Plasmid DNA constructs are attractive candidate for direct supplementation therapy into the subjects skeletal muscle because plasmid DNA's are well-defined entities, that are biochemically stable and have been used successfully for many years. The relatively low expression levels, achieved after simple plasmid DNA injection are sometimes sufficient to prove bio-activity of secreted peptides (Tsurumi et al.,1996). Although not wanting to be bound by theory, injections of the plasmid constructs can promote the production of enzymes and hormones in subj ects in a manner that more closely mimics the natural process. Furthermore, among the non-viral techniques for gene product supplementation in vivo, the direct injection of plasmid DNA into muscle tissue is simple, inexpensive, and safe.
[0004] In contrast to viral vectors, a plasmid based expression system can be composed of a synthetic gene delivery system in addition to the nucleic acid encoding a therapeutic gene products. In this way many of the risks associated with viral vectors can be avoided. The plasmid (i.e. a non-viral expression system) products generally have low toxicity due to the use of "species-specific" components for gene delivery, which minimizes the risks of immunogenicity generally associated with viral vectors. To date there have been no reported cases of plasmid vectors becoming integrated into a host chromosomes (Ledwith et al., 2000), which minimizes the risk of adverse effects such as the activation of oncogenes, or the inactivation of tumor suppressor genes during treatment. As episomal systems residing outside the chromosomes, plasmids have defined pharmacokinetics and elimination profiles, leading to a finite duration of gene expression in target tissues (Hook et al., 2001; Mahato et al., 1997).
[0005] Unfortunately, most applications for plasmid mediated gene supplementation have suffered from low levels of transgene expression that have resulted from the inefficient uptake of plasmid DNA into the treated tissue cells (Wells et al., 1997).
Consequently, the use of plasmid DNA directly injected into a subject for therapy has been limited in the past. For example, the inefficient DNA uptake into muscle fibers after simple direct injection had led to relatively low expression levels, in normal, non-regenerating (Vitadello et al.,1994) or ischemic muscles (Takeshita et al.,1996).
Additionally, the duration of the transgene expression has been short (Hartikka et al., 1996) (Danko and Wolff, 1994).
Until recently, the most successful previous clinical applications have been confined to vaccines (Davis et al., 1994; Davis et al., 1993).
Consequently, the use of plasmid DNA directly injected into a subject for therapy has been limited in the past. For example, the inefficient DNA uptake into muscle fibers after simple direct injection had led to relatively low expression levels, in normal, non-regenerating (Vitadello et al.,1994) or ischemic muscles (Takeshita et al.,1996).
Additionally, the duration of the transgene expression has been short (Hartikka et al., 1996) (Danko and Wolff, 1994).
Until recently, the most successful previous clinical applications have been confined to vaccines (Davis et al., 1994; Davis et al., 1993).
[0006] Thus, extensive efforts have been made to over the past two decades to enhance the delivery of plasmid DNA to cells by both chemical and physical means (Danko et al., 1994). For example, chemical means such as lipofectin/liposome fusion;
polylysine condensation with and without adenovirus enhancement have been used with marginal success (Fisher and Wilson,1994). The use of specific compositions consisting of polyacrylic acid has been disclosed in the International patent publication WO 94/24983.
Naked DNA has been administered as disclosed in International patent publication WO/11092.
Additionally, physical means of plasmid delivery including electroporation, sonoporation, and pressure.
Although each of these methods has had limited success, of all the methods listed, electroporation has been the most promising.
polylysine condensation with and without adenovirus enhancement have been used with marginal success (Fisher and Wilson,1994). The use of specific compositions consisting of polyacrylic acid has been disclosed in the International patent publication WO 94/24983.
Naked DNA has been administered as disclosed in International patent publication WO/11092.
Additionally, physical means of plasmid delivery including electroporation, sonoporation, and pressure.
Although each of these methods has had limited success, of all the methods listed, electroporation has been the most promising.
[0007] Although not wanting to be bound by theory, the delivery ofplasmid DNA
into a cell by electroporation involves the application of a pulsed voltage electric field to create transient pores in the cellular membrane that allows for the influx of exogenous plasmid DNA molecules (Smith and Nordstrom, 2000). By adjusting the electrical pulse generated by an electroporetic system, the efficiency of nucleic acid molecules that travel through passageways or pores can be regulated. U.S. Patent 5,704,908 describes an electroporation apparatus for delivering molecules to cells at a selected location within a cavity in the body of a patient. These pulse voltage injection devices are also described in U.S. PatentNos. 5,439,440 and 5,702,304, and PCT WO 96/12520, 96/12006, 95/19805, and 97/07826.
into a cell by electroporation involves the application of a pulsed voltage electric field to create transient pores in the cellular membrane that allows for the influx of exogenous plasmid DNA molecules (Smith and Nordstrom, 2000). By adjusting the electrical pulse generated by an electroporetic system, the efficiency of nucleic acid molecules that travel through passageways or pores can be regulated. U.S. Patent 5,704,908 describes an electroporation apparatus for delivering molecules to cells at a selected location within a cavity in the body of a patient. These pulse voltage injection devices are also described in U.S. PatentNos. 5,439,440 and 5,702,304, and PCT WO 96/12520, 96/12006, 95/19805, and 97/07826.
[0008] The electroporation technique has been used previously to transfect tumor cells after injection of plasmid DNA (Nishi et al., 1997; Rols et al., 1998), or to deliver the antitumoral drug bleomycin to cutaneous and subcutaneous tumors (Belehradek et al., 1994;
Heller et al., 1996). Electroporation also has been used in rodents and other small animals, e.g. (Muramatsu et al., 1998; Aihara and Miyazaki, 1998; Hasegawa et al., 1998; Rizzuto et al., 1999). Advanced techniques of intramuscular injections of plasmid DNA
followed by electroporation into skeletal muscle have been shown to lead to high levels of circulating growth hormone releasing hormone ("GHRH") (Draghia-Akli et al., 1999) (Draghia-Akli et al., 2002b). The in vivo electroporation of the skeletal muscle allows the plasmid DNA to be efficiently taken up in normal fibers, and consequently expressed.
Electroporation is the use of an electric field to induce transient permeabilization of bio-membrane pores, and allows macromolecules, ions, and water to pass from one side of the membrane to the other. Thus, electroporation has been used to introduce drugs, DNA or other molecules into mufti-cellular tissues. The technique has been used in vivo initially to transfect tumor cells after injection of plasmid DNA (Rols et al., 1998), or to deliver the antitumoral drug bleomycin to cutaneous and subcutaneous tumors (Allegretti and Panje, 2001; Heller et al.,1996).
Recently, numerous studies, mostly on small mammals, showed that the technique increases dramatically plasmid uptake by skeletal muscle cells, and allows production of peptides at therapeutic levels (Yasui et al., 2001; Yin and Tang, 2001). Previously, we reported that human growth hormone releasing hormone ("GHRH") cDNA can be delivered into skeletal muscle by an injectable myogenic expression vector in mice and pigs, where it stimulated growth hormone ("GH") secretion over a period of at least two months (Draghia-Akli et al., 1997;
Draghia-Akli et al., 1999).
Heller et al., 1996). Electroporation also has been used in rodents and other small animals, e.g. (Muramatsu et al., 1998; Aihara and Miyazaki, 1998; Hasegawa et al., 1998; Rizzuto et al., 1999). Advanced techniques of intramuscular injections of plasmid DNA
followed by electroporation into skeletal muscle have been shown to lead to high levels of circulating growth hormone releasing hormone ("GHRH") (Draghia-Akli et al., 1999) (Draghia-Akli et al., 2002b). The in vivo electroporation of the skeletal muscle allows the plasmid DNA to be efficiently taken up in normal fibers, and consequently expressed.
Electroporation is the use of an electric field to induce transient permeabilization of bio-membrane pores, and allows macromolecules, ions, and water to pass from one side of the membrane to the other. Thus, electroporation has been used to introduce drugs, DNA or other molecules into mufti-cellular tissues. The technique has been used in vivo initially to transfect tumor cells after injection of plasmid DNA (Rols et al., 1998), or to deliver the antitumoral drug bleomycin to cutaneous and subcutaneous tumors (Allegretti and Panje, 2001; Heller et al.,1996).
Recently, numerous studies, mostly on small mammals, showed that the technique increases dramatically plasmid uptake by skeletal muscle cells, and allows production of peptides at therapeutic levels (Yasui et al., 2001; Yin and Tang, 2001). Previously, we reported that human growth hormone releasing hormone ("GHRH") cDNA can be delivered into skeletal muscle by an injectable myogenic expression vector in mice and pigs, where it stimulated growth hormone ("GH") secretion over a period of at least two months (Draghia-Akli et al., 1997;
Draghia-Akli et al., 1999).
[0009] Despite the recent advances in the technology of plasmid DNA transfer, additional improvements in electroporation techniques and plasmid DNA
compositions are needed. For example, in theory, the entire electroporation procedure can be completed without causing permanent damage to the cell. However, in practice, the electroporation procedure impinges a fatal stress on most cells and leads to degradation of the plasmid DNA
(Hartikka et al., 2001). Furthermore, until now, plasmids have been preserved at low temperature prior to usage due to decreased stability and degradation (Evans et al., 2000).
compositions are needed. For example, in theory, the entire electroporation procedure can be completed without causing permanent damage to the cell. However, in practice, the electroporation procedure impinges a fatal stress on most cells and leads to degradation of the plasmid DNA
(Hartikka et al., 2001). Furthermore, until now, plasmids have been preserved at low temperature prior to usage due to decreased stability and degradation (Evans et al., 2000).
[0010] We have now optimized a constant current electroporation delivery technique and a plasmid DNA composition that prevents excessive cellular damage and degradation of the plasmid DNA during the electroporation delivery into muscle cells. For example, during the electroporation process, a transfection facilitation polypeptide (e.g. poly-L-glutamate ("PLG")) enhances the uptake process. Although not wanting to be bound by theory, several mechanisms for increased uptake may be utilized. For example, the transfection facilitating polypeptide may bind to surface of proteins and facilitate the uptake by increasing the bio-availability, neutralizing the normal degradation process in the interstitial fluid (i.e. protecting the DNA from the nucleases present in the interstitial fluid).
In the cells, a transfection facilitating polypeptide may prevent transport of DNA into the lysosomes (i.e. organelles where foreign DNA and / or proteins are degraded in the cells) by disruption of microtubule assembly (Fujii et al.,1986). Although not wanting to be bound by theory, transfection facilitating polypeptides (e.g. PLG groups) naturally occur as attachments to side chains in proteins. Accordingly transfection facilitating polypeptides have been used to increase stability of anti-cancer drugs (Li et al., 2000), and as "glue" to close wounds or to prevent bleeding from tissues during wound and tissue repair (Otani et al.,1998; Otani et al., 1996). Some transfection facilitating polypeptides (e.g. PLG) do not enhance an immune response or the production of antibodies. It should be emphasized that some evidence suggests that certain transfection facilitating polypeptides may only effective in conjunction with the method of electroporation. Furthermore, PLG has been demonstrated to decrease muscle damage associated to plasmid delivery (Draghia-Akli et al., 2002a).
In the cells, a transfection facilitating polypeptide may prevent transport of DNA into the lysosomes (i.e. organelles where foreign DNA and / or proteins are degraded in the cells) by disruption of microtubule assembly (Fujii et al.,1986). Although not wanting to be bound by theory, transfection facilitating polypeptides (e.g. PLG groups) naturally occur as attachments to side chains in proteins. Accordingly transfection facilitating polypeptides have been used to increase stability of anti-cancer drugs (Li et al., 2000), and as "glue" to close wounds or to prevent bleeding from tissues during wound and tissue repair (Otani et al.,1998; Otani et al., 1996). Some transfection facilitating polypeptides (e.g. PLG) do not enhance an immune response or the production of antibodies. It should be emphasized that some evidence suggests that certain transfection facilitating polypeptides may only effective in conjunction with the method of electroporation. Furthermore, PLG has been demonstrated to decrease muscle damage associated to plasmid delivery (Draghia-Akli et al., 2002a).
[0011] This efficient strategy of utilizing transfection facilitation polypeptides and electroporation for enhancing the electrophoretic delivery of a plasmid DNA
construct has been described herein and demonstrated in the skeletal muscle of three different mammalian species. Plasmid stability at high temperatures has been demonstrated.
SUMMARY
construct has been described herein and demonstrated in the skeletal muscle of three different mammalian species. Plasmid stability at high temperatures has been demonstrated.
SUMMARY
[0012] One aspect of the current invention is a composition for facilitating the electrophoretic transfer of a nucleic acid expression construct into the cells of a recipient, wherein the nucleic acid expression construct can express an encoded gene in the recipient.
The composition of the invention comprises a nucleic acid expression construct that is associated with a charged transfection-facilitating polypeptide. The composition is prepared wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct. In a preferred embodiment, the ratio in moles is equal to 1 mole of the nucleic acid expression construct to 1,200 moles or less of the charged transfection-facilitating polypeptide, and in another preferred embodiment, the ratio in moles is equal to 1 mole of the nucleic acid expression construct to 1 mole of the charged transfection-facilitating polypeptide. In a preferred embodiment the transfection-facilitating polypeptide comprises a charged polypeptide (e.g.
poly-L-glutamate). Furthermore, the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21.
Additionally, the nucleic acid expression construct encodes a growth-hormone-releasing-hormone ("GHRH") or functional biological equivalent thereof, as embodied in HV-GHRH
(SEQID# 1), TI-GHRH (SEQID# 2), TV-GHRH (SEQID# 3),15127/28-GHRH (SEQ117# 4), wt-GHRH (SEQID#5).
The composition of the invention comprises a nucleic acid expression construct that is associated with a charged transfection-facilitating polypeptide. The composition is prepared wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct. In a preferred embodiment, the ratio in moles is equal to 1 mole of the nucleic acid expression construct to 1,200 moles or less of the charged transfection-facilitating polypeptide, and in another preferred embodiment, the ratio in moles is equal to 1 mole of the nucleic acid expression construct to 1 mole of the charged transfection-facilitating polypeptide. In a preferred embodiment the transfection-facilitating polypeptide comprises a charged polypeptide (e.g.
poly-L-glutamate). Furthermore, the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21.
Additionally, the nucleic acid expression construct encodes a growth-hormone-releasing-hormone ("GHRH") or functional biological equivalent thereof, as embodied in HV-GHRH
(SEQID# 1), TI-GHRH (SEQID# 2), TV-GHRH (SEQID# 3),15127/28-GHRH (SEQ117# 4), wt-GHRH (SEQID#5).
[0013] A second aspect of the current invention is a method for introducing a nucleic acid expression construct into a cell of a selected tissue in a recipient. The method comprises penetrating the selected tissue with a plurality of needle electrodes, wherein the plurality of needle electrodes are arranged in a spaced relationship, introducing a composition comprising nucleic acid expression construct having an associated charged transfection-facilitation polypeptide, and applying an electrical pulse to the plurality of needle electrodes.
However, caliper electrodes can also be used an alternative to needle electrodes. The composition is prepared wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles ofthe charged transfection-facilitating polypeptide per mole of nucleic acid expression construct. In a preferred embodiment, the ratio in moles is equal to 1 mole of the nucleic acid expression construct to 1,200 moles or less of the charged transfection-facilitating polypeptide, and in another preferred embodiment, the ratio in moles is equal to 1 mole of the nucleic acid expression construct to 1 mole of the charged transfection-facilitating polypeptide. In a preferred embodiment the transfection-facilitating polypeptide comprises a charged polypeptide (e.g. poly-L-glutamate). Furthermore, the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21. Additionally, the nucleic acid expression construct encodes a growth-hormone-releasing-hormone ("GHRH") or functional biological equivalent thereof, as embodied in HV-GHRH (SEQID# 1), TI-GHRH (SEQID# 2), TV-GHRH (SEQID# 3), 15/27/28-GHRH (SEQID# 4), wt-GHRH (SEQID#5).
However, caliper electrodes can also be used an alternative to needle electrodes. The composition is prepared wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles ofthe charged transfection-facilitating polypeptide per mole of nucleic acid expression construct. In a preferred embodiment, the ratio in moles is equal to 1 mole of the nucleic acid expression construct to 1,200 moles or less of the charged transfection-facilitating polypeptide, and in another preferred embodiment, the ratio in moles is equal to 1 mole of the nucleic acid expression construct to 1 mole of the charged transfection-facilitating polypeptide. In a preferred embodiment the transfection-facilitating polypeptide comprises a charged polypeptide (e.g. poly-L-glutamate). Furthermore, the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21. Additionally, the nucleic acid expression construct encodes a growth-hormone-releasing-hormone ("GHRH") or functional biological equivalent thereof, as embodied in HV-GHRH (SEQID# 1), TI-GHRH (SEQID# 2), TV-GHRH (SEQID# 3), 15/27/28-GHRH (SEQID# 4), wt-GHRH (SEQID#5).
[0014] A third aspect of the current invention is a method to increase stability of a nucleic acid expression construct, comprising: mixing the nucleic acid expression construct with a charged transfection-facilitating polypeptide, wherein charged transfection-facilitating polypeptide comprises a poly-L-glutamate polypeptide and the nucleic acid expression construct is utilized for plasmid mediated gene supplementation. The method involves making a composition that is prepared wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct. In a preferred embodiment, the ratio in moles is equal to 1 mole of the nucleic acid expression construct to 1,200 moles or less of the charged transfection-facilitating polypeptide, and in another preferred embodiment, the ratio in moles is equal to 1 mole of the nucleic acid expression construct to 1 mole of the charged transfection-facilitating polypeptide. In a preferred embodiment the transfection-facilitating polypeptide comprises a charged polypeptide (e.g. poly-L-glutamate). Furthermore, the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21. Additionally, the nucleic acid expression construct encodes a growth-hormone-releasing-hormone ("GHRH") or functional biological equivalent thereof, as embodied in HV-GHRH (SEQID# 1), TI-GHRH (SEQID# 2), TV-GHRH
(SEQID# 3), 15/27/28-GHRH (SEQID# 4), wt-GHRH (SEQID#5).
BRIEF DESCRIPTION OF DRAWINGS
(SEQID# 3), 15/27/28-GHRH (SEQID# 4), wt-GHRH (SEQID#5).
BRIEF DESCRIPTION OF DRAWINGS
[0015] Figure 1 shows an electrode array of the prior art using six electrodes in three opposed pairs. It further depicts a single centralized electroporation overlap point, which is the center point of the asterisk pattern illustrated;
[0016] Figure 2 shows one electrode array of the present invention using five electrodes. It further depicts how a symmetrically arranged needle electrode array without opposing pairs can produce a decentralized pattern during an electroporation event in an area where no congruent electroporation overlap points develop and how an area of the decentralized pattern resembles a pentagon;
[0017] Figure 3 shows a the serum levels of SEAP in mice that were inj ected with an expression plasmid pSP SEAP coated with various concentrations of poly-L-glutamate;
[0018] Figure 4 shows a the serum levels of SEAP in pigs that were injected with an expression plasmid pSP SEAP coated with and without poly-L-glutamate.
[0019] Figure 5 shows a the serum levels of SEAP in dogs that were injected with an expression plasmid pSI' SEAP coated with and without poly-L-glutama~.
[0020] Figure 6 shows ih vitro increased plasmid DNA stability when poly-L-glutamate is added to the solution. All samples were incubated for 6 month at 37°C.
DETAILED DESCRIPTION OF PREFERRED EMBODIMENTS
TERMS:
DETAILED DESCRIPTION OF PREFERRED EMBODIMENTS
TERMS:
[0021] The term "nucleic acid expression construct" as used herein refers to any type of genetic construct comprising a nucleic acid coding for a RNA capable of being transcribed. The term "expression vector" can also be used interchangeably.
[0022] The term "functional biological equivalent" of GHRH as used herein is a polypeptide that has been engineered to contain a distinct amino acid sequence while simultaneously having similar or improved biologically activity when compared to the GHRH
polypeptide.
polypeptide.
[0023] The term "encoded GHRH" as used herein is a biologically active polypeptide.
[0024] The term "delivery" as used herein is defined as a means of introducing a material into a subject, a cell or any recipient, by means of chemical or biological process, injection, mixing, electroporation, sonoporation, or combination thereof, either under or without pressure.
[0025] The term "subject" as used herein refers to any species of the animal kingdom. In preferred embodiments it refers more specifically to humans and animals used for: pets (e.g. cats, dogs, etc.); work (e.g. horses, cows, etc.); food (chicken, fish, lambs, pigs, etc); and all others known in the art.
[0026] The term "recipient" as used herein refers to any species of the animal kingdom. In preferred embodiments it refers more specifically to humans and animals used for: pets (e.g. cats, dogs, etc.); work (e.g. horses, cows, etc.); food (chicken, fish, lambs, pigs, etc); and all others known in the art.
[0027] The term "promoter" as used herein refers to a sequence of DNA that directs the transcription of a gene. A promoter may be "inducible", initiating transcription in response to an inducing agent or, in contrast, a promoter may be "constitutive", whereby an inducing agent does not regulate the rate of transcription. A promoter may be regulated in a tissue-specific or tissue-preferred manner, such that it is only active in transcribing the operable linked coding region in a specific tissue type or types.
[0028] The term "coding region" as used herein refers to any portion of the DNA
sequence that is transcribed into messenger RNA ("mRNA") and then translated into a sequence of amino acids characteristic of a specific polypeptide.
sequence that is transcribed into messenger RNA ("mRNA") and then translated into a sequence of amino acids characteristic of a specific polypeptide.
[0029] The term "analog" as used herein includes any mutant of GHRH, or synthetic or naturally occurring peptide fragments of GHRH, as HV-GHRH (SEQID#
1), TI-GHRH (SEQID# 2), TV-GHRH (SEQID# 3),15/27/28-GHRH (SEQID# 4), (1-44)NHa or (1-40)OH (SEQID# 6) forms, or shorter forms to up to (1-29)NH2.
1), TI-GHRH (SEQID# 2), TV-GHRH (SEQID# 3),15/27/28-GHRH (SEQID# 4), (1-44)NHa or (1-40)OH (SEQID# 6) forms, or shorter forms to up to (1-29)NH2.
[0030] The term "growth hormone" ("GH") as used herein is defined as a hormone that relates to growth and acts as a chemical messenger to exert its action on a target cell.
[0031] The term "growth hormone releasing hormone" ("GHRH") as used herein is defined as a hormone that facilitates or stimulates release of growth hormone, and in a lesser extent other pituitary hormones, as prolactin.
[0032] The term "molecular switch" as used herein refers molecule that is delivered into a subject that can regulate transcription of a gene.
[0033] The term "cassette" as used herein is defined as one or more transgene expression vectors.
[0034] The term "post-injection" as used herein refers to a time period following the introduction of a nucleic acid cassette that contains heterologous nucleic acid sequence encoding GHRH or biological equivalent thereof into the cells of the subject and allowing expression of the encoded gene to occur while the modified cells are within the living organism.
[0035] The term "placing" as used herein refers to the positioning of a plurality of electrodes (either plate or needle) in a selected tissue.
[0036] The term "heterologous nucleic acid sequence" as used herein is defined as a DNA sequence consisting of differing regulatory and expression elements.
[0037] The term "vector" as used herein refers to any vehicle that delivers a nucleic acid into a cell or organism. Examples include plasmid vectors, viral vectors, liposomes, or cationic lipids.
[0038] The term "electroporation" as used herein refers to a method that utilized electric pulses to deliver a nucleic acid sequence into cells.
[0039] The term "electrical pulse" as used herein refers either a constant current pulse, or a constant-voltage pulse.
[0040] The term "poly-L-glutamate ("PLG")" as used herein refers to a biodegradable polymer of L-glutamic acid, in some aspects of the current invention the sodium salt of the said acid is suitable for use as a vector or adjuvant for DNA transfer into cells with or without electroporation.
[0041] The term "spaced relationship" as used herein refers to a positioning of electrodes in a tissue of a subject in either a symmetrical or non-symmetrical relationship to other electrodes.
[0042] The term "weight ratio" as used herein refers to an amount of nucleic acid expression construct (in micrograms), to an amount of charged transfection-facilitating polypeptide (in micrograms) in a composition, regardless of the total volume delivered.
[0043] The term "mole ratio" as used herein refers to an amount of nucleic acid expression construct (in moles), to an amount of charged transfection-facilitating polypeptide (in moles) in a composition.
[0044] The standard one and three letter abbreviations for amino acids used herein are as follows: Alanine, A, ala; Arginine, R, arg; Asparagine, N, asn;
Aspartic acid, N, asp;
Cysteine, C, cys; Glutamine, Q, gln; Glutamic acid, E, glu; Glycine, G, gly;
Histidine, H, his;
Isoleucine, I, ile; Leucine, L, leu; Lysine, K, lys; Methionine, M, met;
Phenylalanine, F, phe;
Proline, P, pro; Serine, S, ser; Threonine, T, thr; Tryptophan, W, trp;
Tyrosine, Y, tyr; Valine, V, val.
Aspartic acid, N, asp;
Cysteine, C, cys; Glutamine, Q, gln; Glutamic acid, E, glu; Glycine, G, gly;
Histidine, H, his;
Isoleucine, I, ile; Leucine, L, leu; Lysine, K, lys; Methionine, M, met;
Phenylalanine, F, phe;
Proline, P, pro; Serine, S, ser; Threonine, T, thr; Tryptophan, W, trp;
Tyrosine, Y, tyr; Valine, V, val.
[0045] The ability of electroporation to enhance plasmid uptake into the skeletal muscle has been well documented. However, effective compositions of nucleic acid expression vectors and transfection facilitating agents for use in electroporation protocols has not been described in the literature. This invention features compositions and methods for enhancing the delivery of a nucleic acid expression construct in a recipient.
