CA2449296A1 - Modulators of amyloid aggregation - Google Patents
Modulators of amyloid aggregation Download PDFInfo
- Publication number
- CA2449296A1 CA2449296A1 CA002449296A CA2449296A CA2449296A1 CA 2449296 A1 CA2449296 A1 CA 2449296A1 CA 002449296 A CA002449296 A CA 002449296A CA 2449296 A CA2449296 A CA 2449296A CA 2449296 A1 CA2449296 A1 CA 2449296A1
- Authority
- CA
- Canada
- Prior art keywords
- phe
- amyloid
- seq
- compound
- natural
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 230000006933 amyloid-beta aggregation Effects 0.000 title abstract description 7
- 150000001875 compounds Chemical class 0.000 claims abstract description 498
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 479
- 238000004220 aggregation Methods 0.000 claims abstract description 250
- 230000002776 aggregation Effects 0.000 claims abstract description 249
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 196
- 238000000034 method Methods 0.000 claims abstract description 73
- 206010029350 Neurotoxicity Diseases 0.000 claims abstract description 58
- 206010044221 Toxic encephalopathy Diseases 0.000 claims abstract description 58
- 231100000228 neurotoxicity Toxicity 0.000 claims abstract description 58
- 230000007135 neurotoxicity Effects 0.000 claims abstract description 58
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 49
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 17
- 235000001014 amino acid Nutrition 0.000 claims description 180
- 150000001413 amino acids Chemical class 0.000 claims description 154
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 121
- 206010002022 amyloidosis Diseases 0.000 claims description 70
- 230000002401 inhibitory effect Effects 0.000 claims description 67
- COLNVLDHVKWLRT-QMMMGPOBSA-N phenylalanine group Chemical group N[C@@H](CC1=CC=CC=C1)C(=O)O COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 claims description 45
- 210000004899 c-terminal region Anatomy 0.000 claims description 35
- 208000024827 Alzheimer disease Diseases 0.000 claims description 33
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 27
- 150000008574 D-amino acids Chemical group 0.000 claims description 18
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 claims description 15
- JKJSIYKSGIDHPM-WBAXXEDZSA-N Phe-Phe-Ala Chemical compound C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)Cc1ccccc1)C(O)=O JKJSIYKSGIDHPM-WBAXXEDZSA-N 0.000 claims description 13
- 239000003814 drug Substances 0.000 claims description 11
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 claims description 11
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 claims description 11
- SICITCLFXRGKJW-IIZANFQQSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2,6-diaminohexanoyl]amino]-4-methylpentanoyl]amino]-3-methylbutanoyl]amino]-3-phenylpropanoyl]amino]-3-phenylpropanoic acid Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)CC(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 SICITCLFXRGKJW-IIZANFQQSA-N 0.000 claims description 9
- 239000003937 drug carrier Substances 0.000 claims description 8
- BCBFMJYTNKDALA-UFYCRDLUSA-N Val-Phe-Phe Chemical compound N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O BCBFMJYTNKDALA-UFYCRDLUSA-N 0.000 claims description 6
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 6
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 claims description 4
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 claims description 4
- 238000004519 manufacturing process Methods 0.000 claims description 4
- 102000009091 Amyloidogenic Proteins Human genes 0.000 abstract description 25
- 108010048112 Amyloidogenic Proteins Proteins 0.000 abstract description 25
- 201000010099 disease Diseases 0.000 abstract description 19
- 230000003942 amyloidogenic effect Effects 0.000 abstract description 12
- 229940024606 amino acid Drugs 0.000 description 148
- 210000004027 cell Anatomy 0.000 description 95
- 238000003556 assay Methods 0.000 description 77
- 239000000243 solution Substances 0.000 description 60
- -1 (-)-menthoxyacetyl group Chemical group 0.000 description 44
- 125000002160 cholyl group Chemical group [H]C([H])([C@]1(C([C@@]2([H])O[H])([H])[H])[H])[C@@](O[H])([H])C([H])([H])C([H])([H])[C@]1(C([H])([H])[H])[C@]1([H])[C@]2([H])[C@]2([H])C([H])([H])C([H])([H])[C@@]([C@](C([H])([H])[H])(C(C(C(=O)[*])([H])[H])([H])[H])[H])([H])[C@@]2(C([H])([H])[H])[C@](O[H])([H])C1([H])[H] 0.000 description 43
- 108090000623 proteins and genes Proteins 0.000 description 40
- 125000000539 amino acid group Chemical group 0.000 description 38
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 37
- 238000012360 testing method Methods 0.000 description 37
- 229960001760 dimethyl sulfoxide Drugs 0.000 description 34
- 239000000203 mixture Substances 0.000 description 33
- 238000001727 in vivo Methods 0.000 description 30
- 238000006467 substitution reaction Methods 0.000 description 29
- 238000000338 in vitro Methods 0.000 description 28
- 208000035475 disorder Diseases 0.000 description 26
- 239000013604 expression vector Substances 0.000 description 26
- 239000000178 monomer Substances 0.000 description 26
- 102000004169 proteins and genes Human genes 0.000 description 26
- 239000013598 vector Substances 0.000 description 26
- 108020004414 DNA Proteins 0.000 description 24
- 230000015572 biosynthetic process Effects 0.000 description 23
- 230000005764 inhibitory process Effects 0.000 description 23
- 238000012217 deletion Methods 0.000 description 22
- 230000037430 deletion Effects 0.000 description 22
- 230000014509 gene expression Effects 0.000 description 22
- 235000018102 proteins Nutrition 0.000 description 22
- 229920005989 resin Polymers 0.000 description 22
- 239000011347 resin Substances 0.000 description 22
- 102000001049 Amyloid Human genes 0.000 description 21
- 108010094108 Amyloid Proteins 0.000 description 21
- 230000008878 coupling Effects 0.000 description 21
- 238000010168 coupling process Methods 0.000 description 21
- 238000005859 coupling reaction Methods 0.000 description 21
- 239000002253 acid Substances 0.000 description 20
- 230000000694 effects Effects 0.000 description 20
- 239000003112 inhibitor Substances 0.000 description 20
- 238000006116 polymerization reaction Methods 0.000 description 20
- 239000000523 sample Substances 0.000 description 20
- 239000000126 substance Substances 0.000 description 20
- 230000008499 blood brain barrier function Effects 0.000 description 19
- 210000001218 blood-brain barrier Anatomy 0.000 description 19
- 238000001514 detection method Methods 0.000 description 19
- 230000006911 nucleation Effects 0.000 description 19
- 238000010899 nucleation Methods 0.000 description 19
- 230000002285 radioactive effect Effects 0.000 description 19
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 18
- 150000001408 amides Chemical class 0.000 description 17
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 17
- 239000012472 biological sample Substances 0.000 description 17
- 238000003259 recombinant expression Methods 0.000 description 17
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 16
- 101710137189 Amyloid-beta A4 protein Proteins 0.000 description 16
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 16
- 101710151993 Amyloid-beta precursor protein Proteins 0.000 description 16
- 125000004122 cyclic group Chemical group 0.000 description 16
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 16
- 108020004707 nucleic acids Proteins 0.000 description 16
- 102000039446 nucleic acids Human genes 0.000 description 16
- 150000007523 nucleic acids Chemical class 0.000 description 16
- 239000002953 phosphate buffered saline Substances 0.000 description 16
- 102000007079 Peptide Fragments Human genes 0.000 description 15
- 108010033276 Peptide Fragments Proteins 0.000 description 15
- 230000001965 increasing effect Effects 0.000 description 15
- 208000037259 Amyloid Plaque Diseases 0.000 description 14
- 239000003153 chemical reaction reagent Substances 0.000 description 14
- 230000002829 reductive effect Effects 0.000 description 14
- 238000002835 absorbance Methods 0.000 description 13
- 239000012634 fragment Substances 0.000 description 13
- 239000000816 peptidomimetic Substances 0.000 description 13
- JADVWWSKYZXRGX-UHFFFAOYSA-M thioflavine T Chemical compound [Cl-].C1=CC(N(C)C)=CC=C1C1=[N+](C)C2=CC=C(C)C=C2S1 JADVWWSKYZXRGX-UHFFFAOYSA-M 0.000 description 13
- 230000032258 transport Effects 0.000 description 13
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 12
- 108010075875 amyloid beta-protein (16-20) Proteins 0.000 description 12
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 12
- 125000000623 heterocyclic group Chemical group 0.000 description 12
- 230000035772 mutation Effects 0.000 description 12
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 12
- 108091000054 Prion Proteins 0.000 description 11
- 102000029797 Prion Human genes 0.000 description 11
- 125000003118 aryl group Chemical group 0.000 description 11
- 238000006243 chemical reaction Methods 0.000 description 11
- NNBZCPXTIHJBJL-AOOOYVTPSA-N cis-decalin Chemical group C1CCC[C@H]2CCCC[C@H]21 NNBZCPXTIHJBJL-AOOOYVTPSA-N 0.000 description 11
- 230000004048 modification Effects 0.000 description 11
- 238000012986 modification Methods 0.000 description 11
- 238000002360 preparation method Methods 0.000 description 11
- 230000008569 process Effects 0.000 description 11
- 206010035226 Plasma cell myeloma Diseases 0.000 description 10
- 108010071690 Prealbumin Proteins 0.000 description 10
- 102000009190 Transthyretin Human genes 0.000 description 10
- 125000003277 amino group Chemical group 0.000 description 10
- BHQCQFFYRZLCQQ-OELDTZBJSA-N cholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 BHQCQFFYRZLCQQ-OELDTZBJSA-N 0.000 description 10
- 230000008021 deposition Effects 0.000 description 10
- 230000002209 hydrophobic effect Effects 0.000 description 10
- 229910052740 iodine Inorganic materials 0.000 description 10
- 210000002569 neuron Anatomy 0.000 description 10
- 108010073025 phenylalanylphenylalanine Proteins 0.000 description 10
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 9
- 101800001890 Atrial natriuretic peptide Proteins 0.000 description 9
- 102400001282 Atrial natriuretic peptide Human genes 0.000 description 9
- 108010041872 Islet Amyloid Polypeptide Proteins 0.000 description 9
- SECXISVLQFMRJM-UHFFFAOYSA-N N-Methylpyrrolidone Chemical compound CN1CCCC1=O SECXISVLQFMRJM-UHFFFAOYSA-N 0.000 description 9
- 235000020958 biotin Nutrition 0.000 description 9
- 239000011616 biotin Substances 0.000 description 9
- 229960002685 biotin Drugs 0.000 description 9
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 9
- 238000009472 formulation Methods 0.000 description 9
- 238000011534 incubation Methods 0.000 description 9
- 239000011630 iodine Substances 0.000 description 9
- 230000001105 regulatory effect Effects 0.000 description 9
- 101800001288 Atrial natriuretic factor Proteins 0.000 description 8
- 239000004380 Cholic acid Substances 0.000 description 8
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 8
- 102000036770 Islet Amyloid Polypeptide Human genes 0.000 description 8
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 8
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 8
- 238000007792 addition Methods 0.000 description 8
- 230000003941 amyloidogenesis Effects 0.000 description 8
- 238000013459 approach Methods 0.000 description 8
- 125000004432 carbon atom Chemical group C* 0.000 description 8
- NSQLIUXCMFBZME-MPVJKSABSA-N carperitide Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)=O)[C@@H](C)CC)C1=CC=CC=C1 NSQLIUXCMFBZME-MPVJKSABSA-N 0.000 description 8
- 210000003169 central nervous system Anatomy 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- 229960002471 cholic acid Drugs 0.000 description 8
- KXGVEGMKQFWNSR-UHFFFAOYSA-N deoxycholic acid Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 KXGVEGMKQFWNSR-UHFFFAOYSA-N 0.000 description 8
- 238000003745 diagnosis Methods 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- 239000003446 ligand Substances 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 125000003367 polycyclic group Chemical group 0.000 description 8
- 229910052713 technetium Inorganic materials 0.000 description 8
- GKLVYJBZJHMRIY-UHFFFAOYSA-N technetium atom Chemical compound [Tc] GKLVYJBZJHMRIY-UHFFFAOYSA-N 0.000 description 8
- 230000001225 therapeutic effect Effects 0.000 description 8
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 8
- BHQCQFFYRZLCQQ-UHFFFAOYSA-N (3alpha,5alpha,7alpha,12alpha)-3,7,12-trihydroxy-cholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 BHQCQFFYRZLCQQ-UHFFFAOYSA-N 0.000 description 7
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 235000019416 cholic acid Nutrition 0.000 description 7
- 238000001415 gene therapy Methods 0.000 description 7
- 210000004962 mammalian cell Anatomy 0.000 description 7
- 230000004060 metabolic process Effects 0.000 description 7
- 208000022256 primary systemic amyloidosis Diseases 0.000 description 7
- 229940002612 prodrug Drugs 0.000 description 7
- 239000000651 prodrug Substances 0.000 description 7
- 102000005962 receptors Human genes 0.000 description 7
- 108020003175 receptors Proteins 0.000 description 7
- 238000010561 standard procedure Methods 0.000 description 7
- 241000701161 unidentified adenovirus Species 0.000 description 7
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 6
- 208000032838 Hereditary amyloidosis with primary renal involvement Diseases 0.000 description 6
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 6
- XOEDPXDZJHBQIX-ULQDDVLXSA-N Leu-Val-Phe Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 XOEDPXDZJHBQIX-ULQDDVLXSA-N 0.000 description 6
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 6
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 6
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 6
- 239000004473 Threonine Substances 0.000 description 6
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 6
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 6
- 241000700605 Viruses Species 0.000 description 6
- 125000000217 alkyl group Chemical group 0.000 description 6
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 6
- 238000007385 chemical modification Methods 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 201000007891 familial visceral amyloidosis Diseases 0.000 description 6
- 239000000835 fiber Substances 0.000 description 6
- 239000000499 gel Substances 0.000 description 6
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 231100000189 neurotoxic Toxicity 0.000 description 6
- 230000002887 neurotoxic effect Effects 0.000 description 6
- 239000002773 nucleotide Substances 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 230000003287 optical effect Effects 0.000 description 6
- 230000003068 static effect Effects 0.000 description 6
- UDTXUDHDIVNHCL-AENUQYPBSA-N (2s)-2-[[(2s)-4-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-1-[(2s)-6-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-amino-4-methylpentanoyl]amino]-4-carboxybutanoyl]amino]-4-carboxybutanoyl]amino]-4-carboxybutanoyl]amino]-4-methylpe Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O UDTXUDHDIVNHCL-AENUQYPBSA-N 0.000 description 5
- 208000020406 Creutzfeldt Jacob disease Diseases 0.000 description 5
- 208000003407 Creutzfeldt-Jakob Syndrome Diseases 0.000 description 5
- 208000010859 Creutzfeldt-Jakob disease Diseases 0.000 description 5
- 125000000030 D-alanine group Chemical group [H]N([H])[C@](C([H])([H])[H])(C(=O)[*])[H] 0.000 description 5
- 102100033468 Lysozyme C Human genes 0.000 description 5
- 108010014251 Muramidase Proteins 0.000 description 5
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 5
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 5
- 108010065395 Neuropep-1 Proteins 0.000 description 5
- 108010048233 Procalcitonin Proteins 0.000 description 5
- 108010076504 Protein Sorting Signals Proteins 0.000 description 5
- 102000054727 Serum Amyloid A Human genes 0.000 description 5
- 150000007513 acids Chemical class 0.000 description 5
- 125000003342 alkenyl group Chemical group 0.000 description 5
- 125000000304 alkynyl group Chemical group 0.000 description 5
- CKLJMWTZIZZHCS-REOHCLBHSA-N aspartic acid group Chemical group N[C@@H](CC(=O)O)C(=O)O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 239000000032 diagnostic agent Substances 0.000 description 5
- 229940039227 diagnostic agent Drugs 0.000 description 5
- 239000000975 dye Substances 0.000 description 5
- 210000002889 endothelial cell Anatomy 0.000 description 5
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 5
- 108010087823 glycyltyrosine Proteins 0.000 description 5
- 238000003384 imaging method Methods 0.000 description 5
- 239000004325 lysozyme Substances 0.000 description 5
- 229960000274 lysozyme Drugs 0.000 description 5
- 235000010335 lysozyme Nutrition 0.000 description 5
- 239000003550 marker Substances 0.000 description 5
- 238000005259 measurement Methods 0.000 description 5
- 239000002243 precursor Substances 0.000 description 5
- CWCXERYKLSEGEZ-KDKHKZEGSA-N procalcitonin Chemical compound C([C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)NCC(O)=O)[C@@H](C)O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)[C@H]1NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@@H](N)CSSC1)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 CWCXERYKLSEGEZ-KDKHKZEGSA-N 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical class O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 230000001988 toxicity Effects 0.000 description 5
- 231100000419 toxicity Toxicity 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- 208000018282 ACys amyloidosis Diseases 0.000 description 4
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 4
- 102000055006 Calcitonin Human genes 0.000 description 4
- 108060001064 Calcitonin Proteins 0.000 description 4
- 208000005145 Cerebral amyloid angiopathy Diseases 0.000 description 4
- 229920000858 Cyclodextrin Polymers 0.000 description 4
- 108010061642 Cystatin C Proteins 0.000 description 4
- 102000012192 Cystatin C Human genes 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 208000034846 Familial Amyloid Neuropathies Diseases 0.000 description 4
- 208000007487 Familial Cerebral Amyloid Angiopathy Diseases 0.000 description 4
- 102000008946 Fibrinogen Human genes 0.000 description 4
- 108010049003 Fibrinogen Proteins 0.000 description 4
- FKXCBKCOSVIGCT-AVGNSLFASA-N Gln-Lys-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O FKXCBKCOSVIGCT-AVGNSLFASA-N 0.000 description 4
- 208000032849 Hereditary cerebral hemorrhage with amyloidosis Diseases 0.000 description 4
- 206010019889 Hereditary neuropathic amyloidosis Diseases 0.000 description 4
- IDQNVIWPPWAFSY-AVGNSLFASA-N His-His-Gln Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(O)=O IDQNVIWPPWAFSY-AVGNSLFASA-N 0.000 description 4
- 150000008575 L-amino acids Chemical class 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- XMBSYZWANAQXEV-UHFFFAOYSA-N N-alpha-L-glutamyl-L-phenylalanine Natural products OC(=O)CCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XMBSYZWANAQXEV-UHFFFAOYSA-N 0.000 description 4
- 108010066788 PPI 368 Proteins 0.000 description 4
- 108020004511 Recombinant DNA Proteins 0.000 description 4
- 108700028909 Serum Amyloid A Proteins 0.000 description 4
- 108010045517 Serum Amyloid P-Component Proteins 0.000 description 4
- 102100036202 Serum amyloid P-component Human genes 0.000 description 4
- 108010008685 alanyl-glutamyl-aspartic acid Proteins 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 230000009286 beneficial effect Effects 0.000 description 4
- 125000004057 biotinyl group Chemical group [H]N1C(=O)N([H])[C@]2([H])[C@@]([H])(SC([H])([H])[C@]12[H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C(*)=O 0.000 description 4
- 210000004556 brain Anatomy 0.000 description 4
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 4
- 229960004015 calcitonin Drugs 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 238000013461 design Methods 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 229940088598 enzyme Drugs 0.000 description 4
- 150000002148 esters Chemical class 0.000 description 4
- 229940012952 fibrinogen Drugs 0.000 description 4
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 4
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 4
- 201000008319 inclusion body myositis Diseases 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 229960000310 isoleucine Drugs 0.000 description 4
- 238000012423 maintenance Methods 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- FEMOMIGRRWSMCU-UHFFFAOYSA-N ninhydrin Chemical compound C1=CC=C2C(=O)C(O)(O)C(=O)C2=C1 FEMOMIGRRWSMCU-UHFFFAOYSA-N 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 238000012552 review Methods 0.000 description 4
- 229920006395 saturated elastomer Polymers 0.000 description 4
- 208000008864 scrapie Diseases 0.000 description 4
- 239000002904 solvent Substances 0.000 description 4
- 230000004936 stimulating effect Effects 0.000 description 4
- 238000003756 stirring Methods 0.000 description 4
- 231100000331 toxic Toxicity 0.000 description 4
- 230000002588 toxic effect Effects 0.000 description 4
- 201000007905 transthyretin amyloidosis Diseases 0.000 description 4
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 4
- 241001430294 unidentified retrovirus Species 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 3
- ASOKPJOREAFHNY-UHFFFAOYSA-N 1-Hydroxybenzotriazole Chemical compound C1=CC=C2N(O)N=NC2=C1 ASOKPJOREAFHNY-UHFFFAOYSA-N 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- KXEVYGKATAMXJJ-ACZMJKKPSA-N Ala-Glu-Asp Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O KXEVYGKATAMXJJ-ACZMJKKPSA-N 0.000 description 3
- 206010002025 Amyloidosis senile Diseases 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- NYGILGUOUOXGMJ-YUMQZZPRSA-N Asn-Lys-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O NYGILGUOUOXGMJ-YUMQZZPRSA-N 0.000 description 3
- XEDQMTWEYFBOIK-ACZMJKKPSA-N Asp-Ala-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O XEDQMTWEYFBOIK-ACZMJKKPSA-N 0.000 description 3
- KGHLGJAXYSVNJP-WHFBIAKZSA-N Asp-Ser-Gly Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O KGHLGJAXYSVNJP-WHFBIAKZSA-N 0.000 description 3
- 206010007509 Cardiac amyloidosis Diseases 0.000 description 3
- 102000053602 DNA Human genes 0.000 description 3
- 206010011878 Deafness Diseases 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 206010016202 Familial Amyloidosis Diseases 0.000 description 3
- 206010016207 Familial Mediterranean fever Diseases 0.000 description 3
- 102000004878 Gelsolin Human genes 0.000 description 3
- 108090001064 Gelsolin Proteins 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 108010015899 Glycopeptides Proteins 0.000 description 3
- 102000002068 Glycopeptides Human genes 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 201000002795 Muckle-Wells syndrome Diseases 0.000 description 3
- 208000012902 Nervous system disease Diseases 0.000 description 3
- 208000025447 Nodular cutaneous amyloidosis Diseases 0.000 description 3
- MQWISMJKHOUEMW-ULQDDVLXSA-N Phe-Arg-His Chemical compound C([C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CC=CC=C1 MQWISMJKHOUEMW-ULQDDVLXSA-N 0.000 description 3
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical class OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- RWRDLPDLKQPQOW-UHFFFAOYSA-N Pyrrolidine Chemical compound C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 description 3
- 241000283984 Rodentia Species 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- UNUZEBFXGWVAOP-DZKIICNBSA-N Tyr-Glu-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O UNUZEBFXGWVAOP-DZKIICNBSA-N 0.000 description 3
- 208000024780 Urticaria Diseases 0.000 description 3
- LAYSXAOGWHKNED-XPUUQOCRSA-N Val-Gly-Ser Chemical compound CC(C)[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O LAYSXAOGWHKNED-XPUUQOCRSA-N 0.000 description 3
- 208000018756 Variant Creutzfeldt-Jakob disease Diseases 0.000 description 3
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 3
- 230000002159 abnormal effect Effects 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 150000001299 aldehydes Chemical class 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 229910052786 argon Inorganic materials 0.000 description 3
- 238000000149 argon plasma sintering Methods 0.000 description 3
- 230000001746 atrial effect Effects 0.000 description 3
- 229940049706 benzodiazepine Drugs 0.000 description 3
- 125000003310 benzodiazepinyl group Chemical group N1N=C(C=CC2=C1C=CC=C2)* 0.000 description 3
- 239000003613 bile acid Substances 0.000 description 3
- 208000005881 bovine spongiform encephalopathy Diseases 0.000 description 3
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 3
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 3
- 230000000747 cardiac effect Effects 0.000 description 3
- 238000000423 cell based assay Methods 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 230000009920 chelation Effects 0.000 description 3
- 239000013068 control sample Substances 0.000 description 3
- 230000001276 controlling effect Effects 0.000 description 3
- 208000022993 cryopyrin-associated periodic syndrome Diseases 0.000 description 3
- 125000000753 cycloalkyl group Chemical group 0.000 description 3
- 231100000895 deafness Toxicity 0.000 description 3
- 238000010511 deprotection reaction Methods 0.000 description 3
- 239000002612 dispersion medium Substances 0.000 description 3
- 230000002708 enhancing effect Effects 0.000 description 3
- 150000002170 ethers Chemical class 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 230000005284 excitation Effects 0.000 description 3
- 230000001747 exhibiting effect Effects 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 230000005714 functional activity Effects 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 108010050848 glycylleucine Proteins 0.000 description 3
- 108010037850 glycylvaline Proteins 0.000 description 3
- 238000001631 haemodialysis Methods 0.000 description 3
- 229910052736 halogen Inorganic materials 0.000 description 3
- 150000002367 halogens Chemical class 0.000 description 3
- 208000016354 hearing loss disease Diseases 0.000 description 3
- 230000000322 hemodialysis Effects 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 239000001257 hydrogen Substances 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 150000002466 imines Chemical class 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical compound II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 3
- 150000002576 ketones Chemical class 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 125000005647 linker group Chemical group 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 230000007774 longterm Effects 0.000 description 3
- 201000000564 macroglobulinemia Diseases 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 3
- 230000003278 mimic effect Effects 0.000 description 3
- 108091005601 modified peptides Proteins 0.000 description 3
- 239000003607 modifier Substances 0.000 description 3
- 239000003068 molecular probe Substances 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- 210000004940 nucleus Anatomy 0.000 description 3
- 125000001181 organosilyl group Chemical group [SiH3]* 0.000 description 3
- 150000003003 phosphines Chemical class 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 210000001236 prokaryotic cell Anatomy 0.000 description 3
- 125000006239 protecting group Chemical group 0.000 description 3
- 230000017854 proteolysis Effects 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 230000000717 retained effect Effects 0.000 description 3
- 238000004007 reversed phase HPLC Methods 0.000 description 3
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 150000003431 steroids Chemical group 0.000 description 3
- 125000001424 substituent group Chemical group 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 125000000472 sulfonyl group Chemical group *S(*)(=O)=O 0.000 description 3
- 238000001308 synthesis method Methods 0.000 description 3
- 150000003568 thioethers Chemical class 0.000 description 3
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 3
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- RVNCPTOYUFIJGP-RVBZMBCESA-N (2,5-dioxopyrrolidin-1-yl) 5-[(3aS,4S,6aR)-2-amino-3a,4,6,6a-tetrahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoate Chemical compound C([C@@H]1SC[C@H]2[C@@H]1N=C(N2)N)CCCC(=O)ON1C(=O)CCC1=O RVNCPTOYUFIJGP-RVBZMBCESA-N 0.000 description 2
- DQJCDTNMLBYVAY-ZXXIYAEKSA-N (2S,5R,10R,13R)-16-{[(2R,3S,4R,5R)-3-{[(2S,3R,4R,5S,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-5-(ethylamino)-6-hydroxy-2-(hydroxymethyl)oxan-4-yl]oxy}-5-(4-aminobutyl)-10-carbamoyl-2,13-dimethyl-4,7,12,15-tetraoxo-3,6,11,14-tetraazaheptadecan-1-oic acid Chemical compound NCCCC[C@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@@H](C)NC(=O)C(C)O[C@@H]1[C@@H](NCC)C(O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O)[C@@H](CO)O1 DQJCDTNMLBYVAY-ZXXIYAEKSA-N 0.000 description 2
- VZQHRKZCAZCACO-PYJNHQTQSA-N (2s)-2-[[(2s)-2-[2-[[(2s)-2-[[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]propanoyl]amino]prop-2-enoylamino]-3-methylbutanoyl]amino]propanoic acid Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)C(=C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(N)=N VZQHRKZCAZCACO-PYJNHQTQSA-N 0.000 description 2
- HSINOMROUCMIEA-FGVHQWLLSA-N (2s,4r)-4-[(3r,5s,6r,7r,8s,9s,10s,13r,14s,17r)-6-ethyl-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]-2-methylpentanoic acid Chemical compound C([C@@]12C)C[C@@H](O)C[C@H]1[C@@H](CC)[C@@H](O)[C@@H]1[C@@H]2CC[C@]2(C)[C@@H]([C@H](C)C[C@H](C)C(O)=O)CC[C@H]21 HSINOMROUCMIEA-FGVHQWLLSA-N 0.000 description 2
- GHOKWGTUZJEAQD-ZETCQYMHSA-N (D)-(+)-Pantothenic acid Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-ZETCQYMHSA-N 0.000 description 2
- AMHZIUVRYRVYBA-UHFFFAOYSA-N 2-(2-amino-4,5-dihydroimidazol-1-yl)acetic acid Chemical compound NC1=NCCN1CC(O)=O AMHZIUVRYRVYBA-UHFFFAOYSA-N 0.000 description 2
- RAZLJUXJEOEYAM-UHFFFAOYSA-N 2-[bis[2-(2,6-dioxomorpholin-4-yl)ethyl]azaniumyl]acetate Chemical compound C1C(=O)OC(=O)CN1CCN(CC(=O)O)CCN1CC(=O)OC(=O)C1 RAZLJUXJEOEYAM-UHFFFAOYSA-N 0.000 description 2
- BMLMGCPTLHPWPY-UHFFFAOYSA-N 2-oxo-1,3-thiazolidine-4-carboxylic acid Chemical compound OC(=O)C1CSC(=O)N1 BMLMGCPTLHPWPY-UHFFFAOYSA-N 0.000 description 2
- AJYXPNIENRLELY-UHFFFAOYSA-N 2-thiophen-2-ylacetyl chloride Chemical compound ClC(=O)CC1=CC=CS1 AJYXPNIENRLELY-UHFFFAOYSA-N 0.000 description 2
- GDGFTEGUDDPSIT-UHFFFAOYSA-N 4-pyrimidin-4-ylbenzoic acid Chemical compound C1=CC(C(=O)O)=CC=C1C1=CC=NC=N1 GDGFTEGUDDPSIT-UHFFFAOYSA-N 0.000 description 2
- 239000013607 AAV vector Substances 0.000 description 2
- CFPQUJZTLUQUTJ-HTFCKZLJSA-N Ala-Ile-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](C)N CFPQUJZTLUQUTJ-HTFCKZLJSA-N 0.000 description 2
- 102100029470 Apolipoprotein E Human genes 0.000 description 2
- 101710095339 Apolipoprotein E Proteins 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 108090001008 Avidin Proteins 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 101800004538 Bradykinin Proteins 0.000 description 2
- 102400000967 Bradykinin Human genes 0.000 description 2
- OBMZMSLWNNWEJA-XNCRXQDQSA-N C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 Chemical compound C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 OBMZMSLWNNWEJA-XNCRXQDQSA-N 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- QEEBRPGZBVVINN-UHFFFAOYSA-N Desacetyl-bufotalin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C1(O)CCC2C=1C=CC(=O)OC=1 QEEBRPGZBVVINN-UHFFFAOYSA-N 0.000 description 2
- 201000010374 Down Syndrome Diseases 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 102400000524 Fibrinogen alpha chain Human genes 0.000 description 2
- 101710137044 Fibrinogen alpha chain Proteins 0.000 description 2
- 208000003736 Gerstmann-Straussler-Scheinker Disease Diseases 0.000 description 2
- 206010072075 Gerstmann-Straussler-Scheinker syndrome Diseases 0.000 description 2
- 102000058063 Glucose Transporter Type 1 Human genes 0.000 description 2
- YSDLIYZLOTZZNP-UWVGGRQHSA-N Gly-Leu-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)CN YSDLIYZLOTZZNP-UWVGGRQHSA-N 0.000 description 2
- QXZGBUJJYSLZLT-UHFFFAOYSA-N H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH Natural products NC(N)=NCCCC(N)C(=O)N1CCCC1C(=O)N1C(C(=O)NCC(=O)NC(CC=2C=CC=CC=2)C(=O)NC(CO)C(=O)N2C(CCC2)C(=O)NC(CC=2C=CC=CC=2)C(=O)NC(CCCN=C(N)N)C(O)=O)CCC1 QXZGBUJJYSLZLT-UHFFFAOYSA-N 0.000 description 2
- NWGXCPUKPVISSJ-AVGNSLFASA-N His-Gln-Lys Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCCN)C(=O)O)N NWGXCPUKPVISSJ-AVGNSLFASA-N 0.000 description 2
- 101000573901 Homo sapiens Major prion protein Proteins 0.000 description 2
- YNMQUIVKEFRCPH-QSFUFRPTSA-N Ile-Ile-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)O)N YNMQUIVKEFRCPH-QSFUFRPTSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- NJMXCOOEFLMZSR-AVGNSLFASA-N Leu-Met-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(O)=O NJMXCOOEFLMZSR-AVGNSLFASA-N 0.000 description 2
- ITWQLSZTLBKWJM-YUMQZZPRSA-N Lys-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](N)CCCCN ITWQLSZTLBKWJM-YUMQZZPRSA-N 0.000 description 2
- LJADEBULDNKJNK-IHRRRGAJSA-N Lys-Leu-Val Chemical compound CC(C)C[C@H](NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O LJADEBULDNKJNK-IHRRRGAJSA-N 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 241000699673 Mesocricetus auratus Species 0.000 description 2
- YNAVUWVOSKDBBP-UHFFFAOYSA-N Morpholine Chemical compound C1COCCN1 YNAVUWVOSKDBBP-UHFFFAOYSA-N 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 2
- SQVRNKJHWKZAKO-PFQGKNLYSA-N N-acetyl-beta-neuraminic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-PFQGKNLYSA-N 0.000 description 2
- 108091061960 Naked DNA Proteins 0.000 description 2
- 101100342977 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) leu-1 gene Proteins 0.000 description 2
- 239000004677 Nylon Substances 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 101710176384 Peptide 1 Proteins 0.000 description 2
- 102000003992 Peroxidases Human genes 0.000 description 2
- MIDZLCFIAINOQN-WPRPVWTQSA-N Phe-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=CC=C1 MIDZLCFIAINOQN-WPRPVWTQSA-N 0.000 description 2
- GRVMHFCZUIYNKQ-UFYCRDLUSA-N Phe-Phe-Val Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(O)=O GRVMHFCZUIYNKQ-UFYCRDLUSA-N 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical compound C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 description 2
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 2
- 108091006296 SLC2A1 Proteins 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 208000021386 Sjogren Syndrome Diseases 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- DGDCHPCRMWEOJR-FQPOAREZSA-N Thr-Ala-Tyr Chemical group C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 DGDCHPCRMWEOJR-FQPOAREZSA-N 0.000 description 2
- 206010044688 Trisomy 21 Diseases 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- NOXKHHXSHQFSGJ-FQPOAREZSA-N Tyr-Ala-Thr Chemical group C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 NOXKHHXSHQFSGJ-FQPOAREZSA-N 0.000 description 2
- PIFJAFRUVWZRKR-QMMMGPOBSA-N Val-Gly-Gly Chemical compound CC(C)[C@H]([NH3+])C(=O)NCC(=O)NCC([O-])=O PIFJAFRUVWZRKR-QMMMGPOBSA-N 0.000 description 2
- DHINLYMWMXQGMQ-IHRRRGAJSA-N Val-His-His Chemical compound C([C@H](NC(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CN=CN1 DHINLYMWMXQGMQ-IHRRRGAJSA-N 0.000 description 2
- WBPFYNYTYASCQP-CYDGBPFRSA-N Val-Val-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)N WBPFYNYTYASCQP-CYDGBPFRSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 201000003352 adrenal gland pheochromocytoma Diseases 0.000 description 2
- 238000013019 agitation Methods 0.000 description 2
- 125000005466 alkylenyl group Chemical group 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 125000003368 amide group Chemical group 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 125000006367 bivalent amino carbonyl group Chemical group [H]N([*:1])C([*:2])=O 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- QXZGBUJJYSLZLT-FDISYFBBSA-N bradykinin Chemical compound NC(=N)NCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(=O)NCC(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CO)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)CCC1 QXZGBUJJYSLZLT-FDISYFBBSA-N 0.000 description 2
- 210000004781 brain capillary Anatomy 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000010382 chemical cross-linking Methods 0.000 description 2
- 125000003716 cholic acid group Chemical group 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 230000002939 deleterious effect Effects 0.000 description 2
- TXCDCPKCNAJMEE-UHFFFAOYSA-N dibenzofuran Chemical compound C1=CC=C2C3=CC=CC=C3OC2=C1 TXCDCPKCNAJMEE-UHFFFAOYSA-N 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 238000009510 drug design Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- 239000010408 film Substances 0.000 description 2
- 238000007421 fluorometric assay Methods 0.000 description 2
- 238000007429 general method Methods 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 2
- 210000003494 hepatocyte Anatomy 0.000 description 2
- 108010028295 histidylhistidine Proteins 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 206010022498 insulinoma Diseases 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- XMWFMEYDRNJSOO-UHFFFAOYSA-N morpholine-4-carbonyl chloride Chemical compound ClC(=O)N1CCOCC1 XMWFMEYDRNJSOO-UHFFFAOYSA-N 0.000 description 2
- 210000001087 myotubule Anatomy 0.000 description 2
- 230000001537 neural effect Effects 0.000 description 2
- 230000002981 neuropathic effect Effects 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 231100000501 nonneurotoxic Toxicity 0.000 description 2
- 229920001778 nylon Polymers 0.000 description 2
- BOTREHHXSQGWTR-UHFFFAOYSA-N oxolane-3-carboxylic acid Chemical compound OC(=O)C1CCOC1 BOTREHHXSQGWTR-UHFFFAOYSA-N 0.000 description 2
- 208000021255 pancreatic insulinoma Diseases 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 108040007629 peroxidase activity proteins Proteins 0.000 description 2
- 108010024607 phenylalanylalanine Proteins 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 238000002600 positron emission tomography Methods 0.000 description 2
- 229910000160 potassium phosphate Inorganic materials 0.000 description 2
- 235000011009 potassium phosphates Nutrition 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 239000012857 radioactive material Substances 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 150000003346 selenoethers Chemical class 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- YLJREFDVOIBQDA-UHFFFAOYSA-N tacrine Chemical compound C1=CC=C2C(N)=C(CCCC3)C3=NC2=C1 YLJREFDVOIBQDA-UHFFFAOYSA-N 0.000 description 2
- 229960001685 tacrine Drugs 0.000 description 2
- 238000011191 terminal modification Methods 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 230000004797 therapeutic response Effects 0.000 description 2
- JZRWCGZRTZMZEH-UHFFFAOYSA-N thiamine Chemical compound CC1=C(CCO)SC=[N+]1CC1=CN=C(C)N=C1N JZRWCGZRTZMZEH-UHFFFAOYSA-N 0.000 description 2
- 150000003573 thiols Chemical class 0.000 description 2
- VNNLHYZDXIBHKZ-UHFFFAOYSA-N thiophene-2-sulfonyl chloride Chemical compound ClS(=O)(=O)C1=CC=CS1 VNNLHYZDXIBHKZ-UHFFFAOYSA-N 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 238000011830 transgenic mouse model Methods 0.000 description 2
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 2
- 230000007306 turnover Effects 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 241000701447 unidentified baculovirus Species 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- JPOKAKNGULMYHZ-UILVTTEASA-N (2s)-6-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-6-amino-2-[[(2s)-2-[[(2s)-6-amino-2-[[(2s)-6-amino-2-[[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]hexanoyl]amino]hexanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]hexanoyl]amino]-3-(4-hydroxyp Chemical compound C([C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCN=C(N)N)C1=CC=C(O)C=C1 JPOKAKNGULMYHZ-UILVTTEASA-N 0.000 description 1
- DEYLVDCFTICBTB-WCBMZHEXSA-N (2s,3s)-1-methyl-5-oxo-2-pyridin-3-ylpyrrolidine-3-carboxylic acid Chemical compound OC(=O)[C@H]1CC(=O)N(C)[C@@H]1C1=CC=CN=C1 DEYLVDCFTICBTB-WCBMZHEXSA-N 0.000 description 1
- RUDATBOHQWOJDD-UHFFFAOYSA-N (3beta,5beta,7alpha)-3,7-Dihydroxycholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)CC2 RUDATBOHQWOJDD-UHFFFAOYSA-N 0.000 description 1
- FBKFDSUZBVDZIX-FFGDOFBPSA-N (4s)-4-[[(2s)-2-[[(2s)-2-[[2-[[(2s)-2-[[(2s)-2-acetamido-3-phenylpropanoyl]amino]-4-methylsulfanylbutanoyl]amino]-2-methylpropanoyl]amino]-3-[4-(phosphonomethyl)phenyl]propanoyl]amino]-3-(6-chloro-1h-indol-3-yl)propanoyl]amino]-5-[[1-[[(2s)-1-amino-4-meth Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NC(C)(C)C(=O)N[C@@H](CC=1C=CC(CP(O)(O)=O)=CC=1)C(=O)N[C@@H](CC=1C2=CC=C(Cl)C=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)NC1(CC1)C(=O)N[C@@H](CC(C)C)C(N)=O)NC(C)=O)C1=CC=CC=C1 FBKFDSUZBVDZIX-FFGDOFBPSA-N 0.000 description 1
- QYIXCDOBOSTCEI-QCYZZNICSA-N (5alpha)-cholestan-3beta-ol Chemical compound C([C@@H]1CC2)[C@@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@H](C)CCCC(C)C)[C@@]2(C)CC1 QYIXCDOBOSTCEI-QCYZZNICSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- BYEAHWXPCBROCE-UHFFFAOYSA-N 1,1,1,3,3,3-hexafluoropropan-2-ol Chemical compound FC(F)(F)C(O)C(F)(F)F BYEAHWXPCBROCE-UHFFFAOYSA-N 0.000 description 1
- DHBXNPKRAUYBTH-UHFFFAOYSA-N 1,1-ethanedithiol Chemical compound CC(S)S DHBXNPKRAUYBTH-UHFFFAOYSA-N 0.000 description 1
- JFLSOKIMYBSASW-UHFFFAOYSA-N 1-chloro-2-[chloro(diphenyl)methyl]benzene Chemical compound ClC1=CC=CC=C1C(Cl)(C=1C=CC=CC=1)C1=CC=CC=C1 JFLSOKIMYBSASW-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- ZCWPHDXKEDBCER-UHFFFAOYSA-N 2,5-diphenyl-2h-tetrazol-2-ium;bromide Chemical compound [Br-].C1=CC=CC=C1C1=[NH+]N(C=2C=CC=CC=2)N=N1 ZCWPHDXKEDBCER-UHFFFAOYSA-N 0.000 description 1
- CILPHQCEVYJUDN-UHFFFAOYSA-N 2-(5-methyl-2-propan-2-ylcyclohexyl)oxyacetic acid Chemical compound CC(C)C1CCC(C)CC1OCC(O)=O CILPHQCEVYJUDN-UHFFFAOYSA-N 0.000 description 1
- CILPHQCEVYJUDN-VWYCJHECSA-N 2-[(1s,2s,5r)-5-methyl-2-propan-2-ylcyclohexyl]oxyacetic acid Chemical compound CC(C)[C@@H]1CC[C@@H](C)C[C@@H]1OCC(O)=O CILPHQCEVYJUDN-VWYCJHECSA-N 0.000 description 1
- YEDUAINPPJYDJZ-UHFFFAOYSA-N 2-hydroxybenzothiazole Chemical compound C1=CC=C2SC(O)=NC2=C1 YEDUAINPPJYDJZ-UHFFFAOYSA-N 0.000 description 1
- BZTDTCNHAFUJOG-UHFFFAOYSA-N 6-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=CC=C(C(=O)O)C=C21 BZTDTCNHAFUJOG-UHFFFAOYSA-N 0.000 description 1
- CJIJXIFQYOPWTF-UHFFFAOYSA-N 7-hydroxycoumarin Natural products O1C(=O)C=CC2=CC(O)=CC=C21 CJIJXIFQYOPWTF-UHFFFAOYSA-N 0.000 description 1
- 208000036850 AGel amyloidosis Diseases 0.000 description 1
- 102100033639 Acetylcholinesterase Human genes 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 101800000263 Acidic protein Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- SBGXWWCLHIOABR-UHFFFAOYSA-N Ala Ala Gly Ala Chemical compound CC(N)C(=O)NC(C)C(=O)NCC(=O)NC(C)C(O)=O SBGXWWCLHIOABR-UHFFFAOYSA-N 0.000 description 1
- ZVFVBBGVOILKPO-WHFBIAKZSA-N Ala-Gly-Ala Chemical compound C[C@H](N)C(=O)NCC(=O)N[C@@H](C)C(O)=O ZVFVBBGVOILKPO-WHFBIAKZSA-N 0.000 description 1
- TZDNWXDLYFIFPT-BJDJZHNGSA-N Ala-Ile-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(O)=O TZDNWXDLYFIFPT-BJDJZHNGSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 102000004400 Aminopeptidases Human genes 0.000 description 1
- 108090000915 Aminopeptidases Proteins 0.000 description 1
- 208000000044 Amnesia Diseases 0.000 description 1
- KRXIWXCXOARFNT-ZLUOBGJFSA-N Asp-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O KRXIWXCXOARFNT-ZLUOBGJFSA-N 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 101100512078 Caenorhabditis elegans lys-1 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical group NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- 102000005367 Carboxypeptidases Human genes 0.000 description 1
- 108010006303 Carboxypeptidases Proteins 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 206010051290 Central nervous system lesion Diseases 0.000 description 1
- 206010008111 Cerebral haemorrhage Diseases 0.000 description 1
- GHOKWGTUZJEAQD-UHFFFAOYSA-N Chick antidermatitis factor Natural products OCC(C)(C)C(O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-UHFFFAOYSA-N 0.000 description 1
- 229940122041 Cholinesterase inhibitor Drugs 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 238000011537 Coomassie blue staining Methods 0.000 description 1
- 206010011416 Croup infectious Diseases 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- AUNGANRZJHBGPY-UHFFFAOYSA-N D-Lyxoflavin Natural products OCC(O)C(O)C(O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-UHFFFAOYSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- XPDXVDYUQZHFPV-UHFFFAOYSA-N Dansyl Chloride Chemical compound C1=CC=C2C(N(C)C)=CC=CC2=C1S(Cl)(=O)=O XPDXVDYUQZHFPV-UHFFFAOYSA-N 0.000 description 1
- 206010012289 Dementia Diseases 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- QUSNBJAOOMFDIB-UHFFFAOYSA-N Ethylamine Chemical group CCN QUSNBJAOOMFDIB-UHFFFAOYSA-N 0.000 description 1
- 108050001049 Extracellular proteins Proteins 0.000 description 1
- 201000007888 Finnish type amyloidosis Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- ZPDVKYLJTOFQJV-WDSKDSINSA-N Gln-Asn-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O ZPDVKYLJTOFQJV-WDSKDSINSA-N 0.000 description 1
- NMYFPKCIGUJMIK-GUBZILKMSA-N Gln-Met-Gln Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N NMYFPKCIGUJMIK-GUBZILKMSA-N 0.000 description 1
- UQKVUFGUSVYJMQ-IRIUXVKKSA-N Gln-Tyr-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CCC(=O)N)N)O UQKVUFGUSVYJMQ-IRIUXVKKSA-N 0.000 description 1
- WATXSTJXNBOHKD-LAEOZQHASA-N Glu-Asp-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O WATXSTJXNBOHKD-LAEOZQHASA-N 0.000 description 1
- ILGFBUGLBSAQQB-GUBZILKMSA-N Glu-Glu-Arg Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O ILGFBUGLBSAQQB-GUBZILKMSA-N 0.000 description 1
- QJCKNLPMTPXXEM-AUTRQRHGSA-N Glu-Glu-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O QJCKNLPMTPXXEM-AUTRQRHGSA-N 0.000 description 1
- ZYRXTRTUCAVNBQ-GVXVVHGQSA-N Glu-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N ZYRXTRTUCAVNBQ-GVXVVHGQSA-N 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- OLPPXYMMIARYAL-QMMMGPOBSA-N Gly-Gly-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)CNC(=O)CN OLPPXYMMIARYAL-QMMMGPOBSA-N 0.000 description 1
- IALQAMYQJBZNSK-WHFBIAKZSA-N Gly-Ser-Asn Chemical compound [H]NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O IALQAMYQJBZNSK-WHFBIAKZSA-N 0.000 description 1
- UVTSZKIATYSKIR-RYUDHWBXSA-N Gly-Tyr-Glu Chemical compound [H]NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O UVTSZKIATYSKIR-RYUDHWBXSA-N 0.000 description 1
- KSOBNUBCYHGUKH-UWVGGRQHSA-N Gly-Val-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)CN KSOBNUBCYHGUKH-UWVGGRQHSA-N 0.000 description 1
- ZZLWLWSUIBSMNP-CIUDSAMLSA-N His-Asp-Ser Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O ZZLWLWSUIBSMNP-CIUDSAMLSA-N 0.000 description 1
- NTXIJPDAHXSHNL-ONGXEEELSA-N His-Gly-Val Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O NTXIJPDAHXSHNL-ONGXEEELSA-N 0.000 description 1
- LVXFNTIIGOQBMD-SRVKXCTJSA-N His-Leu-Ser Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O LVXFNTIIGOQBMD-SRVKXCTJSA-N 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000701109 Human adenovirus 2 Species 0.000 description 1
- DGABKXLVXPYZII-UHFFFAOYSA-N Hyodeoxycholic acid Natural products C1C(O)C2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)CC2 DGABKXLVXPYZII-UHFFFAOYSA-N 0.000 description 1
- CYHYBSGMHMHKOA-CIQUZCHMSA-N Ile-Ala-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N CYHYBSGMHMHKOA-CIQUZCHMSA-N 0.000 description 1
- KBDIBHQICWDGDL-PPCPHDFISA-N Ile-Thr-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)O)N KBDIBHQICWDGDL-PPCPHDFISA-N 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- XIRYQRLFHWWWTC-QEJZJMRPSA-N Leu-Ala-Phe Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 XIRYQRLFHWWWTC-QEJZJMRPSA-N 0.000 description 1
- URLZCHNOLZSCCA-VABKMULXSA-N Leu-enkephalin Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 URLZCHNOLZSCCA-VABKMULXSA-N 0.000 description 1
- SMEROWZSTRWXGI-UHFFFAOYSA-N Lithocholsaeure Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)CC2 SMEROWZSTRWXGI-UHFFFAOYSA-N 0.000 description 1
- WBSCNDJQPKSPII-KKUMJFAQSA-N Lys-Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O WBSCNDJQPKSPII-KKUMJFAQSA-N 0.000 description 1
- WKUXWMWQTOYTFI-SRVKXCTJSA-N Lys-Met-Gln Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CCCCN)N WKUXWMWQTOYTFI-SRVKXCTJSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- UZVWDRPUTHXQAM-FXQIFTODSA-N Met-Asp-Ala Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O UZVWDRPUTHXQAM-FXQIFTODSA-N 0.000 description 1
- DBTDEFJAFBUGPP-UHFFFAOYSA-N Methanethial Chemical compound S=C DBTDEFJAFBUGPP-UHFFFAOYSA-N 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 101100084053 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) ppi-2 gene Proteins 0.000 description 1
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical compound OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- ZCQWOFVYLHDMMC-UHFFFAOYSA-N Oxazole Chemical compound C1=COC=N1 ZCQWOFVYLHDMMC-UHFFFAOYSA-N 0.000 description 1
- 101150044568 PRNP gene Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- CYZBFPYMSJGBRL-DRZSPHRISA-N Phe-Ala-Glu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O CYZBFPYMSJGBRL-DRZSPHRISA-N 0.000 description 1
- KLXQWABNAWDRAY-ACRUOGEOSA-N Phe-Lys-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 KLXQWABNAWDRAY-ACRUOGEOSA-N 0.000 description 1
- RYQWALWYQWBUKN-FHWLQOOXSA-N Phe-Phe-Glu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O RYQWALWYQWBUKN-FHWLQOOXSA-N 0.000 description 1
- YMIZSYUAZJSOFL-SRVKXCTJSA-N Phe-Ser-Asn Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O YMIZSYUAZJSOFL-SRVKXCTJSA-N 0.000 description 1
- BHHGXPLMPWCGHP-UHFFFAOYSA-N Phenethylamine Chemical group NCCC1=CC=CC=C1 BHHGXPLMPWCGHP-UHFFFAOYSA-N 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 108700021402 PrP 27-30 Proteins 0.000 description 1
- VVAWNPIOYXAMAL-KJEVXHAQSA-N Pro-Thr-Tyr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O VVAWNPIOYXAMAL-KJEVXHAQSA-N 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 101800000645 Rhomboid-related protein 2, N-terminal fragment Proteins 0.000 description 1
- 102400000267 Rhomboid-related protein 2, N-terminal fragment Human genes 0.000 description 1
- BEAFYHFQTOTVFS-VGDYDELISA-N Ser-Ile-His Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CO)N BEAFYHFQTOTVFS-VGDYDELISA-N 0.000 description 1
- 108050000761 Serpin Proteins 0.000 description 1
- 102000008847 Serpin Human genes 0.000 description 1
- 101710190759 Serum amyloid A protein Proteins 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 108010033576 Transferrin Receptors Proteins 0.000 description 1
- 102000007238 Transferrin Receptors Human genes 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- 208000037280 Trisomy Diseases 0.000 description 1
- 101800000716 Tumor necrosis factor, membrane form Proteins 0.000 description 1
- LOOCQRRBKZTPKO-AVGNSLFASA-N Tyr-Glu-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 LOOCQRRBKZTPKO-AVGNSLFASA-N 0.000 description 1
- UEHRGZCNLSWGHK-DLOVCJGASA-N Val-Glu-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O UEHRGZCNLSWGHK-DLOVCJGASA-N 0.000 description 1
- DJQIUOKSNRBTSV-CYDGBPFRSA-N Val-Ile-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H](C(C)C)N DJQIUOKSNRBTSV-CYDGBPFRSA-N 0.000 description 1
- RQOMPQGUGBILAG-AVGNSLFASA-N Val-Met-Leu Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(O)=O RQOMPQGUGBILAG-AVGNSLFASA-N 0.000 description 1
- DVLWZWNAQUBZBC-ZNSHCXBVSA-N Val-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](C(C)C)N)O DVLWZWNAQUBZBC-ZNSHCXBVSA-N 0.000 description 1
- 239000003875 Wang resin Substances 0.000 description 1
- 238000002441 X-ray diffraction Methods 0.000 description 1
- NERFNHBZJXXFGY-UHFFFAOYSA-N [4-[(4-methylphenyl)methoxy]phenyl]methanol Chemical compound C1=CC(C)=CC=C1COC1=CC=C(CO)C=C1 NERFNHBZJXXFGY-UHFFFAOYSA-N 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 230000002730 additional effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 108010005233 alanylglutamic acid Proteins 0.000 description 1
- 125000003282 alkyl amino group Chemical group 0.000 description 1
- 125000005907 alkyl ester group Chemical group 0.000 description 1
- QYIXCDOBOSTCEI-UHFFFAOYSA-N alpha-cholestanol Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(C)CCCC(C)C)C1(C)CC2 QYIXCDOBOSTCEI-UHFFFAOYSA-N 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 125000005001 aminoaryl group Chemical class 0.000 description 1
- 230000001896 anti-amyloidogenic effect Effects 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 101150031224 app gene Proteins 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 108010077245 asparaginyl-proline Proteins 0.000 description 1
- 210000001130 astrocyte Anatomy 0.000 description 1
- 125000004429 atom Chemical group 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 239000013060 biological fluid Substances 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 210000005013 brain tissue Anatomy 0.000 description 1
- QEEBRPGZBVVINN-BMPKRDENSA-N bufalin Chemical compound C=1([C@H]2CC[C@]3(O)[C@H]4[C@@H]([C@]5(CC[C@H](O)C[C@H]5CC4)C)CC[C@@]32C)C=CC(=O)OC=1 QEEBRPGZBVVINN-BMPKRDENSA-N 0.000 description 1
- ATLJNLYIJOCWJE-CWMZOUAVSA-N bufogenin Chemical compound C=1([C@H]2C[C@H]3O[C@@]43[C@H]3[C@@H]([C@]5(CC[C@H](O)C[C@H]5CC3)C)CC[C@@]42C)C=CC(=O)OC=1 ATLJNLYIJOCWJE-CWMZOUAVSA-N 0.000 description 1
- 229950006858 bufogenin Drugs 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000004202 carbamide Chemical group 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 125000002843 carboxylic acid group Chemical group 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 208000015114 central nervous system disease Diseases 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000003710 cerebral cortex Anatomy 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 210000004720 cerebrum Anatomy 0.000 description 1
- RPKLZQLYODPWTM-KBMWBBLPSA-N cholanoic acid Chemical compound C1CC2CCCC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@@H](CCC(O)=O)C)[C@@]1(C)CC2 RPKLZQLYODPWTM-KBMWBBLPSA-N 0.000 description 1
- 239000002812 cholic acid derivative Substances 0.000 description 1
- 239000000544 cholinesterase inhibitor Substances 0.000 description 1
- 239000003593 chromogenic compound Substances 0.000 description 1
- 239000003541 chymotrypsin inhibitor Substances 0.000 description 1
- 238000002983 circular dichroism Methods 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000000536 complexating effect Effects 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- IQFVPQOLBLOTPF-HKXUKFGYSA-L congo red Chemical compound [Na+].[Na+].C1=CC=CC2=C(N)C(/N=N/C3=CC=C(C=C3)C3=CC=C(C=C3)/N=N/C3=C(C4=CC=CC=C4C(=C3)S([O-])(=O)=O)N)=CC(S([O-])(=O)=O)=C21 IQFVPQOLBLOTPF-HKXUKFGYSA-L 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 201000010549 croup Diseases 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 125000004093 cyano group Chemical group *C#N 0.000 description 1
- 150000001923 cyclic compounds Chemical class 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000000640 cyclooctyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- KXGVEGMKQFWNSR-LLQZFEROSA-N deoxycholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 KXGVEGMKQFWNSR-LLQZFEROSA-N 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 229910000397 disodium phosphate Inorganic materials 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 208000012955 familial cardiomyopathy Diseases 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 210000003746 feather Anatomy 0.000 description 1
- RZTAMFZIAATZDJ-UHFFFAOYSA-N felodipine Chemical compound CCOC(=O)C1=C(C)NC(C)=C(C(=O)OC)C1C1=CC=CC(Cl)=C1Cl RZTAMFZIAATZDJ-UHFFFAOYSA-N 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 230000003619 fibrillary effect Effects 0.000 description 1
- 238000005187 foaming Methods 0.000 description 1
- 229940014144 folate Drugs 0.000 description 1
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 230000005017 genetic modification Effects 0.000 description 1
- 235000013617 genetically modified food Nutrition 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 125000005842 heteroatom Chemical group 0.000 description 1
- 150000002391 heterocyclic compounds Chemical class 0.000 description 1
- 229940042795 hydrazides for tuberculosis treatment Drugs 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 1
- DGABKXLVXPYZII-SIBKNCMHSA-N hyodeoxycholic acid Chemical compound C([C@H]1[C@@H](O)C2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)CC1 DGABKXLVXPYZII-SIBKNCMHSA-N 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- QNRXNRGSOJZINA-UHFFFAOYSA-N indoline-2-carboxylic acid Chemical compound C1=CC=C2NC(C(=O)O)CC2=C1 QNRXNRGSOJZINA-UHFFFAOYSA-N 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 238000002329 infrared spectrum Methods 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 238000002743 insertional mutagenesis Methods 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 108010056777 interleukin-2 (59-72) Proteins 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 150000003951 lactams Chemical group 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 108010076756 leucyl-alanyl-phenylalanine Proteins 0.000 description 1
- 108010034529 leucyl-lysine Proteins 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- SMEROWZSTRWXGI-HVATVPOCSA-N lithocholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)CC1 SMEROWZSTRWXGI-HVATVPOCSA-N 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 108010064235 lysylglycine Proteins 0.000 description 1
- 230000032575 lytic viral release Effects 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000001819 mass spectrum Methods 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 150000004702 methyl esters Chemical group 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 230000000877 morphologic effect Effects 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 210000003098 myoblast Anatomy 0.000 description 1
- ZTLGJPIZUOVDMT-UHFFFAOYSA-N n,n-dichlorotriazin-4-amine Chemical compound ClN(Cl)C1=CC=NN=N1 ZTLGJPIZUOVDMT-UHFFFAOYSA-N 0.000 description 1
- 210000000885 nephron Anatomy 0.000 description 1
- 210000001178 neural stem cell Anatomy 0.000 description 1
- 210000002682 neurofibrillary tangle Anatomy 0.000 description 1
- 210000004498 neuroglial cell Anatomy 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 230000007171 neuropathology Effects 0.000 description 1
- 235000001968 nicotinic acid Nutrition 0.000 description 1
- 239000011664 nicotinic acid Substances 0.000 description 1
- 229960003512 nicotinic acid Drugs 0.000 description 1
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 description 1
- 210000004789 organ system Anatomy 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229940055726 pantothenic acid Drugs 0.000 description 1
- 235000019161 pantothenic acid Nutrition 0.000 description 1
- 239000011713 pantothenic acid Substances 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 108010021152 pepBs1-Ac peptide Proteins 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- PETXWIMJICIQTQ-UHFFFAOYSA-N phenylmethoxymethanol Chemical group OCOCC1=CC=CC=C1 PETXWIMJICIQTQ-UHFFFAOYSA-N 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 239000008057 potassium phosphate buffer Substances 0.000 description 1
- 231100000316 potential neurotoxicity Toxicity 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 108010070643 prolylglutamic acid Proteins 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000010453 quartz Substances 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 1
- ATLJNLYIJOCWJE-UHFFFAOYSA-N resibufogenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C=1C=CC(=O)OC=1 ATLJNLYIJOCWJE-UHFFFAOYSA-N 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 235000019192 riboflavin Nutrition 0.000 description 1
- 229960002477 riboflavin Drugs 0.000 description 1
- 239000002151 riboflavin Substances 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000009919 sequestration Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 239000003001 serine protease inhibitor Substances 0.000 description 1
- 108010005584 serpin-enzyme complex receptor Proteins 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N silicon dioxide Inorganic materials O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 150000003871 sulfonates Chemical class 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- RAOIDOHSFRTOEL-UHFFFAOYSA-N tetrahydrothiophene Chemical compound C1CCSC1 RAOIDOHSFRTOEL-UHFFFAOYSA-N 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 235000019157 thiamine Nutrition 0.000 description 1
- 239000011721 thiamine Substances 0.000 description 1
- 239000010409 thin film Substances 0.000 description 1
- HNKJADCVZUBCPG-UHFFFAOYSA-N thioanisole Chemical compound CSC1=CC=CC=C1 HNKJADCVZUBCPG-UHFFFAOYSA-N 0.000 description 1
- 239000003104 tissue culture media Substances 0.000 description 1
- 230000031998 transcytosis Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000032895 transmembrane transport Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 108010051110 tyrosyl-lysine Proteins 0.000 description 1
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 1
- HFTAFOQKODTIJY-UHFFFAOYSA-N umbelliferone Natural products Cc1cc2C=CC(=O)Oc2cc1OCC=CC(C)(C)O HFTAFOQKODTIJY-UHFFFAOYSA-N 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 239000002691 unilamellar liposome Substances 0.000 description 1
- 229930195735 unsaturated hydrocarbon Natural products 0.000 description 1
- RUDATBOHQWOJDD-UZVSRGJWSA-N ursodeoxycholic acid Chemical compound C([C@H]1C[C@@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)CC1 RUDATBOHQWOJDD-UZVSRGJWSA-N 0.000 description 1
- 229960001661 ursodiol Drugs 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 231100000747 viability assay Toxicity 0.000 description 1
- 238000003026 viability measurement method Methods 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Landscapes
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Compounds that modulate the aggregation of amyloidogenic proteins or peptides are disclosed. The modulators of the invention can promote amyloid aggregation or, more preferably, can inhibit natural amyloid aggregation. In a preferred embodiment, the compounds modulate the aggregation of natural .beta.-amyloid peptides (.beta.-AP). In a preferred embodiment, the .beta.-amyloid modulator compounds of the invention are comprised of an A.beta. aggregation core domain and a modifying group coupled thereto such that the compound alters the aggregation or inhibits the neurotoxicity of natural .beta.-amyloid peptides when contacted with the peptides. Furthermore, the modulators are capable of altering natural .beta.-AP aggregation when the natural .beta.-APs are in a molar excess amount relative to the modulators. Pharmaceutical compositions comprising the compounds of the invention, and diagnostic and treatment methods for amyloidogenic diseases using the compounds of the invention, are also disclosed.
Description
MODULATORS OF AMYLOID AGGREGATION
This is a divisional application of Canadian Patent Application Serial Number 2,214,247, filed March 14, 2003.
S
Baclcaround of the Invention Alzheimer's disease (AD), first described by the Bavarian psychiatrist Alois Alzheimer in 1907, is a progressive neurological disorder that begins with short term memory loss and proceeds to disorientation, impairment of judgement and reasoning and, ultimately, dementia.
The course of the disease usually leads to death in a severely debilitated, immobile state between 4 and 12 years after onset. AD has been estimated to afflict 5 to 11 percent of the population over age 65 and as much as 47 percent of the population over age 85. The societal cost for managing AD is upwards of 80 billion dollars annually, primarily due to the extensive custodial care required for AD patients. Moreover, as adults born during the population boom of the 1940's and 1950's approach the age when AD becomes more prevalent, the control and treatment of AD will become an even more significant health care problem.
Currently, there is no treatment that significantly retards the progression of the disease. For reviews on AD, see Selkoe, D.J. Sci. Amer., November 1991, pp. 68-78; and Yankner, B.A. et al. (1991) N.
Eng. J. Med. 325:1849-1857.
It has recently been reported (Games et al. (1995) Nature 373:523-527) that an Alzheimer-type neuropathology has been created in transgenic mice. The transgenic mice express high levels of human mutant amyloid precursor protein and progressively develop many of the pathological conditions associated with AD.
Pathologically, AD is characterized by the presence of distinctive lesions in the victim's brain. These brain lesions include abnormal intracellular filaments called neurofibrillary tangles (NTFs) and extracellular deposits of amyloidogenic proteins in senile, or amyloid plaques. Amyloid deposits are also present in the walls of cerebral blood vessels of AD patients. The major protein constituent of amyloid plaques has been identified as a 4 kilodalton peptide called ~i-amyloid peptide (~i-AP)(Glenner, G.G. and Wong, C.W. (1984) Biochem. Biophys. Res. Commun. 120:885-890; Masters, C. et al. (1985) Proc.
Natl. Acad.
Sci. USA 82:4245-4249). Diffuse deposits of ~i-AP are frequently observed in normal adult brains, whereas AD brain tissue is characterized by more compacted, dense-core ~-amyloid plaques. (See e.g., Davies, L. et al. (1988) Neurology 38:1688-1693). These observations suggest that /3-AP deposition precedes, and contributes to, the destruction of neurons that occurs in AD. In further support of a direct pathogenic role for /3-AP, /i-amyloid has been la shown to be toxic to mature neurons, both in culture and in vivo. Yankner, B.A. et al. (1989) Science 245:417-420; Yankner, B.A. et al. ( 1990) Proc. Natl. Acad. Sci. USA
87:9020-9023;
Roher, A.E. et al. (1991) Biochem. Biophys. Res. Commun. 174:572-579; Kowall, N.W. et al.
(1991) Proc. Natl. Acad. Sci. USA 88:7247-7251. Furthermore, patients with hereditary cerebral hemorrhage with amyloidosis-Dutch-type (HCHWA-D), which is characterized by diffuse ~-amyloid deposits within the cerebral cortex and cerebrovasculature, have been shown to have a point mutation that leads to an amino acid substitution within ~-AP. Levy, E. et o1 (1990) Science x:1124-1126. This observation demonstrates that a specific alteration of the (3-AP sequence can cause /3-amyloid to be deposited.
Natural ~i-AP is derived by proteolysis from a much larger protein callod the amyloid precursor protein (APP). Kung, J. et al. ( 1987) Nature~:733; Goldgaber, D. et al. (1987) Science X5_:877; Robakis, N.K. et al. (1987) Proc. Natl. Acad Sci. USA
84:4190; Tanzi, RE. et al. (1987) Science~5:880. The APP gene maps to chromosome 21, thereby providing an explanation for the p-amyloid deposition seen at an early age in individuals with Down's syndrome, which is caused by trisomy of chromosome 21. Mann, D:M. et al. (1989) Neuropathol. Appl. Neurobiol. 1,x:317; Rumble, B. et al. ( 1989) N. E»g. J.
Med. x:1446.
APP contains a single membrane spanning domain, with a long amino terminal region (about two-thirds of the protein) extending into the extracellular environment and a shorter carboxy-terlninal region projecting into the cytoplasm. Differential splicing of the APP messenger RNA Ieads to at Ieast five forms of APP. composed of either 563 amino acids (APP-563), 695 amino acids (APP-695), 714 amino acids (APP-714), 7~ 1 amino acids (APP-7~
1 ) or 770 I S amino acids (APP-770).
Within APP. naturally-occurring (3 amyloid peptide begins at an aspattic acid residue at amino acid position b72 of APP-770. Naturally-occurring /3-AP derived from proteolysis of APP is 39 to 43 amino acid residues in length. depending on the carboxy-terminal end point. which exhibits heterogeneity. The predominant circulating form of ~-AP
in the blood and cerebrospinal fluid of both AD patients and normal adults is ~il-40 ("short ~i"). Seubert,.
P, et al. (1992) Nature X59:325; Shoji, M. et al. (1992) Science 258:126.
However. (31-42 and ~il-43 ("long ~") also are forms in ~i-amyloid plaques. Masters. C. et al.
(1985) Proc.
. Natl. Acad Sci. USA x:4245; Miller. D. et al. (1993) Arch. Biochem. Biophys.
301:41; Mori, H. er al. ( 1992) J. Biol. Chem. X7:17082. Although the precise molecular mechanism 23 leading to ~i-APP aggregation and deposition is unknown. the process has been likened to that of nucleation-dependent polymerizations. such as protein crystallization, microtubule formation and actin polymerization. See e.g., Jarrett, J.T. and Lansbury, P.T.
(1993) Cell 7~:105~-1058. In such processes, polymerization of monomer components does not occur until nucleus formation. Thus, these processes are characterized by a lag time before aggregation occurs. followed by rapid polymerization after nucleation.
Nucleation can be accelerated by the addition of a "seed" or preformed nucleus, which results in rapid polymerization. The long ~ forms of ~i-AP have been shown to act as seeds, thereby accelerating polymerization of both long and short ~i-AP forms. Jarrett, J.T.
et al. (1993) Biochemistry ;x:4693.
In one study. in which amino acid substitutions were made in (3-AP, two mutant ~i peptides were reported to imerfere with polymerization of non-mutated ~-AP
when the mutant and non-mutant forms of peptide were mixed. Hilbich, C. et al. (1992) J. Mol. Biol.
228:460-473. However, equimolar amounts of the mutant and non-mutant (i. e., natural) ~3 amyloid peptides were used to see this effect and the mutant peptides were reported to be unsuitable for use in vivo. Hilbich, C. et al. (1992), supra.
Summary of the Invention It should be understood that the expression "the invention" and the like as used herein, encompass the subject matter of both the parent and the divisional applications.
This invention pertains to compounds, and pharmaceutical compositions thereof, that can modulate the aggregation of amyloidogenic proteins and peptides, in particular compounds that can modulate the aggregation of natural ~3-amyloid peptides (~-AP) and inhibit the neurotoxicity of natural S-APs. In one embodiment, the invention provides an amyloid modulator compound comprising an amyloidogenic protein, or peptide fragment thereof, coupled directly or indirectly to at least one modifying group such that the compound modulates the aggregation of natural amyloid proteins or peptides when contacted with the natural amyloidogenic proteins or peptides. Preferably, the compound inhibits aggregation of natural amyloidogenic proteins or peptides when contacted with the natural amyloidogenic proteins or peptides. The amyloidogenic protein, or peptide fragment thereof, can be, for example, selected from the group consisting of transthyretin (TTR), prion protein (PrP), islet amyloid polypeptide (IAPP), atrial natriuretic factor (ANF), kappa light chain, lambda light chain, amyloid A, procalcitonin, cystatin C, i82 microglobulin, ApoA-I, gelsolin, procalcitonin, calcitonin, fibrinogen and lysozyme.
In the most preferred embodiment of the invention, the compound modulates the aggregation of natural S-AP. The invention provides a ~3-amyloid peptide compound comprising a formula:
n X,aa wherein Xaa is a (3-amyloid peptide having an amino-terminal amino acid residue corresponding to position 668 of ~-amyloid precursor protein-770 (APP-770) or to a residue carboxy-terminal to position 668 of APP-770, A is a modifying group attached directly or indirectly to the S-amyloid peptide of the compound such that the compound inhibits aggregation of natural ~-amyloid peptides when contacted with the natural ~-amyloid peptides, and n is an integer selected such that the compound inhibits aggregation of natural a-amyloid peptides when contacted with the natural ~-amyloid peptides.
In one embodiment, at least one A group is attached directly or indirectly to the amino terminus of the (3-amyloid peptide of the compound. In another embodiment, at least one A
group is attached directly or indirectly to the carboxy terminus of the ~-amyloid peptide of the Q
compound. In yet another embodiment, at least one A group is attached directly or indirectly to a side chain of at least one amino acid residue of the /i-amyloid peptide of the compound.
In one aspect, this invention also provides a a-amyloid modulator compound comprising an A~ aggregation core domain (ACD) coupled directly or indirectly to at least one modifying group (MG) such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ,~-amyloid peptides when contacted with the natural ~-amyloid peptides. Preferably, the A~ aggregation core domain is modeled after a subregion of natural (3-amyloid peptide between 3 and 10 amino acids in length.
In one aspect, the invention provides a ~i-amyloid modulator compound consisting of an AFB aggregation core domain (ACD) from 4 to 7 amino acids in length and modeled after amino acid positions 17 to 20 of natural (3-amyloid peptide coupled directly or indirectly to at least one modifying group (MG) that is not naturally coupled to natural ~i-amyloid peptides in their native form such that the compound modulates the aggregation or inhibits the neurotoxicity of natural /3-amyloid peptides when contacted with the natural ~-amyloid peptides, wherein said ~3-amyloid modulator compound comprises at least one D amino acid residue.
In another aspect, the invention provides a ~3-amyloid modulator compound consisting of an AS aggregation core domain (ACD) modeled after amino acid positions 17 to 20 of natural ~-amyloid peptide coupled directly or indirectly to at least one modifying group (MG) that is not naturally coupled to natural /3-amyloid peptides in their native form such that the compound modulates the aggregation or inhibits the neurotoxicity of natural (3-amyloid peptides when contacted with the natural ~-amyloid peptides, wherein said ~8-amyloid modulator compound is from 4 to 7 amino acids in length.
In one aspect, the invention also provides (3-amyloid modulator compound comprising a formula:
n ( Y-Xaal-Xaa2-Xaa3-Z
wherein Xaal, Xaa2 and Xaa3 are each amino acid structures and at least two of Xaa,, Xaa2 and Xaa3 are, independently, selected from the group consisting of a leucine structure, a phenylalanine structure and a valine structure;
Y, which may or may not be present, is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to 15;
Z, which may or may not be present, is a peptidic structure having the formula (Xaa~, wherein Xaa is any amino acid structure and b is an integer from 1 to 15; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
5 Xaa,, Xaa2, Xaa3, Y, Z, A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural a-amyloid peptides when contacted with the natural ~-amyloid peptides. In a preferred embodiment, Xaal and Xaa2 are each phenylalanine structures. In another preferred embodiment, Xaa2 and Xaa3 are each phenylalanine structures. In another aspect, at least one of Xaa,, Xaa2, and Xaa3 is a D-amino acid.
In one aspect, this invention further provides a ~B-amyloid modulator compound comprising a formula:
n Y xaa~_Xaa2_Xaa3_Xaa4_Z
wherein Xaa, and Xaa3 are amino acid structures;
Xaa2 is a valine structure;
Xaa4 is a phenylalanine structure;
Y, which may or may not be present, is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to 15;
Z, which may or may not be present, is a peptidic structure having the formula (Xaa~,, wherein Xaa is any amino acid structure and b is an integer from 1 to 15; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
Xaa~, Xaa3, Y, Z, A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ~-amyloid peptides when contacted with the natural (3-amyloid peptides. In a preferred embodiment, Xaal is a leucine structure and Xaa3 is phenylalanine structure. In another aspect, at least one of Xaa~, Xaa2, Xaa3, and Xaa4 is a D-amino acid.
In one aspect, the invention still further provides a compound comprising the formula:
A-Xaa~-Xaa2-Xaa3-Xaa4-Xaas-Xaab-Xaa~-XaaB-B
wherein Xaa, is a histidine structure;
Xaa2 is a glutamine structure;
Xaa3 is a lysine structure;
Xaa4 is a leucine structure;
Xaas is a valine structure;
Xaa6 is a phenylalanine structure;
Xaa~ is a phenylalanine structure;
Xaag is an alanine structure;
A and B are modifying groups attached directly or indirectly to the amino terminus and carboxy terminus, respectively, of the compound;
and wherein Xaa~-Xaaz-Xaa3, Xaa,-Xaa2 or Xaa, may or may not be present;
Xaag may or may not be present; and at least one of A and B is present.
In a further aspect, said ~-amyloid modulator compound is from 4 to 7 amino acids in length.
In one aspect, the modifying groups A and B are groups that are not naturally coupled to natural ~i-amyloid peptides in their native form.
In one aspect, said compound comprises at least one D-amino acid residue.
In one aspect, the invention still further provides a S-amyloid modulator compound comprising a modifying group attached directly or indirectly to a peptidic structure, wherein the peptidic structure comprises amino acid structures having an amino acid sequence selected from the group consisting of His-Gln-Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 5), His-Gln-Lys-Leu-Val-Phe-Phe (SEQ ID NO: 6), Gln-Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO:
7), Gln-Lys-Leu-Val-Phe-Phe (SEQ ID NO: 8), Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 9), Lys-Leu-Val-Phe-Phe (SEQ ID NO: 10), Leu-Val-Phe-Phe-Ala (SEQ ID NO: 11), Leu-Val-Phe-Phe (SEQ ID NO: 12), Leu-Ala-Phe-Phe-Ala (SEQ ID NO: 13), Val-Phe-Phe (SEQ ID NO:
19), Phe-Phe-Ala (SEQ ID NO: 20), Phe-Phe-Val-Leu-Ala (SEQ ID NO: 21), Leu-Val-Phe-Phe-Lys (SEQ ID NO: 22), Leu-Val-Iodotyrosine-Phe-Ala (SEQ ID NO: 23), Val-Phe-Phe-Ala (SEQ >D NO: 24), Ala-Val-Phe-Phe-Ala (SEQ ID NO: 25), Leu-Val-Phe-Iodotyrosine-Ala (SEQ ID NO: 26), Leu-Val-Phe-Phe-Ala-Glu (SEQ ID NO: 27), Phe-Phe-Val-Leu (SEQ
ID
NO: 28), Phe-Lys-Phe-Val-Leu (SEQ ID NO: 29), Lys-Leu-Val-Ala-Phe (SEQ ID NO:
30), Lys-Leu-Val-Phe-Phe-(3Ala (SEQ ID NO: 31) and Leu-Val-Phe-Phe-DAIa (SEQ ID NO:
32).
In one aspect, said /3-amyloid modulator compound comprises at least one D-amino acid residue.
In the compounds of the invention comprising a modifying group, preferably the modifying group comprises a cyclic, heterocyclic or polycyclic group.
Preferred modifying groups contain a cis-decalin group, such as a cholanoyl structure. Preferred modifying groups include a cholyl group, a biotin-containing group, a diethylene-triaminepentaacetyl group, a (-)-menthoxyacetyl group, a fluorescein-containing group or an N-acetylneuraminyl group.
The compounds of the invention can be further modified, for example to alter a pharmacokinetic property of the compound or to label the compound with a detectable substance. Preferred radioactive labels are radioactive iodine or technetium.
In one aspect, the invention also provides a /3-amyloid modulator which inhibits S aggregation of natural (3-amyloid peptides when contacted with a molar excess amount of natural /3-amyloid peptides.