[0046] Composition formulations: The ability of electroporation to enhance plasmid uptake into the skeletal muscle has been well documented, as described above. Other methods that do not involve electroporation also have been shown to enhance plasmid uptake, for example, a plasmid formulated with transfection facilitating particles poly-L-glutamate ("PLG") or polyvinylpyrolidone ("PVP") has been observed to increase gene transfection and consequently increase gene expression to up to 10 fold into mice, rats and dog muscle. One aspect of the current invention is the combination of electroporation and transfection facilitating particles associated with nucleic acid expression constructs.
Although not wanting to be bound by theory, PLG will increase the transfection of the plasmid during the electroporation process, not only by physically stabilizing the plasmid DNA, and facilitating the intracellular transport through the membrane pores, but also through an active transporting mechanism. For example, positively charged surface proteins on the cells attract and complex the negatively charged PLG linked to plasmid DNA through protein-protein interactions.
When an electric field is applied, the surface proteins reverse direction and actively internalize the DNA molecules. Additionally, PLG/DNA molecules that are in contact with the surface of the cell need only to migrate through the plasma membrane, as opposed to DNA molecules located away from the cell surface in the intercellular space. Thus, protein-protein interactions and proximity of transfection particles may substantially increases the transfection efficiency.
Although not wanting to be bound by theory, PLG will increase the transfection of the plasmid during the electroporation process, not only by physically stabilizing the plasmid DNA, and facilitating the intracellular transport through the membrane pores, but also through an active transporting mechanism. For example, positively charged surface proteins on the cells attract and complex the negatively charged PLG linked to plasmid DNA through protein-protein interactions.
When an electric field is applied, the surface proteins reverse direction and actively internalize the DNA molecules. Additionally, PLG/DNA molecules that are in contact with the surface of the cell need only to migrate through the plasma membrane, as opposed to DNA molecules located away from the cell surface in the intercellular space. Thus, protein-protein interactions and proximity of transfection particles may substantially increases the transfection efficiency.
[0047] Poly-L-glutamate ("PLG") is a stable compound, and resistant to high, denaturizing temperatures. PLG has been used previously to increase stability in vaccine preparations because it does not increase the vaccine's immunogenicity.
Additionally, PLG
has been used as an anti-toxin for post antigen inhalation or exposure top ozone. Plasmid DNA delivered by injection, electroporation, or both to the skeletal muscle are easily expressed, and can be measured as indicated by the physiologic levels of the transgene product in the circulation. Nevertheless, stabilization of naked DNA may be required and is necessary in some cases, as prolonged storage before usage, injection into a large number of animals. As plasmid DNA may be stored in different temperature for variable periods of time, it is critical that plasmid solutions be stable for extended periods of time.
It is important that the compound associated with the DNA is not toxic to the cells (e.g. muscle cells) and does not cause breakage of plasmid DNA. It would be preferable for the composition of plasmid DNA and associated transfection facilitating particles to have a similar or increased uptake into the target cells. This invention utilizes low concentrations (e.g. below 6 ~.g/~.1, preferably about 0.01 ~.g/~.l) of low and medium molecular weight poly-L-glutamate (e.g.
l-15 kDa, with an average of 10 kDa or 15-50 kDa, with an average of 35 kDa) compounds display all the desired properties for an effective composition of nucleic acid expression vector and transfection facilitating polypeptide. Although PLG can be used at a high concentration in non-electroporation applications, we have determined that low mole ratio of nucleic acid expression vector to PLG is optimum for electroporation applications to the skeletal muscle.
An example of a useful mole ratio of nucleic acid expression vector to PLG is about 1:5,000.
Another example of a more useful mole ratio of nucleic acid expression vector to PLG
comprises one about 1:2,500. An example of a preferred mole ratio of nucleic acid expression vector to PLG is about 1:1,200. An illustrative mole ratio of nucleic acid expression vector to PLG comprises one about 1:800. A representative mole ratio of nucleic acid expression vector to PLG comprises one about 1:500. An example of a select mole ratio of nucleic acid expression vector to PLG comprises one about 1:200. Another example of an even more select mole ratio of nucleic acid expression vector to PLG comprises one about 1:100. An example of a preferential mole ratio of nucleic acid expression vector to PLG
comprises one about 1:50. Another example of a more preferential mole ratio of nucleic acid expression vector to PLG comprises one about 1:20. An example of a even more preferential mole ratio of nucleic acid expression vector to PLG comprises one about 1:10. An example of a most preferred mole ratio of nucleic acid expression vector to PLG is about 1:1.
Additionally, PLG
has been used as an anti-toxin for post antigen inhalation or exposure top ozone. Plasmid DNA delivered by injection, electroporation, or both to the skeletal muscle are easily expressed, and can be measured as indicated by the physiologic levels of the transgene product in the circulation. Nevertheless, stabilization of naked DNA may be required and is necessary in some cases, as prolonged storage before usage, injection into a large number of animals. As plasmid DNA may be stored in different temperature for variable periods of time, it is critical that plasmid solutions be stable for extended periods of time.
It is important that the compound associated with the DNA is not toxic to the cells (e.g. muscle cells) and does not cause breakage of plasmid DNA. It would be preferable for the composition of plasmid DNA and associated transfection facilitating particles to have a similar or increased uptake into the target cells. This invention utilizes low concentrations (e.g. below 6 ~.g/~.1, preferably about 0.01 ~.g/~.l) of low and medium molecular weight poly-L-glutamate (e.g.
l-15 kDa, with an average of 10 kDa or 15-50 kDa, with an average of 35 kDa) compounds display all the desired properties for an effective composition of nucleic acid expression vector and transfection facilitating polypeptide. Although PLG can be used at a high concentration in non-electroporation applications, we have determined that low mole ratio of nucleic acid expression vector to PLG is optimum for electroporation applications to the skeletal muscle.
An example of a useful mole ratio of nucleic acid expression vector to PLG is about 1:5,000.
Another example of a more useful mole ratio of nucleic acid expression vector to PLG
comprises one about 1:2,500. An example of a preferred mole ratio of nucleic acid expression vector to PLG is about 1:1,200. An illustrative mole ratio of nucleic acid expression vector to PLG comprises one about 1:800. A representative mole ratio of nucleic acid expression vector to PLG comprises one about 1:500. An example of a select mole ratio of nucleic acid expression vector to PLG comprises one about 1:200. Another example of an even more select mole ratio of nucleic acid expression vector to PLG comprises one about 1:100. An example of a preferential mole ratio of nucleic acid expression vector to PLG
comprises one about 1:50. Another example of a more preferential mole ratio of nucleic acid expression vector to PLG comprises one about 1:20. An example of a even more preferential mole ratio of nucleic acid expression vector to PLG comprises one about 1:10. An example of a most preferred mole ratio of nucleic acid expression vector to PLG is about 1:1.
[0048] The proper mole ratio can be calculated for the moles of an appropriately average length nucleic acid expression vector (e.g. in the range of 2,000 by to 30,000 bp) to moles of PLG of low and medium molecular weight poly-L-glutamate (e.g. l-15 kDa, with an average of 10 kDa or 15-50 kDa, with an average of 35 kDa). The resulting electroporation of a plasmid DNA associated with PLG composition resulted in an increased expression of a reporter transgene and no damage to the target tissue.
[0049] Accordingly, the pharmaceutical composition of the present invention may be delivered via various routes and to various sites in an animal body to achieve a particular effect. One skilled in the art will recognize that although more than one route can be used for administration, a particular route can provide a more immediate and more effective reaction than another route. Although not wanting to be bound by theory, local or systemic delivery can be accomplished by administration comprising application or instillation of the formulated composition into body cavities, inhalation or insufflation of an aerosol, or by parenteral introduction, comprising intramuscular, intravenous, peritoneal, subcutaneous, intradermal, as well as topical administration. Additionally, different methods of delivery may be utilized to administer a plasmid/facilitating agent composition into a cell. Examples include: (1) methods utilizing physical means, such as electroporation (electricity), a gene gun (physical force) or applying large volumes of a liquid (pressure); and (2) methods wherein said vector is complexed to another entity, such as a liposome or transporter molecule.
[0050] Constant Current Electroporation: The underlying phenomenon of electroporation is believed to be the same in all cases, but the exact mechanism responsible for the observed effects has not been elucidated. Although not wanting to be bound by theory, the overt manifestation of the electroporative effect is that cell membranes become transiently permeable to large molecules, after the cells have been exposed to electric pulses. There are conduits through cell walls, which under normal circumstances, maintain a resting transmembrane potential of ca. 90 mV by allowing bi-directional ionic migration.
[0051] Although not wanting to be bound by theory, electroporation makes use of the same structures, by forcing a high ionic flux through these structures and opening or enlarging the conduits. In prior art, metallic electrodes are placed in contact with tissues and predetermined voltages, proportional to the distance between the electrodes are imposed on them. The protocols used for electroporation are defined in terms of the resulting field intensities, according to the formula E=old, where ("E") is the field, ("1~") is the imposed voltage and ("d") is the distance between the electrodes.
[0052] The electric field intensity E has been a very important value in prior art when formulating electroporation protocols for the delivery of a drug or macromolecule into the cell of the subj ect. Accordingly, it is possible to calculate any electric field intensity for a variety of protocols by applying a pulse of predetermined voltage that is proportional to the distance between electrodes. However, a caveat is that an electric field can be generated in a tissue with insulated electrodes (i.e. flow of ions is not necessary to create an electric field).
Although not wanting to be bound by theory, it is the current that is necessary for successful electroporation not electric field per se.
Although not wanting to be bound by theory, it is the current that is necessary for successful electroporation not electric field per se.
[0053] During electroporation, the heat produced is the product of the inter-electrode impedance, the square of the current, and the pulse duration. Heat is produced during electroporation in tissues and can be derived as the product of the inter-electrode current, voltage and pulse duration. The protocols currently described for electroporation are defined in terms of the resulting field intensities E, which are dependent on short voltage pulses of unknown current. Accordingly, the resistance or heat generated in a tissue cannot be determined, which leads to varied success with different pulsed voltage electroporation protocols with predetermined voltages. The ability to limit heating of cells across electrodes can increase the effectiveness of any given electroporation voltage pulsing protocol.
[0054) Controlling the current flow between electrodes allows one to determine the relative heating of cells. Thus, it is the current that determines the subsequent effectiveness of any given pulsing protocol, and not the voltage across the electrodes.
Predetermined voltages do not produce predetermined currents, and prior art does not provide a means to determine the exact dosage of current, which limits the usefulness of the technique. Thus, controlling an maintaining the current in the tissue between two electrodes under a threshold will allow one to vary the pulse conditions, reduce cell heating, create less cell death, and incorporate macromolecules into cells more efficiently when compared to predetermined voltage pulses.
Predetermined voltages do not produce predetermined currents, and prior art does not provide a means to determine the exact dosage of current, which limits the usefulness of the technique. Thus, controlling an maintaining the current in the tissue between two electrodes under a threshold will allow one to vary the pulse conditions, reduce cell heating, create less cell death, and incorporate macromolecules into cells more efficiently when compared to predetermined voltage pulses.
[0055] A constant-current electroporation device is the invention of a co-pending application entitled "Electrode assembly for constant current-electroporation and use" S/N
60/362,362 filed on March 7, 2002 with Westerstein et al., ("the Western '362 application") listed as inventors, and is herby incorporated by reference. One aspect of the Western '362 application overcomes the above problem by providing a means to effectively control the dosage of electricity delivered to the cells in the inter-electrode space by precisely controlling the ionic flux that impinges on the conduits in the cell membranes. Thus, the precise dosage of electricity to tissues can be calculated as the product of the current level, the pulse length and the number of pulses delivered. The constant-current system, comprises an electrode apparatus connected to a specially designed circuit, which is also utilized in the current invention.
60/362,362 filed on March 7, 2002 with Westerstein et al., ("the Western '362 application") listed as inventors, and is herby incorporated by reference. One aspect of the Western '362 application overcomes the above problem by providing a means to effectively control the dosage of electricity delivered to the cells in the inter-electrode space by precisely controlling the ionic flux that impinges on the conduits in the cell membranes. Thus, the precise dosage of electricity to tissues can be calculated as the product of the current level, the pulse length and the number of pulses delivered. The constant-current system, comprises an electrode apparatus connected to a specially designed circuit, which is also utilized in the current invention.
[0056] Qne aspect of the present invention is to provide a means to deliver the electroporative current to a volume of tissue along a plurality of paths without, causing excessive concentration of cumulative current in any one location, thereby avoiding cell death owing to overheating of the tissue. However, the composition of the nucleic acid expression vector associated with a transfection facilitation poly-peptide will further facilitate successful transfection protocols. For example, the maximal energy delivery from a particular pulse would occur along a line that connects two electrodes. Prior art teaches that the electrodes are present in pairs and that the voltage pulses are delivered to the paired electrodes of opposed polarity. Accordingly, the maximal energy delivery from a particular pulse would occur along a line that connects two electrodes. An example of the energy delivery pathway in a prior art electrode, which utilizes three pairs of radial electrodes with a center electrode, is described above and as in Figure 1. A distribution of the energy crosses at the center point of the electrodes, which may lead to unnecessary heating and decreased survival of cells. Thus, nucleic acid/transfection facilitation composition of the current invention can also help stabilize cells in prior art electroporation protocols.
[0057] The electrodes of one embodiment of the present invention are arranged in a radial and symmetrical array, but unlike prior art, the electrodes are odd numbered, and not in opposing pairs (Figure 2). Delivering an electric pulse to any two of the electrodes from an electric pulse generator results in a pattern that is best described as a polygon. Tracing this pattern would result in a five-point star with a pentagon of electrical pulses surrounding the center of the array in tissue where the concentration of molecules to be transfected is greatest.
Although not wanting to be bound by theory, it is not the odd number of electrodes, per se, that makes a difference, but in the direction of the current paths. With the configuration of prior art, all the pulses generate a current that passes through the center of the assembly. The cumulated dose, i.e. the heating effect is therefore concentrated in the center, with the peripheral dose falling off rapidly. With the "five-pointed star" arrangement, the dose is spread more evenly, over a larger volume. For example, if the electrodes are arranged in an array of five electrodes, the pulses might be sequentially applied to electrodes 1 and 3, then 3 and 5, then 5 and 2, then 2 and 4, then 4 and 1. However, because the tissue between the electrodes is a volume conductor, a certain current intensity exists along parallel lines, weakening as the distance from the center line increases. The cumulative effect of a sequence of pulses results in a more uniform distribution of the energy delivered to the tissues, increasing the probability that the cells that have been electroporated actually survive the procedure.
Although not wanting to be bound by theory, it is not the odd number of electrodes, per se, that makes a difference, but in the direction of the current paths. With the configuration of prior art, all the pulses generate a current that passes through the center of the assembly. The cumulated dose, i.e. the heating effect is therefore concentrated in the center, with the peripheral dose falling off rapidly. With the "five-pointed star" arrangement, the dose is spread more evenly, over a larger volume. For example, if the electrodes are arranged in an array of five electrodes, the pulses might be sequentially applied to electrodes 1 and 3, then 3 and 5, then 5 and 2, then 2 and 4, then 4 and 1. However, because the tissue between the electrodes is a volume conductor, a certain current intensity exists along parallel lines, weakening as the distance from the center line increases. The cumulative effect of a sequence of pulses results in a more uniform distribution of the energy delivered to the tissues, increasing the probability that the cells that have been electroporated actually survive the procedure.
[0058] It is known in prior art that the nature of the voltage pulse to be generated is determine by the nature of tissue, the size of the selected tissue and distance between electrodes. It is desirable that the voltage pulse be as homogenous as possible and of the correct amplitude. Excessive field strength results in the lysing of cells, whereas a low field strength results in reduced efficacy of electroporation. Prior art inventions utilize the distance between electrodes to calculate the electric field strength and predetermined voltage pulses for electroporation. This reliance on knowing the distance between electrodes is a limitation to the design of electrodes. Because the programmable current pulse controller will determine the impedance in a volume of tissue between two electrodes, the distance between electrodes is not a critical factor for determining the appropriate electrical current pulse. Therefore, an alternative embodiment of the needle electrode array design would be one that is non-symmetrical. In addition, one skilled in the art can imagine any number of suitable symmetrical and non-symmetrical needle electrode arrays that do not deviate from the spirit and scope of a particular electrode design. The depth of each individual electrode within an array and in the desired tissue could be varied with comparable results. In addition, multiple injection sites for the macromolecules could be added to the needle electrode array.
[0059] By utilizing the constant current electroporation device described in the Western '362 application a simple means for determining the temperature elevation of the tissues exposed to the pulses is available. For example, the product of the measured inter-electrode impedance, the square of the current and the cumulated pulse duration is a measure of the total energy delivered. This quantity can be converted to degrees Celsius, when the volume of the tissues encompassed by the electrodes and the specific heat of the tissues are known. For example the rise in tissue temperature ("T", Celsius) is the resistance ("R", ohms), current ("I", Amperes), length of pulse ("t", seconds), and the conversion factor between joules and calories ("K"). T = RIZtK
[0060] At the moment of electroporation, the current increases in a prior art system where a predetermined voltage has been imposed on the electrodes, owing to the fact that increased cell permeability lowers the inter-electrode impedance. This may lead to an excessive temperature rise, resulting in cell death. For example, utilizing values common for conventional electroporators, and assuming that the volume enclosed by the electrodes is one cubic centimeter and the specific heat of the tissues is close to unity, the temperature rise owing to one 50 msec pulse with an average current of 5 Amperes across a typical load impedance of 25 ohms is ca 7.5 °C. This points out the necessity of inserting an adequate delay between successive pulses, to allow the subj ects circulatory system to remove enough heat so that the cumulative temperature rise will not result in destruction of the tissues being electroporated.
[0061 ] The advantage of a constant-current is that the pulse can be prevented from attaining an amplitude at which the cells are destroyed. In a predetermined voltage system, the current can attain a destructive intensity, and the operator can not prevent that from happening. In a constant-current system, the current is preset under a threshold level where cell death does not occur. The exact setting of the current is dependent of the electrode configuration, and it must be determined experimentally. However, once the proper level has been determined, cell survival is assured, from case to case. The addition of a nucleic acid expression construct associated with a transfection facilitating polypeptide increases the opportunity of electroporated cells to incorporate the plasmid construct.
[0062] Nucleic acid constructs for therapy: One aspect of this invention relates to a composition and method for efficient delivery of a nucleic acid construct to a tissue as a treatment for various diseases found in chronically ill subjects. More specifically, the aspects of this invention pertain to a method for delivering a heterologous nucleic acid sequence that is encoding a specific gene (e.g. growth hormone releasing hormone ("GHRH") or biological equivalent thereof) into one or more cells of the sub] ect (e.g. somatic, stem, or germ cells) and allowing expression of the encoded gene (e.g. GHRH or biological equivalent thereof] to occur while the modified cells are within the subject. The method of delivering the nucleic acid sequence encoding the gene is via electroporation. The subsequent expression of the encoded gene can be regulated by a tissue specific promoter (e.g. muscle), and/or by a regulator protein that contains a modified ligand-binding domain (e.g.
molecular switch), which will only be active when the correct modified ligand (e.g. mifepistone) is externally administered into the subject. For example, the extracranial expression and ensuing release of GHRH or biological equivalent thereof by the modified cells can be used to treat anemia, wasting, immune dysfunction, life extension or other disorders in the chronically ill subject.
[0063] Recombinant GH replacement therapy is widely used clinically, with beneficial effects, but generally, the doses are supraphysiological. Such elevated doses of recombinant GH are associated with deleterious side-effects, for example, up to 30% of the recombinant GH treated patients report a higher frequency of insulin resistance or accelerated bone epiphysis growth and closure in pediatric patients. In addition, molecular heterogeneity 1~
of circulating GH may have important implications in growth and homeostasis, which can lead to a less potent GH that has a reduced ability to stimulate the prolactin receptor. These unwanted side effects result from the fact that treatment with recombinant exogenous GH
protein raises basal levels of GH and abolishes the natural episodic pulses of GH. In contradistinction, no side effects have been reported for recombinant GHRH
therapies. The normal levels of GHRH in the pituitary portal circulation range from 150-to-800 pg/ml, while systemic circulating values of the hormone are up to 100-500 pg/ml. Some patients with acromegaly caused by extracranial tumors have level that is nearly 100 times as high (e.g. 50 ng/ml of immunoreactive GHRH). Long term studies using recombinant GHRH
therapies (1-years) in children and elderly humans have shown an absence of the classical GH side-effects, such as changes in fasting glucose concentration or, in pediatric patients, the accelerated bone epiphysal growth and closure or slipping of the capital femoral epiphysis.
Thus, recombinant GHRH therapy may be more physiological than recombinant GH
therapy.
Unfortunately, due to the short half life of the peptide in vivo, frequent (i.e. one to three times a day) intravenous or subcutaneous administration is necessary if the recombinant protein is used. A gene transfer approach, however could overcome this limitations to GHRH use.
Moreover, a wide range of doses can be therapeutic. The choice of GHRH for a gene therapeutic application is favored by the fact that the gene, cDNA and native and several mutated molecules have been characterized for the pig and other species, and the measurement of therapeutic efficacy is straightforward and unequivocal.
[0064] The invention may be better understood with reference to the following examples, which are representative of some of the embodiments of the invention, and are not intended to limit the invention.
[0065] EXAMPLE 1. Plasmid vectors containing the muscle specific synthetic promoter SPcS-12 were previously described (Li et al.,1999). Wild type and mutated porcine GHRH cDNAs were generated by site directed mutagenesis of GHRH cDNA (Altered Sites II
in vitf~o Mutagenesis System, Promega, Madison, WI), and cloned into the BamHI/ Hind III
sites of pSPcS-12, to generate pSP-wt-GHRH, or pSP-HV-GHRH respectively. The 3' untranslated region (3'UTR) of growth hormone was cloned downstream of GHRH
cDNA.
The resultant plasmids contained mutated coding region for GHRH, and the resultant amino acid sequences were not naturally present in mammals. Although not wanting to be bound by theory, the effects on treating anemia; increasing total red blood cell mass in a subject;
reversing the wasting; reversing abnormal weight loss; treating immune dysfunction;
reversing the suppression of lyrnphopoesis; or extending life expectancy for the chronically ill subject are determined ultimately by the circulating levels of analog GHRH
hormones.
Several different plasmids that encoded different mutated amino acid sequences of GHRH or functional biological equivalent thereof are as follows:
Plasmid Encoded Amino Acid Seguence wt-GHRH YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGA-OH
(SEQID#5) HV-GHRH HVDAIFTNSYRKVLAQLSARKLLQDILNRQQGERNQEQGA-OH
(SEQID# 1 ) TI-GHRH YIDAIFTNSYRKVLAQLSARKLLQDILNRQQGERNQEQGA-OH
(SEQID#2) TV-GHRH YVDAIFTNSYRKVLAQLSARKLLQDILNRQQGERNQEQGA-OH
(SEQID#3) 15/27/28- YADAIFTNSYRI~VLAQLSARKLLQDILNRQQGERNQEQGA-OH
GHRH (SEQID#4) In general, the encoded GHRH or functional biological equivalent thereof is of formula (SeqID#6):
-A_1-Az-DAIFTNSYRKVL-A3-QLSARKLLQDI-A4-AS-RQQGERNQEQGA-OH
wherein: a standard one letter amino acid abbreviation is used; and A1 is a D-or L-isomer of an amino acid selected from the group consisting of tyrosine ("Y"), or histidine ("H"); AZ is a D-or L-isomer of an amino acid selected from the group consisting of alanine ("A"), valine ("V"), or isoleucine ("I"); A3 is a D-or L-isomer of an amino acid selected from the group consisting of alanine ("A") or glycine ("G"); A4 is a D-or L-isomer of an amino acid selected from the group consisting of methionein ("M"), or leucine ("L"); A5 is a D-or L-isomer of an amino acid selected from the group consisting of serine ("S") or asparagines ("N").
[0066] Another plasmid that was utilized included the pSP-SEAP construct that contains the SacI/ HindIII SPcS-12 fragment, SEAP gene and SV40 3'UTR from pSEAP-2 Basic Vector (Clontech Laboratories, Inc., Palo Alto, CA).
[0067] The plasmids described above do not contain polylinker, IGF-I gene, a skeletal a-actin promoter or a skeletal a-actin 3' UTR (untranslated region) /
NCR (non-coding region). Furthermore, these plasmids were introduced by muscle injection, followed by in vivo electroporation, as described below.
[0068] In terms of "functional biological equivalents," it is well understood by the skilled artisan that, inherent in the definition of a "biologically functional equivalent" protein and/or polynucleotide, is the concept that there is a limit to the number of changes that may be made within a defined portion of the molecule while retaining a molecule with an acceptable level of equivalent biological activity. Functional biological equivalents are thus defined herein as those proteins (and polynucleotides) in selected amino acids (or codons) may be substituted. A peptide comprising a functional biological equivalent of GHRH
is a polypeptide that has been engineered to contain distinct amino acid sequences while simultaneously having similar or improved biologically activity when compared to GHRH.
For example one biological activity of GHRH is to facilitate growth hormone ("GH") secretion in the subject.
[0069] Plasmid associated with PLG in mice. In order to demonstrate the improved uptake of electroporated cells with a composition of a nucleic acid expression construct associated with a transfection facilitating polypeptide, a series of electroporation experiments were designed. Three separate sets of experiments were conducted in mice. All mice were given a total of 30 ~,g (micrograms) pSP-SEAP (approximately 5,000 base pairs ("bp")), +/- PLG (weighted average MW = 10,900) in a total volume of 25 ~,l (microliters).