In one aspect, the invention also provides a S-amyloid peptide compound comprising an amino acid sequence having at least one amino acid deletion compared to ~AP,_39, such that the compound inhibits aggregation of natural /3-amyloid peptides when contacted with the natural ~3-amyloid peptides. In one embodiment, the compound has at least one internal amino acid deleted compared to /3AP1_39. In another embodiment, the compound has at least one N-terminal amino acid deleted compared to aAP,_39. In yet another embodiment, the compound has at least one C-terminal amino acid deleted compared to /iAP,_39. Preferred compounds include (3AP6_ZO (SEQ ID NO: 13), ~iAPl6-30 (SEQ ID NO: 14), (3AP~_ZO,26~o (SEQ ID NO: 1 S) 1 S and EEWHHHHQQ-~3AP,6_4o (SEQ ID NO: 16).
The compounds of the invention can be formulated into pharmaceutical compositions comprising the compound and a pharmaceutically acceptable carrier. The compounds can also be used in the manufacture of a medicament for the diagnosis or treatment of an amyloidogenic disease.
Another aspect of the invention pertains to diagnostic and treatment methods using the compounds of the invention. The invention provides a method for inhibiting aggregation of natural ~-amyloid peptides, comprising contacting the natural (3-amyloid peptides with a compound of the invention such that aggregation of the natural ~i-amyloid peptides is inhibited. T'he invention also provides a method for inhibiting neurotoxicity of natural (3-amyloid peptides, comprising contacting the natural ~i-amyloid peptides with a compound of the invention such that neurotoxicity of the natural /3-amyloid peptides is inhibited.
In another embodiment, the invention provides a method for detecting the presence or absence of natural (3-amyloid peptides in a biological sample, comprising contacting a biological sample with a compound of the invention and detecting the compound bound to natural a-amyloid peptides to thereby detect the presence or absence of natural ~i-amyloid peptides in the biological sample. In one embodiment, the /3-amyloid modulator compound and the biological sample are contacted in vitro. In another embodiment, the a-amyloid modulator compound is contacted with the biological sample by administering the a-amyloid 7a modulator compound to a subject. For in vivo administration, preferably the compound is labeled with radioactive technetium or radioactive iodine.
In another embodiment, the invention provides a method for detecting natural /3-amyloid peptides to facilitate diagnosis of a ~3-amyloidogenic disease, comprising contacting S a biological sample with a compound of the invention and detecting the compound bound to natural (3-amyloid peptides to facilitate diagnosis of a ~-amyloidogenic disease. In one embodiment, the (3-amyloid modulator compound and the biological sample are contacted in vitro. In another embodiment, the (3-amyloid modulator compound is contacted with the biological sample by administering the ~-amyloid modulator compound to a subject. For in vivo administration, preferably the compound is labeled with radioactive technetium or radioactive iodine. Preferably, the method facilitates diagnosis of Alzheimer's disease.
In one aspect, the invention also provides a method for treating a subject for a disorder associated with amyloidosis, comprising administering to the subject a therapeutically or prophylactically effective amount of a compound of the invention such that the subject is treated for a disorder associated with amyloidosis. The method can be used to treat disorders is selected, for example, from the group consisting of familial amyloid polyneuropathy (Portuguese, Japanese and Swedish types), familial amyloid cardiomyopathy (Danish type), isolated cardiac amyloid, systemic senile amyloidosis, scrapie, bovine spongiform encephalopathy, Creutzfeldt-Jakob disease, Gerstmann-Straussler-Scheinker syndrome, adult onset diabetes, insulinoma, isolated atrial amyloidosis, idiopathic (primary) amyloidosis, myeloma or macroglobulinemia-associated amyloidosis, primary localized cutaneous nodular amyloidosis associated with Sjogren's syndrome, reactive (secondary) amyloidosis, familial Mediterranean Fever and familial amyloid nephropathy with urticaria and deafness (Muckle-Wells syndrome), hereditary cerebral hemorrhage with amyloidosis of Icelandic type, amyloidosis associated with long term hemodialysis, hereditary non-neuropathic systemic amyloidosis (familial amyloid polyneuropathy III), familial amyloidosis of Finnish type, amyloidosis associated with medullary carcinoma of the thyroid, fibrinogen-associated hereditary renal amyloidosis and lysozyme-associated hereditary systemic amyloidosis.
In a preferred embodiment, the invention provides a method for treating a subject for a disorder associated with a-amyloidosis, comprising administering to the subject a therapeutically or prophylactically effective amount of a compound of the invention such that the subject is treated for a disorder associated with (3-amyloidosis.
Preferably the disorder is Alzheimer's disease.
7b In yet another embodiment, the invention provides a method for treating a subject for a disorder associated with (3-amyloidosis, comprising administering to the subject a recombinant expression vector encoding a peptide compound of the invention such that the compound is synthesized in the subject and the subject is treated for a disorder associated with ~i-arnyloidosis. Preferably, the disorder is Alzheimer's disease.
In one aspect, the invention provides a commercial package containing a ~i-amyloid modulator compound as described herein, together with instructions for its use for the treatment of a disorder associated with ~i-amyloidosis. Preferably, said disorder is Alzheimer's disease.
In a further aspect, the invention provides a method for inhibiting aggregation of natural (3-amyloid peptides, comprising contacting the natural (3-amyloid peptides with a /3-amyloid modulator compound as described herein, such that aggregation of the natural (3-amyloid peptides is inhibited.
In another aspect, the invention provides use of the S-amyloid modulator compound as described herein, for the treatment of a disorder associated with (3-amyloidosis.
In a further aspect, the invention provides use of the ~3-amyloid modulator compound as described herein, for the manufacture of a medicament for the treatment of a disorder associated with (3-amyloidosis.
Brief Descr~~otion of the Draw~na Figure 1 is a graphic representation of the turbidity of a ~-AP ~ ~o solution, as measured by optical density at 400 nm, either in the absence of a ~-amyloid modulator or in the presence of the (3-amyloid modulator N-biotinyl-~iAP~~o (1 %, or 5%).
Figure 2 is a schematic representation of compounds which can be used to modify a ~3-AP or an A~i aggregation core domain to form a ~3-amyloid modulator of the invention.
Figure 3 is a graphic representation of the toxicity of A~i ~..4o aggregates.
but not A~i ~ ~o monomers, to cultured neuronal cells.
Figure 4 is a graphic representation of the aggregation of A~ i~o in the presence of an equimolar amount of cholyl-A~i6.2o (panel A), a -2-fold molar excess of cholyl-A(3~2o (panel B) or a ~6-fold molar excess of cholyl-A(36-20 (panel C) and the corresponding toxicity of the aggregates of panels A. B and C to cultured neuronal cells (panels D. E
and F, respectively).
Detailed Description of the Invention This invention pertains to compounds. and pharmaceutical compositions thereof, that can modulate the aggregation of amyloidogenic proteins and peptides. in particular compounds that can modulate the aggregation of natural ~3 amyloid peptides (~i-AP) and inhibit the neurotoxicity of natural (3-APs. A compound of the invention that modulates aggregation of natural (3-AP, referred to herein interchangeably as a ~i amyloid modulator compound. a (3 amyloid modulator or simply a modulator. alters the aggregation of natural [3-AP when the modulator is contacted with natural ~i-AP. Thus. a compound of the invention acts to alter the natural aggregation process or rate for (3-AP. thereby disrupting this process.
Preferably. the compounds inhibit ~i-AP aggregation. Furthermore. the invention provides subregions of the ~i amyloid peptide that are sufficient. when appropriately modified as described herein. to alter (and preferably inhibit) aggregation of natural p amyloid peptides when contacted with the natural ~i amyloid peptides. In particular. preferred modulator compounds of the invention are comprised of a modified form of an A~i aggregation core domain, modeled after the aforementioned A~i subregion (as described further below). which is sufficient to alter (and preferably inhibit) the natural aggregation process or rate for (3-AP.
This A/3 aggregation core domain can comprises as few as three amino acid residues (or derivative, analogues or mimetics thereof). Moreover. while the amino acid sequence of the A~i aggregation core domain can directly correspond to an amino acid sequence found in natural ~i-AP, it is not essential that the amino acid sequence directly correspond to a (3-AP
sequence. Rather, amino acid residues derived from a preferred subregion of ~-AP (a hydrophobic region centered around positions 17-20) can be rearranged in order and/or substituted with homologous residues within a modulator compound of the invention and yet maintain their inhibitory activity (described further below).
w The $ amyloid modulator compounds of the invention can be selected based upon their ability to inhibit the aggregation of nauual (3-AP in vitro and/or iahibit the netu~otoxicity of natural (3-AP fibrils for cultured cells (using assays described herein).
Accordingly, the preferred modulator compounds inhibit the aggregation of natural (3-AP and/or inhibit the neurotoxicity of natural (3-AP. However, modulator compounds selected based on one or both of these properties may have additional properties in vivo that may be beneficial in the treatment of amyloidosis. For example, the modulator compound may interfere with processing of natural (3-AP (either by direct or indirect protease inhibition) or by modulation of processes that produce toxic ~i-AP, or other APP firagments, in vivo.
Alternatively, modulator compounds may be selected based on these latter properties, rather than inhibition of A(3 aggregation in vitro. Moreover. modulator compounds of the invention that are selected based upon their interaction with natural (3-AP also may interact with APP or with other APP fragments.
As used herein. a "modulator" of (3-amyloid aggregation is intended to refer to an agent that, when contacted with natural ~3 amyloid peptides. alters the aggregation of the natural (3 amyIoid peptides. The term "aggregation of ~i amyloid peptides"
refers to a process whereby the peptides associate with each other to form a multimeric, largely insoluble complex. The term "aggregation" further is intended to encompass ~i amyloid fibril formation and also encompasses ~-amyloid plaques.
- The terms "natural p-amyloid peptide", "natural (3-AP" and "natural A(i peptide", used interchangeably herein, are intended to encompass naturally occurring proteolytic cleavage products of the ~i amyloid precursor protein (APP) which are involved in [3-AP
aggregation and ~i-amylvidosi$. These natural peptides include ~i-amyloid peptides having 39-43 amino acids (i.e., A(3~-;g, A(3i~p, A~i~.~~. A~i»~ and A(3~.4;). The amino-terminal amino acid residue of natural ~i-AP corresponds to the aspartic acid residue at position 672 of the 770 amino acid residue fotzn of the amyloid precursor protein ("APP-770"). The 43 amino acid long form of natural ~i-AP has the amino acid sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGWIAT
(also shown in SEQ ID NO: 1 ), whereas the shorter forms have 1-4 amino acid residues deleted from the carboxy-tezZninal end. The amino acid sequence of APP-770 from position 672 (l. e., the amino-terminus of natural p-AP) to its C-terminal end ( 103 amino acids) is shown in SEQ ID NO: 2. The preferred form of natural (3-AP for use in the aggregation assays described herein is A~il.~o.
In the presence of a modulator of the invention, aggregation of natural ~
amyloid peptides is "altered" or "mpdulated". The various forms of the term "alteration" or "modulation" are intended to encompass both inhibition of ~3-AP aggregation and promotion of ~i-AP aggregation. Aggregation of natural (3-AP is "inhibited" in the presence of the modulator when there is a decrease in the amount andlor rate of (3-AP
aggregation as compared to the amount and/or rate of (3-AP aggregation in the absence of the modulator.
..
The various-forms of the term "inhibition" are intended to include both complete and partial inhibition of ~i-AP aggregation. Inhibition of aggregation can be quantitated as the fold increase in the lag time for aggregation or as the decrease in the overall plateau level of aggregation (t. e., total amount of aggregation), using an aggregation assay as described in the Examples. In various embodiments, a modulator of the invention increases the lag time of aggregation at least 1.2-fold, I .5-fold, 1.8-fold, 2-fold, 2.5-fold, 3-fold, 4-fold or 5-fold. In various other embodiments, a modulator of the invention inhibits the plateau level of aggregation at least 10%, 20%, 30%, 40 %, SO %, 75 % or 100 %.
A modulator which inhibits ~i-AP aggregation (an "inhibitory modulator compound") can be used to prevent or delay the onset of ~i-amyloid deposition. Moreover, as demonstrated in Example 10, inhibitory modulator compounds of the invention inhibit the formation andlor activity of neurotoxic aggregates of natural A/3 peptide (t.
e., the inhibitory compounds can be used to inhibit the neurotoxicity of ~3-AP). Still further, also as demonstrated in Example 10. the inhibitory compounds of the invention can be used to I 5 reduce the neurotoxicity of preformed ~i-AP aggregates. indicating that the inhibitory modulators can either bind to preformed A~i fibrils or soluble aggregate and modulate their inherent neurotoxicity or that the modulators can perturb the equilibrium between monomeric and aggregated forms of (3-AP in favor of the non-neurotoxic form.
Alternatively, in another embodiment, a modulator compound of the invention promotes the aggregation of natural A(i peptides. The various forms of the term "promotion"
refer to an increase in the amount and/or rate of ~i-AP aggregation in the presence of the modulator. as compared to the amount and/or rate of (3-AP aggregation in the absence of the modulator. Such a compound which promotes Aj3 aggregation is referred to as a stimulatory modulator compound. Stimulatory modulator compounds may be useful for sequestering ~3-amyloid peptides. for example in a biological compartment where aggregation of (3 :AP may not be deleterious to thereby deplete (3-AP from a biological compartment where aggregation of ~i-AP is deleterious. Moreover, stimulatory modulator compounds can be used to promote A~3 aggregation in in vitro aggregation assays (e.g., assays such as those described in the Examples), for example in screening assays for test compounds that can then inhibit or reverse this A~ aggregation (i.e., a stimulatory modulator compound can act as a "seed" to promote the formation of A(3 aggregates).
In a preferred embodiment, the modulators of the invention are capable of altering ~i-AP aggregation when contacted with a molar excess amount of natural ~3-AP. A
"molar excess amount of natural ~i-AP" refers to a concentration of natural (3-AP, in moles, that is greater than the concentration, in moles, of the modulator. For example, if the modulator and ~i-AP are both present at a concentration of I ~tM, they are said to be "equimolar", whereas if the modulator is present at a concentration of 1 ~M and the ~i-AP is present at a concentration of 5 ~M. the ~-AP is said to be present at a 5-fold molar excess amount compared to the modulator. in preferred embodiments, a modulator of the invention is effective at altering natural ~3-AP aggregation when the natural (3-AP is present at at least a 2-fold, 3-fold or 5-fold mole excess compared to the concentration of the modulator. In other embodiments, the modulator is effective at altering ~i-AP aggregation when the natural ~i-AP is present at at least a 10-fold, 20-fold, 33-fold, 50-fold, 100-fold, 500-fold or 1000-fold molar excess compared to the concentration of the modulator.
Various additional aspects of the modulators of the invention. and the uses thereof, are described in further detail in the following subsections.
I. Modulator Compounds In one embodiment, a modulator of the invention comprises a (3-amyloid peptide compound comprising the formula:
n ( Xaa wherein Xaa is a (3-amyloid peptide. A is a modulating group attached directly or indirectly to the (3-amyloid peptide of the compound such that the compound inhibits aggregation of natural (3-amyloid peptides when contacted with the natural (3-amyloid peptides, and n is an integer selected such that the compound inhibits aggregation of natural (3-amyloid peptides when contacted with the natural (i-amyloid peptides.
Preferably, (3-amyloid peptide of the compound has an amino-terminal amino acid residue corresponding to position 668 of (3-amyloid precursor protein-770 (APP-770) or to a residue carboxy-terminal to position 668 of APP-770. The amino acid sequence of APP-770 from position 668 to position 770 (i.e., the carboxy terminus) is shown below and in SEQ ID
NO: 2:
EVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
More preferably, the amino-terminal amino acid residue of the ~3-amyloid peptide corresponds to position 672 of APP-770 (position ~ of the amino acid sequence of SEQ ID
NO: 2) or to a residue carboxy-terminal to position 672 of APP-770. Although the ~-amyloid peptide of the compound may encompass the 103 amino acid residues corresponding to positions 668-770 of APP-770, preferably the peptide is between 6 and 60 amino acids in length, more preferably between 10 and 43 amino acids in length and even more preferably between 10 and 2~ amino acid residues in length.
As used herein, the term "~i amyloid peptide", as used in a modulator of the invention is intended to encompass peptides having an amino acid sequence identical to that of the natural sequence in APP, as well as peptides having acceptable amino acid substitutions from the natural sequence. Acceptable amino acid substitutions are those that do not affect the ability of the peptide to slur natural (3-AP alggregation. Moreover, particular amino acid substitutions may further contribute to the ability of the peptide to alter nanual p-AP
aggregation and/or may confer additional beneficial properties on the peptide (e.g., increased solubility, reduced association with other amyloid proteins, etc.). For example. substitution of hydrophobic amino acid residues for the two phenylalanine residues at positions 19 and 20 of natural (3-AP (positions 19 and 20 of the amino acid sequence shown in SEQ
ID NO: 1 ) may further contribute to the ability of the peptide to alter ~i-AP
aggregation (see Hilbich, C.
(1992) J. Mol. Biol. 228:460-473). Thus, in one embodiment, the (i-AP of the compound consists of the amino acid sequence shown below and in SEQ ID NO: 3:
DAEFRHDSGYEVHHQKLV(Xaal9)(Xaa2o)AEDVGSNKGAIIGLMVGGWIAT
(or an amino-terminal or carboxy-terminal deletion thereof), wherein Xaa is a hydrophobic amino acid. Examples of hydrophobic amino acids are isoleucine. leucine.
threonine. serine.
alanine. valine or glycine. Preferably, F ~ 9F~o is substituted with T ~ gT~o or G ~ 9I2o~
Other suitable amino acid substitutions include replacement of amino acids in the human peptide with the corresponding amino acids of the rodent (3 :AP peptide.
The three amino acid residues that differ between human and rat (3-AP are at positions ~. 10 and 13 of the amino acid sequence shown in SEQ ID NOs: 1 and 3. A human ~3-AP having the human to rodent substitutions Argg to Gly, Tyro to Phe and Hisl3 to Arg has been shown to retain the properties of the human peptide (see Fraser, P.E. et al. (1992) Biochemistry 31:10716-10723: and Hilbich. C. et al. ( 1991 ) Eur. J. Biochem. 201:61-69).
Accordingly. a human ~i-AP having rodent ~i-AP a.a. substitutions is suitable for use in a modulator of the invention.
Other possible ~i-AP amino acid substitutions are described in Hilbich. C. et al.
(1991) J. Mol. Biol. 218:149-163: and Hilbich. C. (1992) J. Mol. Biol. ?28:460-473.
Moreover, amino acid substitutions that affect the ability of ~i-AP to associate with other proteins can be introduced. For example, one or more amino acid substitutions that reduce the ability of ~-AP to associate with the serpin enzyme complex (SEC) receptor, a 1-antichymotrypsin (ACT) and/or apolipoprotein E (ApoE) can be introduced. A
preferred substitution for reducing binding to the SEC receptor is L34M35 to A;4A35 (at positions 34 and 35 of the amino acid sequences shown in SEQ ID NOs: 1 and 3). A preferred substitution for reducing binding to ACT is Sg to Ag (at position 8 of the amino acid sequences shown in SEQ ID NOs: 1 and 3).
Alternative to (3- .AP amino acid substitutions described herein or known in the art. a modulator composed. at least in part, of an amino acid-substituted (3 amyloid peptide can be prepared by standard techniques and tested for the ability to alter (3-AP
aggregation using an aggregation assay described herein. To retain the properties of the original modulator, preferably conservative amino acid substitutions are made at one or more amino acid residues. A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valise, leucine, isoleucine, proline, phenylslanine, methionine, tryptophan), ~-branched side chains (e.g., threonine, valise, isoleucine) and aromatic side chains (e.g., tyrosine, phcnylalanine, tryptophan, histidine).
Accordingly, a modulator composed of a ~i amyloid peptide having an amino acid sequence that is mutated from that of the wild-type sequence in APP-770 yet which still retains the ability to alter natural ~i-AP aggregation is within the scope of the invention.
As used herein, the term "~3 amyloid peptide" is further intended to include peptide analogues or peptide derivatives or pegtidomimetics that retain the ability to alter natural ~i-AP aggregation as described herein. For example, a (3 amyloid peptide of a modulator of the invention may be modified to increase its stability. bioavailability, solubility, etc. The terms "peptide analogue", "peptide derivative" and "peptidomimetic" as used herein are intended to include molecules which mimic the chemical structure of a peptide and retain the functional properties of the peptide. Approaches to designing peptide analogs are known in the art. For example, see Farmer, P.S. in drug; D~sig~ (E.J. Ariens. ed.) Academic Press, New York, 1980, vol. 10, pp. 119-143; Ball. J.B. and Alewood, P.F. (1990) J. Mol.
Recognition 3_:55;
Morgan, B.A. and Gainor, J.A. ( 1989) Ann. Rep. Med Chem. 24:243; and Freidinger, R.M.
(1989) Trendy Pharmacol. Sci. 10:270. Examples of peptide analogues, derivatives and peptidomimetics include peptides substituted with one or more benzodiazepine molecules (see e.g., James. G.L. et al. (1993) Science 260:1937-1942), peptides with methylated amide linkages and "retro-inverso" peptides (see U.S. Patent No. 4.522.752 by Sisto). Peptide analogues, peptide derivatives and peptidomimetic are described in further detail below with regard to compounds comprising an A~ aggregation core domain.
In a modulator of the invention having the formula shown above, a modulating group ("A") is attached directly or indirectly to the (3-amyloid peptide of the modulator (As used herein, the term "modulating group" and "modifying group" are used interchangeably to describe a chemical croup directly or indirectly attached to an A~i derived peptidic structure).
For example, the modulating group can be directly attached by covalent coupling to the ~i-amyloid peptide or the modulating group can be attached indirectly by a stable non-covalent association. In one embodiment of the invention, the modulating group is attached to the amino-terminus of the ~i-amyloid peptide of the modulator. Accordingly, the modulator can comprise a compound having a formula:
A-~-{ Xaa Alternatively, in another embodiment of the invention, the modulating group is attached to the carboxy-terminus of the (3-amyloid peptide of the modulator. Accordingly, the modulator can comprise a compound having a formula:
O
( Xaa ) ~-A
In yet another embodiment, the modulating group is attached to the side chain of at least one amino acid residues of the ~i-amyloid peptide of the compound (e.g., through the epsilon amino group of a lysyl residue(s), through the carboxyl group of an aspartic acid residues) or a glutamic acid residue(s), through a hydroxy group of a tyrosyl residue(s). a serine residues) or a threonine residues) or other suitable reactive group on an amino acid side chain).
The modulating group is selected such that the compound inhibits aggregation of natural ~i-amyloid peptides when contacted with the natural (i-amyloid peptides.
Accordingly. since the ~3-AP peptide of the compound is modified from its natural state- the modulating group "A" as used herein is not intended to include hydrogen. In a preferred embodiment. the modulating group is a biotin compound of the formula:
W
~X~
~X
O
X;~R~-C-Y
wherein X1-X; are each independently selected from the group consisting of S.
O and NR,.
wherein R~ is hydrogen. or an aryl, lower alkyl, alkenyl or alkynyl moiety; VV
is =O or NR2; R~ is a lower alkylenyl moiety and Y is a direct bond or a spacer molecule selected for its ability to react with a target group on a ~i-AP. At least one of Xl-X3 or W is an NR~
group.
The term "aryl" is intended to include aromatic moieties containing substituted or uasubstituted ring(s), e.g., benzyl, napthyl, etc. Other more complex fused ring moieties also are intended to be included.
The term "lower alkyl or alkylenyl moiety" refers to a saturated, straight or branched chain (or combination thereof] hydrocarbon containing 1 to about 6 carbon atoms, more preferably from 1 to 3 carbon atoms. The terms "lower alkenyl moiety" and "lower alkynyl moiety" refer to unsaturated hydrocarbons containing 1 to about 6 carbon atoms, more preferably 1 to 3 carbon atoms. Preferably, R2 contains 1 to 3 carbon atoms.
Preferably, R~
contains 4 carbon atoms.
The-spacer molecule (~ can be, for lex5ample, a lower alkyl gmup or a linker peptide.
and is preferably selected for its ability to link with a free amino group (e.g., the oc-amino group at the amino-terminus of a ~i-AP). Thus, in a preferred embodiment, the biotin compound modifies the amino-terminus of a ~3-amyloid peptide.
Additional suitable modulating groups may include other cyclic and heterocyclic compounds and other compounds having similar steric "bulk". Non-limiting examples of compounds which can be used to modify a ~3-AP are shown schematically in Figure 2, and include N acetylneuraminic acid, cholic acid, traps-4-cotininecarboxylic acid, 2-imino-1-imidazolidineacetic acid, (S')-(-~indoline-2-carboxylic acid, (-~menthoxyacetic acid. 2-norbornaneacetic acid, Y-oxo-5-acenaphthenebutyric acid, (-~2-oxo-4-thiazolidinecarboxylic acid, tetrahydro-3-furoic acid, 2-iminobiotin-N hydroxysuccinimide ester, diethylenetriaminepentaacetic dianhydride, 4-morpholinecarbonyl chloride, 2-thiopheneacetyl chloride, 2-thiophenesulfonyl chloride, S-(and 6-~carboxyfluorescein (succinimidyl ester), fluorescein isothiocyanate. and acetic acid (or derivatives thereof).
Suitable modulating groups are described further in subsection II below.
In a modulator of the invention. a single modulating group may be attached to a ~i-amyloid peptide (e.g., n=1 in the formula shown above) or multiple modulating groups may be attached to the peptide. The number of modulating groups is selected such that the compound inhibits aggregation of natural ~i-amyloid peptides when contacted with the natural (3-amyloid peptides. However, n preferably is an integer between l and 60, more preferably between l and 30 and even more preferably between l and 10 or 1 and 5.
In another embodiment, a ~i-amyloid modulator compound of the invention comprises an A~3 aggregation core domain (abbreviated as ACD) coupled directly or indirectly to a modifying group such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ~i-amyloid peptides when contacted with the natural ~3-amyloid peptides. As used herein, an "A(3 aggregation core domain" is intended to refer to a structure that is modeled after a subregion of a natural (3-arnyloid peptide which is sufficient to modulate aggregation of natural ~i-APs when this subregion of the natural (3-AP is appropriately modified as described herein (e.g., modified at the amino-terminus). The term "subregion of a natural (3-amyloid peptide" is intended to include amino-terminal and/or carboxy-terminal deletions of natural ~3-AP. The term "subregion of natural (3-AP" is not intended to include full-length natural ~i-AP (i.e., "subregion" does not include Aft-39, A~1-40~ A~31-41~ Apl-42 ~d A~31-43)~
Although not intending to be limited by mechanism, the ACD of the modulators of the invention is thought to confer a specific targeting function on the compound that allows the compound to recognize and specifically interact with natural (3-AP.
Preferably, the ACD
is modeled after a subregion of natural ~i-AP that is less than 15 amino acids in length and more preferably is between 3-10 amino acids in length. In various embodiments, the ACD is modeled after a subregion of (3-AP that is 10, 9, 8, 7, 6, 5, 4 or 3 amino acids in length. In one embodiment, the subregion of ~i-AP upon which the ACD is modeled is an internal or carboxy-terminal region of ø-AP (i.e., downstream of the amino-terminus at amino acid position 1 ). In another embodiment, the ACD is modeled after a subregion of (3-AP that is hydrophobic. In certain specific embodiments, the term Ap aggregation core domain specifically excludes ~i-AP subregions corresponding to amino acid positions 1-15 (A~i1.15)~
6-20 (A~6_20) and 16-40 (A~iI~O).
An A(3 aggregation core domain can be comprised of amino acid residues linked by peptide bonds. That is, the ACD can be a peptide corresponding to a subregion of ~i-AP.
Alternatively, an A~i aggregation core domain can be modeled after the natural A~i peptide region but may be comprised of a peptide analogue, peptide derivative or peptidomimetic compound. or other similar compounds which mimics the structure and function of the natural peptide. Accordingly, as used herein, an "A~3 aggregation core domain"
is intended to include peptides. peptide analogues, peptide derivatives and peptidomimetic compounds which. when appropriately modified. retain the aggregation modulatory activity of the modified natural A(3 peptide subregion. Such structures that are designed based upon the amino acid sequence are referred to herein as "A~i derived peptidic structures." Approaches to designing peptide analogues, derivatives and mimetics are known in the art.
For example, see Farmer, P.S. in Drub Design (E.J. Ariens, ed.) Academic Press. New York.
1980. vol. 10, pp. 119-143; Ball. J.B. and Alewood, P.F. (1990) J. Mol. Recognition 3:~5;
Morgan, B.A.
and Gainor. J.A. ( 1989) Ann. Rep. Med Chem. 24:243; and Freidinger, R.M. ( 1989) Trends Pharmacol. Sci. 10:270. See also Sawyer. T.K. ( 1995) "Peptidomimetic Design and Chemical Approaches to Peptide Metabolism" in Taylor, M.D. and Amidon. G.L.
(eds.) Peptide-Based Drug Design: Controlling Transport and Metabolism. Chapter 17:
Smith. A.B.
3rd. et al. (1995) J. Am. Chem. Soc. 117:11113-11123: Smith. A.B. 3rd, et al.
(1994) J. Am.
Chem. Soc. 116:9947-9962; and I~iirschman. R., et al. (1993) J. Am. Chem. Soc.
11~:12550-12568.
As used herein, a "derivative" of a compound X (e.g., a peptide or amino acid) refers to a form of X in which one or more reaction groups on the compound have been derivatized with a substituent group. Examples of peptide derivatives include peptides in which an amino acid side chain. the peptide backbone, or the amino- or carboxy-terminus has been derivatized (e.g., peptidic compounds with methylated amide linkages). As used herein an "analogue" of a compound X refers to a compound which retains chemical structures of X
necessary for functional activity of X yet which also contains certain chemical structures which differ from X. An examples of an analogue of a naturally-occurring peptide is a peptides which includes one or more non-naturally-occurring amino acids. As used herein, a "mimetic" of a compound X refers to a compound in which chemical structures of X
necessary for functional activity of X have been replaced with other chemical structures which mimic the conformation of X. Examples of peptidomimetics include peptidic compounds in which the peptide backbone is substituted with one or more benzodiazepine molecules (see e.g., James, G.L. et al. (1993) Science x:1937-1942), peptides in which all L-amino acids arc substituted with the corresponding D-amino acids and "retro-inverso"
peptides (see U.S. Patent No. 4,522,752 by Sisto), described further below.
The term mimetic, and in particular, peptidomimetic, is intended to include isosteres.
The term "isostere" as used herein is intended to include a chemical structure that can be substituted for a second chemical structure because the steric conformation of the first structure fits a binding site specific for the second structure. The term specifically includes peptide back-bone modifications (i.e., amide bond mimetics) well known to those skilled in the art. Such modifications include modifications of the amide nitrogen, the a-carbon. amide carbonyl, complete replacement of the amide bond, extensions, deletions or backbone crosslinks. Several peptide backbone modifications are known, including yr[CH2S], yr [CH.,NH], yr[CSNH2], yr[NHCO], yr[COCH,], and yr[(E) or (Z) CH=CH]. In the nomenclature used above, yr indicates the absence of an amide bond. The structure that replaces the amide group is specified within the brackets. Other examples of isosteres include peptides substituted with one or more benzodiazepine molecules (see e.g., James, G.L. et al. (1993) Science x,60:1937-1942) Other possible modifications include an N-alkyl (or aryl) substitution (fir[CONR]), backbone crosslinking to construct lactams and other cyclic structures.
substitution of all D-amino acids for all L-amino acids within the compound ("inverso" compounds) or retro-inverso amino acid incorporation (~y[NHCO]). By "inverso" is meant replacing L-amino acids of a sequence with D-amino acids, and by "retro-inverso" or "enantio-retro" is meant reversing the sequence of the amino acids ("retro") and replacing the L-amino acids with D-amino acids. For example, if the parent peptide is Thr-Ala-Tyr, the retro modified form is Tyr-Ala-Thr. the inverso form is thr-ala-tyr, and the retro-inverso form is tyr-ala-thr (lower case letters refer to D-amino acids). Compared to the parent peptide. a term-inverso peptide has a reversed backbone while retaining substantially the original spatial conformation of the side chains, resulting in a retro-inverso isomer with a topology that closely resembles the parent peptide. See Goodman et al. "Perspectives in Peptide Chemistry" pp. 283-(1981 ). See also U.S. Patent No. 4,522.752 by Sisto for further description of "retro-inverso"
peptides.
Other derivatives of the modulator compounds of the invention include C-terminal hydroxymethyl derivatives, O-modified derivatives (e.g., C-terminal hydroxymethyl benzyl ether), N-terminally modified derivatives including substituted amides such as alkylamides and hydrazides and compounds in which a C-terminal phenylalanine residue is replaced with a phenethylamide analogue (e.g., Val-Phe-phenethylamide as an analogue of the tripeptide Val-Phe-Phe).
In a preferred embodiment, the ACD of the modulator is modeled after tNe subregion of (3-AP encompassing amino acid positions 17-20 (i.e., Leu-Val-Phe-Phe; SEQ
ID NO: 12).
As described feather in Examples 7, 8 sad 91 peptide subregions of Aø 1.4,0 were per, amino-terminally modified and evaluated for their ability to modulate aggregation of natsnal ø-amyloid peptides. One subregion that was effective at inhibiting aggregation was Aø~2o (i.e., amino acid residues 6-20 of the natural Aø~,.4o peptide, the amino acid sequence of which is shown in SEQ ID NO: 4). Amino acid residues werc serially deleted from the amino-terminus or carboxy terminus of this subregion to further delineate a minimal subregion that was su~cient for aggregation inhibitory activity. This process defined Aø ~ 7_20 (e. e., amino acid residues 17-20 of the natural Aø 1,.4o peptide) as a minimal subregion that, when appropriately modified. is sufficient for aggregation inhibitory activity.
Accordingly, an "Aø aggregation core domain" within a modulator compound of the invention can be modeled after Aø ~ 7_20. In one embodiment. the Aø
aggregation core domain comprises Aø~7_2o itself (i.e., a peptide comprising the amino acid sequence leucine-valine-phenylalanine-phenylalanine; SEQ ID NO: 12). In other embodiments, the structure of AøI7_~o is used as a model to design an Aø aggregation core domain having similar structure and function to Aøt7.2o. For example, peptidomimetics, derivatives or analogues of Aø ~ 7_20 (as described above) can be used as an Aø aggregation core domain.
In addition to Aa 17-20~ ~e ~~ Aø Peptide is likely to contain other minimal subregions that arc suffcient for aggregation inhibitory activity. Such additional minimal subregions can be identified by the processes described in Examples 7. 8 and 9, wherein a 1 ~mer subregion of Aø l ~o is serially deleted from the amino-terminus or carboxy terminus, the deleted peptides are appropriately modified and then evaluated for aggregation inhibitory activity.
One form of the ø-amyloid modulator compound comprising an Aø aggregation core domain modeled after Aø ~ 7_2o coupled directly or indirectly to at least one modifying group has the formula:
n ( Y-XaamXaa~-Xaa3-Xaa4-Z
wherein Xaal and Xaa3 are amino acid structures;
Xaay is a valine structure;
XaaQ is a phenylalanine structure;
Y, which may or may not be present. is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to I 5;
Z. which may or may not be present. is a peptidic structure having the formula (Xaa)b, wherein Xaa is any amino acid structure and b is an integer from 1 to I 5; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
Xaa~, Xaa3. Y, Z. A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ø-amyloid peptides when contacted with the natural ø-amyloid peptides.
Preferably, a modulator compound of t9he above formula inhibits agon of natiual (3-amyloid peptides when contacted with the natural ~i-amyloid peptides and/or inhibits A~ neurotoxicity. Alternatively, the modulator compound can promote aggregation of natural ~-amyloid peptides when contacted with the natural ~3-amyloid peptides. The type and number of modifying groups ("A") coupled to the modulator are selected such that the compound alters (and preferably inhibits) aggregation of natural ~3-amyloid peptides when contacted with the natural ~i-amyloid peptides. A single modifying group can be coupled to the modulator (i.e., n=1 in the above formula) or, alternatively, multiple modifying groups can be coupled to the modulator. In various embodiments, n is an integer between 1 and 60, between I and 30, between I and 10, between 1 and 5 or between I and 3.
Suitable types of modifying groups are described further in subsection II below.
As demonstrated in Example 9, amino acid positions 18 (Val ~ g) and 20 (Phe2p) of A~3~~_2p (corresponding to Xaa, and Xaa4) are particularly important within the core domain for inhibitory activity of the modulator compound. Accordingly. these positions are conserved within the core domain in the formula shown above. The terms "valise structure"
and "phenylalanine structure" as used in the above formula are intended to include the natural amino acids, as well as non-naturally-occurring analogues, derivatives and mimetics of valise and phenylalanine, respectively, (including D-amino acids) which maintain the functional activity of the compound. Moreover, although Val ~ g and Phe2a have an important functional role, it is possible that Xaa2 and/or Xaa4 can be substituted with other naturally-occurring amino acids that are structurally related to valise or phenylalanine, respectively, while still maintaining the activity of the compound. Thus, the terms "valise structure"
is intended to include conservative amino acid substitutions that retain the activity of valise at Xaa,. and the term "phenylalanine structure" is intended to include conservative amino acid substitutions that retain the activity of phenylalanine at Xaa4. However, the term "valise structure" is not intended to include threonine.
In contrast to positions 18 and 20 of A~i ~ ~.2p, a Phe to Ala substitution at position 19 (corresponding to Xaa3) did not abolish the activity of the modulator, indicating position I 9 may be more amenable to amino acid substitution. In various embodiments of the above formula, positions Xaa~ and Xaa3 are any amino acid structure. The term "amino acid structure" is intended to include natural and non-natural amino acids as well as analogues, derivatives and mimetics thereof, including D-amino acids. In a preferred embodiment of the above formula. Xaal is a leucine structure and Xaa3 is a phenylalanine structure (i.e., modeled after Leu 1 ~ and Phe ~ g, respectively, in the natural A~i peptide sequence). The term "leucine structure" is used in the same manner as valise structure and phenylalanine structure described above. Alternatively, an another embodiment, Xaa3 is an alanine structure.
The four amino acid structure ACD of the modulator of the above formula can be flanked at the amino-terminal side, carboxy-terminal side, or both, by peptidic structures derived either from the natural A~i peptide sequence or from non-A~i sequences. The term "peptidic stin~cnu~e" is intended to include peptide analogues, derivatives and mimetics thereof,. as described above. The peptidic structure is composed of one or more linked amino acid structiues, the type and number of which in the above formula are variable. For example, in one embodiment, no additional amino acid structures flank the Xaat-Xaa,-Xaa3-5 Xaa4 core sequence (i.e., Y and Z are absent in the above formula). In another embodiment, one or more additional amino acid structures flank only the amino-terminus of the core sequences (i. e., Y is present but Z is absent in the above formula). In yet another embodiment, one or more additional amino acid structures flank only the carboxy-terminus of the core sequences (i.e., Z is present but Y is absent in the above formula).
The length of 10 flanking Z or Y sequences also is variable. For example, in one embodiment, a and b are integers from I to 15. More preferably, a and b are integers between I and 10.
Even more preferably, a and b are integers between 1 and 5. Most preferably, a and b are integers between 1 and 3 One form of the ~i-amyloid modulator compound comprising an A~3 aggregation core 15 domain modeled after A~3 ~ ~_~p coupled directly or indirectly to at least one modifying group has the formula: -A-(Y}-XaauXaa~-Xaa;-Xaa4-(Z)-B
wherein Xaai and Xaa3 are amino acids or amino acid mimetics;
20 Xaa~ is valise or a valise mimetic Xaa4 is phenylalanine or a phenylalanine mimetic;
Y, which may or may not be present. is a peptide or peptidomimetic having the formula (Xaa)a, wherein Xaa is any amino acid or amino acid mimetic and a is an integer from 1 to 15:
~ Z. which may or may not be present, is a peptide or peptidomimetic having the formula (Xaa)b, wherein Xaa is any amino acid or amino acid mimetic and b is an integer from I to I5; and A and B, at least one of which is present, are modifying groups attached directly or indirectly to the amino terminus and carboxy terminus, respectively, of the compound;
Xaal, Xaa3, Y, Z, A and B being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ~i-amyloid peptides when contacted with the natural ~i-amyloid peptides.
In this embodiment. the modulator compound is specifically modified at either its amino-terminus, its carboxy-terminus, or both. The terminology used in this formula is the same as described above. Suitable modifying groups are described in subsection II below. In one embodiment, the compound is modified only at its amino terminus (i.e., B
is absent aad the compound comprises the formula: A-(Y)-Xaa ~ -Xaa,-Xaag-Xaa4-(Z)). In another embodiment, the compound is modified only at its carboxy-terminus (i.e., A is absent and the compound comprises the formula: (Y~Xaa~ IXaa,-Xaa3-Xaa4-(Z)-B). In yet another embodiment, the compound is modified at both its amino- and carboxy termini (i.e., the compound comprises the formula: A-(Y~Xaa~-Xaa~-Xaa3-Xaa4-(Z)-B and both A and B are present). As described above, the type and number of amino acid structures which flank the Xa~aZ-Xaa~-Xaa3-Xaa~ core sequences in the above formula is variable. For example, in one embodiment, a and b are integers from 1 to 1 S. More preferably, a and b are integers between I and 10. Even more preferably, a and b are integers between 1 and 5. Most preferably, a and b are integers between 1 and 3.
As demonstrated in Examples 7, 8 and 9, preferred A~i modulator compounds of the invention comprise modified forms of A~ij4.2t (His-GIn-Lys-Leu-Val-Phe-Phe-Ala; SEQ ID
NO: 5), or amino-terminal or carboxy-terminal deletions thereof, with a preferred "minimal core region" comprising A~i 1 ~-2p. Accordingly, in specific embodiments. the invention provides compounds comprising the formula:
A-Xaa~-Xaa,-Xaa3-Xaa4-Xaag-Xaa6-Xaa~-Xaa8-B
wherein Xaa I is a histidine structure;
Xaa2 is a glutamine structure;
Xaa3 is a lysine structure;
Xaa4 is a leucine structure;
XaaS is a valine structure;
Xaa6 is a phenylalanine structure;
Xaa7 is a phenylalanine structure;
Xaa8 is an alanine structure;
A and B are niodifying groups attached directly or indirectly to the amino tenniaus and carboxy terminus. respectively, of the compound;
and wherein Xaa~-Xaa~-Xaa3, Xaa~-Xaa~ or Xaa~ may or may not be present;
Xaag may or may not be present; and at least one of A and B is present.
In one specific embodiment, the compaund comprises the formula: A-Xaa4-Xaas-Xaa6-XaaT-B (e.g, a modified form of A~i~~_2p, comprising an amino acid sequence Leu-Val-Phe-Phe; SEQ ID NO: 12).
In another specific embodiment, the compound comprises the formula: A-Xaa4-Xaag-Xaa6-Xaa~-Xaag-B (e.g, a modified form of A~it~_2~, comprising an amino acid sequence Leu-Val-Phe-Phe-Ala; SEQ ID NO: I 1).
In another specific embodiment, the compound comprises the formula: A-Xaa3-Xaad-XaaS-Xaa~-Xaa~-B (e.g., a modified farm of A(3t6.2p, comprising an amino acid sequence Lys-Leu-Val-Phe-Phe; SEQ ID NO: 10).
In apother specific embodimern, the cornpou~nd comprises the forlaula: A-Xaa3-Xaa4-Xaas~Xaa6-Xaa~-Xaag-B (c g., a modified form of A(3~~.21, comprising an amino acid sequence Lys-Leu-Val-Phe-Phe-Ala; SEQ ID NO: 9).
In another specific embodiment, the compound comprises the formula: A-Xaa2-Xsa3-Xaa4-Xaas-Xaa6-Xaa~-B (e.g., a modified form of A~its-2o~ ~mPnsing an amino acid sequence Gln-Lys-Leu-Val-Phe-Phe; SEQ ID NO: 8).
In another specific embodiment, the compound comprises the formula: A-Xaa2-Xaa3-Xaa4-Xaag-Xaab-Xaa~-Xaag-B (e.g., a modified form of Aøls-21- comprising an amino acid sequence GIn-Lys-Leu-Val-Phe-Phe-Ala; SEQ ID NO: 7).
In another specific embodiment, the compound comprises the formula: A-Xaal-Xaa2-Xaa3-Xaa4-Xaas-Xaa6-Xaa~-B (e.g., a modified form of A~314-2p, comprising an amino acid sequence His-Gln-Lys-Leu-Val-Phe-Phe; SEQ ID NO: 6).
In another specific embodiment the compound comprises the formula: A-Xaa~-Xaa,-Xaa.;-Xaa4-Xaas-Xaa~-Xaa~-Xaag-B (e.g., a modified form of AJ3I4-2 i ~
comprising an amino acid sequence His-Gln-Lys-Leu-Val-Phe-Phe-Ala; SEQ ID NO: 5).
In preferred embodiments of the aforementioned specif c embodiments, A or B is a cholanoyl structure or a biotin-containing structure (described further in subsection II below).
In further experiments to delineate subregions of A~ upon which an A(3 aggregation con domain can be modeled (the results of which are described in Example 11 ), it was demonstrated that a modulator compound having inhibitory activity can comprise as few as three A~i amino acids residues (e.g., VaI-Phe-Phe. which corresponds to A~3I8-2p or Phe-Phe-Ala. which corresponds to A[3 ~ q-2 ~ ). The results also demonstrated that a modulator compound having a modulating group at its carboxy-terminus is effective at inhibiting A(3 aggregation. Still further. the results demonstrated that the cholyl group, as a modulating group, can be manipulated while maintaining the inhibitory activity of the compounds and that an iodotyrosyl can be substituted for phenylalanine (e.g., at position 19 or 20 of the A~
sequence) while maintaining the ability of the compound to inhibit Ap aggregation.
Still ftuther, the results demonstrated that compounds with inhibitory activity can be created using amino acids residues that are derived from the Ap sequence in the region of about positions 17-21 but wherein the amino acid sequence is rearranged or has a substitution with a non-A~i-derived amino acid. Examples of such compounds include PPI-426, in which the sequence of A~i ~ ~-2 t (LVFFA) has been rearranged (FFVLA), PPI-372, in which the sequence ofA~it~.2p (KLVFF) has been rearranged (FKFVL), and PPI-388, -389 and -390, in which the sequence of A(31~-21 (LVFFA) has been substituted at position 17, 18 or 19, respectively, with an alanine residue (AVFFA for PPI-388, LAFFA for PPI-389 and LVAFA
for PPI-390). The inhibitory activity of these compounds indicate that the presence in the compound of an amino acid sequence directly corresponding to a portion of A~i is not essential for inhibitory activity, but rather suggests that maintenance of the hydrophobic nature of this core region, by inclusion of am~2'3no acid residues such as phenylalanine, valise, leucine, regardless of their precise order, can be sufficient for inhibition of Aø aggregation.
Accordingly, an Aø aggregation core domain can be designed based on the direct Aø amino acid sequence or can be designed based on a rearranged Aø sequence which maintains the hydrophobicity of the Aø subregion, e.g., the region around positions 17-20.
This region of Aø contains the amino acid residues Leu, Val and Phe. Accordingly, preferred Aø
aggregation core domains are composed of at least three amino acid structures (as that term is defined hereinbefore, including amino acid derivatives, analogues and mimeties), wherein at least two of the amino acid structures are, independently, either a leucine structure, a valise structure or a phenylalanine structure (as those terms are defined hereinbefore, including derivatives, analogues and mimetics).
Thus, in another embodiment, the invention provides a ø-amyloid modulator compound comprising a formula:
An ( Y-Xaa ~ -Xaa~-Xaa3-Z
wherein Xaal, Xaa,and Xaa3 are each amino acid structures and at least two of Xaat, Xaa., and Xaa3 are. independently, selected from the group consisting of a leucine structure, a phenylalanine structure and a valise structure;
ZO Y, which may or may not be present, is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to 15;
Z, which may or may not be present. is a peptidic structure having the formula (Xaa)b. wherein Xaa is any amino acid structure and b is an integer from 1 to 1 ~; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
Xaal, Xaa~, Xaa3, Y, Z, A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ø-amyloid peptides when contacted with the natural ø-amyloid peptides.
Preferably, the compound inhibits aggregation of natural ø-arnyloid peptides when contacud with the natural ø-amyloid peptides. In preferred embodiments, Xaa~
and Xaa2 are each phenylalanine structures or Xaa2 and Xaag are each phenylalanine structures. "n" can be, for example, an integer between 1 and 5, whereas "a" and "b" can be, for example, integers between 1 and 5. The modifying group "A" preferably comprises a cyclic, heterocyclic or polycyclic group. More preferably, A contains a cis-decalin group, such as cholanoyl structure or a cholyl group In other embodiments, A can comprise a biotin-_.
containing group, a diethylene-triaminepentaacetyl group, a (-)-menthoxyacetyl group, a fluorescein-containing group or an N-acetylneun3minyl group. In yet other embodiments. the compound may promotes aggregation of natural ø-amyloid peptides when contacted with the nataaal ø-amyloid peptides, may be fuztlter modified to alter a pharmacolcinctic property of the compound or may be further modified to label the compound with a detectable substance.
In another embodiment, the invention provides a ø-amyloid modulator compound comprising a formula:
A-(~-~ 1-~2-~3-~Z~'B
wherein Xaa~, Xaa~and Xaa3 are each amino acid structures and at least two of Xaal, Xaa~ and Xaa3 are, independently, selected from the group consisting of a leucine structure, a phenylalanine structure and a valine structure;
Y, which may or may not be present, is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from Z to 15;
Z, which may or may not be present, is a peptidic structure having the formula (Xaa)b, wherein Xaa is any amino acid structure and b is an integer from 1 to 1 ~: and Z S A and B, at least one of which is present are modifying groups attached directly or indirectly to the amino terminus and carboxy terminus.
respectively. of the compound;
Xaa~, Xaa,, Xaa3, Y, Z, A and B being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ø-amyloid peptides when contacted with the natural ø-amyloid peptides:
Preferably, the compound inhibits aggregation of natural ø-amyloid peptides when contacted with the natural ø-amyloid peptides. In preferred embodiments, Xaa~
and Xaa-, are each phenylalanine structures or Xaa~ and Xaa3 are each phenylalanine structures. In one subembodiment, the compound comprises the formula:
2S A-(y)-~at W?-~3-(Z) In another subembodiment, the compound comprises the formula:
(Y~-Xaai-Xaa~-Xaa3-(Z}-B
"n" can be, for example, an integer between 1 and 5, whereas "a" and "b" can be. for example.
integers between 1 and S. The modifying group "A" preferably comprises a cyclic, heterocyclic or polycyclic group. More preferably, A contains a cis-decalin group. such as cholanoyl structure or a cholyl group In other embodiments. A can comprise a biatin-containing group, a diethylene-triaminepentaacetyl group, a (-)-menthoxyacetyl group, a fluorescein-containing group or an N-acetylneurarninyl group. In yet other embodiments, the compound may promote aggregation of natural ø-amyloid peptides when contacted with the 3S natural ø-amyloid peptides, may be further modified to alter a pharmacokinetic property of the compound or may be further modified to label the compound with a detectable substance.
In preferred specific embodiments, the invention provides a ø-amyloid modulator compound comprising a modifying group attached directly or indirectly to a peptidic structure. wherein the peptidic structure comprises amino acid structures having an amino acid sequence selected From the group consisting of His-Gln-Lys-Leu-Val-Phe~Phe-Ala (SEQ
ID NO: 5), His-Gln-Lys-Leu-Val-Phe-Phe (SEQ ID NO: 6), GIn-Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 7), Gln-Lys-Leu-Val-Phe-Phe (SEQ ID NO: 8), Lys-Leu-VaI-Phe-Phe-Ala (SEQ ID N0: 9), Lys-Leu-Val-Phe-Phe (SEQ ID ~NO: 10), Leu-Val-Phe-Phe-Ala (SEQ
ID
5 NO: I l), Leu-Val-Phe-Phe (SEQ ID NO: 12), Leu-AIa-Phe-Phe-Ala (SEQ ID NO:
13), Val-Phe-Phe (SEQ ID NO: 19), Fhe-Phe-Ala (SEQ ID NO: 20), Phe-Phe-Val-Leu-AIa (SEQ
ID
NO: 21 ), Leu-Val-Phe-Phe-Lys (SEQ ID NO: 22), Leu-Vat-Iodotyrosine-Phe-Ala (SEQ ID
NO: 23), Val-Phe-Phe-Ala (SEQ ID NO: 24), Ala-Vad-Phe-Phe-Ala (SEQ ID NO: ZS), Leu-Val-Phe-Iodotyrosine-Ala (SEQ ID NO: 26), Leu-Val-Phe-Phe-Ala-Glu (SEQ ID NO:
27), 10 Phe-Phe-Val-Leu (SEQ ID NO: 28), Phe-Lys-Phe-VaI-Leu (SEQ ID NO: 29), Lys-Leu-Val-Ala-Phe (SEQ ID NO: 30), Lys-Leu-Val-Phe-Phe-~3Ala (SEQ ID NO: 31 ) and Leu-Val-Phe-Phe-DAIa (SEQ ID NO: 32).
These specific compounds can be further modified to alter a phannacokinetic property of the compound and/or further modified to label the compound with a detectable substance.
15 The modulator compounds of the invention can be incorporated into pharmaceutical compositions (described further in subsection V below) and can be used in detection and treatment methods as described further in subsection VI below.
II. Modifvine Grg~, s 20 Within a modulator compound of the invention, a peptidic structure (such as an A~i derived peptide. or an A~i aggregation core domain. or an amino acid sequence corresponding to a rearranged A~i aggregation core domain) is coupled directly or indirectly to at least one modifying gmup (abbreviated as MG). In one embodiment. a modulator compounds of the invention comprising an aggregation core domain coupled to a modifying group.
the 25 compound can be illustrated schematically as MG-ACD. The term "modifying group" is intended to include structures that are directly attached to the peptidic structure (e.g., by coval~t coupling), as well as those that are indirectly attached to the peptidic structure (e.g., by a stable non-covalent association or by covalent coupling to additional amino acid residues, or mimetics, analogues or derivatives thereof, which may flank the A~i-derived peptidic structure). For example, the modifying group can be coupled to the amino-terminus or carboxy-terminus of an A~i-derived peptidic structure, or to a peptidic or peptidomimetic region flanking the core domain. Alternatively, the modifying group can be coupled to a sidc chain of at least one amino acid residue of an A~i-derived peptidie structure, or to a peptidic or peptidomitnetic region flanking the core domain (e.g.. through the epsilon amino group of a lysyl residue(s). through the carboxyl group of an aspartic acid residues) or a glutamic acid residue(s), through a hydroxy group of a tyrosyl residue(s), a serine residues) or a threonine residues) or other suitable reactive group on an amino acid side chain).
Modifying groups covalently coupled to the pcptidic structure can be attached by means and using~methods well known in the art for linking chemical structures, including, for example, amide, alkylamino, carbamate or urea bonds.
The term "modifying group" is intended to include groups that are not naturally coupled to natural Aø peptides in their native form. Accordingly, the term "modifying S group" is not intended to' include hydrogen. The modifying gmup(s) is selected such that the modulator compound alters, and preferably inhibits, aggregation of natural ø-amyIoid peptides when contacted with the natural ø-amyloid peptides or inhibits the neurotoxicity of natural ø-amyloid peptides when contacted with the natural ø-amyloid peptides.
Although not intending to be limited by mechanism, the modifying groups) of the modulator compounds of the invention is thought to function as a key pharmacophore which is important for conferring on the modulator the ability to disrupt Aø
polymerization.
In a preferred embodiment. the modifying groups) comprises a cyclic, heterocyclic or palycyclic group. The term "cyclic group", as used herein, is intended to include cyclic saturated or unsaturated (i.e., aromatic) group having from about 3 to 10, preferably about 4 to 8. and more preferably about 5 to 7. carbon atoms. Exemplary cyclic groups include cyclopropyl. cyclobutyl, cyclopentyl, cyclohexyl. and cyclooctyl. Cyclic groups may be unsubstituted or substituted at one or more ring positions. Thus. a cyclic group may be substituted with, e.g.. halogens, alkyls, cycloalkyls, alkenyls, alkynyls, aryls, heterocycles, hydroxyls. aminos, nitros, thiols amines, imines. amides, phosphonates.
phosphines, carbonyls, carboxyls, silyls, ethers, thioethers, sulfonyls. sulfonates.
selenoethers, ketones, aldehydes, esters, -CF3, -CN, or the Like.
The term "heterocyclic group" is intended to include cyclic saturated or unsaturated (i.e.. aromatic) group having from about 3 to 10, preferably about 4 to 8, and more preferably about ~ to 7. carbon atoms. wherein the ring structure includes about ane to four heteroatoms.
Heterocyclic groups include pyrrolidine. oxolane. thiolane. imidazole.
oxazole, piperidine, piperazine, morpholine. The heterocyclic ring can be substituted at one or more positions with such substituents as, for example, halogens, alkyls, cycloalkyls, alkenyls, alkynyls, aryls. other heterocycles, hydroxyl, amino. vitro, thiol, amines, imines, amides, phosphonates, phosphines, carbonyls, carboxyls, silyls, ethers, thioethers, sulfonyls, selcnoethers, ketones, aldehydes, esters. -CF3, -CN, or the Like. Heterocycles may also be bridged or fused to other cyclic groups as described below.
The term "polycyclic group" as used herein is intended to refer to two or more saturated or unsaturated (i.e., aromatic) cyclic rings in which two or more carbons are common to two adjoining rings, e.g., the rings are "fused rings". Rings that are joined through non-adjacent atoms are termed "bridged" rings. Each of the rings of the polycyclic group can be substituted with such substituents as described above. as for example, halogens, alkyls, cycloalkyls, alkenyls, alkynyls, hydroxyl, amino. vitro, thiol.
amines, imines, amides, phosphonates, phosphines. carbonyls, carboxyls, silyls, ethers, thioethers, sulfonyls, selenoethers, ketones. aldehydes, esters. -CF;, -CN. or the like.
A preferred polycyclic group is a group containing a cis-decalin stxuctvre.
Although not intending to be limited by mechanism, it is thought that the "bent"
conformation conferred on a modifying group by the presence of a cis-decalin structure contributes to the efficacy of the modifying gmup in disrupting A~ polymerization. Accordingly, other structures which mimic the "bent" configuration of the cis-decalin structure can also be used as modifying groups. An example of a cis-decalin containing structure that can be used as a modifying group is a cholanoyl structure, such as a cholyl group. For example, a modulator compound can be modified at its amino terminus with a cholyl group by reacting the aggregation core domain with cholic acid, a bile acid. as described in Example 4 (the structure of cho1ie acid is illustrated in Figure 2). Moreover, a modulator compound can be modified at its carboxy terminus with a cholyl group according to methods known in the art (see e.g., Wess, G. et al. (1993) Tetrahedron Letters, X4_:817-832; Wess, G.
et aL (1992) Tetrahedron Letters i~:195-198; and Kramer, W. et al. (1992) J. Biol. Chem.
2u7:I8598-18604). Cholyl derivatives and analogues can also be used as modifying groups.
For I S example, a preferred cholyl derivative is Aic (3-(O-aminoethyl-iso)-cholyl). which has a free amino group that can be used to further modify the modulator compound (e.g., a chelation group for 9~Tc can be introduced through the free amino gmup of Aic). As used herein, the term "cholanoyl structure" is intended to include the cholyl group and derivatives and analogues thereof in particular those which retain a four-ring cis-decalin configuration.
Examples of cholanoyl structures include groups derived from other bile acids, such as deoxycholic acid, lithocholic acid, ursodeoxycholic acid, chenodeoxychoiic acid and hyodeoxycholic acid, as well as other related structures such as cholanic acid. bufalin and resibufogenin (although the latter two compounds are not preferred for use as a modifying group). Another example of a cis-decalin containing compound is 5~3-cholestan-3a-of (the cis-decalin isomer of (+~dihydrocholesterol). For further description of bile acid and steroid structure and nomenclature, see Nes, W.R. and McKean, M.L. Biochemisrry of Steroids and Other Isopentanoids, University Park Press, Baltimore, MD, Chapter 2.
In addition to cis-decalin containing groups, other polycyclic groups may be used as modifying groups. For example, modifying groups derived from steroids or (3-lactams may be suitable modifying groups. Moreover, non-limiting examples of some additional cyclic, heterocyclic or polycyclic compounds which can be used to modify an A~3-derived peptidic structure are shown schematically in Figure 2. In one embodiment, the modifying group is a "biotinyI structure", which includes biotinyl groups and analogues and derivatives thereof (such as a 2-iminobiotinyl group). In another embodiment, the modifying group can 3S comprise a "fluorescein-containing group", such as a group derived from reacting an A(3-derived peptidic structure with 5-(and 6-)-carboxvfluorescein, succinimidyl ester or fluorescein isothiocyanate. In various other embodiments, the modifying groups) can comprise an N acetylneuraminyl group, a trans-4-cotininecarboxyl group, a 2-imino-1-imidazolidineacetyl group, an (S}-(-rindoline-2-carboxyl group, a (-~menthoxyacetyl group, a 2-norbonoaaeacetyl group, a Y-oxo-S-acen~~thenebutyryl, a (-)-2-oxo-4-thiazolidinecarboxyl group, a teuahydro-3-furoyl group, a 2-iminobiotinyl group, a diethylenetriaminepentaacetyl group, a 4-morpholinecarbonyl group. a 2-thiopheneacetyl group or a 2-thiophenesulfonyl group.
Prefeaed modifying groups include groups comprising cholyl structures, biotinyl structures, fluorescein-containing groups, a diethylene-triaminepentaacetyl group, a (-)-menthoxyacetyl group, and a N-acetylneuraminyl group. More preferred modifying groups those comprising a cholyl structure or an iminiobiotinyl group.
In addition to the cyclic. heterocyclic and polycyelic groups discussed above, other IO types of modifying groups can be used in a modulator of the invention. For example, small hydrophobic groups may be suitable modifying groups. An example of a suitable non-cyclic modifying group is an acetyl group.
Yet another type of modifying group is a compound that contains a non-natural amino acid that acts as a beta-turn mimetic. such as a dibenzofuran-based amino acid described in Tsang. K.Y. et al. ( 1994) J. Am. Chem. Soc. I 16:3988-400; Diaz H and Kelly.
J. W. ( 1991 Tetrahedron Letters 41:5735-5728; and Diaz. H et aI. (1992) J. Am. Chem. Soc.
114:8316-8318. An example of such a modifying group is a peptide-aminoethyldibenzofiwanyl-proprionic acid (Adp) group (e.g., DDIIL-Adp). This type of modifying gmup further can comprise one or more N-methyl peptide bonds to introduce additional steric hindrance to the aggregation of natural (3-AP when compounds of this type interact with natural ~i-AP.
III. Additional Chemical Modifications of A~i Modulators A p-amyloid modulator compound of the invention can be further modified to alter the specific properties of the compound while retaining the ability of the compound to alter A~i aggregation and inhibit A(3 neurotoxicity. For example. in one embodiment, the compound is further modified to alter a pharmacokinetic property of the compound, such as in vivo stability or half life. In another embodiment. the compound is further modified to label the compound with a detectable substance. In yet another embodiment. the compound is fiurther modified to couple the compound to an additional therapeutic moiety.
Schematically, a modulator of the invention comprising an A~i aggregation core domain coupled directly or indirectly to at least one modifying group can be illustrated as MG-ACD, whereas this compound which has been further modified to alter the properties of the modulator can be illustrated as MG-ACD-CM, wherein CM represents an additional chemical modification.
To further chemically modify the compound, such as to alter the pharmacokinetic properties of the compound, reactive groups can be derivatized. For example, when the modifying group is attached to the amino-terminal end of the aggregation core domain, the earboxy-terminal end of the compound can be further modified. Preferred C-terminal modifications include those which reduce the ability of the compound to act as a substrate for carboxypeptidases. Examples of preferred C-terminal modifiers include an amide group, an ethylamide group and various non-natural amino acids, such as D-amino acids and (3-alanine.
Alternatively, when the modifying group is attached to the carboxy-teTm~inal end of the aggregation core domain, the amino-terminal end of the compound can be further modified, for example, to reduce the ability of the compound to act as a substrate for aminopeptidases.
A modulator compound can be fitrther modified to label the compound by reacting the compound with a detectable substance. Suitable detectable substances include various enzymes, prosthetic groups. fluorescent materials, luminescent materials and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, ~i-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein. fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol: and examples of suitable radioactive material include 14C, 1231, 1241. 12~I? 1311, 99mT~~ 35S or'I~i. In a preferred embodiment, a modulator compound is radioactively labeled with 14C, either by incorporation of 14C
into the modifying group or one or more amino acid structures in the modulator compound. Labeled modulator compounds can be used to assess the in vivo pharmacokinetics of the compounds, as well as to detect A~i aggregation. for example for diagnostic purposes. A~i aggregation can be detected using a labeled modulator compound either in vivo or in an in vitro sample derived from a subject.
Preferably, for use as an in vivo diagnostic agent. a modulator compound of the invention is labeled with radioactive technetium or iodine. Accordingly, in one embodiment, the invention provides a modulator compound labeled with technetium.
preferably ~Tc.
2~ Methods for labeling peptide compounds with technetium are known in the art (see e.g., U.S.
Patent Nos. 5.443,815, 5_5,.180 and 5,405,597, all by Dean et al.: Stepniak-Biniakiewicz D., et al. (1992) J. Med Chem. x:274-279; Fritzberg, A.R., et al. (1988) Proc.
Natl. Acad Sci. USA X5:4025-4029; Baidoo. K.E., et al. (1990) Cancer Res. Suppl. 50:799s-803s; and Regan; L, and Smith, C.K. (1995) Science 270:980-982). A modifying group can be chosen that provides a site at which a chelation group for ggmTc carr be introduced.
such as the Aic derivative of cho1ie acid, which has a free amino group (see Example 11 ). In another embodiment, the invention provides a modulator compound labeled with radioactive iodine.
For example. a phenylalanine residue within the A~i sequence (such as Phe 1 g or Phe2p) can be substituted with radioactive iodotyrosyl (see Example 11 ). Any of the various isotopes of radioactive iodine can be incorporated to create a diagnostic agent.
Preferably, 1231 (half life = 13.2 hours) is used for whole body scintigraphy, 1241 (half life = 4 days) is used for positron emission tomography (PET), 1251 (half life = 60 days) is used for metabolic turnover studies and 1311 (half life = 8 days) is used for whole body counting and delayed low resolution imaging studies.
Fore. an additional modif canon of a modulator compound of the invention can serve to confer an additional therapeutic property on the compound. That is, the additional chemical modification can comprise an additional functional moiety.
For example, a functional moiety which serves to break down or dissolve amyloid plaques can be coupled 5 to the modulator compound. In this form, the MG-ACD portion of the modulator serves to target the compound to Aø peptides and disrupt the polymerization of the Aø
peptides, whereas the additional functional moiety serves to break down or dissolve amyloid plaques after tt~e compound has been targeted to these sites.
In an alternative chemical modification, a ø-amyloid compound of the invention is 10 prepared in a "prodrug" form, wherein the compound itself does not modulate Aø
aggregation, but rather is capable of being transformed, upon metabolism in vivo, into a ø-amyloid modulator compound as defined herein. For example, in this type of compound, the modulating group can be present in a prodrug form that is capable of being converted upon metabolism into the form of an active modulating group. Such a prodrug form of a 15 modifying gmup is referred to herein as a "secondan~ modifying group." A
variety of strategies are known in the art for preparing pepude prodrugs that limit metabolism in order to optimize delivery of the active form of the peptide-based drug (see e.g., Moss, J. (1995) in Peptide-Based Drug Design: Controlling Transport and Metabolism. Taylor, M.D.
and Amidon. G.L. (eds), Chapter 18. Additionally strategies have been specifically tailored to 20 achieving CNS delivery based on "sequential metabolism" (see e.g., Bodor, N., et al. ( 1992) Science 27:1698-1700; Prokai, L., et al. (1994) J. Am. Chem. Soc. 11~f:2643-2644: Bodor, N. and Prokai. L. (1995) in P~tide-Based Drug Des~Qn: Controlling Transport and M oli . Taylor, M.D. and Amidon. G.L. (eds). Chapter 14. In one embodiment of a prodrug form of a modulator of the invention. the modifying group comprises ~an alkyl ester 25 to facilitate blood-brain barrier permeability.
Modulator compounds of the invention can be prepared by standard techniques known in the art. The peptide component of a modulator composed, at least 'in part. of a peptide, can be synthesized using standard techniques such as those described in Bodansky, 30 M. Principles ofPeptide Synthesis,, Springer Verlag, Berlin (1993) and Grant. G.A (ed.).
Synthetic Pegtides: A User's Guide, W.H. Freeman and Company, New York (199?).
Automated peptide synthesizers are commercially available (e.g., Advanced ChemTech Model 396: Milligen/ Biosearch 9600). Additionally, one or more modulating groups can be attached to the Aø-derived peptidic component (e.g.. an Aø aggregation core domain) by standard methods. for example using methods for reaction through an amino group (e.g., the alpha-amino group at the amino-terminus of a peptide), a carboxyl group (e.g., at the carboxy terminus of a peptide), a hydroxyl group (e.g., on a tyrosine, serine or threonine residue) or other suitable reactive group on an amino acid side chain (see e.g., Greene, T.W and Wuts,.
P.G.M. Protective Groups in Organic S ,vnthesis. John Wiley and Sons, Inc., New York ( 1991 ). Exemplary syntheses of preferred p amyloid modulators is described further in Examples 1, 4 and 11.
IV. Screen,~nQ As~avs Another aspect of the invention pertains to a method for selecting a modulator of ~i-amyloid aggregation. In the method, a test compound is contacted with natural ~ amyloid peptides, the aggregation of the natural (3-AP is measured and a modulator is selected based on the ability of thesest compound to alter the aggregation of the natural p-AP (e.g., inhibit or promote aggregation). In a preferred embodiment, the test compound is contacted with a molar excess amount of the natural ~-AP. The amount and/or rate of natural ~i-AP
aggregation in the presence of the test compound can be determined by a suitable assay indicative of ~i-AP aggregation. as described herein (see e.g., Examples 2, ~
and 6).
In a preferred assay, the natural (3-AP is dissolved in solution in the presence of the test compound and aggregation of the natural ~i-AP is assessed in a nucleation assay (see 1 ~ Example 6) by assessing the turbidity of the solution over time. as measured by the apparent absorbance of the solution at 40~ nm (described further in Example 6; see also Jarrett et al.
(1993) Biochemistry 32:4693-4697). In the absence of a ~i-amyloid modulator, the A4og~, of the solution typically stays relatively constant during a lag time in which the (3-AP remains in solution, but then the A4o5nm of the solution rapidly increases as the ~i-AP
aggregates and comes out of solution, ultimately reaching a plateau level (r.e., the A4o;~ of the solution exhibits sigmoidal kinetics over time). In contrast. in the presence of a test compound that inhibits j3-AP aggregation. the A4o5nm of the solution is reduced compared to when the modulator is absent. Thus, in the presence of the inhibitory modulator. the solution may exhibit an increased lag time. a decreased slope of aggregation and/or a lower plateau level 2~ compared to when the modulator is absent. This method for selecting a modulator of ~i-amyloid polymerization can similarly be used to select modulators that promote (3-AP
aggregation. Thus, in the presence of a modulator that promotes ~i-AP
aggregation, the A405nm of the solution is increased compared to when the modulator is absent (e.g., the solution may exhibit an decreased lag time, increase slope of aggregation and/or a higher plateau level compared to when the modulator is absent).
Another assay suitable for use in the screening method of the invention, a seeded extension assay, is also described further in Example 6. In this assay, ~i-AP
monomer and an aggregated j3- .AP "seed" are combined, in the presence and absence of a test compound. and the amount of. (i-fibril formation is assayed based on enhanced emission of the dye Thioflavine T when contacted with ~i-AP fibrils. Moreover, (3-AP aggregation can be .
assessed by electron microscopy (EIvi] of the ~i-AP Preparation in the presence or absence of the modulator. For example, ~i amyloid fibril formation, which is detectable by EM, is reduced in the presence of a modulator that inhibits (i-AP aggregation (i.e., there is a reduced amount or number of ~i-fibrils in the presence of the modulator), whereas ~
fibril formation is increased in-the presence of a modulator that promotes ø-AP aggregation (i.e., there is as increased amount or number of ø-fibrils in the presence of the modulator).
An even more prefentd assay for use in the screening method of the invention to select suitable modulators is the neurotoxicity assay described in Examples 3 and 10.
Compounds are selected which inhibit the formation of neurotoxic Aø aggregates and/or which inhibit the neurotoxicity of preformed Aø fibrils. This neumtoxicity assay is considered to be predictive of neurotoxicity in vivo. Accordingly, inhibitory activity of a modulator compound in the in vitro neurotoxicity assay is predictive of similar inhibitory activity of the compound for neurotoxicity in vivo.
V. ~hg~gubcal Compositions Another aspect of the invention pertains to pharmaceutical compositions of the ø-amyloid modulator compounds of the invention. In one embodiment. the composition includes a ø amyloid modulator compound in a therapeutically or prophylactically effective amount suff cient to alter. and preferably inhibit, aggregation of natural ø-amyioid peptides, and a pharmaceutically acceptable carrier. In another embodiment, the composition includes a ø amyloid modulator compound in a therapeutically or prophylactically effective amount sufficient to inhibit the neurotoxicity of natural ø-amyloid peptides. and a pharmaceutically acceptable carrier. A "therapeutically effective amount" refers to an amount effective, at dosages and for periods of time necessary. to achieve the desired therapeutic result, such as reduction or reversal or ø-amyloid deposition and/or reduction or reversal of Aø
neurotoxicity. A therapeutically effective amount of modulator may vary according to factors such as the disease state, age, seat. and weight of the individual. and the ability of the modulator to elicit a desired response in the individual. Dosage regimens may be adjusted to provide the optimum therapeutic response. A therapeutically effective amount is also one in which any toxic or deuimental effecu of the modulator are outweighed by the therapeuticahy beneficial effects. The potential neurotoxicity of the modulators of the invention can be assayed using the cell-based assay described in Examples 3 and 10 and a therapeutically effective modulator can be selected which daes not exhibit significant neurotoxicity. In a prefetied embodiment, a therapeutically effective amount of a modulator is sufficient to alter, and preferably inhibit. aggregation of a molar excess amount of natural ø-amyloid peptides.
A "prophylactically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result, such as preventing or inhibiting the rate of ø~amyloid deposition and/or Aø neeuotoxicity in a subject predisposed to ø-amyloid deposition. A prophylactically effective amount can be determined as described above for the therapeutically effective amount. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
Onrfactor that may be considered when determining a therapeutically or prophylactically effective amount of a p amyloid modulator is the concentration of natural ~i-AP in a biological compartment of a subject, such as in the cerebrospinal fluid (CSF) of the subject. The concentration of natural /3-AP in the CSF has been estimated at 3 nM
(Schwartzman, (1994) Proc. Natl. Acaci: Sci. USA X1_:8368-8372). A non-limiting range for a therapeutically or prophylactically effective amounts of a ~i amyloid modulator is 0.01 nM-10 pM. It is to be noted that dosage values may vary with the severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
The amount of active compound in the composition may vary according to factors such as the disease state, age. sex. and weight of the individual, each of which may affect the amount of natural (3-AP in the individual. Dosage regimens may be adjusted to provide the optimum therapeutic response. For example. a single bolus may be administered.
several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated;
each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved. and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
As used herein "pharmaceutically acceptable carrier" includes any and all solvents.
dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. In one embodiment. the carrier is suitable for parenteral administration. Preferably, the carrier is suitable for administration into the central nervous system (e.g., intraspinally or intracerebrally).
Alternatively. the carrier can be suitable for intravenous, intraperitoneal or intramuscular administration. In another embodiment, the carrier is suitable for oral administration.
Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound. use thereof in the pharmaceutical compositions of the invention is contemplated. Supplementary active compounds can also be incorporated into the compositions.
Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, S liposome, or other ordered structure suitable to high drug concentration.
The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof., The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it will be preferable to include isotonic agents. for example, sugars, polyalcohols such as manitol, sorbitol, or sodium chloride in the composition.
Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption. for example. monostearate salts and gelatin.
Moreover. the modulators can be administered in a time release formulation, for example in a composition which includes a slow release polymer. The active compounds can be prepared with carriers that will protect the compound against rapid release. such as a controlled release formulation, including implants and microencapsulated delivery systems.
Biodegradable, biocompatible polymers can be used. such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid. collagen, polyorthoesters, polylactic acid and polylactic, polyglycolic copolymers (PLG). Many methods for the preparation of such formulations are patented or generally known to those skilled in the art.
Sterile injectable solutions can be prepared by incorporating the active compound (e.g., ~3-amyloid modulator) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above. as required. followed by filtered sterilization.
2~ Generally. dispersions are prepared by incorporating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions. the preferred methods of preparation are vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
A modulator compound of the invention can be formulated with one or more additional compounds that enhance the solubility of the modulator compound.
Preferred compounds to be added to formulations to enhance the solubility of the modulators are cyclodextrin derivatives, preferably hydroxypropyl-y-cyclodextrin. Drug delivery vehicles containing a cyclodextrin derivative for delivery of peptides to the central nervous system are described in Bodor, N., et al. (1992) Science 257:1698-1700. For the ~3-amyloid modulators described herein. inclusion in the formulation of hydroxypropyl-Y-cyclodextrin at a concentration 50-200 mM increases the aqueous solubility of the compounds. In addition to increased solubility, inclusion of a cyclodextrin derivative in the formulation may have other beneficial effects, since p-cyclodextrin itself has been reported to interact with the Ap peptide and inhibit fibril formation in vitro (Camilleri, P., et al. (1994) FEES
Letters 341:256-2~$.
Accordingly, use of a modulator compound of the invention in combination with a cyclodextrin derivative may result in greater inhibition of A~i aggregation than use of the 5 modulator alone. Chemical modifications of cyclodextrins are known in the art (Hanessian, S., et al. (1995) J. Org. Chem. C0_:4786-4797). In addition to use as an additive in a pharmaceutical composition containing a modulator of the invention, cyclodextrin derivatives may also be useful.as modifying groups and, accordingly, may also be covalently coupled to an A(3 peptide compound to form a modulator compound of the invention.
18 In another embodiment. a pharmaceutical composition comprising a modulator of the invention is formulated such that the modulator is transported across the blood-brain barrier (BBB). Various strategies known in the art for increasing transport across the BBB can be adapted to the modulators of the invention to thereby enhance transport of the riodulators across the BBB (for reviews of such strategies. see e.g., Pardridge. W.M.
(1994) Trends in 15 Biotechnol. 1?:239-24~: Van Hree, J.B. et al. (1993) Pharm. World Sci. 1~:2-9: and Pardridge, W.M. et al. ( 1992) Pharmacol. Toxicol. 7 ~:3-10). In one approach, the modulator is chemically modified to form a prodrug with enhanced transmembrane transport. Suitable chemical modifications include covalent linking of a fatty acid to the modulator through an amide or ester linkage (see e.g., U.S. Patent 4,933,324 and PCT Publication WO
89/07938, 20 both by Shashoua; U.S. Patent 5,284,876 by Hesse et al.; Toth, I. et al.
(1994) J. Drug Target. 2:217-239; and Shashoua, V.E. et al. (1984) J. Med Chem. 27:659-664) and glycating the modulator (see e.g., U.S. Patent 5.260,308 by Poduslo et al.).
Also, N-acylamino acid derivatives may be used in a modulator to form a "lipidic"
prodrug (see e.g., U.S. Patent No. 5,112,863 by Hashimoto et al. issued on May 12'", 1992).
25 In anqther approach for enhancing transport across the BBB, a peptidic or peptidomimetic modulator is conjugated to a second peptide or protein, thereby forming a chimeric protein, wherein the second peptide or protein undergoes absorptive-mediated or receptor-mediated transcytosis through the BBB. Accordingly, by coupling the modulator to this second peptide or protein, the chimeric protein is uamsported across the BBB. The 30 second peptide or protein can be a ligand for a brain capillary endothelial cell receptor ligand.
For example, a preferred ligand is a monoclonal antibody that specifically binds to the transferrin .receptor on brain capillary endothelial cells (see e.g., U.S.