One group of 10 mice received naked, non-coated plasmid; the subsequent groups received plasmid coated with decreasing concentrations of PLG (see Table 1 below):
Group Total Inj.DNA PLG Total PLG Approximate Vol (~,g) (~,g/~,1)(~,g) Mole ratio 1 DNA:PLG
1 25 30 0.00 0.00 -2 25 30 6.00 150 1:1200 3 25 30 1.00 25 1:200 4 25 30 0.10 2.50 1:20 25 30 0.01 0.25 1:2 The mole ratios are provided for the purpose of example. The mole ratio listed in Table 1 are based upon a 5,000 by nucleic acid expression vector, and PLG with the weighted average molecular weight of 10,900. For example group 2 in Table 1 has an inj ection total of 30 ~.g of DNA vector associated with 150 ~.g of transfection facilitating polypeptides, wherein the mole ratio is 1:1,200. Another example of group 3 in Table 1 has an injection total of 30 ~,g of DNA vector associated with 0.25 ~.g of transfection facilitating polypeptides, wherein the mole ratio is less than 1:2. Mole ratio's of DNA vector to PLG having a 1:1 relationship comprises a lower limit formulation still having a higher transfection efficiency than a "naked" DNA vector alone. One of ordinary skill in the art is capable of formulating mole ratio calculations with different length expression vectors and variable molecular weights of PLG. Additionally, it is understood that the length of the nucleic acid expression vector and the weighted average molecular weight of PLG is subject to change based upon specific vector lengths and particular formulation strategies known to one skilled in the art (e.g.
functional nucleic acid expression vectors greater than or less than about 5,000 nucleotides, and PLG having an average molecular weight of less than about 1 to about 30 kDa).
Consequently, even the smallest of PLG polymers (e.g. PLG trimers having a molecular weight ~ 400 Da) can be used for this invention.
[0070] Electroporation was carned out using a constant current electroporation apparatus that is the subject ofthe Western '362 co-pending application. This device was used to deliver square wave pulses in all experiments. The amplitude conditions of 1 mA, 5 pulses, 50 milliseconds per pulse were used. Caliper electrodes were used to deliver in vivo electric pulses. The caliper (plate) electrodes consisted of 1.5 cm square metallic blocks mounted on a ruler, so the distance between the plates could be easily assessed. Plasmid DNA or associated DNA was injected through the intact skin into the tibialis anterior muscle of mice. Each animal received one injection into a single injection site. Although a constant-current electroporation device was used in specific examples, it is not intended to limit general embodiments of the invention (i.e. other electroporation devices may provide satisfactory results.) Furthermore, the order of the placement of the electrodes and subsequent injection of plasmid are not sequentially limiting.
[0071] In order to determine the amount of expression of the SEAP gene product that was encoded on the DNA vector, mice were bled and serum collected for up to 3 month post-injection. The SEAP molecule usually disappears after birth, and it is immunogenic in adult animals. Blood was collected by tail vein collection for mice, before plasmid administration, and up to 3 month post-injection in mice. Serum levels of SEAP
were determined using a chemiluminescence assay (Tropix, Bedford, MA) following the manufacturer instructions. Figure 3 shows the serum SEAP levels for all five groups of mice described in Table 1. Although naked plasmid (Group l, figure 3) showed some expression, all groups with the nucleic acid expression vector associated with PLG (groups 2-5, figure 3) showed significantly higher serum levels of SEAP. Nevertheless, when samples from selected animals from each group were analyzed by histochemistry for inflammation markers (e.g. macrophages, B-cells, and counterstained with hematoxilin / eosin), mice from group 5 (i.e. nucleic acid expression construct coated with 0.01 ~,g/~,1 PLG) had the least inflammation associated with the delivery procedure at 3 days post-injection. Despite higher expression at earlier time points, group 2 injected with plasmid associated with 6 ~.g/~.1 had high inflarmnation and some morphological changes. This observation correlates with the data in the literature, that shows short-term enhanced expression using PLG compounds, expression that disappears at approximately 1 month post-injection. (Fewell et al., 2001).
[0072] Histolo~ical anal - Muscle and skin samples were fixed overnight, dehydrated in alcohol and paraffin embedded. Five microns sections were cut and stained with hematoxilin/ eosin (Sigma Chemical, St. Louis, MO). Serial sections were stained with picric acid. Digital images of the slides were captured using a CoolSnap digital color camera (Roper Scientific, Tucson, AZ) with MetaMorph software (Universal Imaging Corporation, Downington, PA) and a Zeiss Axioplan 2 microscope with a (x 40) objective (numerical aperture 0.75 plan).
[0073] Statistics - Data are analyzed using STATISTICA analysis package (StatSoft, Inc. Tulsa, OK). Values shown in the figures are the mean ~ s.e.m.
Specific P
values were obtained by comparison using ANOVA. A P < 0.05 was set as the level of statistical significance.
[0074] E~~AMPLE 2 - PLG coating in pigs: In order to demonstrate similar results in a larger mammal, experiments similar to Example 1 above were conducted in pigs.
Thus, two groups of three pigs were injected with 500 ~,g (micrograms) of pSP-SEAP and electroporated. The plasmid expressed secreted embryonic alkaline phosphatase ("SEAP").
The molecule usually disappears after birth, and it is immunogenic in adult animals. One group received naked nucleic acid construct and the second group received the nucleic acid construct in 0.01 ~,g/~.1 PLG Pigs were weighted and bled prior to injection, and every other day up to 10 days post-injection. Serum was collected from pigs by jugular puncture before plasmid injection, and at 2, 4, 6, 8 and 10 days for the SEAP studies. Serum levels of SEAP
were determined using a chemiluminescence assay (Tropix, Bedford, MA) following the manufacturer instructions. SEAP assay (Figure 4) showed an increased expression in animals injected with PLG coated plasmid versus naked plasmid throughout 12 days of experiment (32.9 ~ 19.3 ng/ml/kg in PLG/plasmid pig versus 17.14 ~ 12.44 ng/ml/kg in animals inj ected with naked plasmid). Although not wanting to be bound by theory, the increased expression may be attributed to the increased stability of plasmid, facilitation of transfection into the muscle cells, or both.
[0075] Electroporation devices A constant current electroporator machine (Advisys, Inc.) was used to deliver square wave pulses in all experiments. The electroporation parameters included an amplitude condition of 1 mA, 5 pulses, 50 milliseconds per pulse. A
needle electrode was used to deliver in vivo electric pulses. The 5-needle electrode device consists of a circular array (1 cm diameter) of equally spaced filled 21-gauge needles mounted on a non-conductive material. All needles were 2 cm in length and during all injections or electroporations, the needles were completely inserted into the muscle.
Plasmid DNA was inj ected through the intact skin into the semitendinosous muscle of pigs with a 21 g needle.
Each animal received one injection into a single injection site and the injection site also received a tattoo so it could be easily isolated at the end of the experiment.
[0076] Histolo~ical analysis - Muscle and skin samples were fixed overnight, dehydrated in alcohol and paraffin embedded. Five microns sections were cut and stained with hematoxilin/ eosin (Sigma). Serial sections were stained with picric acid.
Digital images of the slides were captured using a CoolSnap digital color camera (Roper Scientific, Tucson, AZ) with MetaMorph software (Universal Imaging Corporation, Downington, PA) and a Zeiss Axioplan 2 microscope with a (x 40) objective (numerical aperture 0.75 plan).
Statistics - Data are analyzed using STATISTICA analysis package (StatSoft, Inc. Tulsa, OIL). Values shown in the figures are the mean ~ s.e.m.
Specific P
values were obtained by comparison using ANOVA. A P < 0.05 was set as the level of statistical significance.
[0078] Example 3: PLG coating in Dogs: In order to demonstrate similar results in a different species of larger mammal, experiments similar to Example 2 were conducted in dogs. Thus, a comparison of expression in dogs injected with 5 needle array electrodes, with coated or naked plasmid. Four groups of 5 dogs were injected with a plasmid DNA, pSP-SEAP, expressing the secreted embryonic alkaline phosphatase ("SEAP"). The molecule usually disappears after birth, and it is immunogenic in adult animals. No adverse reaction, or change in biochemical, clinical or hormonal profiles is related to the development of the immune response to SEAP in animals. As described above, the injection was followed by electroporation, using standard conditions, and 5 needle electrodes. The plasmid DNA was either naked, or coated with a mol / mol dilution of poly-L-glutamate. The groups are as follows:
Group 5 needle (SN), 0.5 mg, 1- naked (NK) Group 5 needle (SN), 0.1 mg, 2 naked (NK) -Group 5 needle (SN), 0.5 mg, 3 coated (PLG) -Group 5 needle (SN), 0.1 mg, 4 coated (PLG) -[0079] Dogs were weight and bled at baseline (pre-inj ection) and every other day to day 10 post-injection. Serum was assayed for SEAP. Values were corrected for weight (blood volume). SEAP values were analyzed for differences in between the different injected groups. The results of these experiments are shown in Figure 5. The results showed that a 5 needle electrode could be used in dogs to efficiently mediate electroporation.
Additionally, PLG coated DNA increasing plasmid stability and electroporation efficiency in dogs.
[0080] Example 4: PLG increases plasmid stability in vitro at high temperatures: In order to evaluate the effects of the PLG on plasmid stability, the following assay has been performed. Plasmid pSP-HV-GHRH encoding for a super-porcine growth hormone releasing hormone was diluted into distilled water to a final concentration of 2 mg/ml. PLG in a mol / mol ratio was added to a group of samples, while PLG was not added into control samples. All samples were incubated for 6 month at 37°C.
After 6 month, aliquots were taken from all samples, and run onto an agarose gel (Figure 6). As seen in the gel image, all plasmid is present in the samples were PLG was added, while in control samples all plasmid is completely degraded.
[0081] One skilled in the art readily appreciates that the patent invention is well adapted to carry out the objectives and obtain the ends and advantages mentioned as well as those inherent therein. Growth hormone, growth hormone releasing hormone, analogs, plasmids, vectors, charged transfection facilitating polypeptides, poly-L-glutamate, pharmaceutical compositions, treatments, electroporation methods, procedures and other techniques described herein are presently representative of several aspects of the current invention and are intended to be exemplary and are not intended as limitations of the scope.
Changes therein and other uses will occur to those skilled in the art which are encompassed within the spirit of the invention or defined by the scope of the pending claims.
[0082] Accordingly, the present invention provides a method of transferring a therapeutic gene to a host, which comprises administering the vector of the present invention, preferably as part of a composition, using any of the aforementioned routes of administration or alternative routes known to those skilled in the art and appropriate for a particular application. Effective gene transfer of a vector to a host cell in accordance with the present invention to a host cell can be monitored in terms of a therapeutic effect (e.g. alleviation of some symptom associated with the particular disease being treated) or, further, by evidence of the transferred gene or expression of the gene within the host (e.g., using the polymerase chain reaction in conjunction with sequencing, Northern or Southern hybridizations, or transcription assays to detect the nucleic acid in host cells, or using immunoblot analysis, antibody-mediated detection, mRNA or protein half life studies, or particularized assays to detect protein or polypeptide encoded by the transferred nucleic acid, or impacted in level or function due to such transfer).
[0083] These methods described herein are by no means all-inclusive, and further methods to suit the specific application will be apparent to the ordinary skilled artisan.
Moreover, the effective amount of the compositions can be further approximated through analogy to compounds known to exert the desired effect.
[0084] Furthermore, the actual dose and schedule can vary depending on whether the compositions are administered in combination with other pharmaceutical compositions, or depending on inter-individual differences in pharmacokinetics, drug disposition, and metabolism. Similarly, amounts can vary in in vitro applications depending on the particular cell line utilized (e.g., based on the number of vector receptors present on the cell surface, or the ability of the particular vector employed for gene transfer to replicate in that cell line).
Furthermore, the amount of vector to be added per cell will likely vary with the length and stability of the therapeutic gene inserted in the vector, as well as the nature of the sequence, and is particularly a parameter which needs to be determined empirically, and can be altered due to factors not inherent to the methods of the present invention (for instance, the cost associated with synthesis). One skilled in the art can easily make any necessary adjustments in accordance with the exigencies of the particular situation.
SEQUENCE LISTING
<110> Advisys <120> INCREASED DELIVERY OF A NUCLEIC ACID CONSTRUCT IN VIVO BY THE
POLY-L-GLUTAMATE ("PLG") SYSTEM
<130> 108328.00115 - AVSI-0021P1 <140> 10/395,709 <141> 2003-03-24 <160> 25 <170> PatentIn version 3.1 <210> 1 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is a functional biological equivalent of GHRH.
<400> 1 His Val Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Ala Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Leu Asn Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 2 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is a functional biological equivalent of GHRH.
<400> 2 Tyr Ile Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Ala Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Leu Asn Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 3 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is a functional biological equivalent of GHRH.
<400> 3 Tyr Val Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Ala Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Leu Asn Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 4 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is a functional biological equivalent of GHRH.
<400> 4 Tyr Ala Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Ala Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Leu Asn Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 5 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is the artificial sequence for the (1-44)NH2 <400> 5 Tyr Ala Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Gly Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Met Ser Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 6 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is the artificial sequence for GHRH (1-40)OH.
<220>
<221> MISC_FEATURE
<222> (1). (1) <223> Xaa at position l may be tyrosine, or histidine <220>
<221> MISC_FEATURE
<222> (2). (2) <223> Xaa at position 2 may be alanine, valine, or isoleucine.
<220>
<221> MISC_FEATURE
<222> (15) .(15) <223> Xaa at position 15 may be alanine, valine, or isoleucine.
<220>
<221> MISC_FEATURE
<222> (27) .(27) <223> Xaa at position 27 may be methionine, or leucine.
<220>
<221> MISC_FEATURE
<222> (28) .(28) <223> Xaa at position 28 may be serine or asparagine.
<400> 6 Xaa Xaa Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Xaa Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Xaa Xaa Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210>
<211>
<212>
DNA
<213>
artificial sequence <220>
<223> is a eukaryoticpromoter 12.
This nucleic c5-acid sequence of a <400>
cggccgtccgccctcggcaccatcctcacgacacccaaatatggcgacgggtgaggaatg60 gtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctcta120 aaaataactcccgggagttatttttagagcggaggaatggtggacacccaaatatggcga180 cggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccgcattcctggg240 ggccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcggcggcccacga300 gctacccggaggagcgggaggcg 323 <210> 8 <211> 190 <212> DNA
<213> artificial sequence <220>
<223> This is a nucleic acid sequence of a human growth hormone ("hGH") poly A tail.
<400> 8 gggtggcatc cctgtgaccc ctccccagtg cctctcctgg ccctggaagt tgccactcca 60 gtgcccacca gccttgtcct aataaaatta agttgcatca ttttgtctga ctaggtgtcc 120 ttctataata ttatggggtg gaggggggtg gtatggagca aggggcaagt tgggaagaca 180 acctgtaggg 190 <210> 9 <211> 219 <212> DNA
<213> artificial sequence <220>
<223> This is the cDNA for Porcine growth hormone releasing hormone <400> 9 atggtgctct gggtgttctt ctttgtgatc ctcaccctca gcaacagctc ccactgctcc 60 ccacctcccc ctttgaccct caggatgcgg cggcacgtag atgccatctt caccaacagc 120 taccggaagg tgctggccca gctgtccgcc cgcaagctgc tccaggacat cctgaacagg 180 cagcagggag agaggaacca agagcaagga gcataatga 219 <210> 10 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is the amino acid sequence for porcine growth hormone releas ing hormone.
<400> 10 Tyr Ala Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Gly Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Met Ser Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 11 <211> 3534 <212> DNA
<213> artificial sequence <220>
<223> Sequence for the operatively linked components of the HV-GHRH pla smid.
<400>
gttgtaaaacgacggccagtgaattgtaatacgactcactatagggcgaattggagctcc60 accgcggtggcggccgtccgccctcggcaccatcctcacgacacccaaatatggcgacgg120 gtgaggaatggtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgt180 tggcgctctaaaaataactcccgggagttatttttagagcggaggaatggtggacaccca240 aatatggcgacggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccg300 cattcctgggggccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcgg360 cggcccacgagctacccggaggagcgggaggcgccaagctctagaactagtggatcccaa420 ggcccaactccccgaaccactcagggtcctgtggacagctcacctagctgccatggtgct480 ctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgctccccacctcc540 ccctttgaccctcaggatgcggcggcacgtagatgccatcttcaccaacagctaccggaa600 ggtgctggcccagctgtccgcccgcaagctgctccaggacatcctgaacaggcagcaggg660 agagaggaaccaagagcaaggagcataatgactgcaggaattcgatatcaagcttatcgg720 ggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccag780 tgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcct840 tctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaa900 cctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggc960 tcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgt1020 tgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggg1080 gtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccacctt1140 ggcctcccaaattgctgggattacaggcgtgaaccactgctCCCttCCCtgtCCttCtga1200 ttttaaaataactataccagcaggaggacgtccagacacagcataggctacctggccatg1260 cccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtcca1320 ctcagtagatgcctgttgaattcgataccgtcgacctcgagggggggcccggtaccagct1380 tttgttccctttagtgagggttaatttcgagcttggcgtaatcatggtcatagctgtttc1440 ctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagt1500 gtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgc1560 ccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcgg1620 ggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgct1680 cggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatcca1740 cagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccagga1800 accgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatc1860 acaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccagg1920 cgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggat1980 acctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggt2040 atctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttc2100 agcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacg2160 acttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcg2220 gtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttg2280 gtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatceg2340 gcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgca2400 gaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagaaga2460 actcgtcaagaaggcgatagaaggcgatgcgctgcgaatcgggagcggcgataccgtaaa2520 gcacgaggaagcggtcagcccattcgccgccaagctcttcagcaatatcacgggtagcca2580 acgctatgtcctgatagcggtccgccacacccagccggccacagtcgatgaatccagaaa2640 agcggccattttccaccatgatattcggcaagcaggcatcgccatgggtcacgacgagat2700 cctcgccgtcgggcatgcgcgccttgagcctggcgaacagttcggctggcgcgagcccct2760 gatgctcttcgtccagatcatcctgatcgacaagaccggcttccatccgagtacgtgctc2820 gctcgatgcgatgtttcgcttggtggtcgaatgggcaggtagccggatcaagcgtatgca2880 gccgccgcattgcatcagccatgatggatactttctcggcaggagcaaggtgagatgaca2940 ggagatcctgccccggcacttcgcccaatagcagccagtcccttcccgcttcagtgacaa3000 cgtcgagcacagctgcgcaaggaacgcccgtcgtggccagccacgatagccgcgctgcct3060 cgtcctgcagttcattcagggcaccggacaggtcggtcttgacaaaaagaaccgggcgcc3120 cctgcgctgacagccggaacacggcggcatcagagcagccgattgtctgttgtgcccagt3180 catagccgaatagcctctccacccaagcggccggagaacctgcgtgcaatccatcttgtt3240 caatcatgcgaaacgatcctcatcctgtctcttgatcagatcttgatcccctgcgccatc3300 agatccttggcggcaagaaagccatccagtttactttgcagggcttcccaaccttaccag3360 agggcgccccagctggcaattccggttcgcttgctgtccataaaaccgcccagtctagca3420 actgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggg3480 gatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgac 3534 <210> 12 <211> 3534 <212> DNA
<213> artificial sequence <220>
<223> Sequence for the operatively linked components of the TI-GHRH pla smid.
<400>
gttgtaaaacgacggccagtgaattgtaatacgactcactatagggcgaattggagctcc60 accgcggtggcggccgtccgccctcggcaccatcctcacgacacccaaatatggcgacgg120 gtgaggaatggtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgt180 tggcgctctaaaaataactcccgggagttatttttagagcggaggaatggtggacaccca240 aatatggcgacggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccg300 cattcctgggggocgggcggtgctcccgcccgcctcgataaaaggctccggggccggcgg360 cggcccacgagctacccggaggagcgggaggcgccaagctctagaactagtggatcccaa420 ggcccaactccccgaaccactcagggtcctgtggacagctcacctagctgccatggtgct480 ctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgetccccacctcc540 ccctttgaccctcaggatgcggcggtatatcgatgccatcttcaccaacagctaccggaa600 ggtgctggcccagctgtccgcccgcaagctgctccaggacatcctgaacaggcagcaggg660 agagaggaaccaagagcaaggagcataatgactgcaggaattcgatatcaagcttatcgg720 ggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccag780 tgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcct840 tctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaa900 cctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggc960 tcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgt1020 tgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggg1080 gtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccacctt1140 ggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctga1200 ttttaaaataactataccagcaggaggacgtccagacacagcataggctacctggccatg1260 cccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtcca1320 ctcagtagatgcctgttgaattcgataccgtcgacctcgagggggggcccggtaccagct1380 tttgttccctttagtgagggttaatttcgagcttggcgtaatcatggtcatagctgtttc1440 ctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagt1500 gtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgc1560 ccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcgg1620 ggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgct1680 cggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatcca1740 cagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccagga1800 accgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatc1860 acaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccagg1920 cgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggat1980 acctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggt2040 atctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttc2100 agcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacg2160 acttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcg2220 gtgctacaga gttcttgaag tggtggccta actacggcta cactagaaga acagtatttg 2280 gtatctgcgc tctgctgaag ccagttacct tcggaaaaag agttggtagc tcttgatccg 2340 gcaaacaaac caccgctggt agcggtggtt tttttgtttg caagcagcag attacgcgca 2400 gaaaaaaagg atctcaagaa gatcctttga tcttttctac ggggtctgac gctcagaaga 2460 actcgtcaag aaggcgatag aaggcgatgc gctgcgaatc gggagcggcg ataccgtaaa 2520 gcacgaggaa gcggtcagcc cattcgccgc caagctcttc agcaatatca cgggtagcca 2580 acgctatgtc ctgatagcgg tccgccacac ccagccggcc acagtcgatg aatccagaaa 2640 agcggccatt ttccaccatg atattcggca agcaggcatc gccatgggtc acgacgagat 2700 cctcgccgtc gggcatgcgc gccttgagcc tggcgaacag ttcggctggc gcgagcccct 2760 gatgctcttc gtccagatca tcctgatcga caagaccggc ttccatccga gtacgtgctc 2820 gctcgatgcg atgtttcgct tggtggtcga atgggcaggt agccggatca agcgtatgca 2880 gccgccgcat tgcatcagcc atgatggata ctttctcggc aggagcaagg tgagatgaca 2940 ggagatcctg ccccggcact tcgcccaata gcagccagtc ccttcccgct tcagtgacaa 3000 cgtcgagcac agctgcgcaa ggaacgcccg tcgtggccag ccacgatagc cgcgctgcct 3060 cgtcctgcag ttcattcagg gcaccggaca ggtcggtctt gacaaaaaga accgggcgcc 3120 cctgcgctga cagccggaac acggcggcat cagagcagcc gattgtctgt tgtgcccagt 3180 catagccgaa tagcctctcc acccaagcgg ccggagaacc tgcgtgcaat ccatcttgtt 3240 caatcatgcg aaacgatcct catcctgtct cttgatcaga tcttgatccc ctgcgccatc 3300 agatccttgg cggcaagaaa gccatccagt ttactttgca gggcttccca accttaccag 3360 agggcgcccc agctggcaat tccggttcgc ttgctgtcca taaaaccgcc cagtctagca 3420 actgttggga agggcgatcg gtgcgggcct cttcgctatt acgccagctg gcgaaagggg 3480 gatgtgctgc aaggcgatta agttgggtaa cgccagggtt ttcccagtca cgac 3534 <210> 13 <211> 3534 <212> DNA
<213> artificial sequence <220>
<223> Sequence for the operatively linked components of the TV-GHRH pla smid.
<400> 13 gttgtaaaac gacggccagt gaattgtaat acgactcact atagggcgaa ttggagctcc 60 accgeggtgg cggccgtccg ccctcggcac catcctcacg acacccaaat atggcgacgg 120 gtgaggaatggtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgt180 tggcgctctaaaaataactcccgggagttatttttagagcggaggaatggtggacaccca240 aatatggcgacggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccg300 cattcctgggggccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcgg360 cggcccacgagctacccggaggagcgggaggcgccaagctctagaactagtggatcccaa420 ggcccaactccccgaaccactcagggtcctgtggacagctcacctagctgccatggtgct480 ctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgctccccacctcc540 ccctttgaccctcaggatgcggcggtatgtagatgccatcttcaccaacagctaccggaa600 ggtgctggcccagctgtccgcccgcaagctgctccaggacatcctgaacaggcagcaggg660 agagaggaaccaagagcaaggagcataatgactgcaggaattcgatatcaagcttatcgg720 ggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccag780 tgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcct840 tctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaa900 cctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggc960 tcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgt1020 tgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggg1080 gtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccacctt1140 ggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctga1200 ttttaaaataactataccagcaggaggacgtccagacacagcataggctacctggccatg1260 cccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtcca1320 ctcagtagatgcctgttgaattcgataccgtcgacctcgagggggggcccggtaccagct1380 tttgttccctttagtgagggttaatttcgagcttggcgtaatcatggtcatagctgtttc1440 ctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagt1500 gtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgc1560 ccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcgg1620 ggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgct1680 cggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatcca1740 cagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccagga1800 accgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatc1860 acaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccagg1920 cgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggat1980 acctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggt2040 atctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttc2100 agcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacg2160 acttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcg2220 gtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttg2280 gtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccg2340 gcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgca2400 gaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagaaga2460 actcgtcaagaaggcgatagaaggcgatgcgctgcgaatcgggagcggcgataccgtaaa2520 gcacgaggaagcggtcagcccattcgccgccaagctcttcagcaatatcacgggtagcca2580 acgctatgtcctgatagcggtccgccacacccagccggccacagtcgatgaatccagaaa2640 agcggccattttccaccatgatattcggcaagcaggcatcgccatgggtcacgacgagat2700 cctcgccgtcgggcatgcgcgccttgagcctggcgaacagttcggctggcgcgagcccct2760 gatgctcttcgtccagatcatcctgatcgacaagaccggcttccatccgagtacgtgctc2820 gctcgatgcgatgtttcgcttggtggtcgaatgggcaggtagccggatcaagcgtatgca2880 gccgccgcattgcatcagccatgatggatactttctcggcaggagcaaggtgagatgaca2940 ggagatcctgccccggcacttcgcccaatagcagccagtcccttcccgcttcagtgacaa3000 cgtcgagcacagctgcgcaaggaacgcccgtcgtggccagccacgatagccgcgctgcct3060 cgtcctgcagttcattcagggcaccggacaggtcggtcttgacaaaaagaaccgggcgcc3120 cctgcgctgacagccggaacacggcggcatcagagcagccgattgtctgttgtgcccagt3180 catagccgaatagcctctccacccaagcggccggagaacctgcgtgcaatccatcttgtt3240 caatcatgcgaaacgatcctcatcctgtctcttgatcagatcttgatcccctgcgccatc3300 agatccttggcggcaagaaagccatccagtttactttgcagggcttcccaaccttaccag3360 agggcgccccagctggcaattccggttcgcttgctgtccataaaaccgcccagtctagca3420 actgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggg3480 gatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgac 3534 <210> 14 <211> 3534 <212> DNA
<213> artificial sequence <220>
<223> Sequence for the operatively linked components of the 15/27/28 GH
RH plasmid.
<400>
gttgtaaaacgacggccagtgaattgtaatacgactcactatagggcgaattggagctcc60 accgcggtggcggccgtccgccctcggcaccatcctcacgacacccaaatatggcgacgg120 gtgaggaatggtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgt180 tggcgctctaaaaataactcccgggagttatttttagagcggaggaatggtggacaccca240 aatatggcgacggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccg300 cattcctgggggccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcgg360 cggcccacgagctacccggaggagcgggaggcgccaagctctagaactagtggatcccaa420 ggcccaactccccgaaccactcagggtcctgtggacagctcacctagctgccatggtgct480 ctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgctccccacctcc540 ccctttgaccctcaggatgcggcggtatatcgatgccatcttcaccaacagctaccggaa600 ggtgctggcccagctgtccgcccgcaagctgctccaggacatcctgaacaggcagcaggg660 agagaggaaccaagagcaaggagcataatgactgcaggaattcgatatcaagcttatcgg720 ggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccag780 tgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcct840 tctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaa900 cctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggc960 tcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgt1020 tgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggg1080 gtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccacctt1140 ggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctga1200 ttttaaaataactataccagcaggaggacgtccagacacagcataggctacctggccatg1260 cccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtcca1320 ctcagtagatgcctgttgaattcgataccgtcgacctcgagggggggcccggtaccagct1380 tttgttccctttagtgagggttaatttcgagcttggcgtaatcatggtcatagctgtttc1440 ctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagt1500 gtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgc1560 ccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcgg1620 ggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgct1680 cggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatcca1740 cagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccagga1800 accgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatc1860 acaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccagg1920 cgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggat1980 acctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggt2040 atctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttc2100 agcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacg2160 acttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcg2220 gtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttg2280 gtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccg2340 gcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgca2400 gaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagaaga2460 actcgtcaagaaggcgatagaaggcgatgcgctgcgaatcgggagcggcgataccgtaaa2520 gcacgaggaagcggtcagcccattcgccgccaagctcttcagcaatatcacgggtagcca2580 acgctatgtcctgatagcggtccgccacacccagccggccacagtcgatgaatccagaaa2640 agcggccattttccaccatgatattcggcaagcaggcatcgccatgggtcacgacgagat2700 cctcgccgtcgggcatgcgcgccttgagcctggcgaacagttcggctggcgcgagcccct2760 gatgctcttcgtccagatcatcctgatcgacaagaccggcttccatccgagtacgtgctc2820 gctcgatgcgatgtttcgcttggtggtcgaatgggcaggtagccggatcaagcgtatgca2880 gccgccgcattgcatcagccatgatggatactttctcggcaggagcaaggtgagatgaca2940 ggagatcctgccccggcacttcgcccaatagcagccagtcccttcccgcttcagtgacaa3000 cgtcgagcacagctgcgcaaggaacgcccgtcgtggccagccacgatagccgcgctgcct3060 cgtcctgcagttcattcagggcaccggacaggtcggtcttgacaaaaagaaccgggcgcc3120 cctgcgctga cagccggaac acggcggcat cagagcagcc gattgtctgt tgtgcccagt 3180 catagccgaa tagcctctcc acccaagcgg ccggagaacc tgcgtgcaat ccatcttgtt 3240 caatcatgcg aaacgatcct catcctgtct cttgatcaga tcttgatccc ctgcgccatc 3300 agatccttgg cggcaagaaa gccatccagt ttactttgca gggcttccca accttaccag 3360 agggcgcccc agctggcaat tccggttcgc ttgctgtcca taaaaccgcc cagtctagca 3420 actgttggga agggcgatcg gtgcgggcct cttcgctatt acgccagctg gcgaaagggg 3480 gatgtgctgc aaggcgatta agttgggtaa cgccagggtt ttcccagtca cgac 3534 <210> 15 <211> 3534 <212> DNA
<213> artificial sequence <220>
<223> This is the entire plasmid sequence for wildtype GHRH.
<400>
gttgtaaaacgacggccagtgaattgtaatacgactcactatagggcgaattggagctcc60 accgcggtggcggccgtccgccctcggcaccatcctcacgacacccaaatatggcgacgg120 gtgaggaatggtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgt180 tggcgctctaaaaataactcccgggagttatttttagagcggaggaatggtggacaccca240 aatatggcgacggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccg300 cattcctgggggccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcgg360 cggcccacgagctacccggaggagcgggaggcgccaagctctagaactagtggatcccaa420 ggcccaactccccgaaccactcagggtcctgtggacagctcacctagctgccatggtgct480 ctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgctccccacctcc540 ccctttgaccctcaggatgcggcggtatgcagatgccatcttcaccaacagctaccggaa600 ggtgctgggccagctgtccgcccgcaagctgctccaggacatcatgagcaggcagcaggg660 agagaggaaccaagagcaaggagcataatgactgcaggaattcgatatcaagcttatcgg720 ggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccag780 tgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcct840 tctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaa900 cctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggc960 tcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgt1020 tgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggg1080 gtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccacctt1140 ggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctga1200 ttttaaaataactataccagcaggaggacgtccagacacagcataggctacctggccatg1260 cccaaccggt gggacatttg agttgcttgc ttggcactgt cctctcatgc gttgggtcca 1320 ctcagtagat gcctgttgaa ttcgataccg tcgacctcga gggggggccc ggtaccagct 1380 tttgttccct ttagtgaggg ttaatttcga gcttggcgta atcatggtca tagctgtttc 1440 ctgtgtgaaa ttgttatccg ctcacaattc cacacaacat acgagcegga agcataaagt 1500 gtaaagcctg gggtgcctaa tgagtgagct aactcacatt aattgcgttg cgctcactgc 1560 ccgctttcca gtcgggaaac ctgtcgtgcc agctgcatta atgaatcggc caacgcgcgg 1620 ggagaggcgg tttgcgtatt gggcgctctt ccgcttcctc gctcactgac tcgctgcgct 1680 cggtcgttcg gctgcggcga gcggtatcag ctcactcaaa ggcggtaata cggttatcca 1740 cagaatcagg ggataacgca ggaaagaaca tgtgagcaaa aggccagcaa aaggccagga 1800 accgtaaaaa ggccgcgttg ctggcgtttt tccataggct ccgcccccct gacgagcatc 1860 acaaaaatcg acgctcaagt cagaggtggc gaaacccgac aggactataa agataccagg 1920 cgtttccccc tggaagctcc ctcgtgcgct ctcctgttcc gaccctgccg cttaccggat 1980 acctgtccgc ctttctccct tcgggaageg tggcgctttc tcatagctca cgctgtaggt 2040 atctcagttc ggtgtaggtc gttcgctcca agctgggctg tgtgcacgaa ccccccgttc 2100 agcccgaccg ctgcgcctta tccggtaact atcgtcttga gtccaacccg gtaagacacg 2160 acttatcgcc actggcagca gccactggta acaggattag cagagcgagg tatgtaggcg 2220 gtgctacaga gttcttgaag tggtggccta actacggcta cactagaaga acagtatttg 2280 gtatctgcgc tctgctgaag ccagttacct tcggaaaaag agttggtagc tcttgatccg 2340 gcaaacaaac caccgctggt agcggtggtt tttttgtttg caagcagcag attacgcgca 2400 gaaaaaaagg atctcaagaa gatcctttga tcttttctac ggggtctgac gctcagaaga 2460 actcgtcaag aaggcgatag aaggcgatgc gctgcgaatc gggagcggcg ataccgtaaa 2520 gcacgaggaa gcggtcagcc cattcgccgc caagctcttc agcaatatca cgggtagcca 2580 acgctatgtc ctgatagcgg tccgccacac ccagccggcc acagtcgatg aatccagaaa 2640 agcggccatt ttccaccatg atattcggca agcaggcatc gccatgggtc acgacgagat 2700 cctcgccgtc gggcatgcgc gccttgagcc tggcgaacag ttcggctggc gcgagcccct 2760 gatgctcttc gtccagatca tcctgatcga caagaccggc ttccatccga gtacgtgctc 2820 gctcgatgcg atgtttcgct tggtggtcga atgggcaggt agccggatca agcgtatgca 2880 gccgccgcat tgcatcagcc atgatggata ctttctcggc aggagcaagg tgagatgaca 2940 ggagatcctg ccccggcact tcgcccaata gcagccagtc ccttcccgct tcagtgacaa 3000 cgtcgagcac agctgcgcaa ggaacgcccg tcgtggccag ccacgatagc cgcgctgcct 3060 cgtcctgcag ttcattcagg gcaccggaca ggtcggtctt gacaaaaaga accgggcgcc 3120 cctgcgctgacagccggaacacggcggcatcagagcagccgattgtctgttgtgcccagt3180 catagccgaatagcctctccacccaagcggccggagaacctgcgtgcaatccatcttgtt3240 caatcatgcgaaacgatcctcatcctgtctcttgatcagatcttgatCCCCtgCgCCatC3300 agatccttggcggcaagaaagccatccagtttactttgcagggcttcccaaccttaccag3360 agggcgccccagctggcaattccggttcgcttgctgtccataaaaccgcccagtctagca3420 actgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggg3480 gatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgac 3534 <210>
<211>
<212>
DNA
<213>
Artificial sequence <220>
<223>
This is the sequence for the pSP-SEAP
cDNA
construct <400>
ggccgtccgccttcggcaccatcctcacgacacccaaatatggcgacgggtgaggaatgg60 tggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaa120 aaataactcccgggagttatttttagagcggaggaatggtggacacccaaatatggcgac180 ggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccgcattcctgggg240 gccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcggcggcecacgag300 ctacccggaggagcgggaggcgccaagctctagaactagtggatcccccgggctgcagga360 attcgatatcaagcttcgaatcgcgaattcgcccaccatgctgctgctgctgctgctgct420 gggcctgaggctacagctctccctgggcatcatcccagttgaggaggagaacccggactt480 ctggaaccgcgaggcagccgaggccctgggtgccgccaagaagctgcagcctgcacagac540 agccgccaagaacctcatcatcttcctgggcgatgggatgggggtgtctacggtgacagc600 tgccaggatcctaaaagggcagaagaaggacaaactggggcctgagatacccctggccat660 ggaccgcttcccatatgtggctctgtccaagacatacaatgtagacaaacatgtgccaga720 cagtggagccacagccacggcctacctgtgcggggtcaagggcaacttccagaccattgg780 cttgagtgcagccgcccgctttaaccagtgcaacacgacacgcggcaacgaggtcatctc840 cgtgatgaatcgggccaagaaagcagggaagtcagtgggagtggtaaccaccacacgagt900 gcagcacgectcgccagccggcacctacgcccacacggtgaaccgcaactggtactcgga960 cgccgacgtgcctgcctcggcccgccaggaggggtgccaggacatcgctacgcagctcat1020 ctccaacatggacattgacgtgatcctaggtggaggccgaaagtacatgtttcgcatggg1080 aaccccagaccctgagtacccagatgactacagccaaggtgggaccaggctggacgggaa1140 gaatctggtgcaggaatggctggcgaagcgccagggtgcccggtatgtgtggaaccgcac1200 tgagctcatgcaggcttccctggacccgtctgtgacccatctcatgggtctctttgagcc1260 tggagacatgaaatacgagatccaccgagactccacactggacccctccctgatggagat1320 gacagaggctgccctgcgcctgctgagcaggaacccccgcggcttcttcctcttcgtgga1380 gggtggtcgcatcgaccatggtcatcatgaaagcagggcttaccgggcactgactgagac1440 gatcatgttcgacgacgccattgagagggcgggccagctcaccagcgaggaggacacgct1500 gagcctcgtcactgccgaccactcccacgtcttctccttcggaggctaccccctgcgagg1560 gagctccatcttcgggctggcccctggcaaggcccgggacaggaaggcctacacggtcct1620 cctatacggaaacggtccaggctatgtgctcaaggacggcgcccggccggatgttaccga1680 gagcgagagcgggagccccgagtatcggcagcagtcagcagtgcccctggacgaagagac1740 ccacgcaggcgaggacgtggcggtgttcgcgcgcggcccgcaggcgcacctggttcacgg1800 cgtgcaggagcagaccttcatagcgcacgtcatggccttcgccgcctgcctggagcccta1860 caccgcctgcgacctggcgccccccgccggcaccaccgacgccgcgcacccgggttactc1920 tagagtcggggcggccggccgcttcgagcagacatgataagatacattgatgagtttgga1980 caaaccacaactagaatgcagtgaaaaaaatgctttatttgtgaaatttgtgatgctatt2040 gctttatttgtaaccattataagctgcaataaacaagttaacaacaacaattgcattcat2100 tttatgtttcaggttcagggggaggtgtgggaggttttttaaagcaagtaaaacctctac2160 aaatgtggtaaaatcgataaggatccgtcgaCCgatgCCCttgagagccttcaacccagt2220 cagctccttccggtgggcgcggggcatgactatCgtCgCCgcacttatgactgtcttctt2280 tatcatgcaactcgtaggacaggtgccggcagcgctcttccgcttcctcgctcactgact2340 cgctgcgctcggtcgttcggctgeggcgagcggtatcagctcactcaaaggcggtaatac2400 ggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaa2460 aggccaggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctg2520 acgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaa2580 gataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgc2640 ttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcac2700 gctgtaggta tctcagttcg gtgtaggtcg ttcgctccaa gctgggctgt gtgcacgaac 2760 cccccgttca gcccgaccgc tgcgccttat ccggtaacta tcgtcttgag tccaacccgg 2820 taagacacga cttatcgcca ctggcagcag ccactggtaa caggattagc agagcgaggt 2880 atgtaggcgg tgctacagag ttcttgaagt ggtggcctaa ctacggctac actagaagga 2940 cagtatttgg tatctgcgct ctgctgaagc cagttacctt cggaaaaaga gttggtagct 3000 cttgatccgg caaacaaacc accgctggta gcggtggttt ttttgtttgc aagcagcaga 3060 ttacgcgcag aaaaaaagga tctcaagaag atcctttgat cttttctacg gggtctgacg 3120 ctcagtggaa cgaaaactca cgttaaggga ttttggtcat gagattatca aaaaggatct 3180 tcacctagat ccttttaaat taaaaatgaa gttttaaatc aatctaaagt atatatgagt 3240 aaacttggtc tgacagttac caatgcttaa tcagtgaggc acctatctca gcgatctgtc 3300 tatttcgttc atccatagtt gcctgactcc ccgtcgtgta gataactacg atacgggagg 3360 gcttaccatc tggccccagt gctgcaatga taccgcgaga cccacgctca ccggctccag 3420 atttatcagc aataaaccag ccagccggaa gggccgagcg cagaagtggt cctgcaactt 3480 tatccgcctc catccagtct attaattgtt gccgggaagc tagagtaagt agttcgccag 3540 ttaatagttt gcgcaacgtt gttgccattg ctacaggcat cgtggtgtca cgctcgtcgt 3600 ttggtatggc ttcattcagc tccggttccc aacgatcaag gcgagttaca tgatccccca 3660 tgttgtgcaa aaaagcggtt agctccttcg gtcctccgat cgttgtcaga agtaagttgg 3720 ccgcagtgtt atcactcatg gttatggcag cactgcataa ttctcttact gtcatgccat 3780 ccgtaagatg cttttctgtg actggtgagt actcaaccaa gtcattctga gaatagtgta 3840 tgcggcgacc gagttgctct tgcccggcgt caatacggga taataccgcg ccacatagca 3900 gaactttaaa agtgctcatc attggaaaac gttcttcggg gcgaaaactc tcaaggatct 3960 taccgctgtt gagatccagt tcgatgtaac ccactcgtgc acccaactga tcttcagcat 4020 cttttacttt caccagcgtt tctgggtgag caaaaacagg aaggcaaaat gccgcaaaaa 4080 agggaataag ggcgacacgg aaatgttgaa tactcatact cttccttttt caatattatt 4140 gaagcattta tcagggttat tgtctcatga gcggatacat atttgaatgt atttagaaaa 4200 ataaacaaat aggggttccg cgcacatttc cccgaaaagt gccacctgac gcgccctgta 4260 <210> 17 <211> 2710 <212> DNA
<213> artificial sequence <220>
<223> Plasmid vector with an analog GHRH sequence codon optimized for m Ouse.
<400>
tgtaatacgactcactatagggcgaattggagctccaccgcggtggcggccgtccgccct60 cggcaccatcctcacgacacccaaatatggcgacgggtgaggaatggtggggagttattt120 ttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaaaaataactcccgg180 gagttatttttagagcggaggaatggtggacacccaaatatggcgacggttcctcacccg240 tcgccatatttgggtgtccgccctcggccggggccgcattcctgggggccgggcggtgct300 cccgcccgcctcgataaaaggctccggggccggcggcggcccacgagctacccggaggag360 cgggaggcgccaagcggatcccaaggcccaactccccgaaccactcagggtcctgtggac420 agctcacctagctgccatggtgctctgggtgctctttgtgatcctcatcctcaccagcgg480 cagccactgcagcctgcctcccagccctcccttcaggatgcagaggcacgtggacgccat540 cttcaccaccaactacaggaagctgctgagccagctgtacgccaggaaggtgatccagga600 catcatgaacaagcagggcgagaggatccaggagcagagggccaggctgagctgataagc660 ttatcggggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgcc720 actccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactag780 gtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagttggg840 aagacaacctgtagggctcgagggggggcccggtaccagcttttgttccctttagtgagg900 gttaatttcgagcttggtcttccgcttcctcgctcactgactcgctgcgctcggtcgttc960 ggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcag1020 gggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaa1080 aggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatc1140 gacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttcccc1200 ctggaagctccctcgtgcgctCtCCtgttCCgaCCCtgCCgcttaccggatacctgtccg1260 cctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagtt1320 cggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgacc1380 gctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgc1440 cactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacag1500 agttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcg1560 ctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaa1620 ccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaag1680 gatctcaagaagatcctttgatcttttctacggggctagcgcttagaagaactcatccag1740 cagacggtagaatgcaatacgttgagagtctggagctgcaataccatacagaaccaggaa1800 acggtcagcccattcaccacccagttcctctgcaatgtcacgggtagccagtgcaatgtc1860 ctggtaacggtctgcaacacccagacgaccacagtcaatgaaaccagagaaacgaccatt1920 ctcaaccatgatgttcggcaggcatgcatcaccatgagtaactaccaggtcctcaccatc1980 cggcatacgagctttcagacgtgcaaacagttcagccggtgccagaccctgatgttcctc2040 atccaggtcatcctggtcaaccagacctgcttccatacgggtacgagcacgttcaatacg2100 atgttttgcctggtggtcaaacggacaggtagctgggtccagggtgtgcagacgacgcat2160 tgcatcagccatgatagaaactttctctgccggagccaggtgagaagacagcaggtcctg2220 acccggaacttcacccagcagcagccagtcacgaccagcttcagtaactacatccagaac2280 tgcagcacacggaacaccagtggttgccagccaagacagacgagctgcttcatcctgcag2340 ttcattcagagcaccagacaggtcagttttaacaaacagaactggacgaccctgtgcaga2400 cagacggaaaacagctgcatcagagcaaccaatggtctgctgtgcccagtcataaccaaa2460 cagacgttcaacccaggctgccggagaacctgcatgcagaccatcctgttcaatcatgcg2520 aaacgatcctcatcctgtctcttgatcagatcttgatcccctgcgccatcagatccttgg2580 cggcaagaaagccatccagtttactttgcagggcttcccaaccttaccagagggcgcccc2640 agctggcaattccggttcgcttgctgtccataaaaccgcccagtctagcaactgttggga2700 agggcgatcg 2710 <210>
<211>
<212>
DNA
<213> ficial arti sequence <220>
<223> mid vectorwith an for Plas analog r GHRH
sequence codon optimized at.
<400>
tgtaatacgactcactatagggcgaattggagctccaccgcggtggcggccgtccgccct60 cggcaccatcctcacgacacccaaatatggcgacgggtgaggaatggtggggagttattt120 ttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaaaaataactcccgg180 gagttatttttagagcggaggaatggtggacacccaaatatggcgacggttcctcacccg240 tcgccatatttgggtgtccgccctcggccggggccgcattcctgggggccgggcggtgct300 cccgcccgcctcgataaaaggctccggggccggcggcggcccacgagctacccggaggag360 cgggaggcgccaagcggatcccaaggcccaactccccgaaccactcagggtcctgtggac420 agctcacctagctgccatggccctgtgggtgttcttcgtgctgctgaccctgaccagcgg480 aagccactgcagcctgcctcccagccctcccttcagggtgcgccggcacgccgacgccat540 cttcaccagcagctacaggaggatcctgggccagctgtacgctaggaagctcctgcacga600 gatcatgaacaggcagcagggcgagaggaaccaggagcagaggagcaggttcaactgata660 agcttatcggggtggcatccctgtgacccctccccagtgcctctcctggccctggaagtt720 gccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgac780 taggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagtt840 gggaagacaacctgtagggctcgagggggggcccggtaccagcttttgttccctttagtg900 agggttaatttcgagcttggtcttccgcttcctcgctcactgactcgctgcgctcggtcg960 ttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaat1020 caggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgta1080 aaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaa1140 atcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttc1200 cccctggaagctccctcgtgCgCtC'tCCtgttCCgaCCCtgCCgCttaCCggatacctgt1260 ccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctca1320 gttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccg1380 accgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttat1440 cgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgcta1500 cagagttcttgaagtggtggcetaactacggctacactagaagaacagtatttggtatct1560 gcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaac1620 aaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaa1680 aaggatctcaagaagatcctttgatcttttctacggggctagcgcttagaagaactcatc1740 cagcagacgg tagaatgcaa tacgttgaga gtctggagct gcaataccat acagaaccag 1800 gaaacggtca gcccattcac cacccagttc ctctgcaatg tcacgggtag ccagtgcaat 1860 gtcctggtaa cggtctgcaa cacccagacg accacagtca atgaaaccag agaaacgacc 1920 attctcaacc atgatgttcg gcaggcatgc atcaccatga gtaactacca ggtcctcacc 1980 atccggcata cgagctttca gacgtgcaaa cagttcagcc ggtgccagac cctgatgttc 2040 ctcatccagg tcatcctggt caaccagacc tgcttccata cgggtacgag cacgttcaat 2100 ~1 acgatgttttgcctggtggtcaaacggacaggtagctgggtccagggtgtgcagacgacg2160 cattgcatcagccatgatagaaactttctctgccggagccaggtgagaagacagcaggtc2220 ctgacccggaacttcacccagcagcagccagtcacgaccagcttcagtaactacatccag2280 aactgcagcacacggaacaccagtggttgccagccaagacagacgagctgcttcatcctg2340 cagttcattcagagcaccagacaggtoagttttaacaaacagaactggacgaccctgtgc2400 agacagacggaaaacagctgcatcagagcaaccaatggtctgctgtgcccagtcataacc2460 aaacagacgttcaacccaggctgccggagaacctgcatgcagaccatcctgttcaatcat2520 gcgaaacgatcctcatcctgtctcttgatcagatcttgatcccctgcgccatcagatcct2580 tggcggcaagaaagccatccagtttactttgcagggcttcccaaccttaccagagggcgc2640 cccagctggcaattccggttcgcttgctgtccataaaaccgcccagtctagcaactgttg2700 ggaagggcga tcg 2713 <210>
<211>
<212>
DNA
<213>
artificial sequence <220>
<223> with an for Plasmid analog b vector GHRH
sequence codon optimized ovine.