Patents 5,182,107 and 5,154.924 and PCT Publications WO 93/10819 and WO 95/02421, all by Friden et al.).
Other suitable peptides or proteins thai can mediate transport across the BBB
include histot~es 35 (see e.g., U.S. Patent 4,902,505 by Pardridge and Schimmel) and ligands such as biotin, folate, niacin, pantothenic acid, riboflavin, thiamin, pryridoxal and ascorbic acid (see e.g., U.S. Patents 5,416,016 and 5,108,921, both by Heinstein). Additionally, the glucose transporter GLUT-1 has been reported to transport glycopeptides (L-serinyl-~i-D-glucoside analogues of [MetS]enkephalin) across the BBB (Poll, R et al. (1994) Proc.
Natl. Acad Sci.
USA Q1:7114-I778). Accordingly, a modulator compound can be coupled to such a glycopeptide to target the modulator to the GLUT-1 glucose transporter. For example, a modulator compound which is modified at its amino terminus with the modifying group Aic (3-(O-aminoethyl-iso~cholyl, a derivative of cholic acid having a free amino group) can be coupled to a glycopeptide through the amino group of Aic by standard methods.
Chimeric proteins can be formed by recombinant DNA methods (e.g., by formation of a chimeric gene encoding a fusion protein) or by chemical crosslinking of the modulator to the second peptide or protein to form a chimeric protein. Numerous chemical crosslinking agents are known in the (e.g., commercially available from Pierce, Rockford IL). A crosslinking agent can be chosen which allows for high yield coupling of the modulator to the second peptide or protein and for subsequent cleavage of the linker to release bioactive modulator. For example, a biotin-avidin-based linker system may be used.
In yet another approach for enhancing transport across the BBB, the modulator is encapsulated in a carrier vector which mediates transport across the BBB. For example. the modulator can be encapsulated in a liposome. such as a positively charged unilamellar liposome (see e.g., PCT Publications WO 88/07851 and WO 88/07852. both by Faden) or in polymeric microspheres (see e.g., U.S. Patent 5,413,797 by Khan et al.. U.S.
Patent 5 71,961 by Mathiowitz et~al. and 5,019,400 by Gombotz et al.). Moreover. the carrier vector can be modified to target it for transport across the BBB. For example, the carrier vector (e.g., liposome) can be covalently modified with a molecule which is actively transported across the BBB or with a ligand for brain endothelial cell receptors. such as a monoclonal antibody that specifically binds to transferrin receptors (see e.g., PCT
Publications WO 91/04014 by Collies et aL and WO 94/02178 by GreiQ et al.).
In still another approach to enhancing transport of the modulator across the BBB. the modulator is coadministered with another agent which functions to permeabilize the BBB.
Examples of such BBB "permeabilizers" include bradykinin and bradykinin agonists (see e.g., U.S. Patent 5,112.596 by Malfroy-Canine) and peptidic compounds disclosed in U.S.
Patent 5,268,164 by Kozarich et al.
A modulator compound of the invention can be formulated into a pharmaceutical composition wherein the modulator is the only active compound or.
alternatively, the pharmaceutical composition can contain additional active compounds. For example, two or more modulator compounds nay be used in combination. Moreover. a modulator compound of the invention can be combined with one or more other agents that have anti-amyloidogenic properties. For example. a modulator compound can be combined with the non-specific cholinesterase inhibitor tacrine (Cognex~, Parke-Davis).
In another embodiment. a pharmaceutical composition of the invention is provided as a packaged formulation. The packaged formulation may include a pharmaceutical composition of the invention in a container and printed instructions for administration of the composition-for treating a subject having a disorder associated with (3-amyloidosis, e.g.
Alzheimer's disease.
VI. Methods of Using Aa Modulators Another aspect of the invention pertains to methods for altering the aggregation or inhibiting the neurotoxicity of natural (3-amyloid peptides. In the methods of the invention, natural p amyloid peptides are contacted with a ~i amyloid modulator such that the aggregation of the aatinal (l amyloid peptides is altered or the neurotoxicity of the natural ~
amyloid peptides is inhibited. In a preferred embodiment, the modulator inhibits aggregation of the natural /3 amyloid peptides. In another embodiment, the modulator promotes aggregation of the natural ~i amyloid peptides. Preferably, aggregation of a molar excess amount of p-AP. relative to the amount of modulator, is altered upon contact with the modulator.
In the method of the invention. natural ~i amyloid peptides can be contacted with a 1 S modulator either in vitro or in vivo. Thus, the term "contacted with" is intended to encompass both incubation of a modulator with a natural ~i-AP preparation in vitro and delivery of the modulator to a site in vivo where natural ~i-AP is present. Since the modulator compound interacts with natural (3-AP, the modulator compounds can be used to detect natural (3-AP, either in vitro or in vivo. Accordingly, one use of the modulator compounds of the invention is as diagnostic agents to detect the presence of natural ~3-AP, either in a biological sample or in vivo in a subject. Furthermore, detection of natural (3-AP utilizing a modulator compound of the invention further can be used to diagnose amyloidosis in a subject.
Additionally, since the modulator compounds of the invention disrupt (3-AP aggregation and inhibit (3-AP
neurotoxicity. the modulator compounds also are useful in the treatment of disorders 2~ associated with (3-amyloidosis, either prophylactically or therapeutically.
Accordingly.
another use of the modulator compounds of the invention is as therapeutic agents to alter aggregation and/or neurotoxicity of natural (i-AP.
In one embodiment. a modulator compound of the invention is used in virro, for example to detect and quantitate natural ~i-AP in sample (e.g., a sample of biological fluid).
To aid in detection. the modulator compound can be modified with a detectable substance.
The source of natural ~i-AP used in the method can be, for example, a sample of cerebrospinal fluid (e.g., from an AD patient, an adult susceptible to AD due to family history, or a normal adult). The natural ~i-AP sample is contacted with a modulator of the invention and aggregation of the (3-AP is measured, such as by as assay described in Examples 2, ~ and 6. Preferably, the nucleation assay and/or seeded extension assay described in Example 6 is used. The degree of aggregation of the ~i-AP sample can then be compared to that of a control samples) of a known concentration of (3-AP, similarly contacted with the modulator and the results can be used as an indication of whether a subject is susceptible to or has a disorder associated with p-amyloidosis. Moreover, ~-AP can be detected by detecting a modulating gmup 'incorporated into the modulator. For example, modulators incorporating a biotin compound as described herein (e.g., an amino-terminally biotinylated ~i-AP peptide) can be detected using a streptavidin or avidin probe which is labeled with a detectable substance (e.g., an enzyme, such as peroxidase).
Detection of natural ~i-AP aggregates mixed with a modulator of the invention using a probe that binds to the modulating group (e.g., biotinlstreptavidin) is described further in Example 2.
In another embodiment, a modulator compound of the invention is used in vivo to detect, and, if desired, quantitate, natural ~i-AP deposition in a subject, for example to aid in the diagnosis of p amyloidosis in the subject. To aid in detection, the modulator compound can be modified with a detectable substance, preferably '~"Tc or radioactive iodine (described further above), which can be detected in vivo in a subject. The labeled ~i-amyloid modulator compound is administered to the subject and, after sufficient time to allow accumulation of the modulator at sites of amyloid deposition, the labeled modulator compound is detected by standard imaging techniques. The radioactive signal generated by the labeled compound can be directly detected (e.g.. whole body counting). or alternatively, the radioactive signal can be converted into an image on an autoradiograph or on a computer screen to allow for imaging of amyloid deposits in the subject. Methods for imaging amyloidosis using radiolabeled proteins are known in the art. For example, serum amyloid P
component (SAP), radioIabeled with either 1~I or ~Te, has been used to image systemic amyloidosis (see e.g., Hawkins, P.N. and Pepys, M.B. (1995) Eur. J. Nucl. Med.
:595-599).
Of the various isotypes of radioactive iodine, preferably 1'-'I (half life =
13.2 hours) is used for whole body scintigraphy, 1241 (half life = 4 days) is used for positron emission tomography (PET). 1'-SI (half life = 60 days) is used for metabolic turnover studies and I3~I
(half life = 8 days) is used for whole body counting and delayed low resolution imaging studies. Analogous to studies using radiolabeled SAP, a labeled modulator compound of the invention can be delivered to a subject by an appropriate route (e.g., intravenously, intraspinally, intracerebrally) in a single bolus, for example containing 100 ~.g of labeled compound carrying approximately 180 MBq of radioactivity.
The invention provides a method for detecting the presence or absence of natural ~i-arnyloid peptides in a biological sample, comprising contacting a biological sample with a compound of the invention and detecting the compound bound to natural /3-amyloid peptides to thereby detect the presence or absence of natural ~i-amyloid peptides in the biological sample. In one embodiment, the ~i-amyloid modulator compound and the biological sample are contacted in vitro. In another embodiment, the ~i-amyloid modulator compound is contacted with the biological sample by administering the ~-amyloid modulator compound to a subject. For in vivo administration, preferably the compound is labeled with radioactive technetium or radioactive iodine.
The invention also provides a method for detecting natural (3-amyloid peptides to facilitate diagnosis of a ~i-amyloidogenic disease. comprising contacting a biological sample with the compound of the invention and det3a~nng the compound bound to natural ~i-amyloid peptides to facilitate diagnosis of a ~-amyloidogenic disease. In one embodiment, the ~i-amyloid modulator compound and the biological sample are contacted in vitro.
In another embodiment, the p-amyloid modulator compound is contacted with the biological sample by administering the (3-amyloid modulator compound to a subject. For in vivo administration, preferably the compound is labeled with radioactive technetium or radioactive iodine.
Preferably, use of the method facilitates diagnosis of Alzheimer's disease.
In another embodiment, the invention provides a method for altering natural ~i-AP
aggregation or inhibiting ~i-AP neurotoxiciry, which can be used prophylactically or therapeutically in the treatment or prevention of disorders associated with (3 amyloidosis, e.g., Alzheimer's Disease. As demonstrated in Example 10, modulator compounds of the invention reduce the toxicity of natural ~3-AP aggregates to cultured neuronal cells.
Moreover. the modulators not only reduce the formation of neurotoxic aggregates but also have the ability to reduce the neurotoxiciry of preformed A~i fibrils.
Accordingly, the modulator compounds of the invention can be used to inhibit or prevent the formation of neurotoxic A(3 fibrils in subjects (e.g., prophylactically in a subject predisposed to ~i-amyloid deposition) and can be used to reverse (3-amyloidosis therapeutically in subjects already exhibiting ~i-amyloid deposition.
A modulator of the invention is contacted with natural ~i amyloid peptides present in a subject (e.g., in the cerebrospinal fluid or cerebrum of the subject) to thereby alter the aggregation of the natural (3-AP and/or inhibit the neurotoxicity of the natural (3-APs. A
modulator compound alone can be administered to the subject. or alternatively, the modulator compound can be administered in combination with other therapeutically active agents (e.g., as discussed above in subsection IV). When combination therapy is employed, the therapeutic agents can be coadministered in a single pharmaceutical composition, coadministered in separate pharmaceutical compositions or administered sequentially.
The modulator may be administered to a subject by any suitable route effective for inhibiting natural ~i-AP aggregation in the subject, although in a particularly preferred embodiment, the modulator is administered parenterally, most preferably to the central nervous system of the subject. Possible routes of CNS administration include intraspinal administration and intracerebral administration (e.g., intracerebrovascular administration).
Alternatively, the compound can be administered, for example, orally, intraperitoneally, intravenously or intramuscularly. For non-CNS administration routes, the compound can be administered in a formulation which allows for transport across the BBB.
Certain modulators may be transported across the BBB without any additional further modification whereas others may need further modification as described above in subsection IV.
Suitable modes and devices for delivery of therapeutic compounds to the CNS of a subject are known in the art, including cerebrovascular reservoirs (e.g., Ommaya or Rikker reservoirs; see e.g., Raney, J.P. et al. (1988) J. Neurosci. Nurs. ?Q:23-29;
Sundaresan, N. et al. (1989) Oncology x:15-22), catbeters for inzrathxal delivery (e.g., Port-a-Cath, Y-cathet«a and the like; see e.g., Plummer, J.L. (1991) Pain 44:215-220; Yaksh, T.L. et al. (1986) Pharmacol. Biochem. Behav. ,x:483-485), injectable intrathecal reservoirs (e.g., Spinalgesic;
see e.g., Brazenor, G.A. (1987) Neurosurgery x:484-491 ), implantable infusion pump 5 systems (e.g., Infusaid; see e.g:, Zierski, J. et al. ( 1988) Acta Neurochem. Suppl. 43:94-99;
Kanoff, R.B. (1994) J. Am. Osteopath. Assoc. 94:487-493) and osmotic pumps (sold by Alza Corporation). A particularly preferred mode of administration is via an implantable, extemal~y programmable infusion pump. Suitable infusion pump systems and reservoir .
systems are also described in U.S. Patent No. 5, 368,562 by Blomquist and U.S.
Patent No.
10 4,731.058 by Doan, developed by Pharmacia Deltec Inc.
The method of the invention for altering ~i-AP aggregation in vivo , and in particular for inhibiting (3-AP aggregation, can be used therapeutically in diseases associated with abnormal ~i amyloid aggregation and deposition to thereby slow the rate of ~i amyloid deposition and/or lessen the degree of (3 amyloid deposition. thereby ameliorating the course 15 of the disease. In a preferred embodiment. the method is used to treat Alzheimer's disease (e.g., sporadic or familial AD, including both individuals exhibiting symptoms of AD and individuals susceptible to familial AD). The method can also be used prophylactically or therapeutically to treat other clinical occurrences of ~i amyloid deposition.
such as in Down's syndrome individuals and in patients with hereditary cerebral hemorrhage with amyloidosis-20 Dutch-type (HCHWA-D). While inhibition of ~3-AP aggregation is a preferred therapeutic method. modulators that promote ~i-AP aggregation may also be useful therapeutically by allowing for the sequestration of (3-AP at sites that do not lead to neurological impairment.
Additionally. abnormal accumulation of ~3-amyloid precursor protein in muscle fibers has been implicated in the pathology of sporadic inclusion body myositis (IBM) (Askana. V.
25 et al. (1996) Proc. NatL Acad Sci. USA 93:1314-1319: Askanas. V. et al.
(1995) Current Opinion in Rhewnatology 7:486-496). Accordingly, the modulators of the invention can be used prophylactically or therapeutically in the treatment of disorders in which ~i-AP. or APP.
is abnormally deposited at non neurological locations, such as treatment of IBM by delivery of the modulators to muscle fibers.
VII. Unmodified A~3 Peptides that Iryibit Ag,Qregation of Natural Q-AP
In addition to. the ~i-amyloid modulators described hereinbefore in which an A(3 peptide is coupled to a modifying group. the invention also provides ~i-amyloid modulators comprised of an unmodified A(3 peptide. It has now been discovered that certain portions of natural (3-AP can alter aggregation of natural j3-APs when contacted with the natural ~i-APs (see Example 12). Accordingly, these unmodified A~i peptides comprise a portion of the natural ~3-AP sequence (i.e., a portion of (3AP~_3g, ~3AP1-40~ ~W-4? ~d ~~'~-43). In particular these unmodified A(3 peptides have at Ieast one amino acid deletion compared to ~~1-39~ ~e ~ortest natural (3-AP, such that the compound alters aggregation of natural.(3-amyloid peptides when contacted with the 4nat ral ~-amyloid peptides. In various embodiments, these unmodified peptide compounds can promote aggregation of natural ~i-amyloid peptides, or, more preferably, can inhibit aggregation of natural ~i-amyl'oid peptides when contacted with the natural (3-amyloid peptides. Even more preferably, the unmodified peptide compound inhibits aggregation of natural ~i-amyloid peptides when contacted with a molar excess amount of natural ~i-amyloid peptides (e.g., a 10-fold, 33-fold or 100-fold molar excess amount of natural ~i-AP).
As discussed above, the unmodified peptide compounds of the invention comprise an amino acid sequence having at least one amino acid deletion compared to the amino acid sequence of (3AP~.3g. Alternatively, the unmodified peptide compound can have at least five, ten, fifteen. twenty, twenty-five, thirty or thirty-five amino acids deleted compared to (~AP1-39~ StilI further the unmodified peptide compound can have 1-~. 1-10, 1-15. I-20, I-25, 1-30 or 1-3~ amino acids deleted compared to (3AP~_39~ The amino acid deletions) may occur at the amino-terminus. the carboxv-terminus. an internal site. or a combination thereof.
of the (3-AP sequence. Accordingly, in one embodiment. an unmodified peptide compound of the invention comprises an amino acid sequence which has at least one internal amino acid deleted compared to ~3AP ~ _;g. Alternatively. the unmodified peptide compound can have at Least five. ten, fi$een, twenty, twenty-five, thirty or thirty-five internal amino acids deleted compared to (3AP~_~g. Still further the unmodified peptide compound can have 1-5, I-10, 1-IS, 1-20, 1-25. 1-30 or 1-35 internal amino acids deleted compared to (3AP~_39~ For peptides with internal deletions, preferably the peptide has an amino terminus corresponding to amino acid residue 1 of natural (3AP and a carboxy terminus corresponding to residue 40 of natural ~iAP and has one or more internal (3-AP amino acid residues deleted (i.e.. a non-contiguous A~ peptide).
In another embodiment. the unmodified peptide compound comprises an amino acid sequence which has at least one N-terminal amino acid deleted compared to (3AP~_39.
Alternatively, the unmodified peptide compound can have at least five, ten, fifteen. twenty, twenty-five. thirty or thirty-five N-terminal amino acids deleted compared to ~3AP~_39. Still further the unmodified peptide compound can have 1-5, 1-10, 1-I~, 1-20. 1-25.
1-30 or 1-35 N-terminal amino acids deleted compared to ~AP~_39~
In yet another embodiment, the unmodified peptide compound comprises an amino acid sequence which has at least one C-terminal amino acid deleted compared to ~iAP 1 _39.
Alternatively, the unmodified peptide compound can have at least five, ten, fifteen. twenty, twenty-five, thim or thirty-five C-terminal amino acids deleted compared to ~iAP~_;g. Still further the unmodified peptide compound can have 1-S, 1-10,' I-15. 1-20, I-25, 1-30 or 1-35 C-terminal amino acids deleted compared to ~iAP~_39~
In addition to deletion of amino acids as compared to ~iAP 1 _39, the peptide compound can have additional non-~i-AP amino acid residues added to it, for example, at the amino terminus, the carboxy-terminus or at an internal site. In one embodiment, the peptide compound has at least one non-/3-amyloid peptide-derived amino acid at iu N-terminus.
Alternatively, the compound can have, for example, 1-3, 1-5, 1-7, I-10, 1-IS
or I-20 non-~-amyloid peptide-derived amino acid at its N-terminus. In another embodiment, the peptide compound has at least one non-~i-amyloid peptide-derived amino acid at iu C-terminus.
Alternatively, the compound can have, for example, I-3, 1-5, 1-7, I-10, 1-16 or 1-20 non-U-amyloid peptide-derived amino acid at its C-terminus.
In specific preferred embodiments,, an unmodified peptide compound of the invention comprises A(3~2p (the amino acid sequence of which is shown in SEQ ID NO: 4), A~i ~ X30 (the amino acid sequence of which is shown in SEQ ID NO: 14), Aril-20, 26-40 (tee ~o acid sequence of which is shown in SEQ ID NO: 15) or EE~HHHHQQ-~iAP~~o (the amino acid sequence of which is shown in SEQ ID NO: 16). In the nomenclature used herein= ~iAP1-2o, 26-4o represents /3AP~-4o in which the internal amino acid residues 21-25 have been deleted.
An unmodified peptide compound of the invention can be chemically synthesized using standard techniques such as those described in Bodansky, M. Principles of Peptide Synthesis. Springer Verlag, Berlin (1993) and Grant. G.A (ed.). Synthetic Peptides: A User's Guide, W.H. Freeman and Company, New York (1992). Automated peptide synthesizers are commercially available (e.g., Advanced ChemTech Model 396; MiIligen/ Biosearch 9600).
Alternatively, unmodified peptide compounds can be prepared according to standard recombinant DNA techniques using a nucleic acid molecule encoding the peptide.
A
nucleotide sequence encoding the peptide can be determined using the genetic code and an oligonucleotide molecule having this nucleotide sequence can be synthesized by standard DNA synthesis methods (e.g., using an automated DNA synthesizer).
Alternatively. a DNA
molecule encoding an unmodified peptide compound can be derived from the natural (3-amyloid precursor protein gene or cDNA (e.g.. using the polvmerase chain reaction and/or restriction enzyme digestion) according to standard molecular biology techniques.
Accordingly. the invention further provides an isolated nucleic acid molecule comprising a nucleotide sequence encoding a /3-amyloid peptide compound, the ~i-amyloid peptide compound comprising an amino acid sequence having at least one amino acid deletion compared to [3AP~-3g such that the p-amyloid peptide compound alters aggregation of natural ~i-amyloid peptides when contacted with the natural ~-amyloid peptides. As used herein. the term "nucleic acid molecule" is intended to include DNA molecules and RNA
molecules and may be single-stranded or double-stranded, but preferably is double-stranded DNA. The isolated nucleic acid encodes a peptide wherein one or more amino acids are deleted from the N-terminus, C-terminus and/or an internal site of ~iAPI_39, as discussed above. In yet other embodiments, the isolated nucleic acid encodes a peptide compound having one or more amino acids deleted compared to ~iAP~-39 and further having at least one non-/3-AP derived amino acid residue added to it, for example, at the amino terminus, the carboxy-terminus or at an internal site. In specific preferred embodiments, an isolated nucleic acid molecule of the invention encodes ~AP6-2o, (3AP 16.3p, SAP ~-20, 26-~0 or EEWHHHFiQQ-~3AP 16-ao~
To facilitate expression of a peptide compound in a host cell by standard recombinant DNA techniques, the isolated nucleic acid encoding the peptide is S incorporated into a recombinant expression vector. Accordingly, the invention also provides recombinant expression vectors comprising the nucleic acid molecules of the invention. As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting anothernucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded DNA loop into which additional DNA segments may be Iigated. Another type of vector is a viral vector, wherein ' additional DNA segments may be Iigated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
Other vectors (e.g., non-episomal mammalian vectors) are inteerated into the genome of a host cell upon introduction into the host cell. and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" or simply "expression vectors". In general. expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" may be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors. such as viral vectors, which serve equivalent functions.
In the recombinant expression vectors of the invention. the nucleotide sequence encoding the peptide compound are operatively linked to one or more regulatory sequences.
selected on the basis of the host cells to be used for expression. The term "operably linked"
is intended to mean that the sequences encoding the peptide compound are linked to the regulatory sequences) in a manner that allows for expression of the peptide compound. The term "regulatory sequence" is intended to includes promoters, enhancers and other expression control elements (e.g., .polyadenylation signals}. Such regulatory sequences are described, for example, in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press. San Diego, CA (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell, those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences) and those that direct expression in a regulatable manner (e.g., only in the presence of an inducing agent). It will be appreciated by those skilled in the art that the design of the expression vector may depend on such factors as the choice of the host cell to be transformed, the level of expression of peptide compound desired, etc. The expression vectors of the invention can be introduced into host cells thereby to produce peptide compounds encoded by nucleic acids as described herein.
The recombinant expression vectors of the invention can be designed for expression of peptide compounds in prokaryotic or eukaryotic cells. For example, peptide compounds can be expressed in bacterial cells such as E. coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology~85, Academic Press, San Diego, CA
( 1990). Alternatively, the recombinant expression vector may be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase. Examples of vectors for expression in yeast S. cerivisae include pYepSecl (Baldari et aL, (1987) EMBOJ. 6:229-234), pMFa (Kurjan and Herskowitz, (1982) Cell 30:933-943), pJRY88 (Schultz et al., (1987) Gene 54:113-123), and pYES2 (Invitrogen Corporation, San Diego, CA). Baculovirus vectors available for expression of proteins or peptides in cultured insect cells (e.g., Sf 9 cells) include the pAc series (Smith et al., (1983) Mol.
Cell. Biol. 3_:2156-2165) and the pVL series (Lucklow. V.A., and Summers, M.D., (1989) Virology 170:31-39).
Examples of mammalian expression vectors include pCDM8 (Seed. B.. (1987) Nature 329:840) and pMT2PC (Kaufman et al. (1987). EMBO J. 6_:187-19~). When used in mammalian cells. the expression vector's control functions are often provided by viral regulatory elements. For example. commonly used promoters are derived from polyoma, Adenovirus 2, cytomegalovirus and Simian Virus 40.
In addition to the regulatory control sequences discussed above. the recombinant expression vector may contain additional nucleotide sequences. For example, the recombinant expression vector may encode a selectable marker gene to identify host cells that have incorporated the vector. Such selectable marker genes are well known in the art.
Moreover. the facilitate secretion of the peptide compound from a host cell.
in particular mammalian host cells. the recombinant expression vector preferably encodes a signal sequence operatively linked to sequences encoding the amino-terminus of the peptide compound such that upon expression. the peptide compound is synthesized with the signal sequence fused to its amino terminus. This signal sequence directs the peptide compound into the secretory pathway of the cell and is then cleaved. allowing for release of the mature peptide compound (i.e., the peptide compound without the signal sequence) from the host cell. Use of a signal sequence to facilitate secretion of proteins or peptides from mammalian host cells is well known in the art.
A recombinant expression vector comprising a nucleic acid encoding a peptide compound that alters aggregation of natural ~i-AP can be introduced into a host cell to thereby produce the peptide compound in the host cell. Accordingly, the invention also provides host cells containing the recombinant expression vectors of the invention. The terms "host cell" and "recombinant host cell" are used interchangeably herein.
It is understood that such terms refer not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be iden~cal to the parent cell, but are still included within the scope of the term as used herein. A host cell may be any prokaryotic or eukaryotic cell. For example, a peptide compound may be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells. Preferably, the peptide compound is expressed in mammalian cells. In a 5 preferred embodiment, the peptide compound is expressed in mammalian cells in vivo in a mammalian subject to treat amyloidosis in the subject through gene therapy (discussed further below). Preferably, the ~i-amyloid peptide compound encoded by the recombinant expression vector issecreted from the host cell upon being expressed in the host cell.
Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional 10 transformation or transfection techniques. As used herein, the terms "transformation" and "transfection" are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, electroporation, microinjection and viral-mediated transfection. Suitable methods for transforming or 15 transfecting host cells can be found in Sambrook et al. (Molecular Cloning:
.4 Laboratory Manual. ?nd Edition, Cold Spring Harbor Laboratory press ( 1989)), and other laboratory manuals. Methods for introducing DNA into mammalian cells in vivo are also known in the art and can be used to deliver the vector DNA to a. subject for gene therapy purposes (discussed further below).
20 For stable transfection of mammalian cells. it is known that, depending upon the expression vector and transfection technique used. only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Preferred selectable markers include those that 25 confer resistance to drugs. such as 6418, hygromycin and methotrexate.
Nucleic acid encoding a selectable marker may be introduced into a host cell on the same vector as that encoring the peptide compound or may be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
30 A nucleic acid of the invention can be delivered to cells in vivo using methods known in the art, such as direct injection of DNA, receptor-mediated DNA uptake or viral-mediated transfeetion. Direct injection has been used to introduce naked DNA into cells in vivo (sec e.g., Acsadi et al. (1991) Nature 332: 815-818; Wolffet al. (1990) Science 247:1465-1468).
A delivery apparatus (e.g., a "gene gun") for injecting DNA into cells in vivo can be used.
35 Such an apparatus is commercially available (e.g., from BioRad). Naked DNA
can also be introduced into cells by complexing the DNA to a canon, such as polylysine, which is coupled to a ligand for a cell-surface receptor (see for example Wu, G. and Wu, C.H. (1988) J. Biol. Chem. 263:14621: Wilson et al. (1992) J. Biol. Chem. 267:963-967; and U.S. Patent No. 5.166320). Binding of the DNA-ligand complex to the receptor facilitates uptake of the DNA by receptor-mediated endocytosis. Additionally, a DNA-ligand complex linked to adenovirus capsids which naturally disrupt endosomes, thereby releasing material into the cytoplasm can be used to avoid degradation of the complex by intracellular lysosomes (see for example Curiel et al. ( 1991 ) Proc. Natl. Acad. Sci. USA 88:8850;
Cristiano et al.
(1993) Proc. Natl. Acad. Sci. USA 90:2122-2126).
Defective retroviruses are well characterized for use in gene transfer for gene therapy purposes (for a review see Miller, A.D. (1990) Blood 76:2?1). Protocols for producing recombinant retroviruses and for infecting cells in vitro or in vivo with such viruses can be found in Current Prst~cols in Molecular BioloQ:v, Ausubel, F.M. et al. (eds.) Green Publishing Associates, (1989), Sections 9.10-9.14 and other standard laboratory manuals.
Examples of suitable retroviruses include pLJ, pZIP, pWE and pEM which are well known to those skilled in the art. Examples of suitable packaging virus lines include yrCrip, yrCre, yr2 and yrAm. Retroviruses have been used to introduce a variety of genes into many different cell types, including epithelial cells, endothelial cells, lymphocytes, myoblasts, hepatocytes, bone marrow cells, in vitro and/or in vivo (see for example Eglitis, et al.
(1985) Science 230:1395-1398; Danos and Mulligan (1988) Proc. Natl. Acad. Sci.
USA
85:6460-6464; Wilson et al. (1988) Proc. Natl. Acad. Sci. USA 85:3014-3018;
Armentano et al. (1990) Proc. Natl. Acad. Sci. USA 87:6141-6145; Huber et al. (1991) Proc. Natl.
Acad. Sci. USA 88:8039-8043; Ferry et al. (1991) Proc. Natl. Acad. Sci. USA
88:8377-8381; Chowdhury et al. (1991) Science 254:1802-1805; van Beusechem et al.
(1992) Proc. Natl. Acad. Sci. USA 89:7640-7644; Kay et al. (1992) Human Gene Therapy 3:641-647; Dai et al. (1992) Proc. Natl. Acad Sci. USA 89:10892-10895; Hwu et al.
(1993) ,I.
Immunol. 150:4104-4115; U.S. Patent No. 4,868,116 by Morgan et al., issued on September 29'", 1989; U.S. Patent No. 4,980,286 by Morgan et al., issued on December 25",1990; PCT Application WO 89/07136 (PCT/US89/00422); PCT
Application WO 89/02468 (PCT/US88/03089); PCT Application WO 89/05345 (PCT/US88/04383); and PCT Application WO 92107573 (PCT/US91/08127)).
Alternatively, the genome of an adenovirus can be manipulated such that it encodes .
and expresses a peptide compound but is inactivated in terms of its ability to replicate in a normal lytic viral life cycle. See for example Berlrner et al. (1988) Bio Techniques 6:616;
Rosenfeld et al. (1991) Science 252:431-434; and Rosenfeld et al. (1992) Cell 68:143-155.
46a Suitable adenoviral vectors derived from the adenovirus strain Ad type 5 d1324 or other strains of adenovirus (e.g., Ad2, Ad3, Ad7 etc.) are well known to those skilled in the art.
Recombinant adenoviruses are advantageous in that they do not require dividing cells to be effective gene delivery vehicles and can be used to infect a wide variety of cell types, S including airway epithelium (Rosenfeld et. aL (1992) cited supra), endothelial cells (Lemarchand et al. ( 1992) Proc. Natl. Acad Sci. USA 89:6482-6486), hepatocytes (Herz and Gerard (1993) Proc. Natl. Acad. Sci. USA 90:2812-2816) and muscle cells (Quantin et al. (1992) Proc. Natl. Acad. Sci USA 89:2581-2584). Additionally, introduced adenoviral DNA (and foreign DNA contained therein) is not integrated into the genome of a host cell but remains episomal, thereby avoiding potential problems that can occur as a result of insertional mutagenesis in situations where introduced DNA becomes integrated iato the host genome (e.g., retroviral DNA).
Adeno-associated virus (AAV) can also be used for delivery of DNA for gene therapy purposes. AAV is a naturally occurring defective virus that requires another virus, such as an adenovirus or a herpes virus, as a helper virus for efficient replication and a productive life cycle. (For a review see Muzyczka et al. Curr. Topics in Micro. and Immunol.
(1992) 158:97-129). It is also one of the few viruses that may integrate its DNA into non-dividing cells, and exhibits ~ high frequency of stable integration (see for example Flotte et al. ( 1992}
Am. J. Respir. Cell. Mol. Biol. 7:349-356; Samulski et al. (1989) .l. 1%irol.
63:3822-3828; and MeLaughlin et al. (1989) J. Yirol. 62:1963-1973). Vectors containing as little as 300 base pairs of AAV can be packaged and can integrate. An AAV vector such as that described in Tratschin et al. (1985) Mol. Cell. Biol. 5:325I-3260 can be used to introduce DNA into cells.
A variety of nucleic acids have been introduced into different cell types using AAV vectors (see for example Hermonat et al. (1984) Proc. Natl. Acad Sci. USA 81:6466-6~170; Tratschin et al. (1985) Mol. Cell. Biol. 4:2072-2081: Wondisford et al. (1988) Mol.
Endocrinol. 2:32 39; Tratschin et al. (1984) J. ~iroL 51:611-619; and Flotte et al. (1993) J.
Biol. Chem.
268:3781-3790}.
The invention provides a method for treating a subject for a disorder associated with ø-amyloidosis. comprising administering to the subject a recombinant expression vector encoding a ø-amyloid peptide compound, the compound comprising an amino acid sequence having at least one amino acid deletion compared to øAP~ ;g, such that the ø-amyloid peptide compound is synthesized in the subject and the subject is treated for a disorder associated with ø-amyloidosis. Preferably, the disorder is Alzheimer's disease. In one embodiment the recombinant expression vector directs expression of the peptide compound in neuronal cells. In another embodiment. the recombinant expression vector directs expression of the peptide compound in glial cells. In yet another embodiment, the recombinant expression vector directs expression of the peptide compound in fibroblast cells.
General methods for gene therapy. are known in the art. See for example, U.S.
Patent No. 5,399,346 by Anderson et al. A biocompatible capsule for delivering genetic material is described in PCT Publication WO 95/05452 by Baetge et al. Methods for grafting genetically modified cells to mat central nervous system disorders are described in U.S.
Patent No. 5,082,670 and in PCT Publications WO 90/06757 and WO 93/10234, all by Gage et al. Isolation and/or genetic modification of multipotent neural stem cells or neuro-derived fetal cells are described in PCT Publications WO 94/02593 by Anderson et al., by Weiss et al., and WO 94/23754 by Major et al. Fibroblasts transduced with genetic material are described in PCT Publication WO 89/02468 by Mulligan et aL
Adenovirus vectors for transfering genetic material into cells of the central nervous system are described in PCT Publication WO 94/08026 by Kahn et al. Herpes simplex virus vectors suitable for treating neural disorders are described in PCT Publications WO 94104695 by Kaplitt and WO
90/09441 by-Geller et al. Promoter elements of the filial fibrillary acidic protein that cxn confer astrocyte specific expression on a linked gene or gene fragment, and which thus can be used for expression of Aø peptides specifically in ast<ocytes, is described in PCT Publication WO 93!07280 by Brenner et al. Furthermore, alternative to expression of an Aø
peptide to modulate amyloidosis, an antisense oligonucleotide that is complementary to a region of the ø-amyloid precursor protein mRNA corresponding to the peptides described herein can be e~cpressed in a subject to modulate amyloidosis. General methods for expressing antisense oligonu~leotides to modulate nervous system disorders are described in PCT
Publication WO
95!09236.
Alternative to delivery by gene therapy, a peptide compound of the invention comprising an amino acid sequence having at least one amino acid deletion compared to øAP~.3g can be delivered to a subject by directly administering the peptide compound to the subject as described further herein for the modified peptide compounds of the invention. The peptide compound can be formulated into a pharmaceutical composition comprising a therapeutically effective amount of the ø-amyloid peptide compound and a pharmaceutically acceptable carrier. The peptide compound can be contacted with natural ø-amyloid peptides with a ø-amyloid peptide compound such that aggregation of the natural ø-amyloid peptides is inhibited. Moreover, the peptide compound can be administered to the subject in a therapeutically effective amount such that the subject is treated for a disorder associated with ø-amyloidosis, such as Alzheimer's disease.
VIII. Qther Embodiments Although the invention has been illustrated hereinbefore with regard to Aø
peptide compounds, the principles described. involving attachment of a modifying groups) to a peptide compound. are applicable to any arnyloidogenic protein or peptide as a means to create a modulator compound that modulates. and preferably inhibits. amyloid aggregation.
Accordingly, the invention provides modulator compounds that can be used to treat amyloidosis is a variety of forms and clinical settings.
Amyloidosis is a general term used to describe pathological conditions characterized by the presence of amyloid. Amyloid is a general term referring to a group of diverse but specific extracellular protein deposits which are seen in a number of different diseases.
Though diverse in their occurrence. all amyloid deposits have common morphologic properties, stain with specific dyes (e.g., Congo red), and have a characteristic red-green birefringent appearance in polarized light after staining. They also share common ultrastructural features and common x-ray diffraction and infrared spectra.
Amyloidosis can be classified clinically as primary, secondary, familial andlor isolated.
Primary amyloid appears de »ovo without any preceding disorder. Secondary amyloid is that form which appears as a complication of a previously existing disorder. Familial amyloid is a genetically inherited form found in particular geographic populations. Isolated forms of amyloid are those that tend to involve a single organ system.
Different amyloids are characterized by the type of pmtein(s) or peptides) present in the deposit. For example, as described hereinbefore, amyloid deposits associated with Alzheimer's disease comprise the (3-amyloid peptide and thus a modulator compound of the invention for detecting and/or treating Alzheimer's disease is designed based on modification of the ~i-arnyloid peptide. The identities of the proteins) or peptides) present in amyloid deposits associatedwith a number of other amyloidogenic diseases have been elucidated. ' Accordingly, modulator compounds for use in the detection andlor treatment of these other amyloidogenic diseases can be prepared in a similar fashion to that described herein for ~i-AP-derived modulators. In vitro assay systems can be established using an amyloidogenic protein or peptide which forms fibrils in vitro, analogous to the A~i assays described herein.
Modulators can be identified using such assay systems, based on the ability of the modulator to disrupt the ~i-sheet structure of the fibrils. Initially, an entire amyloidogenic pmtein can be modified or. more preferably, a peptide fragment thereof that is known to form fibrils in vitro can be modified (e.g., analogous to Aril-40 described herein). Amino acid deletion and substitution analyses can then be performed on the modified protein or peptide (analogous to the studies described in the Examples) to delineate an aggregation core domain that is suffcient, when modified. to disrupt fibril formation.
Non-limiting examples of amyloidogenic proteins or peptides, and their associated amyloidogenic disorders. include:
Transthvretin (TTR) - Amyloids containing transthyretin occur in familial amyloid polyneuropathy (Portuguese. Japanese and Swedish types), familial amyloid cardiomyopathy (Danish type). isolated cardiac amyloid and systennic senile amyloidosis.
Peptide fragments 2~ of transthvretin have been shown to form amyloid fibrils in vitro. For example. TTR 10-20 and TTR 105-11 ~ form amyloid-like fibrils in 20-30% acetonitrile/water at room temperature (Jarvis, J.A., et al.(I994) Int. J. Pept. Protein Res. 44:388-398). Moreover, familial cardiomyopathy !Danish type) is associated with mutation of Leu at position 111 to Met. and an analogue of TTR 105-l la in which the wildtype Leu at position 111 has been substituted with Met (TTR 10~-115Met111 ) also forms amyloid-like fibrils in vitro (see e.g., Hermansen, L.F., et al. (1995) Eur. J. Biochem. 227:772-779; Jarvis et al.
supra). Peptide firagrnents .of TTR that form amyloid fibrils in vitro are also described in Jarvis, J.A., et al.
( 1993 ) Biochem. Biophys. Res. Commun. 192:991-998 and Gustavsson, A., et al.
( 1991 ) Biochem. Biophys. Res. Commu». 17 :1159-1104. A peptide fragment of wildtype or .
mutated transthyretin that forms amyloid fibrils can be modified as described herein to create a modulator of amvloidosis that can be used in the detection or treatment of familial amyloid polyneuropathy (Portuguese. Japanese and Swedish types), familial amyloid cardiomyopathy (Danish type). isolated cardiac amyloid or systemic senile amyloidosis.