<400>
tgtaatacgactcactatagggcgaattggagctccaccgcggtggcggccgtccgccct60 cggcaccatcctcacgacacccaaatatggcgacgggtgaggaatggtggggagttattt120 ttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaaaaataactcccgg180 gagttatttttagagcggaggaatggtggacacccaaatatggcgacggttcctcacccg240 tcgccatatttgggtgtccgccctcggccggggccgcattcctgggggccgggcggtgct300 CCCgCCCgCCtcgataaaaggctccggggccggcggcggcccacgagctacccggaggag360 cgggaggcgccaagcggatcccaaggcccaactccccgaaccactcagggtcctgtggac420 agctcacctagctgccatggtgctgtgggtgttcttcctggtgaccctgaccctgagcag480 cggctcccacggctccctgccctcccagcctctgcgcatccctcgctacgccgacgccat540 cttcaccaacagctaccgcaaggtgctcggccagctcagcgcccgcaagctcctgcagga600 catcatgaaccggcagcagggcgagcgcaaccaggagcagggagcctgataagcttatcg660 gggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactcca720 gtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcc780 ttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagaca840 acctgtagggctcgagggggggcccggtaccagcttttgttccctttagtgagggttaat900 ttcgagcttggtcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgc960 ggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggata1020 acgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccg1080 cgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgct1140 caagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaa1200 gctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttc1260 tcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgt1320 aggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcg1380 ccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactgg1440 cagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttct1500 tgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgc1560 tgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccg1620 ctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctc1680 aagaagatcctttgatcttttctacggggctagcgcttagaagaactcatccagcagacg1740 gtagaatgcaatacgttgagagtctggagctgcaataccatacagaaccaggaaacggtc1800 agcccattcaccacccagttcctctgcaatgtcacgggtagccagtgcaatgtcctggta1860 acggtctgcaacacccagacgaccacagtcaatgaaaccagagaaacgaccattctcaac1920 catgatgttcggcaggcatgcatcaccatgagtaactaccaggtcctcaccatccggcat1980 acgagctttcagacgtgcaaacagttcagccggtgccagaccctgatgttcctcatccag2040 gtcatcctggtcaaccagacctgcttccatacgggtacgagcacgttcaatacgatgttt2100 tgcctggtggtcaaacggacaggtagctgggtccagggtgtgcagacgacgcattgcatc2160 agccatgatagaaactttctctgccggagccaggtgagaagacagcaggtcctgacccgg2220 aacttcacccagcagcagccagtcacgaccagcttcagtaactacatccagaactgcagc2280 acacggaacaccagtggttgccagccaagacagacgagctgcttcatcctgcagttcatt2340 cagagcaccagacaggtcagttttaacaaacagaactggacgaccctgtgcagacagacg2400 gaaaacagctgcatcagagcaaccaatggtctgctgtgcccagtcataaccaaacagacg2460 ttcaacccaggctgccggagaacctgcatgcagaccatcctgttcaatcatgcgaaacga2520 tcctcatcctgtctcttgatcagatcttgatcccctgcgccatcagatccttggcggcaa2580 gaaagccatc cagtttactt tgcagggctt cccaacctta ccagagggcg ccccagctgg 2640 caattccggt tcgcttgctg tccataaaac cgcccagtct agcaactgtt gggaagggcg 2700 atcg 2704 <210>
<211>
<212>
DNA
<213>
artificial sequence <220>
<223> with for Plasmid an analog o vector GHRH
sequence codon optimized vine.
<400>
tgtaatacgactcactatagggcgaattggagctccaccgcggtggcggccgtccgccct60 cggcaccatcctcacgacacccaaatatggcgacgggtgaggaatggtggggagttattt120 ttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaaaaataactcccgg180 gagttatttttagagcggaggaatggtggacacccaaatatggcgacggttcctcacccg240 tcgccatatttgggtgtccgccctcggccggggccgcattcctgggggccgggcggtgct300 cccgcccgcctcgataaaaggctccggggccggcggcggcccacgagctacccggaggag360 cgggaggcgccaagcggatcccaaggcccaactccccgaaccactcagggtcctgtggac420 agctcacctagctgccatggtgctgtgggtgttcttcctggtgaccctgaccctgagcag480 cggaagccacggcagcctgcccagccagcccctgaggatccctaggtacgccgacgccat540 cttcaccaacagctacaggaagatcctgggccagctgagcgctaggaagctcctgcagga600 catcatgaacaggcagcagggcgagaggaaccaggagcagggcgcctgataagcttatcg660 gggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactcca720 gtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcc780 ttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagaca840 acctgtagggctcgagggggggcccggtaccagcttttgttccctttagtgagggttaat900 ttcgagcttggtcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgc960 ggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggata1020 acgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccg1080 cgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgct1140 caagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaa1200 gctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttc1260 tcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgt1320 aggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcg1380 ccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactgg1440 cagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttct1500 tgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgc1560 tgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccg1620 ctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctc1680 aagaagatcctttgatcttttctacggggctagcgcttagaagaactcatccagcagacg1740 gtagaatgcaatacgttgagagtctggagctgcaataccatacagaaccaggaaacggtc1800 agcccattcaccacccagttcctctgcaatgtcacgggtagccagtgcaatgtcctggta1860 acggtctgcaacacccagacgaccacagtcaatgaaaccagagaaacgaccattctcaac1920 catgatgttcggcaggcatgcatcaccatgagtaactaccaggtcctcaccatccggcat1980 acgagctttcagacgtgcaaacagttcagccggtgccagaccctgatgttcctcatccag2040 gtcatcctggtcaaccagacctgcttccatacgggtacgagcacgttcaatacgatgttt2100 tgcctggtggtcaaacggacaggtagctgggtccagggtgtgcagacgacgcattgcatc2160 agccatgatagaaactttctctgccggagccaggtgagaagacagcaggtcctgacccgg2220 aacttcacccagcagcagccagtcacgaccagcttcagtaactacatccagaactgcagc2280 acacggaacaccagtggttgccagccaagacagacgagctgcttcatcctgcagttcatt2340 cagagcaccagacaggtcagttttaacaaacagaactggacgaccctgtgcagacagacg2400 gaaaacagctgcatcagagcaaccaatggtctgctgtgcccagtcataaccaaacagacg2460 ttcaacccaggctgccggagaacctgcatgcagaccatcctgttcaatcatgcgaaacga2520 tcctcatcctgtctcttgatcagatcttgatcccctgcgccatcagatccttggcggcaa2580 gaaagccatccagtttactttgcagggcttcccaaccttaccagagggcgccccagctgg2640 caattccggttcgcttgctgtccataaaaccgcccagtctagcaactgttgggaagggcg2700 atcg 2704 <210> 21 <211> 2713 <212> DNA
<213> artificial sequence <220>
<223> Plasmid vector with an analog GHRH sequence codon optimized for c hicken.
<400>
tgtaatacgactcactatagggcgaattggagctccaccgcggtggcggccgtccgccct60 cggcaccatcctcacgacacccaaatatggcgacgggtgaggaatggtggggagttattt120 ttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaaaaataactcccgg180 gagttatttttagagcggaggaatggtggacacccaaatatggcgacggttcctcacccg240 tcgccatatttgggtgtccgccctcggccggggccgcattcctgggggccgggcggtgct300 cccgcccgcctcgataaaaggctccggggccggcggcggcccacgagctacccggaggag360 cgggaggcgccaagcggatcccaaggcccaactccccgaaccactcagggtcctgtggac420 agctcacctagctgccatggccctgtgggtgttctttgtgctgctgaccctgacctccgg480 aagccactgcagcctgccacccagcccacccttccgcgtcaggcgccacgccgacggcat540 cttcagcaaggcctaccgcaagctcctgggccagctgagcgcacgcaactacctgcacag600 cctgatggccaagcgcgtgggcagcggactgggagacgaggccgagcccctgagctgata660 agcttatcggggtggcatccctgtgacccctccccagtgcctctcctggccctggaagtt720 gccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgac780 taggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagtt840 gggaagacaacctgtagggctcgagggggggcccggtaccagcttttgttccctttagtg900 agggttaatttcgagcttggtcttccgcttcctcgctcactgactcgctgcgctcggtcg960 ttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaat1020 caggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgta1080 aaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaa1140 atcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttc1200 cccctggaagctccctcgtgCgCtCtCCtgttCCgaCCCtgCCgCttaCCggatacctgt1260 ccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctca1320 gttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccg1380 accgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttat1440 cgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgcta1500 cagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatct1560 gcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaac1620 aaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaa1680 aaggatctcaagaagatcctttgatcttttctacggggctagcgcttagaagaactcatc1740 cagcagacggtagaatgcaatacgttgagagtctggagctgcaataccatacagaaccag1800 gaaacggtcagcccattcaccacccagttcctctgcaatgtcacgggtagccagtgcaat1860 gtcctggtaacggtctgcaacacccagacgaccacagtcaatgaaaccagagaaacgacc1920 attctcaaccatgatgttcggcaggcatgcatcaccatgagtaactaccaggtcctcacc1980 atccggcatacgagctttcagacgtgcaaacagttcagccggtgccagaccctgatgttc2040 ctcatccaggtcatcctggtcaaccagacctgcttccatacgggtacgagcacgttcaat2100 acgatgttttgcctggtggtcaaacggacaggtagctgggtccagggtgtgcagacgacg2160 cattgcatcagccatgatagaaactttctctgccggagccaggtgagaagacagcaggtc2220 ctgacccggaacttcacccagcagcagccagtcacgaccagcttcagtaactacatccag2280 aactgcagcacacggaacaccagtggttgccagccaagacagacgagctgcttcatcctg2340 cagttcattcagagcaccagacaggtcagttttaacaaacagaactggacgaccctgtgc2400 agacagacggaaaacagctgcatcagagcaaccaatggtctgctgtgcccagtcataacc2460 aaacagacgttcaacccaggctgccggagaacctgcatgcagaccatcctgttcaatcat2520 gcgaaacgatcctcatcctgtctcttgatcagatcttgatcccctgcgccatcagatcct2580 tggcggcaagaaagccatccagtttactttgcagggcttcccaaccttaccagagggcgc2640 cccagctggcaattccggttcgcttgctgtccataaaaccgcccagtctagcaactgttg2700 ggaagggcgatcg <210> 22 <211> 55 <212> DNA
<213> artificial sequence <220>
<223> Sequence of a human growth hormone ("hGH") 5' UTR.
<400> 22 caaggcccaa ctccccgaac cactcagggt cctgtggaca gctcacctag ctgcc 55 <210> 23 <211> 782 <212> DNA
<213> artificial sequence <220>
<223> This is a nucleic acid sequence of a plasmid pUC-18 origin of rep licaiton <400> 23 tcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggta60 tcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaag120 aacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgcgttgctggcg180 tttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagagg240 tggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtg300 CgCtCtCCtgttCCgaCCCtgCCgCttaCCggatacctgtccgcctttctcccttcggga360 agcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgc420 tccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggt480 aactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccact540 ggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtgg600 cctaactacggctacactagaaggacagtatttggtatctgcgctctgctgaagccagtt660 accttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggt720 ggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcct780 tt 782 <210> 24 <21l> 5 <212> DNA
<213> artificial sequence <220>
<223> This is a NEO ribosomal binding site.
<400> 24 tcctC 5 <210> 25 <211> 29 <212> DNA
<213> artificial sequence <220>
<223> This is a nucleic acid sequence of a prokaryotic PNEO promoter.
<400> 25 accttaccag agggcgcccc agctggcaa 29 2~
[0061 ] The advantage of a constant-current is that the pulse can be prevented from attaining an amplitude at which the cells are destroyed. In a predetermined voltage system, the current can attain a destructive intensity, and the operator can not prevent that from happening. In a constant-current system, the current is preset under a threshold level where cell death does not occur. The exact setting of the current is dependent of the electrode configuration, and it must be determined experimentally. However, once the proper level has been determined, cell survival is assured, from case to case. The addition of a nucleic acid expression construct associated with a transfection facilitating polypeptide increases the opportunity of electroporated cells to incorporate the plasmid construct.
[0062] Nucleic acid constructs for therapy: One aspect of this invention relates to a composition and method for efficient delivery of a nucleic acid construct to a tissue as a treatment for various diseases found in chronically ill subjects. More specifically, the aspects of this invention pertain to a method for delivering a heterologous nucleic acid sequence that is encoding a specific gene (e.g. growth hormone releasing hormone ("GHRH") or biological equivalent thereof) into one or more cells of the sub] ect (e.g. somatic, stem, or germ cells) and allowing expression of the encoded gene (e.g. GHRH or biological equivalent thereof] to occur while the modified cells are within the subject. The method of delivering the nucleic acid sequence encoding the gene is via electroporation. The subsequent expression of the encoded gene can be regulated by a tissue specific promoter (e.g. muscle), and/or by a regulator protein that contains a modified ligand-binding domain (e.g.
molecular switch), which will only be active when the correct modified ligand (e.g. mifepistone) is externally administered into the subject. For example, the extracranial expression and ensuing release of GHRH or biological equivalent thereof by the modified cells can be used to treat anemia, wasting, immune dysfunction, life extension or other disorders in the chronically ill subject.
[0063] Recombinant GH replacement therapy is widely used clinically, with beneficial effects, but generally, the doses are supraphysiological. Such elevated doses of recombinant GH are associated with deleterious side-effects, for example, up to 30% of the recombinant GH treated patients report a higher frequency of insulin resistance or accelerated bone epiphysis growth and closure in pediatric patients. In addition, molecular heterogeneity 1~
of circulating GH may have important implications in growth and homeostasis, which can lead to a less potent GH that has a reduced ability to stimulate the prolactin receptor. These unwanted side effects result from the fact that treatment with recombinant exogenous GH
protein raises basal levels of GH and abolishes the natural episodic pulses of GH. In contradistinction, no side effects have been reported for recombinant GHRH
therapies. The normal levels of GHRH in the pituitary portal circulation range from 150-to-800 pg/ml, while systemic circulating values of the hormone are up to 100-500 pg/ml. Some patients with acromegaly caused by extracranial tumors have level that is nearly 100 times as high (e.g. 50 ng/ml of immunoreactive GHRH). Long term studies using recombinant GHRH
therapies (1-years) in children and elderly humans have shown an absence of the classical GH side-effects, such as changes in fasting glucose concentration or, in pediatric patients, the accelerated bone epiphysal growth and closure or slipping of the capital femoral epiphysis.
Thus, recombinant GHRH therapy may be more physiological than recombinant GH
therapy.
Unfortunately, due to the short half life of the peptide in vivo, frequent (i.e. one to three times a day) intravenous or subcutaneous administration is necessary if the recombinant protein is used. A gene transfer approach, however could overcome this limitations to GHRH use.
Moreover, a wide range of doses can be therapeutic. The choice of GHRH for a gene therapeutic application is favored by the fact that the gene, cDNA and native and several mutated molecules have been characterized for the pig and other species, and the measurement of therapeutic efficacy is straightforward and unequivocal.
[0064] The invention may be better understood with reference to the following examples, which are representative of some of the embodiments of the invention, and are not intended to limit the invention.
[0065] EXAMPLE 1. Plasmid vectors containing the muscle specific synthetic promoter SPcS-12 were previously described (Li et al.,1999). Wild type and mutated porcine GHRH cDNAs were generated by site directed mutagenesis of GHRH cDNA (Altered Sites II
in vitf~o Mutagenesis System, Promega, Madison, WI), and cloned into the BamHI/ Hind III
sites of pSPcS-12, to generate pSP-wt-GHRH, or pSP-HV-GHRH respectively. The 3' untranslated region (3'UTR) of growth hormone was cloned downstream of GHRH
cDNA.
The resultant plasmids contained mutated coding region for GHRH, and the resultant amino acid sequences were not naturally present in mammals. Although not wanting to be bound by theory, the effects on treating anemia; increasing total red blood cell mass in a subject;
reversing the wasting; reversing abnormal weight loss; treating immune dysfunction;
reversing the suppression of lyrnphopoesis; or extending life expectancy for the chronically ill subject are determined ultimately by the circulating levels of analog GHRH
hormones.
Several different plasmids that encoded different mutated amino acid sequences of GHRH or functional biological equivalent thereof are as follows:
Plasmid Encoded Amino Acid Seguence wt-GHRH YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGA-OH
(SEQID#5) HV-GHRH HVDAIFTNSYRKVLAQLSARKLLQDILNRQQGERNQEQGA-OH
(SEQID# 1 ) TI-GHRH YIDAIFTNSYRKVLAQLSARKLLQDILNRQQGERNQEQGA-OH
(SEQID#2) TV-GHRH YVDAIFTNSYRKVLAQLSARKLLQDILNRQQGERNQEQGA-OH
(SEQID#3) 15/27/28- YADAIFTNSYRI~VLAQLSARKLLQDILNRQQGERNQEQGA-OH
GHRH (SEQID#4) In general, the encoded GHRH or functional biological equivalent thereof is of formula (SeqID#6):
-A_1-Az-DAIFTNSYRKVL-A3-QLSARKLLQDI-A4-AS-RQQGERNQEQGA-OH
wherein: a standard one letter amino acid abbreviation is used; and A1 is a D-or L-isomer of an amino acid selected from the group consisting of tyrosine ("Y"), or histidine ("H"); AZ is a D-or L-isomer of an amino acid selected from the group consisting of alanine ("A"), valine ("V"), or isoleucine ("I"); A3 is a D-or L-isomer of an amino acid selected from the group consisting of alanine ("A") or glycine ("G"); A4 is a D-or L-isomer of an amino acid selected from the group consisting of methionein ("M"), or leucine ("L"); A5 is a D-or L-isomer of an amino acid selected from the group consisting of serine ("S") or asparagines ("N").
[0066] Another plasmid that was utilized included the pSP-SEAP construct that contains the SacI/ HindIII SPcS-12 fragment, SEAP gene and SV40 3'UTR from pSEAP-2 Basic Vector (Clontech Laboratories, Inc., Palo Alto, CA).
[0067] The plasmids described above do not contain polylinker, IGF-I gene, a skeletal a-actin promoter or a skeletal a-actin 3' UTR (untranslated region) /
NCR (non-coding region). Furthermore, these plasmids were introduced by muscle injection, followed by in vivo electroporation, as described below.
[0068] In terms of "functional biological equivalents," it is well understood by the skilled artisan that, inherent in the definition of a "biologically functional equivalent" protein and/or polynucleotide, is the concept that there is a limit to the number of changes that may be made within a defined portion of the molecule while retaining a molecule with an acceptable level of equivalent biological activity. Functional biological equivalents are thus defined herein as those proteins (and polynucleotides) in selected amino acids (or codons) may be substituted. A peptide comprising a functional biological equivalent of GHRH
is a polypeptide that has been engineered to contain distinct amino acid sequences while simultaneously having similar or improved biologically activity when compared to GHRH.
For example one biological activity of GHRH is to facilitate growth hormone ("GH") secretion in the subject.
[0069] Plasmid associated with PLG in mice. In order to demonstrate the improved uptake of electroporated cells with a composition of a nucleic acid expression construct associated with a transfection facilitating polypeptide, a series of electroporation experiments were designed. Three separate sets of experiments were conducted in mice. All mice were given a total of 30 ~,g (micrograms) pSP-SEAP (approximately 5,000 base pairs ("bp")), +/- PLG (weighted average MW = 10,900) in a total volume of 25 ~,l (microliters).
One group of 10 mice received naked, non-coated plasmid; the subsequent groups received plasmid coated with decreasing concentrations of PLG (see Table 1 below):
Group Total Inj.DNA PLG Total PLG Approximate Vol (~,g) (~,g/~,1)(~,g) Mole ratio 1 DNA:PLG
1 25 30 0.00 0.00 -2 25 30 6.00 150 1:1200 3 25 30 1.00 25 1:200 4 25 30 0.10 2.50 1:20 25 30 0.01 0.25 1:2 The mole ratios are provided for the purpose of example. The mole ratio listed in Table 1 are based upon a 5,000 by nucleic acid expression vector, and PLG with the weighted average molecular weight of 10,900. For example group 2 in Table 1 has an inj ection total of 30 ~.g of DNA vector associated with 150 ~.g of transfection facilitating polypeptides, wherein the mole ratio is 1:1,200. Another example of group 3 in Table 1 has an injection total of 30 ~,g of DNA vector associated with 0.25 ~.g of transfection facilitating polypeptides, wherein the mole ratio is less than 1:2. Mole ratio's of DNA vector to PLG having a 1:1 relationship comprises a lower limit formulation still having a higher transfection efficiency than a "naked" DNA vector alone. One of ordinary skill in the art is capable of formulating mole ratio calculations with different length expression vectors and variable molecular weights of PLG. Additionally, it is understood that the length of the nucleic acid expression vector and the weighted average molecular weight of PLG is subject to change based upon specific vector lengths and particular formulation strategies known to one skilled in the art (e.g.
functional nucleic acid expression vectors greater than or less than about 5,000 nucleotides, and PLG having an average molecular weight of less than about 1 to about 30 kDa).
Consequently, even the smallest of PLG polymers (e.g. PLG trimers having a molecular weight ~ 400 Da) can be used for this invention.
[0070] Electroporation was carned out using a constant current electroporation apparatus that is the subject ofthe Western '362 co-pending application. This device was used to deliver square wave pulses in all experiments. The amplitude conditions of 1 mA, 5 pulses, 50 milliseconds per pulse were used. Caliper electrodes were used to deliver in vivo electric pulses. The caliper (plate) electrodes consisted of 1.5 cm square metallic blocks mounted on a ruler, so the distance between the plates could be easily assessed. Plasmid DNA or associated DNA was injected through the intact skin into the tibialis anterior muscle of mice. Each animal received one injection into a single injection site. Although a constant-current electroporation device was used in specific examples, it is not intended to limit general embodiments of the invention (i.e. other electroporation devices may provide satisfactory results.) Furthermore, the order of the placement of the electrodes and subsequent injection of plasmid are not sequentially limiting.
[0071] In order to determine the amount of expression of the SEAP gene product that was encoded on the DNA vector, mice were bled and serum collected for up to 3 month post-injection. The SEAP molecule usually disappears after birth, and it is immunogenic in adult animals. Blood was collected by tail vein collection for mice, before plasmid administration, and up to 3 month post-injection in mice. Serum levels of SEAP
were determined using a chemiluminescence assay (Tropix, Bedford, MA) following the manufacturer instructions. Figure 3 shows the serum SEAP levels for all five groups of mice described in Table 1. Although naked plasmid (Group l, figure 3) showed some expression, all groups with the nucleic acid expression vector associated with PLG (groups 2-5, figure 3) showed significantly higher serum levels of SEAP. Nevertheless, when samples from selected animals from each group were analyzed by histochemistry for inflammation markers (e.g. macrophages, B-cells, and counterstained with hematoxilin / eosin), mice from group 5 (i.e. nucleic acid expression construct coated with 0.01 ~,g/~,1 PLG) had the least inflammation associated with the delivery procedure at 3 days post-injection. Despite higher expression at earlier time points, group 2 injected with plasmid associated with 6 ~.g/~.1 had high inflarmnation and some morphological changes. This observation correlates with the data in the literature, that shows short-term enhanced expression using PLG compounds, expression that disappears at approximately 1 month post-injection. (Fewell et al., 2001).
[0072] Histolo~ical anal - Muscle and skin samples were fixed overnight, dehydrated in alcohol and paraffin embedded. Five microns sections were cut and stained with hematoxilin/ eosin (Sigma Chemical, St. Louis, MO). Serial sections were stained with picric acid. Digital images of the slides were captured using a CoolSnap digital color camera (Roper Scientific, Tucson, AZ) with MetaMorph software (Universal Imaging Corporation, Downington, PA) and a Zeiss Axioplan 2 microscope with a (x 40) objective (numerical aperture 0.75 plan).
[0073] Statistics - Data are analyzed using STATISTICA analysis package (StatSoft, Inc. Tulsa, OK). Values shown in the figures are the mean ~ s.e.m.
Specific P
values were obtained by comparison using ANOVA. A P < 0.05 was set as the level of statistical significance.
[0074] E~~AMPLE 2 - PLG coating in pigs: In order to demonstrate similar results in a larger mammal, experiments similar to Example 1 above were conducted in pigs.
Thus, two groups of three pigs were injected with 500 ~,g (micrograms) of pSP-SEAP and electroporated. The plasmid expressed secreted embryonic alkaline phosphatase ("SEAP").
The molecule usually disappears after birth, and it is immunogenic in adult animals. One group received naked nucleic acid construct and the second group received the nucleic acid construct in 0.01 ~,g/~.1 PLG Pigs were weighted and bled prior to injection, and every other day up to 10 days post-injection. Serum was collected from pigs by jugular puncture before plasmid injection, and at 2, 4, 6, 8 and 10 days for the SEAP studies. Serum levels of SEAP
were determined using a chemiluminescence assay (Tropix, Bedford, MA) following the manufacturer instructions. SEAP assay (Figure 4) showed an increased expression in animals injected with PLG coated plasmid versus naked plasmid throughout 12 days of experiment (32.9 ~ 19.3 ng/ml/kg in PLG/plasmid pig versus 17.14 ~ 12.44 ng/ml/kg in animals inj ected with naked plasmid). Although not wanting to be bound by theory, the increased expression may be attributed to the increased stability of plasmid, facilitation of transfection into the muscle cells, or both.
[0075] Electroporation devices A constant current electroporator machine (Advisys, Inc.) was used to deliver square wave pulses in all experiments. The electroporation parameters included an amplitude condition of 1 mA, 5 pulses, 50 milliseconds per pulse. A
needle electrode was used to deliver in vivo electric pulses. The 5-needle electrode device consists of a circular array (1 cm diameter) of equally spaced filled 21-gauge needles mounted on a non-conductive material. All needles were 2 cm in length and during all injections or electroporations, the needles were completely inserted into the muscle.
Plasmid DNA was inj ected through the intact skin into the semitendinosous muscle of pigs with a 21 g needle.
Each animal received one injection into a single injection site and the injection site also received a tattoo so it could be easily isolated at the end of the experiment.
[0076] Histolo~ical analysis - Muscle and skin samples were fixed overnight, dehydrated in alcohol and paraffin embedded. Five microns sections were cut and stained with hematoxilin/ eosin (Sigma). Serial sections were stained with picric acid.
Digital images of the slides were captured using a CoolSnap digital color camera (Roper Scientific, Tucson, AZ) with MetaMorph software (Universal Imaging Corporation, Downington, PA) and a Zeiss Axioplan 2 microscope with a (x 40) objective (numerical aperture 0.75 plan).
Statistics - Data are analyzed using STATISTICA analysis package (StatSoft, Inc. Tulsa, OIL). Values shown in the figures are the mean ~ s.e.m.
Specific P
values were obtained by comparison using ANOVA. A P < 0.05 was set as the level of statistical significance.
[0078] Example 3: PLG coating in Dogs: In order to demonstrate similar results in a different species of larger mammal, experiments similar to Example 2 were conducted in dogs. Thus, a comparison of expression in dogs injected with 5 needle array electrodes, with coated or naked plasmid. Four groups of 5 dogs were injected with a plasmid DNA, pSP-SEAP, expressing the secreted embryonic alkaline phosphatase ("SEAP"). The molecule usually disappears after birth, and it is immunogenic in adult animals. No adverse reaction, or change in biochemical, clinical or hormonal profiles is related to the development of the immune response to SEAP in animals. As described above, the injection was followed by electroporation, using standard conditions, and 5 needle electrodes. The plasmid DNA was either naked, or coated with a mol / mol dilution of poly-L-glutamate. The groups are as follows:
Group 5 needle (SN), 0.5 mg, 1- naked (NK) Group 5 needle (SN), 0.1 mg, 2 naked (NK) -Group 5 needle (SN), 0.5 mg, 3 coated (PLG) -Group 5 needle (SN), 0.1 mg, 4 coated (PLG) -[0079] Dogs were weight and bled at baseline (pre-inj ection) and every other day to day 10 post-injection. Serum was assayed for SEAP. Values were corrected for weight (blood volume). SEAP values were analyzed for differences in between the different injected groups. The results of these experiments are shown in Figure 5. The results showed that a 5 needle electrode could be used in dogs to efficiently mediate electroporation.
Additionally, PLG coated DNA increasing plasmid stability and electroporation efficiency in dogs.
[0080] Example 4: PLG increases plasmid stability in vitro at high temperatures: In order to evaluate the effects of the PLG on plasmid stability, the following assay has been performed. Plasmid pSP-HV-GHRH encoding for a super-porcine growth hormone releasing hormone was diluted into distilled water to a final concentration of 2 mg/ml. PLG in a mol / mol ratio was added to a group of samples, while PLG was not added into control samples. All samples were incubated for 6 month at 37°C.
After 6 month, aliquots were taken from all samples, and run onto an agarose gel (Figure 6). As seen in the gel image, all plasmid is present in the samples were PLG was added, while in control samples all plasmid is completely degraded.
[0081] One skilled in the art readily appreciates that the patent invention is well adapted to carry out the objectives and obtain the ends and advantages mentioned as well as those inherent therein. Growth hormone, growth hormone releasing hormone, analogs, plasmids, vectors, charged transfection facilitating polypeptides, poly-L-glutamate, pharmaceutical compositions, treatments, electroporation methods, procedures and other techniques described herein are presently representative of several aspects of the current invention and are intended to be exemplary and are not intended as limitations of the scope.
Changes therein and other uses will occur to those skilled in the art which are encompassed within the spirit of the invention or defined by the scope of the pending claims.
[0082] Accordingly, the present invention provides a method of transferring a therapeutic gene to a host, which comprises administering the vector of the present invention, preferably as part of a composition, using any of the aforementioned routes of administration or alternative routes known to those skilled in the art and appropriate for a particular application. Effective gene transfer of a vector to a host cell in accordance with the present invention to a host cell can be monitored in terms of a therapeutic effect (e.g. alleviation of some symptom associated with the particular disease being treated) or, further, by evidence of the transferred gene or expression of the gene within the host (e.g., using the polymerase chain reaction in conjunction with sequencing, Northern or Southern hybridizations, or transcription assays to detect the nucleic acid in host cells, or using immunoblot analysis, antibody-mediated detection, mRNA or protein half life studies, or particularized assays to detect protein or polypeptide encoded by the transferred nucleic acid, or impacted in level or function due to such transfer).
[0083] These methods described herein are by no means all-inclusive, and further methods to suit the specific application will be apparent to the ordinary skilled artisan.
Moreover, the effective amount of the compositions can be further approximated through analogy to compounds known to exert the desired effect.
[0084] Furthermore, the actual dose and schedule can vary depending on whether the compositions are administered in combination with other pharmaceutical compositions, or depending on inter-individual differences in pharmacokinetics, drug disposition, and metabolism. Similarly, amounts can vary in in vitro applications depending on the particular cell line utilized (e.g., based on the number of vector receptors present on the cell surface, or the ability of the particular vector employed for gene transfer to replicate in that cell line).
Furthermore, the amount of vector to be added per cell will likely vary with the length and stability of the therapeutic gene inserted in the vector, as well as the nature of the sequence, and is particularly a parameter which needs to be determined empirically, and can be altered due to factors not inherent to the methods of the present invention (for instance, the cost associated with synthesis). One skilled in the art can easily make any necessary adjustments in accordance with the exigencies of the particular situation.
SEQUENCE LISTING
<110> Advisys <120> INCREASED DELIVERY OF A NUCLEIC ACID CONSTRUCT IN VIVO BY THE
POLY-L-GLUTAMATE ("PLG") SYSTEM
<130> 108328.00115 - AVSI-0021P1 <140> 10/395,709 <141> 2003-03-24 <160> 25 <170> PatentIn version 3.1 <210> 1 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is a functional biological equivalent of GHRH.
<400> 1 His Val Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Ala Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Leu Asn Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 2 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is a functional biological equivalent of GHRH.
<400> 2 Tyr Ile Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Ala Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Leu Asn Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 3 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is a functional biological equivalent of GHRH.
<400> 3 Tyr Val Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Ala Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Leu Asn Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 4 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is a functional biological equivalent of GHRH.
<400> 4 Tyr Ala Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Ala Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Leu Asn Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 5 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is the artificial sequence for the (1-44)NH2 <400> 5 Tyr Ala Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Gly Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Met Ser Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 6 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is the artificial sequence for GHRH (1-40)OH.
<220>
<221> MISC_FEATURE
<222> (1). (1) <223> Xaa at position l may be tyrosine, or histidine <220>
<221> MISC_FEATURE
<222> (2). (2) <223> Xaa at position 2 may be alanine, valine, or isoleucine.
<220>
<221> MISC_FEATURE
<222> (15) .(15) <223> Xaa at position 15 may be alanine, valine, or isoleucine.
<220>
<221> MISC_FEATURE
<222> (27) .(27) <223> Xaa at position 27 may be methionine, or leucine.
<220>
<221> MISC_FEATURE
<222> (28) .(28) <223> Xaa at position 28 may be serine or asparagine.
<400> 6 Xaa Xaa Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Xaa Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Xaa Xaa Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210>
<211>
<212>
DNA
<213>
artificial sequence <220>
<223> is a eukaryoticpromoter 12.
This nucleic c5-acid sequence of a <400>
cggccgtccgccctcggcaccatcctcacgacacccaaatatggcgacgggtgaggaatg60 gtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctcta120 aaaataactcccgggagttatttttagagcggaggaatggtggacacccaaatatggcga180 cggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccgcattcctggg240 ggccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcggcggcccacga300 gctacccggaggagcgggaggcg 323 <210> 8 <211> 190 <212> DNA
<213> artificial sequence <220>
<223> This is a nucleic acid sequence of a human growth hormone ("hGH") poly A tail.
<400> 8 gggtggcatc cctgtgaccc ctccccagtg cctctcctgg ccctggaagt tgccactcca 60 gtgcccacca gccttgtcct aataaaatta agttgcatca ttttgtctga ctaggtgtcc 120 ttctataata ttatggggtg gaggggggtg gtatggagca aggggcaagt tgggaagaca 180 acctgtaggg 190 <210> 9 <211> 219 <212> DNA
<213> artificial sequence <220>
<223> This is the cDNA for Porcine growth hormone releasing hormone <400> 9 atggtgctct gggtgttctt ctttgtgatc ctcaccctca gcaacagctc ccactgctcc 60 ccacctcccc ctttgaccct caggatgcgg cggcacgtag atgccatctt caccaacagc 120 taccggaagg tgctggccca gctgtccgcc cgcaagctgc tccaggacat cctgaacagg 180 cagcagggag agaggaacca agagcaagga gcataatga 219 <210> 10 <211> 40 <212> PRT
<213> artificial sequence <220>
<223> This is the amino acid sequence for porcine growth hormone releas ing hormone.
<400> 10 Tyr Ala Asp Ala Ile Phe Thr Asn Ser Tyr Arg Lys Val Leu Gly Gln Leu Ser Ala Arg Lys Leu Leu Gln Asp Ile Met Ser Arg Gln Gln Gly Glu Arg Asn Gln Glu Gln Gly Ala <210> 11 <211> 3534 <212> DNA
<213> artificial sequence <220>
<223> Sequence for the operatively linked components of the HV-GHRH pla smid.
<400>
gttgtaaaacgacggccagtgaattgtaatacgactcactatagggcgaattggagctcc60 accgcggtggcggccgtccgccctcggcaccatcctcacgacacccaaatatggcgacgg120 gtgaggaatggtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgt180 tggcgctctaaaaataactcccgggagttatttttagagcggaggaatggtggacaccca240 aatatggcgacggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccg300 cattcctgggggccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcgg360 cggcccacgagctacccggaggagcgggaggcgccaagctctagaactagtggatcccaa420 ggcccaactccccgaaccactcagggtcctgtggacagctcacctagctgccatggtgct480 ctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgctccccacctcc540 ccctttgaccctcaggatgcggcggcacgtagatgccatcttcaccaacagctaccggaa600 ggtgctggcccagctgtccgcccgcaagctgctccaggacatcctgaacaggcagcaggg660 agagaggaaccaagagcaaggagcataatgactgcaggaattcgatatcaagcttatcgg720 ggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccag780 tgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcct840 tctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaa900 cctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggc960 tcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgt1020 tgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggg1080 gtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccacctt1140 ggcctcccaaattgctgggattacaggcgtgaaccactgctCCCttCCCtgtCCttCtga1200 ttttaaaataactataccagcaggaggacgtccagacacagcataggctacctggccatg1260 cccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtcca1320 ctcagtagatgcctgttgaattcgataccgtcgacctcgagggggggcccggtaccagct1380 tttgttccctttagtgagggttaatttcgagcttggcgtaatcatggtcatagctgtttc1440 ctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagt1500 gtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgc1560 ccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcgg1620 ggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgct1680 cggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatcca1740 cagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccagga1800 accgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatc1860 acaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccagg1920 cgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggat1980 acctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggt2040 atctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttc2100 agcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacg2160 acttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcg2220 gtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttg2280 gtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatceg2340 gcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgca2400 gaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagaaga2460 actcgtcaagaaggcgatagaaggcgatgcgctgcgaatcgggagcggcgataccgtaaa2520 gcacgaggaagcggtcagcccattcgccgccaagctcttcagcaatatcacgggtagcca2580 acgctatgtcctgatagcggtccgccacacccagccggccacagtcgatgaatccagaaa2640 agcggccattttccaccatgatattcggcaagcaggcatcgccatgggtcacgacgagat2700 cctcgccgtcgggcatgcgcgccttgagcctggcgaacagttcggctggcgcgagcccct2760 gatgctcttcgtccagatcatcctgatcgacaagaccggcttccatccgagtacgtgctc2820 gctcgatgcgatgtttcgcttggtggtcgaatgggcaggtagccggatcaagcgtatgca2880 gccgccgcattgcatcagccatgatggatactttctcggcaggagcaaggtgagatgaca2940 ggagatcctgccccggcacttcgcccaatagcagccagtcccttcccgcttcagtgacaa3000 cgtcgagcacagctgcgcaaggaacgcccgtcgtggccagccacgatagccgcgctgcct3060 cgtcctgcagttcattcagggcaccggacaggtcggtcttgacaaaaagaaccgggcgcc3120 cctgcgctgacagccggaacacggcggcatcagagcagccgattgtctgttgtgcccagt3180 catagccgaatagcctctccacccaagcggccggagaacctgcgtgcaatccatcttgtt3240 caatcatgcgaaacgatcctcatcctgtctcttgatcagatcttgatcccctgcgccatc3300 agatccttggcggcaagaaagccatccagtttactttgcagggcttcccaaccttaccag3360 agggcgccccagctggcaattccggttcgcttgctgtccataaaaccgcccagtctagca3420 actgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggg3480 gatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgac 3534 <210> 12 <211> 3534 <212> DNA
<213> artificial sequence <220>
<223> Sequence for the operatively linked components of the TI-GHRH pla smid.
<400>
gttgtaaaacgacggccagtgaattgtaatacgactcactatagggcgaattggagctcc60 accgcggtggcggccgtccgccctcggcaccatcctcacgacacccaaatatggcgacgg120 gtgaggaatggtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgt180 tggcgctctaaaaataactcccgggagttatttttagagcggaggaatggtggacaccca240 aatatggcgacggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccg300 cattcctgggggocgggcggtgctcccgcccgcctcgataaaaggctccggggccggcgg360 cggcccacgagctacccggaggagcgggaggcgccaagctctagaactagtggatcccaa420 ggcccaactccccgaaccactcagggtcctgtggacagctcacctagctgccatggtgct480 ctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgetccccacctcc540 ccctttgaccctcaggatgcggcggtatatcgatgccatcttcaccaacagctaccggaa600 ggtgctggcccagctgtccgcccgcaagctgctccaggacatcctgaacaggcagcaggg660 agagaggaaccaagagcaaggagcataatgactgcaggaattcgatatcaagcttatcgg720 ggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccag780 tgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcct840 tctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaa900 cctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggc960 tcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgt1020 tgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggg1080 gtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccacctt1140 ggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctga1200 ttttaaaataactataccagcaggaggacgtccagacacagcataggctacctggccatg1260 cccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtcca1320 ctcagtagatgcctgttgaattcgataccgtcgacctcgagggggggcccggtaccagct1380 tttgttccctttagtgagggttaatttcgagcttggcgtaatcatggtcatagctgtttc1440 ctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagt1500 gtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgc1560 ccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcgg1620 ggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgct1680 cggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatcca1740 cagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccagga1800 accgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatc1860 acaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccagg1920 cgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggat1980 acctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggt2040 atctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttc2100 agcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacg2160 acttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcg2220 gtgctacaga gttcttgaag tggtggccta actacggcta cactagaaga acagtatttg 2280 gtatctgcgc tctgctgaag ccagttacct tcggaaaaag agttggtagc tcttgatccg 2340 gcaaacaaac caccgctggt agcggtggtt tttttgtttg caagcagcag attacgcgca 2400 gaaaaaaagg atctcaagaa gatcctttga tcttttctac ggggtctgac gctcagaaga 2460 actcgtcaag aaggcgatag aaggcgatgc gctgcgaatc gggagcggcg ataccgtaaa 2520 gcacgaggaa gcggtcagcc cattcgccgc caagctcttc agcaatatca cgggtagcca 2580 acgctatgtc ctgatagcgg tccgccacac ccagccggcc acagtcgatg aatccagaaa 2640 agcggccatt ttccaccatg atattcggca agcaggcatc gccatgggtc acgacgagat 2700 cctcgccgtc gggcatgcgc gccttgagcc tggcgaacag ttcggctggc gcgagcccct 2760 gatgctcttc gtccagatca tcctgatcga caagaccggc ttccatccga gtacgtgctc 2820 gctcgatgcg atgtttcgct tggtggtcga atgggcaggt agccggatca agcgtatgca 2880 gccgccgcat tgcatcagcc atgatggata ctttctcggc aggagcaagg tgagatgaca 2940 ggagatcctg ccccggcact tcgcccaata gcagccagtc ccttcccgct tcagtgacaa 3000 cgtcgagcac agctgcgcaa ggaacgcccg tcgtggccag ccacgatagc cgcgctgcct 3060 cgtcctgcag ttcattcagg gcaccggaca ggtcggtctt gacaaaaaga accgggcgcc 3120 cctgcgctga cagccggaac acggcggcat cagagcagcc gattgtctgt tgtgcccagt 3180 catagccgaa tagcctctcc acccaagcgg ccggagaacc tgcgtgcaat ccatcttgtt 3240 caatcatgcg aaacgatcct catcctgtct cttgatcaga tcttgatccc ctgcgccatc 3300 agatccttgg cggcaagaaa gccatccagt ttactttgca gggcttccca accttaccag 3360 agggcgcccc agctggcaat tccggttcgc ttgctgtcca taaaaccgcc cagtctagca 3420 actgttggga agggcgatcg gtgcgggcct cttcgctatt acgccagctg gcgaaagggg 3480 gatgtgctgc aaggcgatta agttgggtaa cgccagggtt ttcccagtca cgac 3534 <210> 13 <211> 3534 <212> DNA
<213> artificial sequence <220>
<223> Sequence for the operatively linked components of the TV-GHRH pla smid.
<400> 13 gttgtaaaac gacggccagt gaattgtaat acgactcact atagggcgaa ttggagctcc 60 accgeggtgg cggccgtccg ccctcggcac catcctcacg acacccaaat atggcgacgg 120 gtgaggaatggtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgt180 tggcgctctaaaaataactcccgggagttatttttagagcggaggaatggtggacaccca240 aatatggcgacggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccg300 cattcctgggggccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcgg360 cggcccacgagctacccggaggagcgggaggcgccaagctctagaactagtggatcccaa420 ggcccaactccccgaaccactcagggtcctgtggacagctcacctagctgccatggtgct480 ctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgctccccacctcc540 ccctttgaccctcaggatgcggcggtatgtagatgccatcttcaccaacagctaccggaa600 ggtgctggcccagctgtccgcccgcaagctgctccaggacatcctgaacaggcagcaggg660 agagaggaaccaagagcaaggagcataatgactgcaggaattcgatatcaagcttatcgg720 ggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccag780 tgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcct840 tctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaa900 cctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggc960 tcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgt1020 tgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggg1080 gtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccacctt1140 ggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctga1200 ttttaaaataactataccagcaggaggacgtccagacacagcataggctacctggccatg1260 cccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtcca1320 ctcagtagatgcctgttgaattcgataccgtcgacctcgagggggggcccggtaccagct1380 tttgttccctttagtgagggttaatttcgagcttggcgtaatcatggtcatagctgtttc1440 ctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagt1500 gtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgc1560 ccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcgg1620 ggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgct1680 cggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatcca1740 cagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccagga1800 accgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatc1860 acaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccagg1920 cgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggat1980 acctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggt2040 atctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttc2100 agcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacg2160 acttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcg2220 gtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttg2280 gtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccg2340 gcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgca2400 gaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagaaga2460 actcgtcaagaaggcgatagaaggcgatgcgctgcgaatcgggagcggcgataccgtaaa2520 gcacgaggaagcggtcagcccattcgccgccaagctcttcagcaatatcacgggtagcca2580 acgctatgtcctgatagcggtccgccacacccagccggccacagtcgatgaatccagaaa2640 agcggccattttccaccatgatattcggcaagcaggcatcgccatgggtcacgacgagat2700 cctcgccgtcgggcatgcgcgccttgagcctggcgaacagttcggctggcgcgagcccct2760 gatgctcttcgtccagatcatcctgatcgacaagaccggcttccatccgagtacgtgctc2820 gctcgatgcgatgtttcgcttggtggtcgaatgggcaggtagccggatcaagcgtatgca2880 gccgccgcattgcatcagccatgatggatactttctcggcaggagcaaggtgagatgaca2940 ggagatcctgccccggcacttcgcccaatagcagccagtcccttcccgcttcagtgacaa3000 cgtcgagcacagctgcgcaaggaacgcccgtcgtggccagccacgatagccgcgctgcct3060 cgtcctgcagttcattcagggcaccggacaggtcggtcttgacaaaaagaaccgggcgcc3120 cctgcgctgacagccggaacacggcggcatcagagcagccgattgtctgttgtgcccagt3180 catagccgaatagcctctccacccaagcggccggagaacctgcgtgcaatccatcttgtt3240 caatcatgcgaaacgatcctcatcctgtctcttgatcagatcttgatcccctgcgccatc3300 agatccttggcggcaagaaagccatccagtttactttgcagggcttcccaaccttaccag3360 agggcgccccagctggcaattccggttcgcttgctgtccataaaaccgcccagtctagca3420 actgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggg3480 gatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgac 3534 <210> 14 <211> 3534 <212> DNA
<213> artificial sequence <220>
<223> Sequence for the operatively linked components of the 15/27/28 GH
RH plasmid.
<400>
gttgtaaaacgacggccagtgaattgtaatacgactcactatagggcgaattggagctcc60 accgcggtggcggccgtccgccctcggcaccatcctcacgacacccaaatatggcgacgg120 gtgaggaatggtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgt180 tggcgctctaaaaataactcccgggagttatttttagagcggaggaatggtggacaccca240 aatatggcgacggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccg300 cattcctgggggccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcgg360 cggcccacgagctacccggaggagcgggaggcgccaagctctagaactagtggatcccaa420 ggcccaactccccgaaccactcagggtcctgtggacagctcacctagctgccatggtgct480 ctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgctccccacctcc540 ccctttgaccctcaggatgcggcggtatatcgatgccatcttcaccaacagctaccggaa600 ggtgctggcccagctgtccgcccgcaagctgctccaggacatcctgaacaggcagcaggg660 agagaggaaccaagagcaaggagcataatgactgcaggaattcgatatcaagcttatcgg720 ggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccag780 tgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcct840 tctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaa900 cctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggc960 tcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgt1020 tgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggg1080 gtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccacctt1140 ggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctga1200 ttttaaaataactataccagcaggaggacgtccagacacagcataggctacctggccatg1260 cccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtcca1320 ctcagtagatgcctgttgaattcgataccgtcgacctcgagggggggcccggtaccagct1380 tttgttccctttagtgagggttaatttcgagcttggcgtaatcatggtcatagctgtttc1440 ctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagt1500 gtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgc1560 ccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcgg1620 ggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgct1680 cggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatcca1740 cagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccagga1800 accgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatc1860 acaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccagg1920 cgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggat1980 acctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggt2040 atctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttc2100 agcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacg2160 acttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcg2220 gtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttg2280 gtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccg2340 gcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgca2400 gaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagaaga2460 actcgtcaagaaggcgatagaaggcgatgcgctgcgaatcgggagcggcgataccgtaaa2520 gcacgaggaagcggtcagcccattcgccgccaagctcttcagcaatatcacgggtagcca2580 acgctatgtcctgatagcggtccgccacacccagccggccacagtcgatgaatccagaaa2640 agcggccattttccaccatgatattcggcaagcaggcatcgccatgggtcacgacgagat2700 cctcgccgtcgggcatgcgcgccttgagcctggcgaacagttcggctggcgcgagcccct2760 gatgctcttcgtccagatcatcctgatcgacaagaccggcttccatccgagtacgtgctc2820 gctcgatgcgatgtttcgcttggtggtcgaatgggcaggtagccggatcaagcgtatgca2880 gccgccgcattgcatcagccatgatggatactttctcggcaggagcaaggtgagatgaca2940 ggagatcctgccccggcacttcgcccaatagcagccagtcccttcccgcttcagtgacaa3000 cgtcgagcacagctgcgcaaggaacgcccgtcgtggccagccacgatagccgcgctgcct3060 cgtcctgcagttcattcagggcaccggacaggtcggtcttgacaaaaagaaccgggcgcc3120 cctgcgctga cagccggaac acggcggcat cagagcagcc gattgtctgt tgtgcccagt 3180 catagccgaa tagcctctcc acccaagcgg ccggagaacc tgcgtgcaat ccatcttgtt 3240 caatcatgcg aaacgatcct catcctgtct cttgatcaga tcttgatccc ctgcgccatc 3300 agatccttgg cggcaagaaa gccatccagt ttactttgca gggcttccca accttaccag 3360 agggcgcccc agctggcaat tccggttcgc ttgctgtcca taaaaccgcc cagtctagca 3420 actgttggga agggcgatcg gtgcgggcct cttcgctatt acgccagctg gcgaaagggg 3480 gatgtgctgc aaggcgatta agttgggtaa cgccagggtt ttcccagtca cgac 3534 <210> 15 <211> 3534 <212> DNA
<213> artificial sequence <220>
<223> This is the entire plasmid sequence for wildtype GHRH.