S
dip (PrP) - Amyloids in a number of spongiform encxphslopathies, including scrapie in sheep, bovine spongiform encephalopathy in cows and Creutzfeldt-Jakob disease (CJ) and Gerstrnann-Straussler-Scheinker syndrome (GSS) in himzans, contain PrP.
Limited proteolysis of PrPSc (the prion protein associated with scrapie) leads to a 27-30 kDa fragment (PrP27-30) that polymerizes into rod-shaped amyloids (see e.g., Pan, K.M., et al.
(1993) Proc. Natl. Acad Sci. USA 9:10962-10966; Gusset, M., et al. (1993) Proc. Natl.
Acad Sci. USA 90:1-5). Peptide fragments of PrP from humans and other mammals have been shown to form amyloid fibrils in vitro. For example, polypeptides corresponding to sequences encoded by normal and mutant alleles of the PRNP gene (encoding the precursor of the prion protein involved in CJ), in the regions of codon 178 and codon 200, spontaneously form amyloid fibrils in vitro (see e.g., Goldfarb, L.G., et al.
(1993) Proc. Natl.
Acad Sci. USA X0_:4451-4454). A peptide encompassing residues 106-126 of human PrP has been reported to form straight fibrils similar to those extracted from GSS
brains, whereas a peptide encompassing residues 127-147 of human PrP has been reported to form twisted fibrils resembling scrapie-associated fibrils (Tagliavini. F.. et al. ( 1993) Proc. Natl. Acad Sci. USA 90:9678-9682). Peptides of Syrian hamster PrP encompassing residues 109-122, 113-127,113-120, 178-191 or 202-218 have been reported to form amyloid fibrils, with the most amyloidogenic peptide being Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala (SEQ ID NO:
17), which corresponds to residues 113-120 of Syrian hamster PrP but which is also conserved in PrP from other species (Gusset, M., et al. (1992) Proc. Natl. Acad Sci. USA
89:10940-10944). A peptide fragment of PrP that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of scrapie. bovine spongiform encephalopathy, Creutzfeldt-Jakob disease or Gerstmann-Straussler-Scheinker syndrome.
I,~let Amvioid Polvge tp ide (IAPP. also known as amylin) - Amyloids containing IAPP
occur in adult onset diabetes and insuIinoma. IAPP is a 37 amino acid polypeptide formed from an 89 amino acid precursor protein (see e.g., Betsholtz. C., et al.
(1989) Exp. Cell. Res.
,3:484-493; V~%estermark, P., et al. (1987) Proc. Natl. Acad. Sci. USA ~4-:3881-3885). A
peptide corresponding to IAPP residues 20-29 has been reported to form amyloid-Iike fibrils in vitro, with residues 25-29, having the sequence Ala-Ile-Leu-Ser-Ser (SEQ ID
N0: 18), being strongly amyloidogenic (Westetmark, P., et al. (1990) Proe. Natl. Acad Sci. USA
X7:5036-5040; Glenner, G.G., et al. (1988) Biochem. Biophys. Res. Common.
X55:608-614).
A peptide fragment of IAPP that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of adult onset diabetes or insulinoma.
Atrial Natriuretic Factor (ANF) - Amyloids containing ANF are associated with isolated atrial amyloid (see e.g., Johansson, B., et al. (198'7) Biochem.
Biophys. Res.
Com~nun. x:1087-1092). ANF corresponds to amino acid residues 99-126 (proANF99-126) ofthe ANF prohormone (proANPl-126) (Pucci, A., et al. (1991) J. Pathol.
165:235-241 ). ANF, er a fiagment thereof,, that forms ~yloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of isolated atrial amyloid.
KaBoa ~r Lambda Light - Amyloids containing kappa or lambda light chains are associated idiopathic (primary) amyloidosis, myeloma or macroglobulinemia-associated amyloidosis, and primary localized cutaneous nodular amyloidosis associated with Sjogren's syndrome. The structure of amyloidogenic kappa and lambda light chains, including amino acid sequence analygis, has been characterized (see e.g., Buxbaum, J.N., et al. (1990) Ann.
Intern. Med _1:455-464; Sehormann, N., et al. (1995) Proc. Natl. Aead Sei. USA
92:9490-9494; Hurle, M.R., et al. (1994) Proc. Natl. Acad Sci. USA X1_:5446-5450;
Liepnieks, J.J., et al. (1990) Mol. Immunol. 27:481-485; Gertz, M.A., et al. (1985) Scand J.
Immunol. 2:245-250; Inazumi, .T., et al. (1994) Dermatology 18Q:125-128). Kappa or lambda light chains, or a peptide fragment thereof that forms amyloid fibrils, can be modified as descriued herein to create a modulator of amyloidosis that can be used in the detection or treatmem of idiopathic (primary) amyloidosis, myeloma or macroglobulinemia-associated amyloidosis or primary localized cutaneous nodular amyloidosis associated with Sjostren's syndrome.
Amvloid A - Amyloids containing the amyloid A protein (AA protein), derived from serum amyloid A, are associated with reactive (secondary) amyloidosis (see e.g., Liepnieks, J.J., et al. (1995) Biochim. Biophys. Acta x:81-86), familial Mediterranean Fever and familial amyloid nephropathy with urticaria and deafness (Muckle-Wells syndrome) (see e.g., Linke. R.P., et al. (1983) Lab. Invest. 48:698-704). Recombinant human serum amylvid A
forms amyloid-like fibrils in vitro (Yamada, T., et al. (1994) Biochim.
Biophys. Acta 1 6:323-329) and circular dichroism studies revealed a predominant ~i sheet/turn structure (McCubbin, W.D., et al. (1988) Biochem J. x,56:775-783). Serum amyloid A, amyloid A
protein or a fraatnent thereof that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of reactive (secondary) amyloidosis, familial Mediterranean Fever and familial amyloid nephropathy with urticaria and deafness (Muckle-Wells syndrome).
sta ' C - Amyloids containing a variant of cystatin C are associated with hereditary cerebral hemorrhage with amyIoidosis of Icelandic type. The disease is associated with a leucine to glycine mutation at position 68 and cystatin C containing this mutation aggregates in vitro (Abrahatrtson, M. and Grubb, A. (1994) Proc. Natl. Acad Sci. USA
Ql_:1416-1420). Cystatin C or a peptide fragment thereof that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of hereditary cerebral hemorrhage with amyloidosis of Icelandic type.
13 micrqglobulin - Amyloids containing X32 microglobulin (~i2M) are a major complication of long term hemodialysis (see e.g., Stein, G., et al. (1994) Nephrol. Dial.
Transplant. 9:48-50; Floege, J., et al. (1992) Kidney Int. Suppl. 38:S78-S85;
Maury, C.P.
(1990) Rheumatol. Int. 10:1-8). The native ~32M protein has been shown to fomn amyloid fibrils in vitae (Connors, L.H., et al. (1985) Biochem. Biophys. Res. Common.
131:1063-1068; Ono, K., et al. (1994) Nephron 66:404-407). ~i2~I, or a peptide fragment thereof that forms amyloid fibrils, can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of amyloidosis associated with long term hemodialysis.
Ap~lip~»rotein A-I (ApoA-I) - Amyloids containing variant forms of ApoA-I have been found in hereditary non-neuropathic systemic amyloidosis (familial amyloid polyneutopathy III). For example. N-tttminal fragments (residues 1-86,1-92 and 1-93) of an ApoA-I variant having a Trp to Arg mutation at position SD have been detected in amyloids (Booth, D.R., et al. ( I 995) QJM $$:695-702). In another family, a Ieucine to arginine mutation at position 60 was found (Soutar, A.K., et at. ( 1992) Proc. Natl.
Acad Sci. USA
89:7389-7393). ApoA-I or a peptide fragment thereof that fomns amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of hereditary non-neumpathic systemic amyloidosis.
1 ~ Ge oli - Amyloids containing variants of gelsolin are associated with familial amyloidosis of Finnish type. Synthetic gelsoIin peptides that have sequence homology to wildtvpe or mutant geIsolins and that form amyloid fibrils in vitro are reported in Maury, C.P. et al. (1994) Lab. Invest. 70:558-564. A nine residue segment surrounding residue 187 (which is mutated in familial gelsolin amyloidosis) was defined as an amyloidogenic region (Maury, et al., supra; see also Maury, C.P., et al. (1992) Biochem. Biophys.
Res. Common.
11:227-231: Maury, C.P. (1991) J. Clin. Invest. 87:I I95-1 I99). Gelsolin or a peptide fragment thereof that forms amyloid fibrils can be modified as described herein to create a modulator of amvloidosis that can be used in the detection or treatment of familial amyloidosis of Finnish type.
Procalcitonin or calcnto~,n - Amyloids containing procalcitonin. calcitonin or caleitonin-like immunoreactivity have been detected in amyloid fibrils associated with medullary carcinoma of the thymid (see e.g., Butler, M. and Khan, S. ( 1986) Arch. Pathol.
Lab. Med. 110:647-649; Sletten, K., et al. ( 1976) J. Exp. Med. 143:993-998).
Calcitonin has been shown to form a nonbranching fibrillar structure in vitro (Kedar, L, et al. ( 1976) Isr. J.
Med. Sei. 12:1137-1140). Procalcitonin. calcitonin or a fragment thereof that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of amyloidosis associated with medullary carcinoma of the thyroid.
Fibrinogen - Amyloids containing a variant form of fibrinogen alpha-chain have been found in hereditary renal amyloidosis. An arginine to Ieucine mutation at position 534 has been reported in amyloid fibril protein isolated from postmortem kidney of an affected individual (Benson. M.D., et al. (1993) Nature Genetics x:252-255). Fibrinogen alpha-chain or a peptide fragment thereof that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that cur be used in the detection or treatment of fibrinogen-associated hereditary renal amyloidosis.
vso a - Amyloids containing a variant form of lysozyme have been found in hereditary systemic amyloidosis. In one family the disease was associated with a threonine to isoleucine mutation at position ~6, whereas in another family the disease was associated with a histidine to aspartic acid mutation at position 67 (Pepys, M.B., et al.
(1993) Nature 362:53-5~7). Lysozyme or a peptide fragment thereof that forms amyloid fibrils can be modified as describFd herein to create a modulator of amyloidosis that can be used in the detection or treatment of lysozyme-associated hereditary systemic amyloidosis.
This invention is further illustrated by the following examples which should not be construed as limiting. A modulator's ability to alter the aggregation of (3-amyloid peptide in the assays described below are predictive of the modulator's ability to perform the same function in vivo.
1~
EXAMPLE 1: Construction of [3-Amyloid Modulators A ~i-amyloid modulator composed of an amino-terminally biotinylated (3-amyloid 20 peptide of the amino acid sequence:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGW
(positions 1 to 40 of SEQ ID NO: 1 ) was prepared by solid-phase peptide synthesis using an Na-9-fluorenylinethyloxycarbonyl (FMOC)-based protection strategy as follows.
Starting with 2.~ mmoles of FMOC-Val-Vliang resin. sequential additions of each amino acid wen 25 performed using a four-fold excess of protected amino acids.. l-hydroxybenzotriazole (HOBt) and diisopmpyl carbodiimide (DIC). Recouplings were performed when necessary as determined by ninhydrin testing of the resin after coupling. Each synthesis cycle was minimally described by a three minute deprotection (25 % piperidine/N-methyl-pyrrolidone (NMP)), a 1 ~ minute deprotection, five one minute NMP washes, a 60 minute coupling cycle, 30 five NMP washes and a ninhydrin test. To a 700 mg portion of the fully assembled peptidc-resin, biotin (obtained commercially from Molecular Probes, Ine.) was substituted. for an FMOC-amino acid was coupled by the above protocol. The peptide was removed from the resin by treatment with trifluoroacetic acid (TFA) (82.~ %), water (5 %), thioanisole (5 %), phenol (5 %). ethanedithiol (2.5 %) for two hours followed by precipitation of the peptide in 35 cold ether. The solid was pelleted by centrifugation (Z400 rpm x 10 min.), and the ether decanted. It was resuspended in ether, pelIeted and decanted a second time.
The solid. was dissolved in 10 % acetic acid and lyophilized to dryness to yield 230 mg of crude biotinylated peptide. 60 mg of the solid was dissolved in 25 % acetonitrile (ACN) /0.1 %
TFA and applied to a C 18 reversed phase high performance liquid chromatography (HPLC) column.
Biotinyl ~A~~.4p was eluted usiag a linar Sg adient of 30-45 %
acetonitrilel0.1 % TFA over 40 miautes. One primary fraction (4 mg) and several side fractions were isolated. The main fraction yielded a mass spectrum of 4556 (matrix-assisted laser desorption ionization -time of flight) which matches the theoretical (4555) for this peptide.
A p-amyloid modulator composed of an amino-terminally biotinylated [3-amyloid peptide of the amino acid sequence:
DAEFRHDSGYEVHHQ
(positiops 1 to 15 of SEQ ID NO: 1) was prepared on an Advanced ChemTech Model multiple peptide synthesizer using an automated protocol established by the manufacturer for 0.025 mrnole scale synthesis. Double couplings were performed on all cycles using 2-(1H-benzotriazol-1-y1r1,1,3,3-tetramethyluronium hexafluorophosphate (HBTU)/N,N-diisopropylethylamine (DIEA)/HOBt/FMOC-AA in four-fold excess for 30 minutes followed by DIC/HOBtlFMOC-AA in four-fold excess for 4~ minutes. The peptide was deprotected and removed from the resin by treatment with TFA/water (95 %/5 %) for three hours and precipitated with ether as described above. The pellet was resuspended in 10 %
acetic acid and lyophilized. The material was purified by a preparative HPLC using 15 %-40 acetonitrile over 80 minutes on a Vydac C18 column (21 x 250 mm). The main isolate eluted as a single symmetrical peak when analyzed by analytical HPLC and yielded the expected molecular weight when analyzed by electrospray mass spectrometry. Result =
2052.6 (2052 theoretical).
~-amyloid modulator compounds comprising other regions of the ~i-AP amino acid sequence (e.g.. an A~i aggregation core domain) were similarly prepared using the synthesis methods described above. Moreover, modulators comprising other amyloidogenic peptides can be similarly prepared.
EXAMPLE 2: Inhibition of p-Amyloid Aggregation by Modulators The ability of ~3-amyloid modulators to inhibit the aggregation of natural ~i-AP when combined with the natural (3-AP was examined in a series of aggregation assays. Natural (3-AP (~i-APl,.4p) was obtained commercially from Bachem (Torrance, CA). Amino-terminally biotinylated ~i-AP modulators were prepared as described in Example 1.
A. (optical Density Assay In one assay, (3-AP aggregation was measured by determining the increase in turbidity of a solution of natural /3-AP over time in the absence or presence of various concentrations of the modulator. Turbidity of the solution was quantitated by determining the optical density at 400 nm (AQpp ~,) of the solution over time.
The aggregation of natural (3-AP in the absence of modulator was determined as follows. (3-AP~-4o was dissolved in hexafluoro isopropanol (HFIP; Aldrieh Chemical Co., SS
Inc.) at 2 mglml. Aliquou of the HFIP solution (87 ~1) were transferred to individual 10 mm x 75 mm test tubes. A stream of argon gas was passed through each tube to evaporate the HFIP. To the resulting thin film of peptide, dimethylsulfoxide (DMSO; Aldrich Chemical Co., Inc.) (25 ~1) was added to dissolve the peptide. A 2 mm x 7 mmTeflon-coated magnetic stir bar was added to each tube. Buffer (475 pL of 100 mM NaCI, 10 mM sodium phosphate, pH 7.4) was added to the DMSO solution with stirring. The resulting mixture was stirred continuously and the optical density was monitored at 400 nm to observe the formation of insoluble peptide aggregates.
Alternatively, (3-AP~.,40 was dissolved in DMSO as described above at 1.6 mM (6.9 mg/ml) and aliquots (25 p1) were added to stirred buffer (475 ~1), followed by monitoring of absorbance at 400 nm.
For inhibition studies in which a ~3-amyloid modulator was dissolved in solution together with the natural (3-AP, the modulators were dissolved in DMSO either with or without prior dissolution in HFIP. These compounds were then added to buffer with stirring, followed by addition of ~i-AP ~ ~0 in DMSO. Alternatively. HFIP solutions of modulators were combined with ~i-AP ~ ~0 in HFIP followed by evaporation and redissolution of the mixture in DMSO. Buffer was then added to the DMSO solution to initiate the assay. The amino-terminally biotinylated ~3-amyloid peptide modulators N-biotinyl-~iAP
1~0, and N-biotinyl-(iAP 1 _ 15 were tested at concentrations of 1 % and 5 % in the natural ~i-AP ~ ~0 solution.
A representative example of the results is shown graphically in Figure 1, which depicts the inhibition of aggregation of natural ~i-AP ~ ~0 by N-biotinyl-~iAP
~ ~0. In the absence of the modulator. the optical density of the natural p-AP solution showed a characteristic sigmoidal curve. with a lag time prior to aggregation (approximately 3 hours in Figure 1 ) in which the A400 nm w~ low . followed by rapid increase in the A4o0 nm~ which quickly reached a plateau level. representing aggregation of the natural ~i amyloid peptides.
In contrast. in the presence of as little as 1 % of the N-biotinyl-(3AP1~0 modulator, aggregation of the natural [3 amyloid peptides was markedly inhibited, indicated by an increase in the lag time, a decrease in the slope of aggregation and a decrease in the plateau level reached for the turbidity of the solution (see Figure 1 ). N-biotinyl-~iAP t.40 at a concentration of 5 % similarly inhibited aggregation of the natural ~i amyloid peptide.
Furthermore, similar results were observed when N-biotinyl-~iAP 1 _ 15 ''Was used as the modulator. These results demonstrate that an N-terminally biotinylated [3-AP
modulator can effectively inhibit the aggregation of natural ~i amyloid peptides, even when the natural ~i amyloid peptides are present at as much as a 100-fold molar excess concentration.
B. Fluorescence Assav In a second assay, (3-AP aggregation was measured using a fluorometric assay essentially as described in Levine, H. (1993) Protein Science 2_:404-410. In this assay, the dye thioflaviae T (ThT) is contacted with the ~i-AP solution. Association of ThT with aggregated ~i-AP, but not monomeric or loosely associated ~-AP, gives rise to a new excitation (ex) maximum at 450 nm and an enhanced emission (em) at 482 nm, compared to the 385 nm (ex) and 445 nm (em) for the free dye. ~i-AP aggregation was assayed by this method as follows. Aliquots (2.9 ~1) of the solutions used in the aggregation assays as described above in section A were removed from the samples and diluted in 200 p1 of potassium phosphate buffer (50 mM, pH 7.0) containing thiotlavin T ( 10 ~uM;
obtained commerFially from Aldrich Chemical Co., Inc.). Excitation was set at 450 nm and emission was measured at 482 nm. Similar to the results observed with the optical density assay described above in section A, as little as 1 % of the N-biotinylated ~-AP
modulators was effective at inhibiting the aggregation of natural (3 amyloid peptides using this fluorometric assay.
C. Static gre~ation A~av In a third assay, [3-AP aggregation was measured by visualization of the peptide aggregates using SDS-polyacrylamide gel electrophoresis (SDS-PAGE). In this assay, ~i-AP
solutions were allowed to aggregate over a period of time and then aliquots of the reaction were run on a standard SDS-PAGE gel. Typical solution conditions were 200 pM
of J3-APB.
4p in PBS at 37 °C for 8 days or 200 ~M ~i-AP~~p in 0.1 M sodium acetate at 37 °C for 3 days. The peptide aggregates were visualized by Coomassie blue staining of the gel or, for ~3-AP solutions that included a biotinylated [3-AP modulator, by western blotting of a filter prepared from the gel with a streptavidin-peroxidase probe, followed by a standard peroxidase assay. The ~i-AP aggregates are identifiable as high molecular weight, low mobility bands on the gel, which are readily distinguishable from the low molecular weight, high mobility (3-AP monomer or dimer bands.
When natural (3-AP~.Qp aggregation was assayed by this method in the absence of any ~i amyloid modulators, high molecular weight aggregates were readily detectable on the gel.
In contrast, when N-biotinyl-~i-AP~.,4p modulator self aggregation was assayed (i.e., aggregation of the N-biotinyl peptide alone, in the absence of any natural (3-AP), few if any high molecular weight aggregates were observed, indicating that the ability of the modulator to self aggregate is significantly reduced compared to natural ~i-AP. Finally, when aggregation of a mixture of natural ~3-AP ~ ~p and N.biotinylated ~3-AP ~ ~p was assayed by this method, reduced amounts of the peptide mixture associated into high molecular weight aggregates, thus demonstrating that the ~i amyloid modulator is effective at inhibiting the aggregation of the natural ~i amyloid peptides.
Nenroto:ieity AnsiyaT~ of (3-Amyioid Modulators The neumtoxicity of the p-amyloid modulators is tested in a cell-based assay using the neuronal precursor cell line PC-12, or primary neuronal cells, and the viability indicator 3,(4,4-dimethylthiazol-2-yl)2,5-Biphenyl-tetrazolium bromide (MT'I~. (See Shearman. M.S.
et al. (I994) Proc. Natl. Acad Sci. USA x:1470-1474; Hansen, M.B. et al.
(1989) J. Immun.
Methods x_9:203-210). PC-12 is a rat adrenal pheochromocytoma cell line and is available from the American,Type Culture Collection, Rockville, MD (ATCC CRL 1721 ). MTT
(commercially available from Sigma Chemical Co. ) is a chromogenic substrate that is converted from yellow to blue in viable cells, which can be detected spectrophotometrically.
To test the neurotoxicity of a p-amyloid modulator (either alone or combined with natural p-AP). cells first are plated in 96-well plates at 7,000-10,000 cells/well and allowed to adhere by overnight culture at 37 °C. Serial dilutions of freshly dissolved or "aged"
modulators (either alone or combined with natural (3-AP) in phosphate buffered saline (PBS) I S are added to the wells in triplicate and incubation is continued for two or more days. Aged modulators are prepared by incubating an aqueous solution of the modulator at 37 °C
undisturbed for a prolonged period (e.g., five days or more). For the final two hours of exposure of the cells to the modulator preparation, MTT is added to the media to a final concentration of 1 mg/ml and incubation is continued at 37 °C.
Following the two hour incubation with MTT, the media is removed and the cells are lysed in isopropanoU0.4N HCl with agitation. An equal volume of PBS is added to each well and the absorbance of each well at 570 nm is measured to quantitate viable cells. Alternatively, MTT is solubilized by addition of 50 % N.N-dimethyl formamide/20 % sodium dodecyl sulfate added directly to the . media in the v~°ells and viable cells are likewise quantitated by measuring absorbance at 570 nm. The relative neurotoxicity of a ~i-amyloid modulator (either alone or in combination with mtural ~i-AP) is determined by comparison to natural ~i-AP alone (e.g., (31-40, p1-42), whica exhibits neurotoxicity in this assay and thus can serve as a positive control.
EXAMPLE 4: Syntheses of Additional Modified p-Amyloid Peptide Compounds In this example. a series of modified p-APs. having a variety of N terminal or random side chain modifications were synthesized.
A series ofN terminally modified p-amyloid peptides was synthesized using standard methods. Fully-protected resin-bound peptides corresponding to Ap(I-15) and Ap(I-40) were prepared as described in Example 1 on Wang resin to eventually afford carboxyl terminal peptide acids. Small portions of each peptide resin (13 and 20 ~cmoles, respectively) were aliquoted into the wells of the reaction block of an Advanced ChemTech Model 396 Multiple Peptide Synthesizer. The N-terminal FMOC protecting group of each sample was removed in the standard manner with 25% piperidine in NMP followed by extensive washing SO
with NMP.-The unprotected N terminal a-amino group of each peptide-resin sample was modified using one of the following methods:
Metho~g, coupling of modifying reagents containing free carboxylic acid groups:
The modifying reagent (five equivalents) was predissolved in NMP, DMSO or a mixture of those two solvents. HOBT and DIC (five equivalents of each reagent) were added to the dissolved modifier and the resulting solution was added to one equivalent of free-amino peptide-resin. Coupling was allowed to proceed overnight, followed by washing.
If a ninhydFin test on a small sample of peptide-resin showed that coupling was not complete, the coupling was repeated using I-hydroxy-7-azabenzotriazole (HOAt) in place of HOBt.
N~ethod B. coupling of modifying reagents obtained in preactivated forms: The modifying reagent (five equivalents) was predissolved in NMP, DMSO or a mixture of these two solvenu and added to one equivalent of peptide-resin.
Diisopropylethylamine (DIEA;
six equivalents) was added to the suspension of activated modifier and peptide-resin.
Coupling was allowed to proceed overnight, followed by washing. If a ninhydrin test on a I 5 small sample of peptide-resin showed that coupling was not complete. the coupling was repeated.
After the second coupling (if required) the N terminally modified peptide-resins were dried at reduced pressure and cleaved from the resin with removal of side-chain protecting groups as described in Example 1. Analytical reversed-phase HPLC was used to confirm that a major product was present in the resulting crude peptides which were purified using Millipore Sep-Pak cartridges or preparative reverse-phase HPLC. Mass spectrometry was used to confirm the presence of the desired compound in the product.
Method A was used to couple N aeetylneuraminic acid, cholic acid. trans-4-cotininecarboxylic acid. 2-imino-I-imidazolidineacetic acid, (S')-(-)-indoline-2-carboxylic acid, (-)-menthoxyacetic acid. 2-norbornaneacetic acid. r-oxo-5-acenaphthenebutyric acid.
(-~2-oxo-4-thiazolidinecarboxylic acid, and tetrahydro-3-furoic acid. Method B
was.used to couple 2-iminobiotin N hydroxysuccinimide ester. diethylenetriaminepentaacetic dianhydride, 4-morpholinecarbonyl chloride, 2-thiopheneacetyl chloride, and 2-thiophenesulfonyl chloride.
In a manner similar to the construction of N terminally modified A~(1-IS) and Ap(1-40) peptides described above, N fluoresceinyl Ap(I-IS) and Aa(I-40) were prepared in two alternative manners using the preactivated reagents ~-(and 6)-carboxyfluorescein succinimidyl ester and fluorescein-5-isothiocyanate (FITC Isomer I). Both reagents were obtained from Molecular Probes Ine. Couplings were performed using four equivalents of reagent per equivalent of peptide-resin with DIEA added to make the reaction solution basic to wet pH paper. Couplings of each reagent to A~i(1-IS)-resin appeared to be complete aRer a single overnight coupling. Coupling to Aa( 1-40)-resin was slower as indicated by a positive ninhydrin test and both reagents were recoupled to this peptide-resin overnight in te~hydrofiaan-NMP ( 1 ~ v/v). The resulting N urminally modified peptide-resins were cleaved, deprotected and purified as described in Example A.
In addition to the N fluoresceinyl A(i peptides described above, a p-amyloid modulator comprised of random modification of Ap(1-40) with fluorescein was prepared.
Ap(1-40) purchased from Bachem was dissolved in DMSO at approximately 2 mg/mL.
(and-6)-Carboxyfluorescein purchased from Molecular Probes was added in a 1.5 molar excess and DIEA was added to make the solution basic to wet pH paper. The reaction was allowed to proceedfor 1 hour at mom temperature and was then quenched with triethanolamine. The product was added to assays as this crude mixture.
(3-amyloid modulator compounds comprising other regions of the p-AP amino acid sequence (e.g., an Aj3 aggregation core domain) were similarly prepared using the synthesis methods described above. Moreover, modulators comprising other amyloidogenic peptides can be similarly prepared.
1 S E~AMP~ S: Identification of Additional [i-Amyloid Modulators In this Example, two assays of A~i aggregation were used to identify ~i-amyloid modulators which can inhibit this process.
The first assay is referred to as a seeded static assay (SSA) and was performed as follows:
To prepare a soitition of A(3 monomer. the appropriate quantity of A(3(1-40) peptide (Bachem) was weighed out on a micro-balance (the amount was corrected for the amount of water in the preparation, which, depending on lot number,.was 20-30% w/w). The peptide was dissolved in 1125 volume of dimethysulfoxide (DMSO), followed by water to volume and 1l2 volume 2x PBS (10x PBS: NaCI 137 mM. KCl 2.7 mM Na~HP04 ~ 7H~0 4.3 mM. KH2P04 1.4 mM pH 7.2) to a final concentration of 200 pM.
To prepare a stock seed, l ml of the above A(3 monomer preparation. was incubated for 8 days at 37 °C and sheared sequentially through an 18, 23, 26 and 30 gauge needle 25, 25, 50, and 100 times respectively. 2 ~1 samples of the sheared material was taken for fluorescence measurements after every 50 passes through the 30 gauge needle until the fluorescence units (FU) had plateaued (approx. 100-150x).
To prepare a candidate inhibitor, the required amount of candidate inhibitor was weighed out and the stock dissolved in lx PBS to a final concentration of 1 mM
(10x stock).
If insoluble. it was dissolved in 1/10 volume of DMSO and diluted in lx PBS to 1 mM. A
further 1/10 dilution was also prepared to test each candidate at both 100 pM
and 10 ~eM.
For the aggregation assay, each sample was set up in tirplicate [50 ~1 of 200 ~M
monomer,125 FU sheared seed (variable quantity dependent on the batch of seed.
routinely 3-6 ~1), 10 ~1 of lOx inhibitor solution, final volume made up to 100 ~1 with lx PBS]. Two concentrations of each inhibitor were tested 100 ~M and 10 ~M, equivalent to a 1:1 and a 1:10 molar ratio of monomer to inhibitor. The controls included an unneeded reaction to confirm that the fresh monomer contained no seed, and a seeded reaction in the absence of inhibitor, as a reference to compare against putative inhibitors. The assay was incubated at 37 °C for 6 h, taking 2 ~1 samples hourly for fluorescence measuremenTM. To measure 5 fluorescence, a 2 g1 sample of A/3 was added to 400 p1 of Thioflavin-T
solution (50 mM
Potassium Phosphate 10 mM Thioflavin-T pH 7.5). The samples were vortexed and the fluorescence was read in a 0.~ ml micro quartz cuvette at EX 450 nm and EM 482 nm (Hitach14~00 ~luorlmeter). ~i-aggregation results in enhanced emission of Thioflavin-TT'"' Accordingly, samples including an effective inhibitor compound exhibit reduced emission as 10 compared to control samples without the inhibitor compound.
The second assay is referred to as a shaken plate aggregation assay and was performed as follows:
A~3(.1-40) peptide from Bachem (Torrance. CA) was dissolved in HFIP
(1,I,I,3,3,3-1 ~ Hexafluoro-?-proganol: Aldrich I0.5?2-8) at a concentration of 2 mg peptide/ml and incubated at room temperature for 30 min. HFIP solubilized peptide was sonicated in a waterbath sonicator for ~ min at highest setting. then evaporated to dryness under a stream of argon. The peptide film was resuspended in anhydrous dimethylsulfoxide (DMSO) at a concentration of 6:9 mglml, sonicated for ~ min as before, then filtered through a 0.2 micron nylon syringe filter 20 (VWR cat. No. 28196-050). Candidate inhibitors were dissolved directly in DMSO, generally at a molar concentration 4 times that of the A~3(1-40) peptide.
Candidates were assayed in triplicate. For each candidate to be tested, 4 parts A~i{1-40) peptide in DMSO were combined with 1 part candidate inhibitor in DMSO in a glass vial, and mixed to produce a 1:1 molar ratio of A(i peptide to candidate. For different molar ratios, 25 candidates were diluted with DMSO prior to addition to A~i( 1-40). in order to keep the final DMSO and A~i(1-40) concentrations constant. Into an ultra low binding 96 well plate (Corning Costar cat. No. 2500, Cambridge MA) 100 ~1 PTL buffer ( 150 mM NaCI,10 mM
NaH?P04;
pH 7.4) was aliquotted per well. For each candidate, 10 ~1 of peptide mixture in DMSO was aliquotted into each of three wells containing bt~'er. The covered plate was vigorously 30 vortexed on a plate shaker at high speed for 30 seconds. An additional 100 ~1 of PTL buffer was added to each well and again the plate was vortexed vigorously for 30 sec.
Absorbance at 405 nnZ was immediately read in a plate reader for a baseline reading. The plate was returned to the plate shaker and vortexed at moderate speed for 5 hours at room temperature, with absorbance readings taken at 15-20 min intervals. Increased absorbance indicated aggregation.
35 Accordingly, effective inhibitor compounds cause a decrease in absorbance in the test sample as compared to a control sample without the inhibitor compound.
Representative results of the static seeded assay and shaken plate assay with prefentd ~-arnyloid modulators are shown below in Table I.
TABLE I
' CandidsteA~ Amino Modifying Ene~ m i Errec><
~ m Inhibitor ~ Reagent shaken plate. Seeded Static Acids I, ~ ,sss I Assa ' i ~
Cholic Complete ,~",~, ~ acid ' ~
174 A 1-15 ~ inhibition at 100% conc Diethylene- Decreased ,~"~, I
~
176 ' ' A~i1-15 ~ Plateau . triamine yenta .
. ;
f acetic acid i ; None "~,~, (-)-Menthoxy ~
180 ~ A~1-15 ~ . .
i acetic acid I
i Fluorescein Decreased ~ ,~"~, ;
;
190 A~i1-15 . Plateau carboxylic acid ;
(FICO) h-EVHHHHQ~K- Complete ++
220 ~ A~i16-40 ' inhibition IAIi at (16-40)]-OH
100%, increased mutant ' i i to at 10 %
Increased ~ ~",~, ~ I tag 224 A(31-40 F~sFzo-'T~sT2o mutant ~
' . I. accelerated i ~,~, L33 H17~5-lU ~VC«v awu , oyy cyouv~ ~ w ~ 10% ConC
* '~"~' = A strong inhibitor of aggregation. The rate of aggregation in the presence of the inhibitor was decreased compared to the control by at feast 30-50%
These results indicate that (3-APs modified by a wide variety of N-terminal modifying groups are effective at modulating (3-amyloid aggregation.
EXAMPLE 6: Additional [3-Amyloid Aggregation Assays Most preferably, the ability of (3-amyloid modulator compounds to modulate (e.g., inhibit or promote) the aggregation of natural ~-AP when combined with the natural (3-AP is examined in one or both of the aggregation assays described below. Natural ~i-AP (~i-AP t gyp) for use in the aggregation assays is commercially available from Bachem (Torrance, CA).
A. Nucleation Assay, The nucleation assay is employed to determine the ability of test compounds to alter (e.g. inhibit) the early events in formation of p-AP fibers from monomeric (3-AP.
Characteristic of a nucleated polymerization mechanism, a lag time is observed prior to nucleation, after which the peptide rapidly forms fibers as reflected in a linear rise in turbidity. The time delay before polymerization of (i-AP monomer can be quantified as well as the extent of formation of insoluble fiber by light scattering (turbidity).
Polymerization reaches equilibrium when the maximum turbidity reaches a plateau. The turbidity of a solution of natural ~i-AP in the absence or presence of various concentrations of a ~i-amyloid modulator compound is determined by measuring the apparent absorbance of the solution at 405nm (A4o5 "",) over time. The threshold of sensitivity for the measurement of turbidity is in the rapge of 15-20 pM (3-AP. A decrease in turbidity over time in the presence of the modulator. as compared to the turbidity in the absence of the modulator, indicates that the modulator inhibits fornzation of ~i-AP fibers from monomeric (3-AP. This assay can be performed using stirring or shaking to accelerate polymerization. thereby increasing the speed of the assay. Moreover the assay can be adapted to a 96-well plate format to screen multiple compounds.
To perform the nucleation assay, first A~i~.~p peptide is dissolved in HFIP
(1,1,1,3,3.3-Hexafluoro-2-propanoh Aldrich 10.522-8) at a concentration of 2 mg peptide/ml and incubated at room temperature for 30 min. HFIP-solubilized peptide is sonicated in a waterbath sonicator for ~ min at highest setting, then evaporated to dryness under a stream of argon. The peptide film is resuspended in anhydrous dimethylsulfoxide (DMSO) at a concentration of 6.9 mg/ml (25x concentration), sonicated for 5 min as before.
then filtered through a 0.2 micron nylon syringe filter (VWR cat. No. 28196-050). Test compounds are dissolved in DMSO at a 100x concentration. Four volumes of 25x A(3 tip peptide in DMSO
are combined with one volume of test compound in DMSO in a glass vial. and mixed to produce a 1:1 molar ratio of A(3 peptide to test compound. For different molar ratios, test compounds are diluted with DMSO prior to addition to A(3 ~-4p, in order to keep the final DMSO and A~t.~p concentrations constant. Control samples do not contain the test compound. Ten microliters of the mixture is then added to the bottom of a well of a Corning Costar ultra low binding 96-well plate (Corning Costar, Cambridge MA; cat. No.
2500).
Ninety microliters of water is added to the well, the plate is shaken on a rotary shaken at a constant speed at room temperature for 30 seconds, an additional 100 ~I of 2x PTL buffer (20 mM NaH2P04, 300 mM NaCI, pH 7.4) is added to the well, the plate is reshaken for 30 seconds and a baseline (t=0) turbidity reading is taken by measuring the apparent absorbance at 405 nm using a Hio-Rad Model 450 Microplate Reader. The plate is then returned to the shaker and shaken continuously for 5 hours. Turbidity readings are taken at 1 ~ minute intervals.
~i-amyloid aggregation in the absence of any modulators results in enhanced turbidity of the natural ~-AP solution (i.e., an increase in the apparent absorbance at 405 nm over time). Accordingly, a solution including an effective inhibitory modulator compound exhibits reduced turbidity as compared to the control sample without the modulator compound (f. e., less apparent absorbance at 405 nm over time as compared to the control sample).
B. Seeded Extension Assay The seeded extension assay can be employed to measure the rate of A~3 fiber formed in a solution of Ap monomer following addition of polymeric A~ fiber "seed".
The ability of test compounds to prevent further deposition of monomeric A~i to previously deposited amyloid is determined using a direct indicator of ~i-sheet formation using fluorescence. In contrast with the nucleation assay, the addition of seed provides immediate nucleation and continued growth of preformed fibrils without the need for continuous mixing, and thus results in the absence of a lag time before polymerization starts. Since this assay uses static polymerization conditions, the activity of positive compounds in the nucleation assay can be confirmed in this second assay under different conditions and with an addition2i probe of amvloid structure.
In the seeded extension assay. monomeric A~il~p is incubated in the presence of a "seed" nucleus (approximately ten mole percent of Al3 that has been previously allowed to polymerize under controlled static conditions). Samples of the solution are then diluted in thioflavin T (Th-T). The polymer-specific association of Th-T with A~i produces a fluorescent complex that allows the measurement of the extent of fibril fornnation (Levine, H.
(1993) Protein Science 2_:404-410). In particular. association of Th-T with aggregated (3-AP, but not monomeric or loosely associated ~3-AP, gives rise to a new excitation (ex) maximum at 450 nm and an enhanced emission (em) at 482 nm, compared to the 38~ nm (ex) and 445 nm (em) for the free dye. Small aliquots of the polymerization mixture contain sufficient fibril to be mixed with Th-T to allow the monitoring of the reaction mixture by repeated 2~ sampling. A linear growth curve is observed in the presence of excess monomer. The formation of thioflavin T responsive (3-sheet fibrils parallels the increase in turbidity observed using the nucleation assay.
A solution of A(3 monomer for use in the seeded extension assay is prepared by dissolving an appropriate quantity of A~i~"4p peptide in 1/25 volume of dimethysulfoxide (DMSO), followed by water to 1/2 volume and 1/2 volume 2x PBS (10x PBS: NaCI
137 mM, KCI 2.7 mM Na2HP04 ~ 7H20 4.3 mM, KH2P041.4 mM pH 7.2) to a final concentration of 200 ~M. To prepare the stock seed, 1 ml of the A~i monomer preparation, is incubated for approximately 8 days at 37 °C and sheared sequentially through an 18, 23, 26 and 30 gauge needle 25, 25, 50, and 100 times respectively. 2 p1 samples of the sheared material is taken for fluorescence measurements after every 50 passes through the 30 gauge needle until the fluorescence units (F~ plateau (approx.100-150x). Test compounds are prepared by dissolving ar. :.ppropriate amount of test compound in lx PBS to a final concentration of 1 mM (1 Ox stock). If insoluble. the compound is dissolved in 1/10 volume of DMSO and diluted in la PBS to 1 mM. A further 1/10 dilution is also prepared to test each candidate at both 100 pM and 10 ~M.
To perform the seeded extension assay, each sample is set up with 50 ~:1 of 200 pM
monomer, 125 FU sheared seed (a variable quantity dependent on the batch of seed. routinely 3-6 p1) and 10 ~1 of l Ox modulator solution. The sample volume is then adjusted to a final volume of 100 p1 with lx PBS. Two concentrations of each modulator typically are tested:
100 ~M and 10 ~M, equivalent to a 1:1 and a 1: I 0 molar ratio of monomer to modulator.
The controls include an unneeded reaction to confirm that the fresh monomer contains no seed, and a seeded reaction in the absence of any modulators, as a reference to compare IO against candidate modulators. The assay is incubated at 37 °C for 6 h. taking 2 ~1 samples hourly for fluorescence measurements. To measure fluorescence, a 2 ~I sample of A/3 is added to 400 gel of Thioflavin-T solution (50 mM Potassium Phosphate 10 mM
Thioflavin-T~
pH 7.5). The samples are vortexed and the fluorescence is read in a 0.~ ml micro Quartz TM
cuvette at EX 450 nm and EM 482 nm (Hitachi 4500 Fluorimeter).
15 p-amyloid aggregation results in enhanced emission of Thioflavin-T.
Accordingly, samples including an effective inhibitory modulator compound exhibit reduced emission as compared to control samples without the modulator compound.
~XAMPI~ 7: Ef~'ect of Different Amino Acid Subregions of A[3 Peptide on the 20 Inhibitory Activity of ~i~Amyloid Modulator Compounds To determine the effect of various subregions of A~i »p on the inhibitory activity of a a ~i-amyloid modulator. overlapping A/3 peptide 1 Smers were constructed. For each 1 Smer, four different amino-terminal modif crs were tested: a cholyl group, an iminobiotinyl group.
25 an N-acetyl neuraminyl group (NANA) and a 5-(and 6-~carboxyfluoresceinyl group (FICO).
The modulators were evaluated in the nucleation and seeded extension assays described in Example 6.
The results of the nucleation assays are summarized below in Table II. The concentration of Aj3l.dp used in the assays was 50 pM. The "mole %" value listed in Table II
30 refers to the % concentration of the test compound relative to A(3~-4p.
Accordingly, 100%
indicates that A~i ~,.4p and the test compound were equimolar. Mole % values less than 100%
indicate that A~i ~~p was in molar excess relative to the test compound (e.g.,10% indicates that A~i l.~p was in 10-fold molar excess relative to the test compound). The results of the nucleation assays for each test compound are presented in Table II in two ways. The "fold 35 increase in lag time". which is a measure of the ability of the compound to delay the onset of aggregation, refers to the ratio of the observed lag time in the presence of the test compound to the observed lag time in the control without the test compound. Accordingly a fold increase in lag time of 1.0 indicates no change in lag time. whereas numbers >
1.0 indicate an increase in lag time. The "% inhibition of plateau", which is a measure of the ability of the compound to dect~se the total amount of aggregation, refers to the reduction of the final turbidity in the presence of the test compound expressed as a percent of the control without the test compound. Accordingly, an inhibitor that abolishes aggregation during the course of the assay will have a % inhibition of 100. N-terminally modified A~i subregions which 5 exhibited inhibitory activity are indicated in bold in Table II.
Table II
N-terminal Fotd iacresse% Inhibition Reference lylodificationg,,d Peptide1e "/ a Lay Tjtnef atea #
PPI-174 cholyl A~ - 10 0 >4.5 100 PPI-264 c6olyl A~ p 100 >4.5 100 PPI-269 cholyl A(3 _~ 100 1.5 ~-,0 PPI-274 choiyl A~i ~ p 100 >4.5 100 PPI-279 cholyl A l_ 100 1.6 51 PPI-284 cholyl A(3 ~ 100 >4.5 87 PPI-173 NANA A~i ~ _ 100 -1 ~0 PPI-266 NANA A~i6.2 100 1.3 64 PPI-271 NANA A(3 _Z 100 13 77 PPI-276 ~1ANA A(31 p 100 ~1 ~-~0 ' PPI-281 NANA A(32 _3 100 1 53 PPI-286 NANA A ~p 100 1.3 -~0 PPI-172 IminobiotinylA/3 _~ 100 1.2 -r0 PPI267 IminobiotinylA~i Ip 100 1.6 44 ~
PPI-272 IminobiotinylA~ _2 100 1.2 40 PPI-277 IminobiotinylA~t~3e 100 1.2 55 PPI-282 IminobiotinylA 100 -1 66 PPI-287 IminobiotinylA~i ~ ' 100 2.3 -~0 PPI-190 FICO A~ _ 100 -1 30 PPI-268 FICO A~i _2 100 1.9 .r0 PPI-2?3 FICO A~i -Z 100 1.7 34 PPI-278 FICO A~i ~. 100 1.6 59 PPI-283 FICO A~ 100 L2 25 PPI-288 FICO A~i2~p 100 2 75 These results indicate that certain subregions of A~3l~p, when modified with an 10 appropriate modifying group, are effective at inhibiting the aggregation of A[3~.~p. A cholyl group was an effective modifying group for several subregions. Cholic acid alone was tested for inhibitory activity but had no effect on A(3 aggregation. The A(3~2o subregion exhibited high levels of inhibitory activity when modified with several different modifying gmups (cholyl, NANA. in~inobiotinyl), with choIyl-A~36.2p (PPI-264) being the most active fonm.
Accordingly, this modulator compound was chosen for fiuther analysis.
described in Example 8.
EXAMPLE 8: Identification of a Five Amino Acid Subregion of A~ Peptide Sufficient for Inhibitory Activity of a ~i-Amyloid Modulator Compound To further delineate a minimal subregion of cholyl-A(3~2o su~cient for inhibitory activity,, a series of amino terminal and carboxy terminal amino acid deletions of cholyl-A~3~2o were constructed. The modulators all had the same cholyl amino-terminal modification. Additionally, for the peptide series having carboxy terminal deletions, the carboxy terminus was further modified to an amide. The modulators were evaluated as described in Example 7 and the results are summarized below in Table III.
wherein the data is presented as described in Example 7.
1 S Table III
N-Terns. C-Term. Fold increase~0 Inhibition ~
Ref # ~d. A Pe 'de Mod. Mole in LaQ of Plateau % Time PPI-264 cholyl A~~~o - 100 >4.5 100 PPI-341 cholyl A~-2o - 100 >4.5 100 33 2 .-0 PPI-342 cholyl A(3g_ - 100 1.~ --0 33 2.1 -r0 PPI-343 cholyl A/39_ o - 33 2.0 --0 344 cholyl = -.i j. 2.1 -r0 PPI -A(It -20 PPI-345 cholyl A~3 _~o - 33 1.5 ~.-0 PPI-346 cholvl A~3 _~o - 33 2.1 --U
PPI-347 cholyl A~3~3- - 33 2.6 ~-0 o PPI-348 cholyl A~itZp - 33 2.0 49 PPI-349 cholyl A[3 Z - 33 2.3 50 PPI-350 cholyl A(31~20 - 38 3.4 23 PPI-296 cholyl A~i p amide 33 1.8 ~0 PPI-321 cholyl A(3~~9 amide 33 1.4 -~-0 PPI-325 cholyl A/3 ~ ~ amide 33 1.8 ~.0 PPi-331 cholyl A~i~~4 amide 33 1.0 29 PPI-339 cholyl A[3~1o amide 33 1.1 13 These results indicate that activity of the modulator is maintained when amino acid residue 6 is removed from the amino terminal end of the modulator (i.e., cholyl-A~i~-2o retained activity) but activity is lost as the peptide is deleted further at the amino-terminal end by removal of amino acid position 7 through to amino acid position 12 (s. e..
cholyl-A(3g.2o through cholyl-A~ilg-20 did inhibit the plateau level of A~ agony. However, fi>rtber deletion of amino acid position 13 resulted in a compound (i.e., cholyl-A~314-20) in which inhibitory activity is restored. Furthermore, additional deletion of amino acid position 14 (i.e., cholyl-A(ils_2o) or Positions 14 and 15 (i.e:, cholyl-A~i16.2o) still maintained inhibitory activity. Thus, amino terminal deletions of A~i~zo identified A~i 120 ~ a subregion which is sufficient for inhibitory activity when appropriately modified. In contrast, carboxy terminal deletion of amino acid position 20 resulted in loss of activity which was not fully restored as the peptide was deleted further at the carboxy-terminal end. Thus, maintenance of position 20 within the modulator may be important for inhibitory activity.
~.XAMPLE 9: Identification of a Four Amino Acid Subregion of A~i Peptide Sufficient for Inhibitory Activity of a (3-Amyloid Modulator Compound In this example, the smallest effective modulator identified in the studies described in Example 8. cholyl-A~i 1 X20 (PPI-3 SO), was analyzed further. Additional amino-and carboxy-terminal deletions were made with eholyl-A~i 16.20, as well as an amino acid substitution (Val1 g->Thr), to identify the smallest region sufficient for the inhibitory activity of the modulaxor. A peptide comprised of five alanine residues, (AIa)5, modified at its amino-terminus with cholic acid, was used as a specificity control. The modulators were evaluated as described in Example 7 and the results are summarized below in Table IV, wherein the data is presented as described in Example 7.
Table IV
N-Term. C-Term. Fold Increase% lnhib'rcion ef. ~ ~ A~i Mod. le % !~ Time of Plateau Pe ric a PPI-264 cbolyl A~6. - 10 2.0 43 ~ o PPI-347 cbolyl A~t~zo - 10 ZZ 57 PPI-349 cbotyl A~i1 - 100 >5.0 100 33 2.6 35 10 2.1 --~0 PPI-350 cboiyl A lit - 100 >5.0 100 o 10 2.4 40 PPI368 cbolyl A~l~-Zt - 100 >5.0 100 PPI-374 imino- Apl6.2o - 100 13 86 ~ biotinyl PPI-366 cholyl A(31 - 100 3.1 --0 10 1.6 --0 PPI-369 cholyl A~i - 100 ~ 1 --0 x.20 (Val 8->Thr) PPI-370 cholyl A(3t6-2p - 100 2.6 73 ~ (Phe Ala) PPI-365 cholyl (Ala) - 100 --1 -0 ( PPI-319 _ cholylA[3 smide 33 S.6 ~-4 ~
10 2.7 ~0 PPI-321 cholyl A~ amide 100 1.2 0 PPI-377 - A~ - 100 ~l --0 As shown in Table IV, cholyl-A~il~2o (PPI-350) and cholyl-A~i~~-z~ (PPI-368) both exhibited inhibitory activity, indicating that the four-amino acid minimal subregion of positions 17-20 is sufficient for inhibitory activity. Loss of.position 20 (e.g., in PPI-366 and PPI-321) resulted in loss of inhibitory activity, demonstrating the importance of position 20.
Moreover, mutation of valine at position 18 to threonine (in PPI-369) also resulted in loss of activity, demonstrating the importance of position 18. In contrast, mutation of phenylalanine at position 19 to alanine (cholyl-A~316-2o Phel9->Ala; PPI-370) resulted in a compound which still retained detectable inhibitory activity. Accordingly, the phenylalanine at position 19 is more amenable to substitution, preferably with another hydrophobic amino acid residue.
Cholyl-penta-alanine (PPI-365) showed no inhibitory activity. demonstrating the specificity of the A~i peptide portion of the modulator. Moreover, unmodified A~i~6-2o (PPI-377) was not inhibitory, dern~onstrating the functional importance of the amino-terminal modifying group. The specific functional group influenced the activity of the modulator.
For example, iminobiotinyl-A~it~2o (PPI-374) exhibited inhibitory activity similar to cholyl-A(3i~2o, whereas an N-acetyl neuraminic acid (NANA)-modified A~i 1 X20 was not an effective inhibitory modulator (not listed in Table IV). A C-terminal amide derivative of cholyl-A~i~6.
20'(PPI-319) retained high activity is delaying the lag time of aggregation, indicating that the carboxy-terminus of the modulator can be derivatized without loss of inhibitory activity.
Although this amide-derivatized compound did not inhibit the overall plateau level of aggregation over time. the compound was not tested at concentrations higher than mole 33 %.
Higher concentrations of the amide-derivatized compound are predicted to inhibit the overall plateau level of aggregation, similar to cholyl-A(31~20 (PPI-350).
EXAMPLE 10: Effect of ~-Amyloid Modulators on the Neurotoxicity of Natural (3-Amyloid Peptide Aggregates The neurotoxicity of natural ~i-amyloid peptide aggregates, in either the presence or.
absence of a (3-amyloid modulator, is tested in a cell-based assay using either a rat or human neuronally-derived cell line (PC-12 cells or NT-2 cells, respectively) and the viability indicator 3,(4,4-dimethylthiazol-2-yl)2,5-diphenyl-tetrazolium bromide (MT'17.
(See e.g., Shearman, M.S. et al. (1994) Proc. Natl. Acad Sci. USA 9_x:1470-1474; Hansen, M.B. et al.
(1989) J. Immun. Methods 11 :203-210 for a description of similar cell-based viability assays). PC-12 is a rat adrenal pheochromocytoma cell line and is available from the American Type Culture Collection, Roclcville, MD (ATCC CRL 1721 ). MTT
(commercially available from Sigma Chemical Co.) is a chromogeaic substrate that is converted from yellow to blue in viable cells, which can be detected specuophotometrically.
To test the neurotoxicity of natural ~3-amyloid peptides, stock solutions of fresh A(3 monomers and aged A~ aggregates were first prepared. A~i~~p in I00% DMSO was prepared from lyophilized powder and immediately diluted in one half the final volume in H20 and then one half the final volume in 2X PBS so that a final concentration of 200 ~M
peptide, 4% DMSO is achieved. Peptide prepared in this way and tested immediately on cells is referred to ~s "fresh" A~ monomer. To prepare "aged" A~i aggregates, peptide TM
solution was placed in a 1.~ ml Eppendorf tube and incubated at 37 °C
for eight days to allow fibrils to form. Such "aged" A~ peptide can be tested directly on cells or frozen at -80°C. The neurotoxicity of fresh monomers and aged aggregates were tested using PC12 and NT2 cells. PC12 cells were routinely cultured in Dulbeco's modif:ed Eagle's medium (DNIEM) containing 10% hone serum, 5% fetal calf serum, 4mM glutamine, and I%
genumycin. NT2 cells were routinely cultured in OPTI-MEM medium (GIBCUBRL CAT.
16 31985) supplemented with 10% fetal calf serum, 2 mM glutamine and 1 %
gentamycin.
Cells were plated at 10-15,000 cells per well in 90 p1 of fresh medium in a 96 -well tissue culture plate 3-4 hours prior to treaunent. The fresh or aged A~ peptide solutions ( I 0 pL) were then diluted 1:10 directly into tissue culture medium so that the final concentration was in the range of I-I O pM peptide. Cells are incubated in the presence of peptide without a change in media for 48 hours at 37°C. For the final three hours of exposure of the cells to the (3-AP preparation. MTI' was added to the media to a final concentration of 1 mglml and incubation was continued at 37 °C. Following the two hour incubation with MTT, the media was removed and the cells were Iysed in 100 pL isopropanoU0.4N HCI with agitation. An equal volume of PBS was added to each well and the plates were agitated for an additional 10 minutes. Absorbance of each well at 570 nm was measured using a microtiter plate reader to quantitate viable cells.
The neurotoxicity of aged (S day or 8 day) A~ Lip aggregates alone, but not fresh A~3 ~.~p monomers alone, was confirmed in an experiment the results of which are shown in Figure 3, which demonstrates that incubating the neuronal cells with increasing amounts of fresh A~i ~.~p monomers was not significantly toxic to the cells whereas incubating the cells with increasing amounts of 5 day or 8 day A(31~p aggregates led to increasing atriount of neurotoxicity. The ECSO for toxicity of aged A~i~.~p aggregates was I-2 pM for both the PC12 cells and the NT2 cells.
To determine the effect of a ~i-amyloid modulator compound on the neurotoxicity of A~~.4p aggregates. a modulator compound, cholyl-A~iøZp (PPI-264), was preincubated with A~il~p monomers under standard nucleation assay conditions as described in Example 6 and at particular time intervals post-incubation, aliquots of the ~-AP/modulator solution were removed and 1 ) the turbidity of the solution was assessed as a measure of aggregation and 2) the solution was applied to cultured neuronal cells for 48 hours at which time cell viability was assased~usiag IvtTT to determine the n'eurotoxicity of the solution. The results of the turbidity analysis are shown in Figure 4, panels A, B and C. In panel A, Aø
1.4p and cholyl-Aø6.zp were both present at 64 pM. In panel B, Aøt.~p was print at 30 ~NI and cholyl-Aø~.2p was present at 64 E,eM. In panel C, Aøl.~p was present at 10 ~M and cholyl-Aø6.2o was present at 64 pM. These data show that an equimolar amount of cholyl-Aø~.2p is effective at inhibiting aggregation of Aø1"4p (see Figure 4, panel A) and that as the concentration of Aø lip is reduced, the amount of detectable aggregation of the Aø 1-4p monomer is cowespondingly reduced (compare Figure 4, panels B and C with panel A). The corresponding results of the neurotoxicity analysis are shown in Figure 4, panels D, E, and F.
These insults demonstrate that the ø-amyloid modulator compound not only inhibits aggregation of Aø~.4p monomers but also inhibits the neurotoxicity of the Aø~~p solution, illustrated by the reduced percent toxicity of the cells when incubated with the' Aø~.4plmodulator solution as compared to Aø~.~p alone (see e.g., Figure 4, panel D).
Moreover, even when Aø l.dp aggregation was not detectable as measured by light scattering, the modulator compound inhibited the neurotoxicity of the Aø ~.4p solution (see Figure 4, panels E and F). Thus, the formation of neumtoxic Aø t.~p aggregates precedes the fonaation of insoluble aggregates detectable by light scattering and the modulator compound is effective at inhibiting the inhibiting the formation and/or activity of these neurotoxic aggregates. Similar results were seen with other modulator compounds, such as iminobiotinyl-Aø6_2p (PPI-267), cholyl-Aø»2p (PPI-350) and cholyl-Aø1~2o-amide (PPI-319).
Additionally, the ø-amyloid modulator compounds have been demonstrated to reduce the neurotoxicity of preformed Aø ~.4p aggregates. In these experiments, Aø
~.~p aggregates were preformed by incubation of the monomers in the absence of any modulators.
The modulator compound was then incubated with the preformed A(3~.4p aggregates for 24 hours ai 37 °C, after which time the ø-AP/modulator solution was collected and its neurotoxicity evaluated as described above. Incubation of preformed Aøl.~p aggregates with the modulator compound prior to applying the solution to neuronal cells resulted in a decrease in the neurotoxicity of the Aø~-4p solution. These results suggest that the modulator can either bind to Aø fibrils or soluble aggregate and modulate their inherent neurotoxicity or that the modulator can perivrb the equilibrium between monomeric and aggregated forms of Aø1.4p in favor of the non-neurotoxic form.
EXAMPLE 11: Characterization of Additional ø-Amyioid Modulator Compounds In this example, additional modulator compounds designed based upon amino acids 17-20 of Aø, LVFF (identified in Example 9), were prepared and analyzed to further delineau the structural features necessary for inhibition of ø-amyloid aggregation. Types of compounds analyzed included ones having only three amino acid residues of an Aø
aggregation-core domain. compounds in which the amino acid residues of an A~
aggregation core domain were rearranged or in which amino acid substitutions had been made, compounds modified with a carboxy-terminal modifying group and compounds in which the modifying group had been derivaxized. Abbreviations used in this example are:
h- (free amino terminus), -oh (free carboxylic acid terminus), -nh2 (amide terminus), CA (cholyl, the aryl portion of cholic acid), NANA (N acetyl neuraminyl), IB (iminobiotinyl), ~iA (~i-alanyl), DA (D-alanyl), Adp (aminoethyldibenzofiuanylpropanoic acid), Aic (3-(O~-aminoethyl-iso~
cholyI, a derivative,of cholic acid), IY (iodotyrosyl), o-methyl (carboxy-terminal methyl ester), N me (N methyl peptide bond), DeoxyCA (deoxycholyl) and LithoCA
(lithocholyl).
Modulator compounds having am Aic modifying group at either the amino- or carboxy-terminus (e.g., PPI-408 and PPI-418) were synthesized using known methods (see e.g., Wess, G, et al. (1993) Tetrahedron Letters, x:817-822; Wess, G. et al.
(1992) Tetrahedron Letters x:195-198). Briefly, 3-iso-O-(2-aminoethyl)-cholic acid (3(3-(2-aminoethoxy)-7a.12a-dihydroxy-S~i-cholanoic acid) was converted to the FMOC-protected derivative using FMOC-OSu (the hydroxysuccinimide ester of the FMOC group, which is commercially available) to obtain a reagent that was used to introduce the cholic acid derivative into the compound. For N-terminal introduction of the cholic acid moiety, the FMOC-protected reagent was coupled to the N-terminal amino acid of a solid-phase peptide in the standard manner, followed by standard FMOC-deprotection conditions and subsequent cleavage from the resin, followed by HPLC purification. For C-terminal introduction of the cholic acid moiety, the FMOC-protected reagent was attached to 2-chlorotrityl chloride resin in the standard manner. This amino aryl derivatized resin was then used in the standard manner to synthesize the complete modified peptide.
The modulators were evaluated in the nucleation and seeded extension assays described in Example 6 and the results are summarized below in Table V. The change in lag time (~L,ag) is presented as the ratio of the lag time observed in the presence of the test compound to the lag time of the control. Data are reported for assays in the presence of 100 mole % inhibitor relative to the concentration of A~ii".4p, except for PPI-315, PPI-348, PPI-380, PPI-407 and PPI-418, for which the data is reported in the presence of 33 mole inhibitor. Inhibition (% Inuclv) is listed as the percent reduction in the maximum observed turbidity in the control at the end of the assay time .~iod: .. inhibition in the extension assay ('~o Ice") is listed as the percent reduction of thioflavin-T $tmraceace of ~i-structure in the presence of 25 mole % inhibitor. Compounds with a % Inucl'n of at least 30%
are highlighted in bold.
T~~,1~ V 72 N-Tens. C-Tam.
PPI-293 CA - -oh 1.0 0 ND*
PPI-315 CA HQKLVFF 1.1 5 ND
PPI-316 NANA HQKLYFF -ah 1.5 -15 ND
PPI-319 CA KLVFF -nh 5.4 70 52 PPI-339 CA HDSGY 1.1- -18 ND
PPI-348 CA HQKLVFF -06 2.0 70 ND
PPI-349 CA Q KLVFF -06 >5 100 56 PPI-350 CA KLVFF -06 1.8 72 11 PPI-365 CA AAAAA -oh 0.8 -7 0 PPI366 CA QKLVF -oh 3.1 -23 ND
PPI-368 CA LVFFA -06 >5 100 91 PPI-369 CA KLTFF oh 1.1 -16 44 PPI-370 CA KLVAF -oh 2.6 73 31 PPI-371 CA KLVFF(A) -oh 2.5 76 80 PPI-372 CA FKFVL -06 0.8 45 37 PFI-373 NANA KLVFF -oh 0.9 16 8 PPI-374 IB KLVFF -oh 13 86 0 PPI-375 CA KTVFF -oh 1.2 18 21 PPI-377 h- KLVFF -oh 1.1 0 8 ~PPI-379 CA LVFFAE -oh 1.4 55 16 PPI-380 CA LVFF -06 1.8 72* 51 PPI-381 CA LVFF(DA) -oh 23 56 11 PPI-382 CA LVFFA -nh~ 1.0 -200 91 PPI-383 h-asLa~o~VFF -oh 0.4 14 0 PPI-386 h- LVFFA -oh 1.0 15 11 PPI-387 h- KLVFF -nh~ 1.3 ~ -9 39 PPI-388 CA AVFFA -06 1.4 68 44 PPI-389 CA LAFFA -oh 1.5 47 b6 PPI390 CA LVAFA -oh 2.7 25 0 PPI-392 CA VFFA -06 2.0 76 10 PPI393 CA LVF -oh 1.3 I 0 PPI-394 CA VFF -oh 1.8 55 0 PPI-395 CA FFA -oh 1.0 51 6 PPI-39b CA LV(IY)FA -oh >5 100 71 PPI-401 CA LVFFA -o-methylND . ND 0 PPI-405 h- LVFFA -ah~ 1.3 11 70 PPI-407 CA LVFFK -oh >5 100** 85 -.
PPI-408 6- LVFFA (Aic)-oh3.5 46 3 PPI-418 h-(Aic) LVFFA -oh >5 100** 87 PPI-426 CA FFVLA -oh >5 100 89 PPI-391 CA LVFAA -oh 1.6 40 ND
PPI-397 CA LVF(IY)A -06 >5 95 ND
PPI-400 CA AVAFA -oh 1.0 -I S ND
PPI-403 * * * HQKLVFF -oh 1.4 -75 0 PPI-404 * * * LKLVFF -oh 1.8 -29 7 *
PPI-424 DeoxyCA LVFFA -oh 3.0 -lI4 82 PPI-425 LithoCA LVFFA -oh 2.8 -229 0 PPI-428 CA FF -oh 1.7 -78 15 PPI-429 CA FFV -oh Z.2 -33 7 PPI-430 CA FFYL -oh 4.1 33 75 PPI-433 CA LVFFA -oh 2.8 27 ND
(all D amino acids) PPI-435 t-Boc LVFFA -oh 3.0 -5 ND
PPI-438 CA GFF -oh 1.0 0 ND
' ND = not done " = 33 mol "" = h-DDIII(N Me-Val)DLL(Adp) ""= h-DDII(N Me-Leu)VEH(Adp) Certain compounds shown in Table V (PPI-319, PPI-349, PPI-350, PPI-368 and PPI-426) also were tested in neurotoxicity assays such as those described in Example Z 0. For each compound. the delay of the appearance of neurotoxicity relative to control coincided with the delay in the time at which polymerization of A~i began in the nucleation assays.
This correlation between the prevention of formation of neurotoxic A~i species and the prevention of polymerization of A~i was consistently observed for all compounds tested.
The results shown in Table V demonstrate that at an effective modulator compound can comprise as few as three A~i amino acids residues (see PPI-394, comprising the amino acid sequence VFF, which corresponds to A~3I$_2o, and PPI-395, comprising the amino acid sequence FFA. which corresponds to A(3I9-21 )- The results also demonstrate that a modulator compound having a modulating group at its carboxy-terminus is effective at inhibiting A~i aggregation (see PPI-408, modified at its C-terminus with Aic). Still further.
the results demonstrate that the cholyl gmup, as a modulating group, can be manipulated while maintaining.the inhibitory activity of the compounds (see PPI-408 and PPI-418, both of which comprise the cholyI derivative Aic). The free amino group of the Aic derivative of cholic acid represents a position at which a chelation group for ~nTc can be introduced, e.g., to create a diagnostic agent. Additionally, the ability to substitute iodotyrosyl for phenylalanine at position 19 or 20 of the A~i sequence (see PPI-396 and PPI-397) while maintaining the ability of the compound to inhibit A~i aggregation indicates that the compound could be labeled with radioactive iodine, e.g., to create a diagnostic agent, without loss of the inhibitory activity of the compound.
Finally, compounds with inhibitory activity were created using A~i derived amino acids but wherein the amino acid sequence was rearranged or had a substitution with a non-A~-derived amino acid. Exarnples of such compounds include PPI-426, in which the seQuence of A~i 1 ~-21 (LVFFA) has been reawanged (FFVLA), PPI-372, in which tire sequence of~Pr~t~.2o (KLVFF~ has been reaeraanged (FKF'VL), and PPI-388, -389 and -390, in which the sequence of A~i t 7_21 (LVFFA) has been substituted at position 17,18 or 19, respectively, with an alanine residue (AVFFA for PPI-388, LAFFA for PPI-389 and LVAFA
for PPI-390). The inhibitory activity of these compounds indicate that the presence in the compound of an amino acid sequence directly corresponding to a portion of A~i is not essential for inhibitory activity, but rather suggests that maintenance of the hydrophobic nature of this core region, by inclusion of amino acid residues such as phenylalaaine, valine, leucine"regardless of their precise order, can be sufficient for inhibition of A~i aggregation.
EXAMPLE IZ: Characterization of ~i-Amyloid Modulator Compounds Comprising an Unmodified ~i-Amyloid Peptide To examine the ability of unmodified A~ peptides to modulate aggregation of natural j3-AP, a series of A~ peptides having amino- and/or carboxy terminal deletions as compared to A~it~o, or having intenzal amino acids deleted (i.e.. noncontiguous peptides), were prepared. One peptide (PPI-220) had additional, non-A/3-derived amino acid rasidues at its amino-terminus. These peptides all had a free amino group at the amino-terminus and a free carboxylic acid at the carboxy-terminus. These unmodified peptides were evaluated in assays as described in Example 7. The results are summarized below in Table VI, wherein the data is presented as described in Example 7. Compounds exhibiting at least a 1.5 fold increase in lag time are highlighted in bold.
Table VI
Fold Increase% Inhibition lteferenc~#~ o % _ in g Timeo f plateau AIi Peo '~,ie PPI ZZ6 ~ ~ 100 i.66 76 A
PPI-227 A~ i 100 -1 47 PPI-Z28 A ~ 100 >4.5 100 PPI-229 A 1 ~ N
PPI-230 A 100 0.8 -.0 o PPI-231 A~ l~- - ~1 18 -PPI-247 A~i I00 ~-1 -.~0 .
(Q3I-35) PPI-?.48 A ~i I00 1.58 -0 _2 (d26-30) PPI-249 A ~ 100 237 -~0 _ o (A21-25) PPI-I50 A~3 100 1.55 --0 ,1 (A1620) PPI-251 A~ 100 ~1.2 ~-0 .
o t o (A11-15) PPI 152 A~i 100 1.9 33 -(A6-10) PPI-253 A~ 100 1.9 -~0 PPI?SO EEVVHHHHQQ-A/3 100 >4 100 The results shown in ?able VI demonstrate that limited portions of the A~
sequence can have a significant inhibitory effect on natural ~-AP aggregation even when the peptide is not modified by a modifying group. Preferred unmodified peptides are Aj3g,2o (PPI-226), A~1~-30 (PPl-228), A(31-20, 26.40 (fPI-249) and EEwHHHHQQ-A~mo (PPI-Z20), the amino 5 acid sequences of which are shown in SEQ ID NOs: 4,14,15, and 16, respectively.
Foaming part of this disclosure is th,e appended Sequence Listing, the contents of Which STC summarize in Tabla VII below.
Table VII
SEO I_D NO: gmino A_~ ~gtide Sequence 1 43 amino acids Aft 2 143 amino acids APP C-terminus 3 43 amino acids A(3t~ (19. 20 muted) 4 HDSGYEVHHQKLVFF A~i~
5 HQKLVFFA A(3 4_ t 6 HQKLVFF A~t~. o 7 QKLVFFA A~ t 5-8 Q~CLVFF A~i 9 KLVFFA A~t6_2t 10 KLVFF A~3t 12 LVFF A(it~_ 13 LAFFA A~ ~. t ~ t ~A) 14 KLVFFAEDVGSNKGA Aft o 15 3 5 amino acids ~ A~i t _ 16 35 amuio acids EEWHHHHQQ-~iAP t ~o 17 AGAAAAGA FrP peptide 18 AILSS amylin peptide 19 VFF A~it~
This is a divisional application of Canadian Patent Application Serial Number 2,214,247, filed March 14, 2003.
S
Baclcaround of the Invention Alzheimer's disease (AD), first described by the Bavarian psychiatrist Alois Alzheimer in 1907, is a progressive neurological disorder that begins with short term memory loss and proceeds to disorientation, impairment of judgement and reasoning and, ultimately, dementia.
The course of the disease usually leads to death in a severely debilitated, immobile state between 4 and 12 years after onset. AD has been estimated to afflict 5 to 11 percent of the population over age 65 and as much as 47 percent of the population over age 85. The societal cost for managing AD is upwards of 80 billion dollars annually, primarily due to the extensive custodial care required for AD patients. Moreover, as adults born during the population boom of the 1940's and 1950's approach the age when AD becomes more prevalent, the control and treatment of AD will become an even more significant health care problem.
Currently, there is no treatment that significantly retards the progression of the disease. For reviews on AD, see Selkoe, D.J. Sci. Amer., November 1991, pp. 68-78; and Yankner, B.A. et al. (1991) N.
Eng. J. Med. 325:1849-1857.
It has recently been reported (Games et al. (1995) Nature 373:523-527) that an Alzheimer-type neuropathology has been created in transgenic mice. The transgenic mice express high levels of human mutant amyloid precursor protein and progressively develop many of the pathological conditions associated with AD.
Pathologically, AD is characterized by the presence of distinctive lesions in the victim's brain. These brain lesions include abnormal intracellular filaments called neurofibrillary tangles (NTFs) and extracellular deposits of amyloidogenic proteins in senile, or amyloid plaques. Amyloid deposits are also present in the walls of cerebral blood vessels of AD patients. The major protein constituent of amyloid plaques has been identified as a 4 kilodalton peptide called ~i-amyloid peptide (~i-AP)(Glenner, G.G. and Wong, C.W. (1984) Biochem. Biophys. Res. Commun. 120:885-890; Masters, C. et al. (1985) Proc.
Natl. Acad.
Sci. USA 82:4245-4249). Diffuse deposits of ~i-AP are frequently observed in normal adult brains, whereas AD brain tissue is characterized by more compacted, dense-core ~-amyloid plaques. (See e.g., Davies, L. et al. (1988) Neurology 38:1688-1693). These observations suggest that /3-AP deposition precedes, and contributes to, the destruction of neurons that occurs in AD. In further support of a direct pathogenic role for /3-AP, /i-amyloid has been la shown to be toxic to mature neurons, both in culture and in vivo. Yankner, B.A. et al. (1989) Science 245:417-420; Yankner, B.A. et al. ( 1990) Proc. Natl. Acad. Sci. USA
87:9020-9023;
Roher, A.E. et al. (1991) Biochem. Biophys. Res. Commun. 174:572-579; Kowall, N.W. et al.
(1991) Proc. Natl. Acad. Sci. USA 88:7247-7251. Furthermore, patients with hereditary cerebral hemorrhage with amyloidosis-Dutch-type (HCHWA-D), which is characterized by diffuse ~-amyloid deposits within the cerebral cortex and cerebrovasculature, have been shown to have a point mutation that leads to an amino acid substitution within ~-AP. Levy, E. et o1 (1990) Science x:1124-1126. This observation demonstrates that a specific alteration of the (3-AP sequence can cause /3-amyloid to be deposited.
Natural ~i-AP is derived by proteolysis from a much larger protein callod the amyloid precursor protein (APP). Kung, J. et al. ( 1987) Nature~:733; Goldgaber, D. et al. (1987) Science X5_:877; Robakis, N.K. et al. (1987) Proc. Natl. Acad Sci. USA
84:4190; Tanzi, RE. et al. (1987) Science~5:880. The APP gene maps to chromosome 21, thereby providing an explanation for the p-amyloid deposition seen at an early age in individuals with Down's syndrome, which is caused by trisomy of chromosome 21. Mann, D:M. et al. (1989) Neuropathol. Appl. Neurobiol. 1,x:317; Rumble, B. et al. ( 1989) N. E»g. J.
Med. x:1446.
APP contains a single membrane spanning domain, with a long amino terminal region (about two-thirds of the protein) extending into the extracellular environment and a shorter carboxy-terlninal region projecting into the cytoplasm. Differential splicing of the APP messenger RNA Ieads to at Ieast five forms of APP. composed of either 563 amino acids (APP-563), 695 amino acids (APP-695), 714 amino acids (APP-714), 7~ 1 amino acids (APP-7~
1 ) or 770 I S amino acids (APP-770).
Within APP. naturally-occurring (3 amyloid peptide begins at an aspattic acid residue at amino acid position b72 of APP-770. Naturally-occurring /3-AP derived from proteolysis of APP is 39 to 43 amino acid residues in length. depending on the carboxy-terminal end point. which exhibits heterogeneity. The predominant circulating form of ~-AP
in the blood and cerebrospinal fluid of both AD patients and normal adults is ~il-40 ("short ~i"). Seubert,.
P, et al. (1992) Nature X59:325; Shoji, M. et al. (1992) Science 258:126.
However. (31-42 and ~il-43 ("long ~") also are forms in ~i-amyloid plaques. Masters. C. et al.
(1985) Proc.
. Natl. Acad Sci. USA x:4245; Miller. D. et al. (1993) Arch. Biochem. Biophys.
301:41; Mori, H. er al. ( 1992) J. Biol. Chem. X7:17082. Although the precise molecular mechanism 23 leading to ~i-APP aggregation and deposition is unknown. the process has been likened to that of nucleation-dependent polymerizations. such as protein crystallization, microtubule formation and actin polymerization. See e.g., Jarrett, J.T. and Lansbury, P.T.
(1993) Cell 7~:105~-1058. In such processes, polymerization of monomer components does not occur until nucleus formation. Thus, these processes are characterized by a lag time before aggregation occurs. followed by rapid polymerization after nucleation.
Nucleation can be accelerated by the addition of a "seed" or preformed nucleus, which results in rapid polymerization. The long ~ forms of ~i-AP have been shown to act as seeds, thereby accelerating polymerization of both long and short ~i-AP forms. Jarrett, J.T.
et al. (1993) Biochemistry ;x:4693.
In one study. in which amino acid substitutions were made in (3-AP, two mutant ~i peptides were reported to imerfere with polymerization of non-mutated ~-AP
when the mutant and non-mutant forms of peptide were mixed. Hilbich, C. et al. (1992) J. Mol. Biol.
228:460-473. However, equimolar amounts of the mutant and non-mutant (i. e., natural) ~3 amyloid peptides were used to see this effect and the mutant peptides were reported to be unsuitable for use in vivo. Hilbich, C. et al. (1992), supra.
Summary of the Invention It should be understood that the expression "the invention" and the like as used herein, encompass the subject matter of both the parent and the divisional applications.
This invention pertains to compounds, and pharmaceutical compositions thereof, that can modulate the aggregation of amyloidogenic proteins and peptides, in particular compounds that can modulate the aggregation of natural ~3-amyloid peptides (~-AP) and inhibit the neurotoxicity of natural S-APs. In one embodiment, the invention provides an amyloid modulator compound comprising an amyloidogenic protein, or peptide fragment thereof, coupled directly or indirectly to at least one modifying group such that the compound modulates the aggregation of natural amyloid proteins or peptides when contacted with the natural amyloidogenic proteins or peptides. Preferably, the compound inhibits aggregation of natural amyloidogenic proteins or peptides when contacted with the natural amyloidogenic proteins or peptides. The amyloidogenic protein, or peptide fragment thereof, can be, for example, selected from the group consisting of transthyretin (TTR), prion protein (PrP), islet amyloid polypeptide (IAPP), atrial natriuretic factor (ANF), kappa light chain, lambda light chain, amyloid A, procalcitonin, cystatin C, i82 microglobulin, ApoA-I, gelsolin, procalcitonin, calcitonin, fibrinogen and lysozyme.
In the most preferred embodiment of the invention, the compound modulates the aggregation of natural S-AP. The invention provides a ~3-amyloid peptide compound comprising a formula:
n X,aa wherein Xaa is a (3-amyloid peptide having an amino-terminal amino acid residue corresponding to position 668 of ~-amyloid precursor protein-770 (APP-770) or to a residue carboxy-terminal to position 668 of APP-770, A is a modifying group attached directly or indirectly to the S-amyloid peptide of the compound such that the compound inhibits aggregation of natural ~-amyloid peptides when contacted with the natural ~-amyloid peptides, and n is an integer selected such that the compound inhibits aggregation of natural a-amyloid peptides when contacted with the natural ~-amyloid peptides.