<400>
gttgtaaaacgacggccagtgaattgtaatacgactcactatagggcgaattggagctcc60 accgcggtggcggccgtccgccctcggcaccatcctcacgacacccaaatatggcgacgg120 gtgaggaatggtggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgt180 tggcgctctaaaaataactcccgggagttatttttagagcggaggaatggtggacaccca240 aatatggcgacggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccg300 cattcctgggggccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcgg360 cggcccacgagctacccggaggagcgggaggcgccaagctctagaactagtggatcccaa420 ggcccaactccccgaaccactcagggtcctgtggacagctcacctagctgccatggtgct480 ctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgctccccacctcc540 ccctttgaccctcaggatgcggcggtatgcagatgccatcttcaccaacagctaccggaa600 ggtgctgggccagctgtccgcccgcaagctgctccaggacatcatgagcaggcagcaggg660 agagaggaaccaagagcaaggagcataatgactgcaggaattcgatatcaagcttatcgg720 ggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccag780 tgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcct840 tctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaa900 cctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggc960 tcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgt1020 tgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggg1080 gtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccacctt1140 ggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctga1200 ttttaaaataactataccagcaggaggacgtccagacacagcataggctacctggccatg1260 cccaaccggt gggacatttg agttgcttgc ttggcactgt cctctcatgc gttgggtcca 1320 ctcagtagat gcctgttgaa ttcgataccg tcgacctcga gggggggccc ggtaccagct 1380 tttgttccct ttagtgaggg ttaatttcga gcttggcgta atcatggtca tagctgtttc 1440 ctgtgtgaaa ttgttatccg ctcacaattc cacacaacat acgagcegga agcataaagt 1500 gtaaagcctg gggtgcctaa tgagtgagct aactcacatt aattgcgttg cgctcactgc 1560 ccgctttcca gtcgggaaac ctgtcgtgcc agctgcatta atgaatcggc caacgcgcgg 1620 ggagaggcgg tttgcgtatt gggcgctctt ccgcttcctc gctcactgac tcgctgcgct 1680 cggtcgttcg gctgcggcga gcggtatcag ctcactcaaa ggcggtaata cggttatcca 1740 cagaatcagg ggataacgca ggaaagaaca tgtgagcaaa aggccagcaa aaggccagga 1800 accgtaaaaa ggccgcgttg ctggcgtttt tccataggct ccgcccccct gacgagcatc 1860 acaaaaatcg acgctcaagt cagaggtggc gaaacccgac aggactataa agataccagg 1920 cgtttccccc tggaagctcc ctcgtgcgct ctcctgttcc gaccctgccg cttaccggat 1980 acctgtccgc ctttctccct tcgggaageg tggcgctttc tcatagctca cgctgtaggt 2040 atctcagttc ggtgtaggtc gttcgctcca agctgggctg tgtgcacgaa ccccccgttc 2100 agcccgaccg ctgcgcctta tccggtaact atcgtcttga gtccaacccg gtaagacacg 2160 acttatcgcc actggcagca gccactggta acaggattag cagagcgagg tatgtaggcg 2220 gtgctacaga gttcttgaag tggtggccta actacggcta cactagaaga acagtatttg 2280 gtatctgcgc tctgctgaag ccagttacct tcggaaaaag agttggtagc tcttgatccg 2340 gcaaacaaac caccgctggt agcggtggtt tttttgtttg caagcagcag attacgcgca 2400 gaaaaaaagg atctcaagaa gatcctttga tcttttctac ggggtctgac gctcagaaga 2460 actcgtcaag aaggcgatag aaggcgatgc gctgcgaatc gggagcggcg ataccgtaaa 2520 gcacgaggaa gcggtcagcc cattcgccgc caagctcttc agcaatatca cgggtagcca 2580 acgctatgtc ctgatagcgg tccgccacac ccagccggcc acagtcgatg aatccagaaa 2640 agcggccatt ttccaccatg atattcggca agcaggcatc gccatgggtc acgacgagat 2700 cctcgccgtc gggcatgcgc gccttgagcc tggcgaacag ttcggctggc gcgagcccct 2760 gatgctcttc gtccagatca tcctgatcga caagaccggc ttccatccga gtacgtgctc 2820 gctcgatgcg atgtttcgct tggtggtcga atgggcaggt agccggatca agcgtatgca 2880 gccgccgcat tgcatcagcc atgatggata ctttctcggc aggagcaagg tgagatgaca 2940 ggagatcctg ccccggcact tcgcccaata gcagccagtc ccttcccgct tcagtgacaa 3000 cgtcgagcac agctgcgcaa ggaacgcccg tcgtggccag ccacgatagc cgcgctgcct 3060 cgtcctgcag ttcattcagg gcaccggaca ggtcggtctt gacaaaaaga accgggcgcc 3120 cctgcgctgacagccggaacacggcggcatcagagcagccgattgtctgttgtgcccagt3180 catagccgaatagcctctccacccaagcggccggagaacctgcgtgcaatccatcttgtt3240 caatcatgcgaaacgatcctcatcctgtctcttgatcagatcttgatCCCCtgCgCCatC3300 agatccttggcggcaagaaagccatccagtttactttgcagggcttcccaaccttaccag3360 agggcgccccagctggcaattccggttcgcttgctgtccataaaaccgcccagtctagca3420 actgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggg3480 gatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgac 3534 <210>
<211>
<212>
DNA
<213>
Artificial sequence <220>
<223>
This is the sequence for the pSP-SEAP
cDNA
construct <400>
ggccgtccgccttcggcaccatcctcacgacacccaaatatggcgacgggtgaggaatgg60 tggggagttatttttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaa120 aaataactcccgggagttatttttagagcggaggaatggtggacacccaaatatggcgac180 ggttcctcacccgtcgccatatttgggtgtccgccctcggccggggccgcattcctgggg240 gccgggcggtgctcccgcccgcctcgataaaaggctccggggccggcggcggcecacgag300 ctacccggaggagcgggaggcgccaagctctagaactagtggatcccccgggctgcagga360 attcgatatcaagcttcgaatcgcgaattcgcccaccatgctgctgctgctgctgctgct420 gggcctgaggctacagctctccctgggcatcatcccagttgaggaggagaacccggactt480 ctggaaccgcgaggcagccgaggccctgggtgccgccaagaagctgcagcctgcacagac540 agccgccaagaacctcatcatcttcctgggcgatgggatgggggtgtctacggtgacagc600 tgccaggatcctaaaagggcagaagaaggacaaactggggcctgagatacccctggccat660 ggaccgcttcccatatgtggctctgtccaagacatacaatgtagacaaacatgtgccaga720 cagtggagccacagccacggcctacctgtgcggggtcaagggcaacttccagaccattgg780 cttgagtgcagccgcccgctttaaccagtgcaacacgacacgcggcaacgaggtcatctc840 cgtgatgaatcgggccaagaaagcagggaagtcagtgggagtggtaaccaccacacgagt900 gcagcacgectcgccagccggcacctacgcccacacggtgaaccgcaactggtactcgga960 cgccgacgtgcctgcctcggcccgccaggaggggtgccaggacatcgctacgcagctcat1020 ctccaacatggacattgacgtgatcctaggtggaggccgaaagtacatgtttcgcatggg1080 aaccccagaccctgagtacccagatgactacagccaaggtgggaccaggctggacgggaa1140 gaatctggtgcaggaatggctggcgaagcgccagggtgcccggtatgtgtggaaccgcac1200 tgagctcatgcaggcttccctggacccgtctgtgacccatctcatgggtctctttgagcc1260 tggagacatgaaatacgagatccaccgagactccacactggacccctccctgatggagat1320 gacagaggctgccctgcgcctgctgagcaggaacccccgcggcttcttcctcttcgtgga1380 gggtggtcgcatcgaccatggtcatcatgaaagcagggcttaccgggcactgactgagac1440 gatcatgttcgacgacgccattgagagggcgggccagctcaccagcgaggaggacacgct1500 gagcctcgtcactgccgaccactcccacgtcttctccttcggaggctaccccctgcgagg1560 gagctccatcttcgggctggcccctggcaaggcccgggacaggaaggcctacacggtcct1620 cctatacggaaacggtccaggctatgtgctcaaggacggcgcccggccggatgttaccga1680 gagcgagagcgggagccccgagtatcggcagcagtcagcagtgcccctggacgaagagac1740 ccacgcaggcgaggacgtggcggtgttcgcgcgcggcccgcaggcgcacctggttcacgg1800 cgtgcaggagcagaccttcatagcgcacgtcatggccttcgccgcctgcctggagcccta1860 caccgcctgcgacctggcgccccccgccggcaccaccgacgccgcgcacccgggttactc1920 tagagtcggggcggccggccgcttcgagcagacatgataagatacattgatgagtttgga1980 caaaccacaactagaatgcagtgaaaaaaatgctttatttgtgaaatttgtgatgctatt2040 gctttatttgtaaccattataagctgcaataaacaagttaacaacaacaattgcattcat2100 tttatgtttcaggttcagggggaggtgtgggaggttttttaaagcaagtaaaacctctac2160 aaatgtggtaaaatcgataaggatccgtcgaCCgatgCCCttgagagccttcaacccagt2220 cagctccttccggtgggcgcggggcatgactatCgtCgCCgcacttatgactgtcttctt2280 tatcatgcaactcgtaggacaggtgccggcagcgctcttccgcttcctcgctcactgact2340 cgctgcgctcggtcgttcggctgeggcgagcggtatcagctcactcaaaggcggtaatac2400 ggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaa2460 aggccaggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctg2520 acgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaa2580 gataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgc2640 ttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcac2700 gctgtaggta tctcagttcg gtgtaggtcg ttcgctccaa gctgggctgt gtgcacgaac 2760 cccccgttca gcccgaccgc tgcgccttat ccggtaacta tcgtcttgag tccaacccgg 2820 taagacacga cttatcgcca ctggcagcag ccactggtaa caggattagc agagcgaggt 2880 atgtaggcgg tgctacagag ttcttgaagt ggtggcctaa ctacggctac actagaagga 2940 cagtatttgg tatctgcgct ctgctgaagc cagttacctt cggaaaaaga gttggtagct 3000 cttgatccgg caaacaaacc accgctggta gcggtggttt ttttgtttgc aagcagcaga 3060 ttacgcgcag aaaaaaagga tctcaagaag atcctttgat cttttctacg gggtctgacg 3120 ctcagtggaa cgaaaactca cgttaaggga ttttggtcat gagattatca aaaaggatct 3180 tcacctagat ccttttaaat taaaaatgaa gttttaaatc aatctaaagt atatatgagt 3240 aaacttggtc tgacagttac caatgcttaa tcagtgaggc acctatctca gcgatctgtc 3300 tatttcgttc atccatagtt gcctgactcc ccgtcgtgta gataactacg atacgggagg 3360 gcttaccatc tggccccagt gctgcaatga taccgcgaga cccacgctca ccggctccag 3420 atttatcagc aataaaccag ccagccggaa gggccgagcg cagaagtggt cctgcaactt 3480 tatccgcctc catccagtct attaattgtt gccgggaagc tagagtaagt agttcgccag 3540 ttaatagttt gcgcaacgtt gttgccattg ctacaggcat cgtggtgtca cgctcgtcgt 3600 ttggtatggc ttcattcagc tccggttccc aacgatcaag gcgagttaca tgatccccca 3660 tgttgtgcaa aaaagcggtt agctccttcg gtcctccgat cgttgtcaga agtaagttgg 3720 ccgcagtgtt atcactcatg gttatggcag cactgcataa ttctcttact gtcatgccat 3780 ccgtaagatg cttttctgtg actggtgagt actcaaccaa gtcattctga gaatagtgta 3840 tgcggcgacc gagttgctct tgcccggcgt caatacggga taataccgcg ccacatagca 3900 gaactttaaa agtgctcatc attggaaaac gttcttcggg gcgaaaactc tcaaggatct 3960 taccgctgtt gagatccagt tcgatgtaac ccactcgtgc acccaactga tcttcagcat 4020 cttttacttt caccagcgtt tctgggtgag caaaaacagg aaggcaaaat gccgcaaaaa 4080 agggaataag ggcgacacgg aaatgttgaa tactcatact cttccttttt caatattatt 4140 gaagcattta tcagggttat tgtctcatga gcggatacat atttgaatgt atttagaaaa 4200 ataaacaaat aggggttccg cgcacatttc cccgaaaagt gccacctgac gcgccctgta 4260 <210> 17 <211> 2710 <212> DNA
<213> artificial sequence <220>
<223> Plasmid vector with an analog GHRH sequence codon optimized for m Ouse.
<400>
tgtaatacgactcactatagggcgaattggagctccaccgcggtggcggccgtccgccct60 cggcaccatcctcacgacacccaaatatggcgacgggtgaggaatggtggggagttattt120 ttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaaaaataactcccgg180 gagttatttttagagcggaggaatggtggacacccaaatatggcgacggttcctcacccg240 tcgccatatttgggtgtccgccctcggccggggccgcattcctgggggccgggcggtgct300 cccgcccgcctcgataaaaggctccggggccggcggcggcccacgagctacccggaggag360 cgggaggcgccaagcggatcccaaggcccaactccccgaaccactcagggtcctgtggac420 agctcacctagctgccatggtgctctgggtgctctttgtgatcctcatcctcaccagcgg480 cagccactgcagcctgcctcccagccctcccttcaggatgcagaggcacgtggacgccat540 cttcaccaccaactacaggaagctgctgagccagctgtacgccaggaaggtgatccagga600 catcatgaacaagcagggcgagaggatccaggagcagagggccaggctgagctgataagc660 ttatcggggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgcc720 actccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactag780 gtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagttggg840 aagacaacctgtagggctcgagggggggcccggtaccagcttttgttccctttagtgagg900 gttaatttcgagcttggtcttccgcttcctcgctcactgactcgctgcgctcggtcgttc960 ggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcag1020 gggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaa1080 aggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatc1140 gacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttcccc1200 ctggaagctccctcgtgcgctCtCCtgttCCgaCCCtgCCgcttaccggatacctgtccg1260 cctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagtt1320 cggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgacc1380 gctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgc1440 cactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacag1500 agttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcg1560 ctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaa1620 ccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaag1680 gatctcaagaagatcctttgatcttttctacggggctagcgcttagaagaactcatccag1740 cagacggtagaatgcaatacgttgagagtctggagctgcaataccatacagaaccaggaa1800 acggtcagcccattcaccacccagttcctctgcaatgtcacgggtagccagtgcaatgtc1860 ctggtaacggtctgcaacacccagacgaccacagtcaatgaaaccagagaaacgaccatt1920 ctcaaccatgatgttcggcaggcatgcatcaccatgagtaactaccaggtcctcaccatc1980 cggcatacgagctttcagacgtgcaaacagttcagccggtgccagaccctgatgttcctc2040 atccaggtcatcctggtcaaccagacctgcttccatacgggtacgagcacgttcaatacg2100 atgttttgcctggtggtcaaacggacaggtagctgggtccagggtgtgcagacgacgcat2160 tgcatcagccatgatagaaactttctctgccggagccaggtgagaagacagcaggtcctg2220 acccggaacttcacccagcagcagccagtcacgaccagcttcagtaactacatccagaac2280 tgcagcacacggaacaccagtggttgccagccaagacagacgagctgcttcatcctgcag2340 ttcattcagagcaccagacaggtcagttttaacaaacagaactggacgaccctgtgcaga2400 cagacggaaaacagctgcatcagagcaaccaatggtctgctgtgcccagtcataaccaaa2460 cagacgttcaacccaggctgccggagaacctgcatgcagaccatcctgttcaatcatgcg2520 aaacgatcctcatcctgtctcttgatcagatcttgatcccctgcgccatcagatccttgg2580 cggcaagaaagccatccagtttactttgcagggcttcccaaccttaccagagggcgcccc2640 agctggcaattccggttcgcttgctgtccataaaaccgcccagtctagcaactgttggga2700 agggcgatcg 2710 <210>
<211>
<212>
DNA
<213> ficial arti sequence <220>
<223> mid vectorwith an for Plas analog r GHRH
sequence codon optimized at.
<400>
tgtaatacgactcactatagggcgaattggagctccaccgcggtggcggccgtccgccct60 cggcaccatcctcacgacacccaaatatggcgacgggtgaggaatggtggggagttattt120 ttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaaaaataactcccgg180 gagttatttttagagcggaggaatggtggacacccaaatatggcgacggttcctcacccg240 tcgccatatttgggtgtccgccctcggccggggccgcattcctgggggccgggcggtgct300 cccgcccgcctcgataaaaggctccggggccggcggcggcccacgagctacccggaggag360 cgggaggcgccaagcggatcccaaggcccaactccccgaaccactcagggtcctgtggac420 agctcacctagctgccatggccctgtgggtgttcttcgtgctgctgaccctgaccagcgg480 aagccactgcagcctgcctcccagccctcccttcagggtgcgccggcacgccgacgccat540 cttcaccagcagctacaggaggatcctgggccagctgtacgctaggaagctcctgcacga600 gatcatgaacaggcagcagggcgagaggaaccaggagcagaggagcaggttcaactgata660 agcttatcggggtggcatccctgtgacccctccccagtgcctctcctggccctggaagtt720 gccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgac780 taggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagtt840 gggaagacaacctgtagggctcgagggggggcccggtaccagcttttgttccctttagtg900 agggttaatttcgagcttggtcttccgcttcctcgctcactgactcgctgcgctcggtcg960 ttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaat1020 caggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgta1080 aaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaa1140 atcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttc1200 cccctggaagctccctcgtgCgCtC'tCCtgttCCgaCCCtgCCgCttaCCggatacctgt1260 ccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctca1320 gttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccg1380 accgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttat1440 cgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgcta1500 cagagttcttgaagtggtggcetaactacggctacactagaagaacagtatttggtatct1560 gcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaac1620 aaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaa1680 aaggatctcaagaagatcctttgatcttttctacggggctagcgcttagaagaactcatc1740 cagcagacgg tagaatgcaa tacgttgaga gtctggagct gcaataccat acagaaccag 1800 gaaacggtca gcccattcac cacccagttc ctctgcaatg tcacgggtag ccagtgcaat 1860 gtcctggtaa cggtctgcaa cacccagacg accacagtca atgaaaccag agaaacgacc 1920 attctcaacc atgatgttcg gcaggcatgc atcaccatga gtaactacca ggtcctcacc 1980 atccggcata cgagctttca gacgtgcaaa cagttcagcc ggtgccagac cctgatgttc 2040 ctcatccagg tcatcctggt caaccagacc tgcttccata cgggtacgag cacgttcaat 2100 ~1 acgatgttttgcctggtggtcaaacggacaggtagctgggtccagggtgtgcagacgacg2160 cattgcatcagccatgatagaaactttctctgccggagccaggtgagaagacagcaggtc2220 ctgacccggaacttcacccagcagcagccagtcacgaccagcttcagtaactacatccag2280 aactgcagcacacggaacaccagtggttgccagccaagacagacgagctgcttcatcctg2340 cagttcattcagagcaccagacaggtoagttttaacaaacagaactggacgaccctgtgc2400 agacagacggaaaacagctgcatcagagcaaccaatggtctgctgtgcccagtcataacc2460 aaacagacgttcaacccaggctgccggagaacctgcatgcagaccatcctgttcaatcat2520 gcgaaacgatcctcatcctgtctcttgatcagatcttgatcccctgcgccatcagatcct2580 tggcggcaagaaagccatccagtttactttgcagggcttcccaaccttaccagagggcgc2640 cccagctggcaattccggttcgcttgctgtccataaaaccgcccagtctagcaactgttg2700 ggaagggcga tcg 2713 <210>
<211>
<212>
DNA
<213>
artificial sequence <220>
<223> with an for Plasmid analog b vector GHRH
sequence codon optimized ovine.
<400>
tgtaatacgactcactatagggcgaattggagctccaccgcggtggcggccgtccgccct60 cggcaccatcctcacgacacccaaatatggcgacgggtgaggaatggtggggagttattt120 ttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaaaaataactcccgg180 gagttatttttagagcggaggaatggtggacacccaaatatggcgacggttcctcacccg240 tcgccatatttgggtgtccgccctcggccggggccgcattcctgggggccgggcggtgct300 CCCgCCCgCCtcgataaaaggctccggggccggcggcggcccacgagctacccggaggag360 cgggaggcgccaagcggatcccaaggcccaactccccgaaccactcagggtcctgtggac420 agctcacctagctgccatggtgctgtgggtgttcttcctggtgaccctgaccctgagcag480 cggctcccacggctccctgccctcccagcctctgcgcatccctcgctacgccgacgccat540 cttcaccaacagctaccgcaaggtgctcggccagctcagcgcccgcaagctcctgcagga600 catcatgaaccggcagcagggcgagcgcaaccaggagcagggagcctgataagcttatcg660 gggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactcca720 gtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcc780 ttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagaca840 acctgtagggctcgagggggggcccggtaccagcttttgttccctttagtgagggttaat900 ttcgagcttggtcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgc960 ggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggata1020 acgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccg1080 cgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgct1140 caagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaa1200 gctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttc1260 tcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgt1320 aggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcg1380 ccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactgg1440 cagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttct1500 tgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgc1560 tgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccg1620 ctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctc1680 aagaagatcctttgatcttttctacggggctagcgcttagaagaactcatccagcagacg1740 gtagaatgcaatacgttgagagtctggagctgcaataccatacagaaccaggaaacggtc1800 agcccattcaccacccagttcctctgcaatgtcacgggtagccagtgcaatgtcctggta1860 acggtctgcaacacccagacgaccacagtcaatgaaaccagagaaacgaccattctcaac1920 catgatgttcggcaggcatgcatcaccatgagtaactaccaggtcctcaccatccggcat1980 acgagctttcagacgtgcaaacagttcagccggtgccagaccctgatgttcctcatccag2040 gtcatcctggtcaaccagacctgcttccatacgggtacgagcacgttcaatacgatgttt2100 tgcctggtggtcaaacggacaggtagctgggtccagggtgtgcagacgacgcattgcatc2160 agccatgatagaaactttctctgccggagccaggtgagaagacagcaggtcctgacccgg2220 aacttcacccagcagcagccagtcacgaccagcttcagtaactacatccagaactgcagc2280 acacggaacaccagtggttgccagccaagacagacgagctgcttcatcctgcagttcatt2340 cagagcaccagacaggtcagttttaacaaacagaactggacgaccctgtgcagacagacg2400 gaaaacagctgcatcagagcaaccaatggtctgctgtgcccagtcataaccaaacagacg2460 ttcaacccaggctgccggagaacctgcatgcagaccatcctgttcaatcatgcgaaacga2520 tcctcatcctgtctcttgatcagatcttgatcccctgcgccatcagatccttggcggcaa2580 gaaagccatc cagtttactt tgcagggctt cccaacctta ccagagggcg ccccagctgg 2640 caattccggt tcgcttgctg tccataaaac cgcccagtct agcaactgtt gggaagggcg 2700 atcg 2704 <210>
<211>
<212>
DNA
<213>
artificial sequence <220>
<223> with for Plasmid an analog o vector GHRH
sequence codon optimized vine.
<400>
tgtaatacgactcactatagggcgaattggagctccaccgcggtggcggccgtccgccct60 cggcaccatcctcacgacacccaaatatggcgacgggtgaggaatggtggggagttattt120 ttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaaaaataactcccgg180 gagttatttttagagcggaggaatggtggacacccaaatatggcgacggttcctcacccg240 tcgccatatttgggtgtccgccctcggccggggccgcattcctgggggccgggcggtgct300 cccgcccgcctcgataaaaggctccggggccggcggcggcccacgagctacccggaggag360 cgggaggcgccaagcggatcccaaggcccaactccccgaaccactcagggtcctgtggac420 agctcacctagctgccatggtgctgtgggtgttcttcctggtgaccctgaccctgagcag480 cggaagccacggcagcctgcccagccagcccctgaggatccctaggtacgccgacgccat540 cttcaccaacagctacaggaagatcctgggccagctgagcgctaggaagctcctgcagga600 catcatgaacaggcagcagggcgagaggaaccaggagcagggcgcctgataagcttatcg660 gggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactcca720 gtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtcc780 ttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagaca840 acctgtagggctcgagggggggcccggtaccagcttttgttccctttagtgagggttaat900 ttcgagcttggtcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgc960 ggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggata1020 acgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccg1080 cgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgct1140 caagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaa1200 gctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttc1260 tcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgt1320 aggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcg1380 ccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactgg1440 cagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttct1500 tgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgc1560 tgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccg1620 ctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctc1680 aagaagatcctttgatcttttctacggggctagcgcttagaagaactcatccagcagacg1740 gtagaatgcaatacgttgagagtctggagctgcaataccatacagaaccaggaaacggtc1800 agcccattcaccacccagttcctctgcaatgtcacgggtagccagtgcaatgtcctggta1860 acggtctgcaacacccagacgaccacagtcaatgaaaccagagaaacgaccattctcaac1920 catgatgttcggcaggcatgcatcaccatgagtaactaccaggtcctcaccatccggcat1980 acgagctttcagacgtgcaaacagttcagccggtgccagaccctgatgttcctcatccag2040 gtcatcctggtcaaccagacctgcttccatacgggtacgagcacgttcaatacgatgttt2100 tgcctggtggtcaaacggacaggtagctgggtccagggtgtgcagacgacgcattgcatc2160 agccatgatagaaactttctctgccggagccaggtgagaagacagcaggtcctgacccgg2220 aacttcacccagcagcagccagtcacgaccagcttcagtaactacatccagaactgcagc2280 acacggaacaccagtggttgccagccaagacagacgagctgcttcatcctgcagttcatt2340 cagagcaccagacaggtcagttttaacaaacagaactggacgaccctgtgcagacagacg2400 gaaaacagctgcatcagagcaaccaatggtctgctgtgcccagtcataaccaaacagacg2460 ttcaacccaggctgccggagaacctgcatgcagaccatcctgttcaatcatgcgaaacga2520 tcctcatcctgtctcttgatcagatcttgatcccctgcgccatcagatccttggcggcaa2580 gaaagccatccagtttactttgcagggcttcccaaccttaccagagggcgccccagctgg2640 caattccggttcgcttgctgtccataaaaccgcccagtctagcaactgttgggaagggcg2700 atcg 2704 <210> 21 <211> 2713 <212> DNA
<213> artificial sequence <220>
<223> Plasmid vector with an analog GHRH sequence codon optimized for c hicken.
<400>
tgtaatacgactcactatagggcgaattggagctccaccgcggtggcggccgtccgccct60 cggcaccatcctcacgacacccaaatatggcgacgggtgaggaatggtggggagttattt120 ttagagcggtgaggaaggtgggcaggcagcaggtgttggcgctctaaaaataactcccgg180 gagttatttttagagcggaggaatggtggacacccaaatatggcgacggttcctcacccg240 tcgccatatttgggtgtccgccctcggccggggccgcattcctgggggccgggcggtgct300 cccgcccgcctcgataaaaggctccggggccggcggcggcccacgagctacccggaggag360 cgggaggcgccaagcggatcccaaggcccaactccccgaaccactcagggtcctgtggac420 agctcacctagctgccatggccctgtgggtgttctttgtgctgctgaccctgacctccgg480 aagccactgcagcctgccacccagcccacccttccgcgtcaggcgccacgccgacggcat540 cttcagcaaggcctaccgcaagctcctgggccagctgagcgcacgcaactacctgcacag600 cctgatggccaagcgcgtgggcagcggactgggagacgaggccgagcccctgagctgata660 agcttatcggggtggcatccctgtgacccctccccagtgcctctcctggccctggaagtt720 gccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgac780 taggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagtt840 gggaagacaacctgtagggctcgagggggggcccggtaccagcttttgttccctttagtg900 agggttaatttcgagcttggtcttccgcttcctcgctcactgactcgctgcgctcggtcg960 ttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaat1020 caggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgta1080 aaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaa1140 atcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttc1200 cccctggaagctccctcgtgCgCtCtCCtgttCCgaCCCtgCCgCttaCCggatacctgt1260 ccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctca1320 gttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccg1380 accgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttat1440 cgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgcta1500 cagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatct1560 gcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaac1620 aaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaa1680 aaggatctcaagaagatcctttgatcttttctacggggctagcgcttagaagaactcatc1740 cagcagacggtagaatgcaatacgttgagagtctggagctgcaataccatacagaaccag1800 gaaacggtcagcccattcaccacccagttcctctgcaatgtcacgggtagccagtgcaat1860 gtcctggtaacggtctgcaacacccagacgaccacagtcaatgaaaccagagaaacgacc1920 attctcaaccatgatgttcggcaggcatgcatcaccatgagtaactaccaggtcctcacc1980 atccggcatacgagctttcagacgtgcaaacagttcagccggtgccagaccctgatgttc2040 ctcatccaggtcatcctggtcaaccagacctgcttccatacgggtacgagcacgttcaat2100 acgatgttttgcctggtggtcaaacggacaggtagctgggtccagggtgtgcagacgacg2160 cattgcatcagccatgatagaaactttctctgccggagccaggtgagaagacagcaggtc2220 ctgacccggaacttcacccagcagcagccagtcacgaccagcttcagtaactacatccag2280 aactgcagcacacggaacaccagtggttgccagccaagacagacgagctgcttcatcctg2340 cagttcattcagagcaccagacaggtcagttttaacaaacagaactggacgaccctgtgc2400 agacagacggaaaacagctgcatcagagcaaccaatggtctgctgtgcccagtcataacc2460 aaacagacgttcaacccaggctgccggagaacctgcatgcagaccatcctgttcaatcat2520 gcgaaacgatcctcatcctgtctcttgatcagatcttgatcccctgcgccatcagatcct2580 tggcggcaagaaagccatccagtttactttgcagggcttcccaaccttaccagagggcgc2640 cccagctggcaattccggttcgcttgctgtccataaaaccgcccagtctagcaactgttg2700 ggaagggcgatcg <210> 22 <211> 55 <212> DNA
<213> artificial sequence <220>
<223> Sequence of a human growth hormone ("hGH") 5' UTR.
<400> 22 caaggcccaa ctccccgaac cactcagggt cctgtggaca gctcacctag ctgcc 55 <210> 23 <211> 782 <212> DNA
<213> artificial sequence <220>
<223> This is a nucleic acid sequence of a plasmid pUC-18 origin of rep licaiton <400> 23 tcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggta60 tcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaag120 aacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgcgttgctggcg180 tttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagagg240 tggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtg300 CgCtCtCCtgttCCgaCCCtgCCgCttaCCggatacctgtccgcctttctcccttcggga360 agcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgc420 tccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggt480 aactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccact540 ggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtgg600 cctaactacggctacactagaaggacagtatttggtatctgcgctctgctgaagccagtt660 accttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggt720 ggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcct780 tt 782 <210> 24 <21l> 5 <212> DNA
<213> artificial sequence <220>
<223> This is a NEO ribosomal binding site.
<400> 24 tcctC 5 <210> 25 <211> 29 <212> DNA
<213> artificial sequence <220>
<223> This is a nucleic acid sequence of a prokaryotic PNEO promoter.
<400> 25 accttaccag agggcgcccc agctggcaa 29 2~
Claims (90)
1. A composition comprising:
(a) a nucleic acid expression construct; and (b) a charged transfection-facilitating polypeptide associated therewith;
wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
(a) a nucleic acid expression construct; and (b) a charged transfection-facilitating polypeptide associated therewith;
wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
2. The composition of claim 1, wherein the charged transfection-facilitating polypeptide comprises poly-L-glutamate.
3. The composition of claim 1, wherein the ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1,200 moles or less of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
4. The composition of claim 1, wherein the ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1 mole of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
5. The composition of claim 1, wherein an average molecular length of the nucleic acid expression vector is from about 2,000 to about 5,000 nucleotide base pairs.
6. The composition of claim 1, wherein an average molecular weight of the charged transfection-facilitating polypeptide is from about 400 to about 30,000 Da.
7. The composition of claim 1, wherein an average molecular length of the nucleic acid expression vector is about 5,000 nucleotide base pairs, and an average molecular weight of the charged transfection-facilitating polypeptide is about 10,900 Da.
8. The composition of claim 1, wherein the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21.
9. The composition of claim 1, wherein the nucleic acid expression construct comprises a gene that encodes a growth-hormone-releasing hormone ("GHRH") or functional biological equivalent thereof.
10. The composition of claim 9, wherein the encoded GHRH is a biologically active polypeptide, and the encoded functional biological equivalent of GHRH is a polypeptide that has been engineered to contain a distinct amino acid sequence while simultaneously having similar or improved biologically activity when compared to the GHRH polypeptide.
11. The composition of claim 9, wherein the encoded GHRH or functional biological equivalent thereof is of formula (SEQID #6):
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
12. The composition of claim 1, wherein the nucleic acid expression construct encodes a polypeptide of a sequence comprising SeqID#1, SeqID#2, SeqID#3, SeqID#4, or SeqID#5.
13. A composition comprising:
(a) a nucleic acid expression construct; and (b) a poly-L-glutamate polypeptide associated therewith;
wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
(a) a nucleic acid expression construct; and (b) a poly-L-glutamate polypeptide associated therewith;
wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
14. The composition of claim 13, wherein the ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1,200 moles or less of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
15. The composition of claim 13, wherein the ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1 mole of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
16. The composition of claim 13, wherein an average molecular length of the nucleic acid expression vector is from about 2,000 to about 5,000 nucleotide base pairs.
17. The composition of claim 13, wherein an average molecular weight of the charged transfection-facilitating polypeptide is from about 400 to about 30,000 Da.
18. The composition of claim 13, wherein an average molecular length of the nucleic acid expression vector is about 5,000 nucleotide base pairs, and an average molecular weight of the charged transfection-facilitating polypeptide is about 10,900 Da.
19. The composition of claim 13, wherein the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, Seq117#18, SeqID#19, SeqID#20, or SeqID#21.
20. The composition of claim 13, wherein the nucleic acid expression construct comprises a gene that encodes a growth-hormone-releasing hormone ("GHRH") or functional biological equivalent thereof.
21. The composition of claim 20, wherein the encoded GHRH is a biologically active polypeptide, and the encoded functional biological equivalent of GHRH is a polypeptide that has been engineered to contain a distinct amino acid sequence while simultaneously having similar or improved biologically activity when compared to the GHRH polypeptide.
22. The composition of claim 20, wherein the encoded GHRH or functional biological equivalent thereof is of formula (SEQID#6):
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
23. The composition of claim 13, wherein the nucleic acid expression construct encodes a polypeptide of a sequence comprising SeqID#1, SeqID#2, SeqID#3, SeqID#4, or SeqID#5.
24. A composition comprising:
(a) a nucleic acid expression construct encoding a growth hormone releasing hormone ("GHRH") or functional biological equivalent thereof, and (b) a poly-L-glutamate polypeptide associated therewith, wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
(a) a nucleic acid expression construct encoding a growth hormone releasing hormone ("GHRH") or functional biological equivalent thereof, and (b) a poly-L-glutamate polypeptide associated therewith, wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
25. The composition of claim 24, wherein the ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1,200 moles or less of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
26. The composition of claim 24, wherein the ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1 mole of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
27. The composition of claim 24, wherein an average molecular length of the nucleic acid expression vector is from about 2,000 to about 5,000 nucleotide base pairs.
28. The composition of claim 24, wherein an average molecular weight of the charged transfection-facilitating polypeptide is from about 400 to about 30,000 Da.
29. The composition of claim 24, wherein an average molecular length of the nucleic acid expression vector is about 5,000 nucleotide base pairs, and an average molecular weight of the charged transfection-facilitating polypeptide is about 10,900 Da.
30. The composition of claim 24, wherein the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21.
31. The composition of claim 24, wherein the encoded GHRH is a biologically active polypeptide, and the encoded functional biological equivalent of GHRH is a polypeptide that has been engineered to contain a distinct amino acid sequence while simultaneously having similar or improved biologically activity when compared to the GHRH polypeptide.
32. The composition of claim 24, wherein the encoded GHRH or functional biological equivalent thereof is of formula (SEQID#6):
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
33. The method of claim 24, wherein the nucleic acid expression construct encodes a polypeptide of a sequence comprising SeqID#1, SeqID#2, SeqID#3, SeqID#4, or SeqID#5.
34. A composition comprising:
(a) a nucleic acid expression construct encoding a growth hormone releasing hormone ("GHRH") or functional biological equivalent thereof, and (b) a charged transfection-facilitating polypeptide associated theewith;
wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
(a) a nucleic acid expression construct encoding a growth hormone releasing hormone ("GHRH") or functional biological equivalent thereof, and (b) a charged transfection-facilitating polypeptide associated theewith;
wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
35. The composition of claim 34, wherein the ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1,200 moles or less of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
36. The composition of claim 34, wherein the ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1 mole of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
37. The composition of claim 34, wherein an average molecular length of the nucleic acid expression vector is from about 2,000 to about 5,000 nucleotide base pairs.
38. The composition of claim 34, wherein an average molecular weight of the charged transfection-facilitating polypeptide is from about 400 to about 30,000 Da.
39. The composition of claim 34, wherein an average molecular length of the nucleic acid expression vector is about 5,000 nucleotide base pairs, and an average molecular weight of the charged transfection-facilitating polypeptide is about 10,900 Da.
40. The composition of claim 34, wherein the charged transfection-facilitating polypeptide comprises poly-L-glutamate.
41. The composition of claim 34, wherein the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21.
42. The composition of claim 34, wherein the encoded GHRH is a biologically active polypeptide, and the encoded functional biological equivalent of GHRH is a polypeptide that has been engineered to contain a distinct amino acid sequence while simultaneously having similar or improved biologically activity when compared to the GHRH polypeptide.
43. The composition of claim 34, wherein the encoded GHRH or functional biological equivalent thereof is of formula (SEQID#6):
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
44. The method of claim 34, wherein the nucleic acid expression construct encodes a polypeptide of a sequence comprising SeqID#1, SeqID#2, SeqID#3, SeqID#4, or SeqID#5.
45. A method for introducing a nucleic acid expression construct into a cell of a selected tissue in a recipient, comprising:
(a) placing a plurality of electrodes in the selected tissue, wherein the plurality of electrodes are arranged in a spaced relationship;
(b) introducing the nucleic acid expression construct having a charged transfection-facilitating polypeptide associated therewith; and (c) applying a constant current electrical pulse to the plurality of electrodes;
wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
(a) placing a plurality of electrodes in the selected tissue, wherein the plurality of electrodes are arranged in a spaced relationship;
(b) introducing the nucleic acid expression construct having a charged transfection-facilitating polypeptide associated therewith; and (c) applying a constant current electrical pulse to the plurality of electrodes;
wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
46. The composition of claim 45, wherein the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21.
47. The method of claim 45, wherein the cell of the selected tissue comprises a somatic cell, a stem cell, or a germ cell.
48. The method of claim 45, wherein the selected tissue in the recipient comprises muscle.
49. The method of claim 45, wherein the charged transfection-facilitating polypeptide comprises poly-L-glutamate.
50. The method of claim 45, wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1,200 moles or less of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
51. The method of claim 45, wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1 mole of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
52. The method of claim 45, wherein the plurality of electrodes are constructed from a material that will make galvanic contact with the tissues.
53. The method of claim 45, wherein the nucleic acid expression construct comprises a gene that encodes a growth-hormone-releasing hormone ("GHRH") or functional biological equivalent thereof.
54. The method of claim 53, wherein the encoded GHRH or functional biological equivalent thereof is expressed in a tissue specific cell of the subject.
55. The method of claim 53, wherein the encoded GHRH is a biologically active polypeptide; and the encoded functional biological equivalent of GHRH is a polypeptide that has been engineered to contain a distinct amino acid sequence while simultaneously having similar or improved biologically activity when compared to the GHRH polypeptide.
56. The method of claim 53, wherein the encoded GHRH or functional biological equivalent thereof is of formula (SEQID#6):
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
57. The method of claim 45, wherein the nucleic acid expression construct encodes a polypeptide of a sequence comprising SeqID#1, SeqID#2, SeqID#3, SeqID#4, or SeqID#5.
58. A method for introducing a nucleic acid expression construct into a muscle cell in a body, comprising:
(a) placing a plurality of electrodes in the selected tissue, wherein the plurality of electrodes are arranged in a spaced relationship;
(b) introducing the nucleic acid expression construct having a charged transfection-facilitating polypeptide associated therewith; wherein charged transfection-facilitating polypeptide comprises a poly-L-glutamate polypeptide;
(c) applying an electrical pulse to the plurality of electrodes, wherein the nucleic acid expression construct encodes a growth hormone releasing hormone ("GHRH") or functional biological equivalent thereof; and a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
(a) placing a plurality of electrodes in the selected tissue, wherein the plurality of electrodes are arranged in a spaced relationship;
(b) introducing the nucleic acid expression construct having a charged transfection-facilitating polypeptide associated therewith; wherein charged transfection-facilitating polypeptide comprises a poly-L-glutamate polypeptide;
(c) applying an electrical pulse to the plurality of electrodes, wherein the nucleic acid expression construct encodes a growth hormone releasing hormone ("GHRH") or functional biological equivalent thereof; and a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
59. The method of claim 58, wherein an average molecular length of the nucleic acid expression vector is from about 2,000 to about 5,000 nucleotide base pairs.
60. The method of claim 58, wherein an average molecular weight of the charged transfection-facilitating polypeptide is from about 400 to about 30,000 Da.
61. The method of claim 58, wherein an average molecular length of the nucleic acid expression vector is about 5,000 nucleotide base pairs, and an average molecular weight of the charged transfection-facilitating polypeptide is about 10,900 Da.
62. The method of claim 58, wherein the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21.
63. The method of claim 58, wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1,200 moles or less of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
64. The method of claim 58, wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1 mole of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
65. The method of claim 58, wherein the plurality of needle electrodes are constructed from a material that will make galvanic contact with the tissues.
66. The method of claim 58, wherein introducing the nucleic acid expression construct into the muscle cell of the recipient initiates expression of an encoded GHRH
or functional biological equivalent thereof.
or functional biological equivalent thereof.
67. The method of claim 58, wherein the encoded GHRH or functional biological equivalent thereof is expressed in a tissue specific cell of the subject.
68. The method of claim 58, wherein the encoded GHRH is a biologically active polypeptide; and the encoded functional biological equivalent of GHRH is a polypeptide that has been engineered to contain a distinct amino acid sequence while simultaneously having similar or improved biologically activity when compared to the GHRH polypeptide.
69. The method of claim 58, wherein the encoded GHRH or functional biological equivalent thereof is of formula (SEQID#6):
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
70. The method of claim 58, wherein the nucleic acid expression construct encodes a polypeptide of a sequence comprising SeqID#1, SeqID#2, SeqID#3, SeqID#4, or SeqID#5.
71. A method to increase stability of a nucleic acid expression construct, comprising:
mixing the nucleic acid expression construct with a charged transfection-facilitating polypeptide to give a stabilized nucleic acid expression construct;
wherein (a) the in vitro degradation of the stabilized nucleic acid expression construct is slower as compared to that of the nucleic acid expression construct not associated with a transfection-facilitation polypeptide; and (b) a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
mixing the nucleic acid expression construct with a charged transfection-facilitating polypeptide to give a stabilized nucleic acid expression construct;
wherein (a) the in vitro degradation of the stabilized nucleic acid expression construct is slower as compared to that of the nucleic acid expression construct not associated with a transfection-facilitation polypeptide; and (b) a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
72. The method of claim 71, wherein charged transfection-facilitating polypeptide comprises a poly-L-glutamate polypeptide.
73. The method of claim 71, wherein an average molecular length of the nucleic acid expression vector is from about 2,000 to about 5,000 nucleotide base pairs.
74. The method of claim 71, wherein an average molecular weight of the charged transfection-facilitating polypeptide is from about 400 to about 30,000 Da.
75. The method of claim 71, wherein an average molecular length of the nucleic acid expression vector is about 5,000 nucleotide base pairs, and an average molecular weight of the charged transfection-facilitating polypeptide is about 10,900 Da.
76. The method of claim 71, wherein the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21.
77. The method of claim 71, wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1,200 moles or less of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
78. The method of claim 71, wherein a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1 mole of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
79. The method of claim 71, wherein the nucleic acid expression construct encodes a growth hormone releasing hormone ("GHRH") or functional biological equivalent thereof.
80. The method of claim 79, wherein the encoded GHRH or functional biological equivalent thereof is of formula (SEQID#6):
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
81. The method of claim 71, wherein the nucleic acid expression construct encodes a polypeptide of a sequence comprising SeqID#1, SeqID#2, SeqID#3, SeqID#4, or SeqID#5.
82. A method to increase stability of a nucleic acid expression construct, comprising:
mixing the nucleic acid expression construct with a charged transfection-facilitating polypeptide to give a stabilized nucleic acid expression construct wherein the in vitro degradation of the stabilized nucleic acid expression construct is slower as compared to that of the nucleic acid expression construct not associated with a transfection-facilitation polypeptide;
the charged transfection-facilitating polypeptide comprises a poly-L-glutamate polypeptide;
the nucleic acid expression construct encodes a growth hormone releasing hormone ("GHRH") or functional biological equivalent thereof; and a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
mixing the nucleic acid expression construct with a charged transfection-facilitating polypeptide to give a stabilized nucleic acid expression construct wherein the in vitro degradation of the stabilized nucleic acid expression construct is slower as compared to that of the nucleic acid expression construct not associated with a transfection-facilitation polypeptide;
the charged transfection-facilitating polypeptide comprises a poly-L-glutamate polypeptide;
the nucleic acid expression construct encodes a growth hormone releasing hormone ("GHRH") or functional biological equivalent thereof; and a ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct comprises from 1 mole to 5,000 moles of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
83. The method of claim 82, wherein an average molecular length of the nucleic acid expression vector is from about 2,000 to about 5,000 nucleotide base pairs.
84. The method of claim 82, wherein an average molecular weight of the charged transfection-facilitating polypeptide is from about 400 to about 30,000 Da.
85. The method of claim 82, wherein an average molecular length of the nucleic acid expression vector is about 5,000 nucleotide base pairs, and an average molecular weight of the charged transfection-facilitating polypeptide is about 10,900 Da.
86. The method of claim 82, wherein the nucleic acid expression construct comprises SeqID#11, SeqID#12, SeqID#13, SeqID#14, SeqID#17, SeqID#18, SeqID#19, SeqID#20, or SeqID#21.
87. The method of claim 82, wherein the ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1,200 moles or less of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
88. The method of claim 82, wherein the ratio in moles of the charged transfection-facilitating polypeptide to nucleic acid expression construct is equal to 1 mole of the charged transfection-facilitating polypeptide per mole of nucleic acid expression construct.
89. The method of claim 82, wherein the encoded GHRH or functional biological equivalent thereof is of formula (SEQID#6):
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
wherein the formula has the following characteristics:
X1 is a D-or L-isomer of the amino acid tyrosine ("Y"), or histidine ("H");
X2 is a D-or L-isomer of the amino acid alanine ("A"), valine ("V"), or isoleucine ("I");
X3 is a D-or L-isomer of the amino acid alanine ("A") or glycine ("G");
X4 is a D-or L-isomer of the amino acid methionine ("M"), or leucine ("L");
X5 is a D-or L-isomer of the amino acid serine ("S") or asparagine ("N"); or a combination thereof.
90. The method of claim 82, wherein the nucleic acid expression construct encodes a polypeptide of a sequence comprising SeqID#1, SeqID#2, SeqID#3, SeqID#4, or SeqID#5.
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US15667002A | 2002-05-28 | 2002-05-28 | |
US10/156,670 | 2002-05-28 | ||
US10/395,709 | 2003-03-24 | ||
US10/395,709 US20040014645A1 (en) | 2002-05-28 | 2003-03-24 | Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system |
PCT/US2003/016541 WO2003099341A1 (en) | 2002-05-28 | 2003-05-23 | Increased delivery of a nucleic acid constrtuct in vivo by the poly-l-glutamate (plg) system |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2485976A1 true CA2485976A1 (en) | 2003-12-04 |
Family
ID=29586320
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002485976A Abandoned CA2485976A1 (en) | 2002-05-28 | 2003-05-23 | Increased delivery of a nucleic acid construct in vivo by the poly-l-glutamate (plg) system |
Country Status (7)
Country | Link |
---|---|
EP (1) | EP1513559A4 (en) |
CN (1) | CN1662261A (en) |
AU (1) | AU2003273142A1 (en) |
BR (1) | BR0311539A (en) |
CA (1) | CA2485976A1 (en) |
MX (1) | MXPA04011766A (en) |
WO (1) | WO2003099341A1 (en) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPWO2005089810A1 (en) * | 2004-03-22 | 2008-01-31 | 関西ティー・エル・オー株式会社 | Bone induction method by introducing human bone morphogenetic gene using electroporation method |
ATE413890T1 (en) * | 2004-07-23 | 2008-11-15 | Advisys Inc | GROWTH HORMONE RELEASING HORMONE ENHANCES THE VACCINE-INDUCED IMMUNE RESPONSE |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
MXPA02000938A (en) * | 1999-07-26 | 2004-03-19 | Baylor College Medicine | Super active porcine growth hormone releasing hormone analog. |
JP4987205B2 (en) * | 2000-03-03 | 2012-07-25 | ジェネトロニクス, インコーポレイテッド | Nucleic acid preparations for gene delivery and methods of use |
BR0214869A (en) * | 2001-12-11 | 2005-03-08 | Advisys Inc | Plasmid-mediated supplementation for treatment of chronically ill individuals |
-
2003
- 2003-05-23 AU AU2003273142A patent/AU2003273142A1/en not_active Abandoned
- 2003-05-23 WO PCT/US2003/016541 patent/WO2003099341A1/en not_active Application Discontinuation
- 2003-05-23 CA CA002485976A patent/CA2485976A1/en not_active Abandoned
- 2003-05-23 MX MXPA04011766A patent/MXPA04011766A/en not_active Application Discontinuation
- 2003-05-23 BR BR0311539-9A patent/BR0311539A/en not_active Application Discontinuation
- 2003-05-23 EP EP03741818A patent/EP1513559A4/en not_active Withdrawn
- 2003-05-23 CN CN 03814625 patent/CN1662261A/en active Pending
Also Published As
Publication number | Publication date |
---|---|
BR0311539A (en) | 2005-10-25 |
MXPA04011766A (en) | 2005-03-31 |
AU2003273142A1 (en) | 2003-12-12 |
WO2003099341A1 (en) | 2003-12-04 |
CN1662261A (en) | 2005-08-31 |
EP1513559A1 (en) | 2005-03-16 |
EP1513559A4 (en) | 2006-01-18 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20040014645A1 (en) | Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system | |
AU2014211454B2 (en) | High avidity binding molecules recognizing MAGE-A1 | |
CA2469310C (en) | Plasmid mediated supplementation for treating chronically ill subjects | |
EP1951751B1 (en) | Gene therapy for renal failure | |
CA2464199C (en) | A composition and method to alter lean body mass and bone properties in a subject | |
AU2007319351B2 (en) | Intra-vascular kidney gene therapy with plasmid encoding BMP-7 | |
CA2513743C (en) | Reducing culling in herd animals growth hormone releasing hormone (ghrh) | |
US20040038918A1 (en) | Modified pituitary gland development in offspring from expectant mother animals treated with growth hormone releasing hormone therapy | |
US20040192593A1 (en) | Protease resistant ti-growth hormone releasing hormone | |
JP2003052390A (en) | Growth hormone and growth hormone releasing hormone composition | |
CA2485976A1 (en) | Increased delivery of a nucleic acid construct in vivo by the poly-l-glutamate (plg) system | |
US6759393B1 (en) | Growth hormone and growth hormone releasing hormone compositions | |
CN114606265B (en) | Mini base editor capable of realizing single AAV virus coating | |
TW200424214A (en) | Plasmid mediated GHRH supplementation for renal failures | |
US8962818B2 (en) | Compositions comprising GHRH and GnRH and methods of using the same | |
EP1711187B1 (en) | Reducing arthritis and lameness in subjects by growth hormone releasing hormone (ghrh) supplementation | |
CN110819589B (en) | Method for enhancing immune effector cell function | |
RU2839576C2 (en) | Viral expression construct comprising fibroblast growth factor 21 (fgf21) coding sequence | |
CN107287240B (en) | Recombinant adeno-associated virus gene therapy vector and drug for treating type 2 achromatopsia patients | |
WO2009065121A1 (en) | Increased stability of a dna formulation by including poly-l-glutamate | |
CN109321602A (en) | PKD2 recombinates over-express vector and its construction method and purposes | |
HK1140779A (en) | Gene therapy for renal failure | |
HK1143754B (en) | Intra-vascular kidney gene therapy with plasmid encoding bmp-7 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
FZDE | Discontinued |