In one embodiment, at least one A group is attached directly or indirectly to the amino terminus of the (3-amyloid peptide of the compound. In another embodiment, at least one A
group is attached directly or indirectly to the carboxy terminus of the ~-amyloid peptide of the Q
compound. In yet another embodiment, at least one A group is attached directly or indirectly to a side chain of at least one amino acid residue of the /i-amyloid peptide of the compound.
In one aspect, this invention also provides a a-amyloid modulator compound comprising an A~ aggregation core domain (ACD) coupled directly or indirectly to at least one modifying group (MG) such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ,~-amyloid peptides when contacted with the natural ~-amyloid peptides. Preferably, the A~ aggregation core domain is modeled after a subregion of natural (3-amyloid peptide between 3 and 10 amino acids in length.
In one aspect, the invention provides a ~i-amyloid modulator compound consisting of an AFB aggregation core domain (ACD) from 4 to 7 amino acids in length and modeled after amino acid positions 17 to 20 of natural (3-amyloid peptide coupled directly or indirectly to at least one modifying group (MG) that is not naturally coupled to natural ~i-amyloid peptides in their native form such that the compound modulates the aggregation or inhibits the neurotoxicity of natural /3-amyloid peptides when contacted with the natural ~-amyloid peptides, wherein said ~3-amyloid modulator compound comprises at least one D amino acid residue.
In another aspect, the invention provides a ~3-amyloid modulator compound consisting of an AS aggregation core domain (ACD) modeled after amino acid positions 17 to 20 of natural ~-amyloid peptide coupled directly or indirectly to at least one modifying group (MG) that is not naturally coupled to natural /3-amyloid peptides in their native form such that the compound modulates the aggregation or inhibits the neurotoxicity of natural (3-amyloid peptides when contacted with the natural ~-amyloid peptides, wherein said ~8-amyloid modulator compound is from 4 to 7 amino acids in length.
In one aspect, the invention also provides (3-amyloid modulator compound comprising a formula:
n ( Y-Xaal-Xaa2-Xaa3-Z
wherein Xaal, Xaa2 and Xaa3 are each amino acid structures and at least two of Xaa,, Xaa2 and Xaa3 are, independently, selected from the group consisting of a leucine structure, a phenylalanine structure and a valine structure;
Y, which may or may not be present, is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to 15;
Z, which may or may not be present, is a peptidic structure having the formula (Xaa~, wherein Xaa is any amino acid structure and b is an integer from 1 to 15; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
5 Xaa,, Xaa2, Xaa3, Y, Z, A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural a-amyloid peptides when contacted with the natural ~-amyloid peptides. In a preferred embodiment, Xaal and Xaa2 are each phenylalanine structures. In another preferred embodiment, Xaa2 and Xaa3 are each phenylalanine structures. In another aspect, at least one of Xaa,, Xaa2, and Xaa3 is a D-amino acid.
In one aspect, this invention further provides a ~B-amyloid modulator compound comprising a formula:
n Y xaa~_Xaa2_Xaa3_Xaa4_Z
wherein Xaa, and Xaa3 are amino acid structures;
Xaa2 is a valine structure;
Xaa4 is a phenylalanine structure;
Y, which may or may not be present, is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to 15;
Z, which may or may not be present, is a peptidic structure having the formula (Xaa~,, wherein Xaa is any amino acid structure and b is an integer from 1 to 15; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
Xaa~, Xaa3, Y, Z, A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ~-amyloid peptides when contacted with the natural (3-amyloid peptides. In a preferred embodiment, Xaal is a leucine structure and Xaa3 is phenylalanine structure. In another aspect, at least one of Xaa~, Xaa2, Xaa3, and Xaa4 is a D-amino acid.
In one aspect, the invention still further provides a compound comprising the formula:
A-Xaa~-Xaa2-Xaa3-Xaa4-Xaas-Xaab-Xaa~-XaaB-B
wherein Xaa, is a histidine structure;
Xaa2 is a glutamine structure;
Xaa3 is a lysine structure;
Xaa4 is a leucine structure;
Xaas is a valine structure;
Xaa6 is a phenylalanine structure;
Xaa~ is a phenylalanine structure;
Xaag is an alanine structure;
A and B are modifying groups attached directly or indirectly to the amino terminus and carboxy terminus, respectively, of the compound;
and wherein Xaa~-Xaaz-Xaa3, Xaa,-Xaa2 or Xaa, may or may not be present;
Xaag may or may not be present; and at least one of A and B is present.
In a further aspect, said ~-amyloid modulator compound is from 4 to 7 amino acids in length.
In one aspect, the modifying groups A and B are groups that are not naturally coupled to natural ~i-amyloid peptides in their native form.
In one aspect, said compound comprises at least one D-amino acid residue.
In one aspect, the invention still further provides a S-amyloid modulator compound comprising a modifying group attached directly or indirectly to a peptidic structure, wherein the peptidic structure comprises amino acid structures having an amino acid sequence selected from the group consisting of His-Gln-Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 5), His-Gln-Lys-Leu-Val-Phe-Phe (SEQ ID NO: 6), Gln-Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO:
7), Gln-Lys-Leu-Val-Phe-Phe (SEQ ID NO: 8), Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 9), Lys-Leu-Val-Phe-Phe (SEQ ID NO: 10), Leu-Val-Phe-Phe-Ala (SEQ ID NO: 11), Leu-Val-Phe-Phe (SEQ ID NO: 12), Leu-Ala-Phe-Phe-Ala (SEQ ID NO: 13), Val-Phe-Phe (SEQ ID NO:
19), Phe-Phe-Ala (SEQ ID NO: 20), Phe-Phe-Val-Leu-Ala (SEQ ID NO: 21), Leu-Val-Phe-Phe-Lys (SEQ ID NO: 22), Leu-Val-Iodotyrosine-Phe-Ala (SEQ ID NO: 23), Val-Phe-Phe-Ala (SEQ >D NO: 24), Ala-Val-Phe-Phe-Ala (SEQ ID NO: 25), Leu-Val-Phe-Iodotyrosine-Ala (SEQ ID NO: 26), Leu-Val-Phe-Phe-Ala-Glu (SEQ ID NO: 27), Phe-Phe-Val-Leu (SEQ
ID
NO: 28), Phe-Lys-Phe-Val-Leu (SEQ ID NO: 29), Lys-Leu-Val-Ala-Phe (SEQ ID NO:
30), Lys-Leu-Val-Phe-Phe-(3Ala (SEQ ID NO: 31) and Leu-Val-Phe-Phe-DAIa (SEQ ID NO:
32).
In one aspect, said /3-amyloid modulator compound comprises at least one D-amino acid residue.
In the compounds of the invention comprising a modifying group, preferably the modifying group comprises a cyclic, heterocyclic or polycyclic group.
Preferred modifying groups contain a cis-decalin group, such as a cholanoyl structure. Preferred modifying groups include a cholyl group, a biotin-containing group, a diethylene-triaminepentaacetyl group, a (-)-menthoxyacetyl group, a fluorescein-containing group or an N-acetylneuraminyl group.
The compounds of the invention can be further modified, for example to alter a pharmacokinetic property of the compound or to label the compound with a detectable substance. Preferred radioactive labels are radioactive iodine or technetium.
In one aspect, the invention also provides a /3-amyloid modulator which inhibits S aggregation of natural (3-amyloid peptides when contacted with a molar excess amount of natural /3-amyloid peptides.
In one aspect, the invention also provides a S-amyloid peptide compound comprising an amino acid sequence having at least one amino acid deletion compared to ~AP,_39, such that the compound inhibits aggregation of natural /3-amyloid peptides when contacted with the natural ~3-amyloid peptides. In one embodiment, the compound has at least one internal amino acid deleted compared to /3AP1_39. In another embodiment, the compound has at least one N-terminal amino acid deleted compared to aAP,_39. In yet another embodiment, the compound has at least one C-terminal amino acid deleted compared to /iAP,_39. Preferred compounds include (3AP6_ZO (SEQ ID NO: 13), ~iAPl6-30 (SEQ ID NO: 14), (3AP~_ZO,26~o (SEQ ID NO: 1 S) 1 S and EEWHHHHQQ-~3AP,6_4o (SEQ ID NO: 16).
The compounds of the invention can be formulated into pharmaceutical compositions comprising the compound and a pharmaceutically acceptable carrier. The compounds can also be used in the manufacture of a medicament for the diagnosis or treatment of an amyloidogenic disease.
Another aspect of the invention pertains to diagnostic and treatment methods using the compounds of the invention. The invention provides a method for inhibiting aggregation of natural ~-amyloid peptides, comprising contacting the natural (3-amyloid peptides with a compound of the invention such that aggregation of the natural ~i-amyloid peptides is inhibited. T'he invention also provides a method for inhibiting neurotoxicity of natural (3-amyloid peptides, comprising contacting the natural ~i-amyloid peptides with a compound of the invention such that neurotoxicity of the natural /3-amyloid peptides is inhibited.
In another embodiment, the invention provides a method for detecting the presence or absence of natural (3-amyloid peptides in a biological sample, comprising contacting a biological sample with a compound of the invention and detecting the compound bound to natural a-amyloid peptides to thereby detect the presence or absence of natural ~i-amyloid peptides in the biological sample. In one embodiment, the /3-amyloid modulator compound and the biological sample are contacted in vitro. In another embodiment, the a-amyloid modulator compound is contacted with the biological sample by administering the a-amyloid 7a modulator compound to a subject. For in vivo administration, preferably the compound is labeled with radioactive technetium or radioactive iodine.
In another embodiment, the invention provides a method for detecting natural /3-amyloid peptides to facilitate diagnosis of a ~3-amyloidogenic disease, comprising contacting S a biological sample with a compound of the invention and detecting the compound bound to natural (3-amyloid peptides to facilitate diagnosis of a ~-amyloidogenic disease. In one embodiment, the (3-amyloid modulator compound and the biological sample are contacted in vitro. In another embodiment, the (3-amyloid modulator compound is contacted with the biological sample by administering the ~-amyloid modulator compound to a subject. For in vivo administration, preferably the compound is labeled with radioactive technetium or radioactive iodine. Preferably, the method facilitates diagnosis of Alzheimer's disease.
In one aspect, the invention also provides a method for treating a subject for a disorder associated with amyloidosis, comprising administering to the subject a therapeutically or prophylactically effective amount of a compound of the invention such that the subject is treated for a disorder associated with amyloidosis. The method can be used to treat disorders is selected, for example, from the group consisting of familial amyloid polyneuropathy (Portuguese, Japanese and Swedish types), familial amyloid cardiomyopathy (Danish type), isolated cardiac amyloid, systemic senile amyloidosis, scrapie, bovine spongiform encephalopathy, Creutzfeldt-Jakob disease, Gerstmann-Straussler-Scheinker syndrome, adult onset diabetes, insulinoma, isolated atrial amyloidosis, idiopathic (primary) amyloidosis, myeloma or macroglobulinemia-associated amyloidosis, primary localized cutaneous nodular amyloidosis associated with Sjogren's syndrome, reactive (secondary) amyloidosis, familial Mediterranean Fever and familial amyloid nephropathy with urticaria and deafness (Muckle-Wells syndrome), hereditary cerebral hemorrhage with amyloidosis of Icelandic type, amyloidosis associated with long term hemodialysis, hereditary non-neuropathic systemic amyloidosis (familial amyloid polyneuropathy III), familial amyloidosis of Finnish type, amyloidosis associated with medullary carcinoma of the thyroid, fibrinogen-associated hereditary renal amyloidosis and lysozyme-associated hereditary systemic amyloidosis.
In a preferred embodiment, the invention provides a method for treating a subject for a disorder associated with a-amyloidosis, comprising administering to the subject a therapeutically or prophylactically effective amount of a compound of the invention such that the subject is treated for a disorder associated with (3-amyloidosis.
Preferably the disorder is Alzheimer's disease.
7b In yet another embodiment, the invention provides a method for treating a subject for a disorder associated with (3-amyloidosis, comprising administering to the subject a recombinant expression vector encoding a peptide compound of the invention such that the compound is synthesized in the subject and the subject is treated for a disorder associated with ~i-arnyloidosis. Preferably, the disorder is Alzheimer's disease.
In one aspect, the invention provides a commercial package containing a ~i-amyloid modulator compound as described herein, together with instructions for its use for the treatment of a disorder associated with ~i-amyloidosis. Preferably, said disorder is Alzheimer's disease.
In a further aspect, the invention provides a method for inhibiting aggregation of natural (3-amyloid peptides, comprising contacting the natural (3-amyloid peptides with a /3-amyloid modulator compound as described herein, such that aggregation of the natural (3-amyloid peptides is inhibited.
In another aspect, the invention provides use of the S-amyloid modulator compound as described herein, for the treatment of a disorder associated with (3-amyloidosis.
In a further aspect, the invention provides use of the ~3-amyloid modulator compound as described herein, for the manufacture of a medicament for the treatment of a disorder associated with (3-amyloidosis.
Brief Descr~~otion of the Draw~na Figure 1 is a graphic representation of the turbidity of a ~-AP ~ ~o solution, as measured by optical density at 400 nm, either in the absence of a ~-amyloid modulator or in the presence of the (3-amyloid modulator N-biotinyl-~iAP~~o (1 %, or 5%).
Figure 2 is a schematic representation of compounds which can be used to modify a ~3-AP or an A~i aggregation core domain to form a ~3-amyloid modulator of the invention.
Figure 3 is a graphic representation of the toxicity of A~i ~..4o aggregates.
but not A~i ~ ~o monomers, to cultured neuronal cells.
Figure 4 is a graphic representation of the aggregation of A~ i~o in the presence of an equimolar amount of cholyl-A~i6.2o (panel A), a -2-fold molar excess of cholyl-A(3~2o (panel B) or a ~6-fold molar excess of cholyl-A(36-20 (panel C) and the corresponding toxicity of the aggregates of panels A. B and C to cultured neuronal cells (panels D. E
and F, respectively).
Detailed Description of the Invention This invention pertains to compounds. and pharmaceutical compositions thereof, that can modulate the aggregation of amyloidogenic proteins and peptides. in particular compounds that can modulate the aggregation of natural ~3 amyloid peptides (~i-AP) and inhibit the neurotoxicity of natural (3-APs. A compound of the invention that modulates aggregation of natural (3-AP, referred to herein interchangeably as a ~i amyloid modulator compound. a (3 amyloid modulator or simply a modulator. alters the aggregation of natural [3-AP when the modulator is contacted with natural ~i-AP. Thus. a compound of the invention acts to alter the natural aggregation process or rate for (3-AP. thereby disrupting this process.
Preferably. the compounds inhibit ~i-AP aggregation. Furthermore. the invention provides subregions of the ~i amyloid peptide that are sufficient. when appropriately modified as described herein. to alter (and preferably inhibit) aggregation of natural p amyloid peptides when contacted with the natural ~i amyloid peptides. In particular. preferred modulator compounds of the invention are comprised of a modified form of an A~i aggregation core domain, modeled after the aforementioned A~i subregion (as described further below). which is sufficient to alter (and preferably inhibit) the natural aggregation process or rate for (3-AP.
This A/3 aggregation core domain can comprises as few as three amino acid residues (or derivative, analogues or mimetics thereof). Moreover. while the amino acid sequence of the A~i aggregation core domain can directly correspond to an amino acid sequence found in natural ~i-AP, it is not essential that the amino acid sequence directly correspond to a (3-AP
sequence. Rather, amino acid residues derived from a preferred subregion of ~-AP (a hydrophobic region centered around positions 17-20) can be rearranged in order and/or substituted with homologous residues within a modulator compound of the invention and yet maintain their inhibitory activity (described further below).
w The $ amyloid modulator compounds of the invention can be selected based upon their ability to inhibit the aggregation of nauual (3-AP in vitro and/or iahibit the netu~otoxicity of natural (3-AP fibrils for cultured cells (using assays described herein).
Accordingly, the preferred modulator compounds inhibit the aggregation of natural (3-AP and/or inhibit the neurotoxicity of natural (3-AP. However, modulator compounds selected based on one or both of these properties may have additional properties in vivo that may be beneficial in the treatment of amyloidosis. For example, the modulator compound may interfere with processing of natural (3-AP (either by direct or indirect protease inhibition) or by modulation of processes that produce toxic ~i-AP, or other APP firagments, in vivo.
Alternatively, modulator compounds may be selected based on these latter properties, rather than inhibition of A(3 aggregation in vitro. Moreover. modulator compounds of the invention that are selected based upon their interaction with natural (3-AP also may interact with APP or with other APP fragments.
As used herein. a "modulator" of (3-amyloid aggregation is intended to refer to an agent that, when contacted with natural ~3 amyloid peptides. alters the aggregation of the natural (3 amyIoid peptides. The term "aggregation of ~i amyloid peptides"
refers to a process whereby the peptides associate with each other to form a multimeric, largely insoluble complex. The term "aggregation" further is intended to encompass ~i amyloid fibril formation and also encompasses ~-amyloid plaques.
- The terms "natural p-amyloid peptide", "natural (3-AP" and "natural A(i peptide", used interchangeably herein, are intended to encompass naturally occurring proteolytic cleavage products of the ~i amyloid precursor protein (APP) which are involved in [3-AP
aggregation and ~i-amylvidosi$. These natural peptides include ~i-amyloid peptides having 39-43 amino acids (i.e., A(3~-;g, A(3i~p, A~i~.~~. A~i»~ and A(3~.4;). The amino-terminal amino acid residue of natural ~i-AP corresponds to the aspartic acid residue at position 672 of the 770 amino acid residue fotzn of the amyloid precursor protein ("APP-770"). The 43 amino acid long form of natural ~i-AP has the amino acid sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGWIAT
(also shown in SEQ ID NO: 1 ), whereas the shorter forms have 1-4 amino acid residues deleted from the carboxy-tezZninal end. The amino acid sequence of APP-770 from position 672 (l. e., the amino-terminus of natural p-AP) to its C-terminal end ( 103 amino acids) is shown in SEQ ID NO: 2. The preferred form of natural (3-AP for use in the aggregation assays described herein is A~il.~o.
In the presence of a modulator of the invention, aggregation of natural ~
amyloid peptides is "altered" or "mpdulated". The various forms of the term "alteration" or "modulation" are intended to encompass both inhibition of ~3-AP aggregation and promotion of ~i-AP aggregation. Aggregation of natural (3-AP is "inhibited" in the presence of the modulator when there is a decrease in the amount andlor rate of (3-AP
aggregation as compared to the amount and/or rate of (3-AP aggregation in the absence of the modulator.
..
The various-forms of the term "inhibition" are intended to include both complete and partial inhibition of ~i-AP aggregation. Inhibition of aggregation can be quantitated as the fold increase in the lag time for aggregation or as the decrease in the overall plateau level of aggregation (t. e., total amount of aggregation), using an aggregation assay as described in the Examples. In various embodiments, a modulator of the invention increases the lag time of aggregation at least 1.2-fold, I .5-fold, 1.8-fold, 2-fold, 2.5-fold, 3-fold, 4-fold or 5-fold. In various other embodiments, a modulator of the invention inhibits the plateau level of aggregation at least 10%, 20%, 30%, 40 %, SO %, 75 % or 100 %.
A modulator which inhibits ~i-AP aggregation (an "inhibitory modulator compound") can be used to prevent or delay the onset of ~i-amyloid deposition. Moreover, as demonstrated in Example 10, inhibitory modulator compounds of the invention inhibit the formation andlor activity of neurotoxic aggregates of natural A/3 peptide (t.
e., the inhibitory compounds can be used to inhibit the neurotoxicity of ~3-AP). Still further, also as demonstrated in Example 10. the inhibitory compounds of the invention can be used to I 5 reduce the neurotoxicity of preformed ~i-AP aggregates. indicating that the inhibitory modulators can either bind to preformed A~i fibrils or soluble aggregate and modulate their inherent neurotoxicity or that the modulators can perturb the equilibrium between monomeric and aggregated forms of (3-AP in favor of the non-neurotoxic form.
Alternatively, in another embodiment, a modulator compound of the invention promotes the aggregation of natural A(i peptides. The various forms of the term "promotion"
refer to an increase in the amount and/or rate of ~i-AP aggregation in the presence of the modulator. as compared to the amount and/or rate of (3-AP aggregation in the absence of the modulator. Such a compound which promotes Aj3 aggregation is referred to as a stimulatory modulator compound. Stimulatory modulator compounds may be useful for sequestering ~3-amyloid peptides. for example in a biological compartment where aggregation of (3 :AP may not be deleterious to thereby deplete (3-AP from a biological compartment where aggregation of ~i-AP is deleterious. Moreover, stimulatory modulator compounds can be used to promote A~3 aggregation in in vitro aggregation assays (e.g., assays such as those described in the Examples), for example in screening assays for test compounds that can then inhibit or reverse this A~ aggregation (i.e., a stimulatory modulator compound can act as a "seed" to promote the formation of A(3 aggregates).
In a preferred embodiment, the modulators of the invention are capable of altering ~i-AP aggregation when contacted with a molar excess amount of natural ~3-AP. A
"molar excess amount of natural ~i-AP" refers to a concentration of natural (3-AP, in moles, that is greater than the concentration, in moles, of the modulator. For example, if the modulator and ~i-AP are both present at a concentration of I ~tM, they are said to be "equimolar", whereas if the modulator is present at a concentration of 1 ~M and the ~i-AP is present at a concentration of 5 ~M. the ~-AP is said to be present at a 5-fold molar excess amount compared to the modulator. in preferred embodiments, a modulator of the invention is effective at altering natural ~3-AP aggregation when the natural (3-AP is present at at least a 2-fold, 3-fold or 5-fold mole excess compared to the concentration of the modulator. In other embodiments, the modulator is effective at altering ~i-AP aggregation when the natural ~i-AP is present at at least a 10-fold, 20-fold, 33-fold, 50-fold, 100-fold, 500-fold or 1000-fold molar excess compared to the concentration of the modulator.
Various additional aspects of the modulators of the invention. and the uses thereof, are described in further detail in the following subsections.
I. Modulator Compounds In one embodiment, a modulator of the invention comprises a (3-amyloid peptide compound comprising the formula:
n ( Xaa wherein Xaa is a (3-amyloid peptide. A is a modulating group attached directly or indirectly to the (3-amyloid peptide of the compound such that the compound inhibits aggregation of natural (3-amyloid peptides when contacted with the natural (3-amyloid peptides, and n is an integer selected such that the compound inhibits aggregation of natural (3-amyloid peptides when contacted with the natural (i-amyloid peptides.
Preferably, (3-amyloid peptide of the compound has an amino-terminal amino acid residue corresponding to position 668 of (3-amyloid precursor protein-770 (APP-770) or to a residue carboxy-terminal to position 668 of APP-770. The amino acid sequence of APP-770 from position 668 to position 770 (i.e., the carboxy terminus) is shown below and in SEQ ID
NO: 2:
EVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
More preferably, the amino-terminal amino acid residue of the ~3-amyloid peptide corresponds to position 672 of APP-770 (position ~ of the amino acid sequence of SEQ ID
NO: 2) or to a residue carboxy-terminal to position 672 of APP-770. Although the ~-amyloid peptide of the compound may encompass the 103 amino acid residues corresponding to positions 668-770 of APP-770, preferably the peptide is between 6 and 60 amino acids in length, more preferably between 10 and 43 amino acids in length and even more preferably between 10 and 2~ amino acid residues in length.
As used herein, the term "~i amyloid peptide", as used in a modulator of the invention is intended to encompass peptides having an amino acid sequence identical to that of the natural sequence in APP, as well as peptides having acceptable amino acid substitutions from the natural sequence. Acceptable amino acid substitutions are those that do not affect the ability of the peptide to slur natural (3-AP alggregation. Moreover, particular amino acid substitutions may further contribute to the ability of the peptide to alter nanual p-AP
aggregation and/or may confer additional beneficial properties on the peptide (e.g., increased solubility, reduced association with other amyloid proteins, etc.). For example. substitution of hydrophobic amino acid residues for the two phenylalanine residues at positions 19 and 20 of natural (3-AP (positions 19 and 20 of the amino acid sequence shown in SEQ
ID NO: 1 ) may further contribute to the ability of the peptide to alter ~i-AP
aggregation (see Hilbich, C.
(1992) J. Mol. Biol. 228:460-473). Thus, in one embodiment, the (i-AP of the compound consists of the amino acid sequence shown below and in SEQ ID NO: 3:
DAEFRHDSGYEVHHQKLV(Xaal9)(Xaa2o)AEDVGSNKGAIIGLMVGGWIAT
(or an amino-terminal or carboxy-terminal deletion thereof), wherein Xaa is a hydrophobic amino acid. Examples of hydrophobic amino acids are isoleucine. leucine.
threonine. serine.
alanine. valine or glycine. Preferably, F ~ 9F~o is substituted with T ~ gT~o or G ~ 9I2o~
Other suitable amino acid substitutions include replacement of amino acids in the human peptide with the corresponding amino acids of the rodent (3 :AP peptide.
The three amino acid residues that differ between human and rat (3-AP are at positions ~. 10 and 13 of the amino acid sequence shown in SEQ ID NOs: 1 and 3. A human ~3-AP having the human to rodent substitutions Argg to Gly, Tyro to Phe and Hisl3 to Arg has been shown to retain the properties of the human peptide (see Fraser, P.E. et al. (1992) Biochemistry 31:10716-10723: and Hilbich. C. et al. ( 1991 ) Eur. J. Biochem. 201:61-69).
Accordingly. a human ~i-AP having rodent ~i-AP a.a. substitutions is suitable for use in a modulator of the invention.
Other possible ~i-AP amino acid substitutions are described in Hilbich. C. et al.
(1991) J. Mol. Biol. 218:149-163: and Hilbich. C. (1992) J. Mol. Biol. ?28:460-473.
Moreover, amino acid substitutions that affect the ability of ~i-AP to associate with other proteins can be introduced. For example, one or more amino acid substitutions that reduce the ability of ~-AP to associate with the serpin enzyme complex (SEC) receptor, a 1-antichymotrypsin (ACT) and/or apolipoprotein E (ApoE) can be introduced. A
preferred substitution for reducing binding to the SEC receptor is L34M35 to A;4A35 (at positions 34 and 35 of the amino acid sequences shown in SEQ ID NOs: 1 and 3). A preferred substitution for reducing binding to ACT is Sg to Ag (at position 8 of the amino acid sequences shown in SEQ ID NOs: 1 and 3).
Alternative to (3- .AP amino acid substitutions described herein or known in the art. a modulator composed. at least in part, of an amino acid-substituted (3 amyloid peptide can be prepared by standard techniques and tested for the ability to alter (3-AP
aggregation using an aggregation assay described herein. To retain the properties of the original modulator, preferably conservative amino acid substitutions are made at one or more amino acid residues. A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valise, leucine, isoleucine, proline, phenylslanine, methionine, tryptophan), ~-branched side chains (e.g., threonine, valise, isoleucine) and aromatic side chains (e.g., tyrosine, phcnylalanine, tryptophan, histidine).
Accordingly, a modulator composed of a ~i amyloid peptide having an amino acid sequence that is mutated from that of the wild-type sequence in APP-770 yet which still retains the ability to alter natural ~i-AP aggregation is within the scope of the invention.
As used herein, the term "~3 amyloid peptide" is further intended to include peptide analogues or peptide derivatives or pegtidomimetics that retain the ability to alter natural ~i-AP aggregation as described herein. For example, a (3 amyloid peptide of a modulator of the invention may be modified to increase its stability. bioavailability, solubility, etc. The terms "peptide analogue", "peptide derivative" and "peptidomimetic" as used herein are intended to include molecules which mimic the chemical structure of a peptide and retain the functional properties of the peptide. Approaches to designing peptide analogs are known in the art. For example, see Farmer, P.S. in drug; D~sig~ (E.J. Ariens. ed.) Academic Press, New York, 1980, vol. 10, pp. 119-143; Ball. J.B. and Alewood, P.F. (1990) J. Mol.
Recognition 3_:55;
Morgan, B.A. and Gainor, J.A. ( 1989) Ann. Rep. Med Chem. 24:243; and Freidinger, R.M.
(1989) Trendy Pharmacol. Sci. 10:270. Examples of peptide analogues, derivatives and peptidomimetics include peptides substituted with one or more benzodiazepine molecules (see e.g., James. G.L. et al. (1993) Science 260:1937-1942), peptides with methylated amide linkages and "retro-inverso" peptides (see U.S. Patent No. 4.522.752 by Sisto). Peptide analogues, peptide derivatives and peptidomimetic are described in further detail below with regard to compounds comprising an A~ aggregation core domain.
In a modulator of the invention having the formula shown above, a modulating group ("A") is attached directly or indirectly to the (3-amyloid peptide of the modulator (As used herein, the term "modulating group" and "modifying group" are used interchangeably to describe a chemical croup directly or indirectly attached to an A~i derived peptidic structure).
For example, the modulating group can be directly attached by covalent coupling to the ~i-amyloid peptide or the modulating group can be attached indirectly by a stable non-covalent association. In one embodiment of the invention, the modulating group is attached to the amino-terminus of the ~i-amyloid peptide of the modulator. Accordingly, the modulator can comprise a compound having a formula:
A-~-{ Xaa Alternatively, in another embodiment of the invention, the modulating group is attached to the carboxy-terminus of the (3-amyloid peptide of the modulator. Accordingly, the modulator can comprise a compound having a formula:
O
( Xaa ) ~-A
In yet another embodiment, the modulating group is attached to the side chain of at least one amino acid residues of the ~i-amyloid peptide of the compound (e.g., through the epsilon amino group of a lysyl residue(s), through the carboxyl group of an aspartic acid residues) or a glutamic acid residue(s), through a hydroxy group of a tyrosyl residue(s). a serine residues) or a threonine residues) or other suitable reactive group on an amino acid side chain).
The modulating group is selected such that the compound inhibits aggregation of natural ~i-amyloid peptides when contacted with the natural (i-amyloid peptides.
Accordingly. since the ~3-AP peptide of the compound is modified from its natural state- the modulating group "A" as used herein is not intended to include hydrogen. In a preferred embodiment. the modulating group is a biotin compound of the formula:
W
~X~
~X
O
X;~R~-C-Y
wherein X1-X; are each independently selected from the group consisting of S.
O and NR,.
wherein R~ is hydrogen. or an aryl, lower alkyl, alkenyl or alkynyl moiety; VV
is =O or NR2; R~ is a lower alkylenyl moiety and Y is a direct bond or a spacer molecule selected for its ability to react with a target group on a ~i-AP. At least one of Xl-X3 or W is an NR~
group.
The term "aryl" is intended to include aromatic moieties containing substituted or uasubstituted ring(s), e.g., benzyl, napthyl, etc. Other more complex fused ring moieties also are intended to be included.
The term "lower alkyl or alkylenyl moiety" refers to a saturated, straight or branched chain (or combination thereof] hydrocarbon containing 1 to about 6 carbon atoms, more preferably from 1 to 3 carbon atoms. The terms "lower alkenyl moiety" and "lower alkynyl moiety" refer to unsaturated hydrocarbons containing 1 to about 6 carbon atoms, more preferably 1 to 3 carbon atoms. Preferably, R2 contains 1 to 3 carbon atoms.
Preferably, R~
contains 4 carbon atoms.
The-spacer molecule (~ can be, for lex5ample, a lower alkyl gmup or a linker peptide.
and is preferably selected for its ability to link with a free amino group (e.g., the oc-amino group at the amino-terminus of a ~i-AP). Thus, in a preferred embodiment, the biotin compound modifies the amino-terminus of a ~3-amyloid peptide.
Additional suitable modulating groups may include other cyclic and heterocyclic compounds and other compounds having similar steric "bulk". Non-limiting examples of compounds which can be used to modify a ~3-AP are shown schematically in Figure 2, and include N acetylneuraminic acid, cholic acid, traps-4-cotininecarboxylic acid, 2-imino-1-imidazolidineacetic acid, (S')-(-~indoline-2-carboxylic acid, (-~menthoxyacetic acid. 2-norbornaneacetic acid, Y-oxo-5-acenaphthenebutyric acid, (-~2-oxo-4-thiazolidinecarboxylic acid, tetrahydro-3-furoic acid, 2-iminobiotin-N hydroxysuccinimide ester, diethylenetriaminepentaacetic dianhydride, 4-morpholinecarbonyl chloride, 2-thiopheneacetyl chloride, 2-thiophenesulfonyl chloride, S-(and 6-~carboxyfluorescein (succinimidyl ester), fluorescein isothiocyanate. and acetic acid (or derivatives thereof).
Suitable modulating groups are described further in subsection II below.
In a modulator of the invention. a single modulating group may be attached to a ~i-amyloid peptide (e.g., n=1 in the formula shown above) or multiple modulating groups may be attached to the peptide. The number of modulating groups is selected such that the compound inhibits aggregation of natural ~i-amyloid peptides when contacted with the natural (3-amyloid peptides. However, n preferably is an integer between l and 60, more preferably between l and 30 and even more preferably between l and 10 or 1 and 5.
In another embodiment, a ~i-amyloid modulator compound of the invention comprises an A~3 aggregation core domain (abbreviated as ACD) coupled directly or indirectly to a modifying group such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ~i-amyloid peptides when contacted with the natural ~3-amyloid peptides. As used herein, an "A(3 aggregation core domain" is intended to refer to a structure that is modeled after a subregion of a natural (3-arnyloid peptide which is sufficient to modulate aggregation of natural ~i-APs when this subregion of the natural (3-AP is appropriately modified as described herein (e.g., modified at the amino-terminus). The term "subregion of a natural (3-amyloid peptide" is intended to include amino-terminal and/or carboxy-terminal deletions of natural ~3-AP. The term "subregion of natural (3-AP" is not intended to include full-length natural ~i-AP (i.e., "subregion" does not include Aft-39, A~1-40~ A~31-41~ Apl-42 ~d A~31-43)~
Although not intending to be limited by mechanism, the ACD of the modulators of the invention is thought to confer a specific targeting function on the compound that allows the compound to recognize and specifically interact with natural (3-AP.
Preferably, the ACD
is modeled after a subregion of natural ~i-AP that is less than 15 amino acids in length and more preferably is between 3-10 amino acids in length. In various embodiments, the ACD is modeled after a subregion of (3-AP that is 10, 9, 8, 7, 6, 5, 4 or 3 amino acids in length. In one embodiment, the subregion of ~i-AP upon which the ACD is modeled is an internal or carboxy-terminal region of ø-AP (i.e., downstream of the amino-terminus at amino acid position 1 ). In another embodiment, the ACD is modeled after a subregion of (3-AP that is hydrophobic. In certain specific embodiments, the term Ap aggregation core domain specifically excludes ~i-AP subregions corresponding to amino acid positions 1-15 (A~i1.15)~
6-20 (A~6_20) and 16-40 (A~iI~O).
An A(3 aggregation core domain can be comprised of amino acid residues linked by peptide bonds. That is, the ACD can be a peptide corresponding to a subregion of ~i-AP.
Alternatively, an A~i aggregation core domain can be modeled after the natural A~i peptide region but may be comprised of a peptide analogue, peptide derivative or peptidomimetic compound. or other similar compounds which mimics the structure and function of the natural peptide. Accordingly, as used herein, an "A~3 aggregation core domain"
is intended to include peptides. peptide analogues, peptide derivatives and peptidomimetic compounds which. when appropriately modified. retain the aggregation modulatory activity of the modified natural A(3 peptide subregion. Such structures that are designed based upon the amino acid sequence are referred to herein as "A~i derived peptidic structures." Approaches to designing peptide analogues, derivatives and mimetics are known in the art.
For example, see Farmer, P.S. in Drub Design (E.J. Ariens, ed.) Academic Press. New York.
1980. vol. 10, pp. 119-143; Ball. J.B. and Alewood, P.F. (1990) J. Mol. Recognition 3:~5;
Morgan, B.A.
and Gainor. J.A. ( 1989) Ann. Rep. Med Chem. 24:243; and Freidinger, R.M. ( 1989) Trends Pharmacol. Sci. 10:270. See also Sawyer. T.K. ( 1995) "Peptidomimetic Design and Chemical Approaches to Peptide Metabolism" in Taylor, M.D. and Amidon. G.L.
(eds.) Peptide-Based Drug Design: Controlling Transport and Metabolism. Chapter 17:
Smith. A.B.
3rd. et al. (1995) J. Am. Chem. Soc. 117:11113-11123: Smith. A.B. 3rd, et al.
(1994) J. Am.
Chem. Soc. 116:9947-9962; and I~iirschman. R., et al. (1993) J. Am. Chem. Soc.
11~:12550-12568.
As used herein, a "derivative" of a compound X (e.g., a peptide or amino acid) refers to a form of X in which one or more reaction groups on the compound have been derivatized with a substituent group. Examples of peptide derivatives include peptides in which an amino acid side chain. the peptide backbone, or the amino- or carboxy-terminus has been derivatized (e.g., peptidic compounds with methylated amide linkages). As used herein an "analogue" of a compound X refers to a compound which retains chemical structures of X
necessary for functional activity of X yet which also contains certain chemical structures which differ from X. An examples of an analogue of a naturally-occurring peptide is a peptides which includes one or more non-naturally-occurring amino acids. As used herein, a "mimetic" of a compound X refers to a compound in which chemical structures of X
necessary for functional activity of X have been replaced with other chemical structures which mimic the conformation of X. Examples of peptidomimetics include peptidic compounds in which the peptide backbone is substituted with one or more benzodiazepine molecules (see e.g., James, G.L. et al. (1993) Science x:1937-1942), peptides in which all L-amino acids arc substituted with the corresponding D-amino acids and "retro-inverso"
peptides (see U.S. Patent No. 4,522,752 by Sisto), described further below.
The term mimetic, and in particular, peptidomimetic, is intended to include isosteres.
The term "isostere" as used herein is intended to include a chemical structure that can be substituted for a second chemical structure because the steric conformation of the first structure fits a binding site specific for the second structure. The term specifically includes peptide back-bone modifications (i.e., amide bond mimetics) well known to those skilled in the art. Such modifications include modifications of the amide nitrogen, the a-carbon. amide carbonyl, complete replacement of the amide bond, extensions, deletions or backbone crosslinks. Several peptide backbone modifications are known, including yr[CH2S], yr [CH.,NH], yr[CSNH2], yr[NHCO], yr[COCH,], and yr[(E) or (Z) CH=CH]. In the nomenclature used above, yr indicates the absence of an amide bond. The structure that replaces the amide group is specified within the brackets. Other examples of isosteres include peptides substituted with one or more benzodiazepine molecules (see e.g., James, G.L. et al. (1993) Science x,60:1937-1942) Other possible modifications include an N-alkyl (or aryl) substitution (fir[CONR]), backbone crosslinking to construct lactams and other cyclic structures.
substitution of all D-amino acids for all L-amino acids within the compound ("inverso" compounds) or retro-inverso amino acid incorporation (~y[NHCO]). By "inverso" is meant replacing L-amino acids of a sequence with D-amino acids, and by "retro-inverso" or "enantio-retro" is meant reversing the sequence of the amino acids ("retro") and replacing the L-amino acids with D-amino acids. For example, if the parent peptide is Thr-Ala-Tyr, the retro modified form is Tyr-Ala-Thr. the inverso form is thr-ala-tyr, and the retro-inverso form is tyr-ala-thr (lower case letters refer to D-amino acids). Compared to the parent peptide. a term-inverso peptide has a reversed backbone while retaining substantially the original spatial conformation of the side chains, resulting in a retro-inverso isomer with a topology that closely resembles the parent peptide. See Goodman et al. "Perspectives in Peptide Chemistry" pp. 283-(1981 ). See also U.S. Patent No. 4,522.752 by Sisto for further description of "retro-inverso"
peptides.
Other derivatives of the modulator compounds of the invention include C-terminal hydroxymethyl derivatives, O-modified derivatives (e.g., C-terminal hydroxymethyl benzyl ether), N-terminally modified derivatives including substituted amides such as alkylamides and hydrazides and compounds in which a C-terminal phenylalanine residue is replaced with a phenethylamide analogue (e.g., Val-Phe-phenethylamide as an analogue of the tripeptide Val-Phe-Phe).
In a preferred embodiment, the ACD of the modulator is modeled after tNe subregion of (3-AP encompassing amino acid positions 17-20 (i.e., Leu-Val-Phe-Phe; SEQ
ID NO: 12).
As described feather in Examples 7, 8 sad 91 peptide subregions of Aø 1.4,0 were per, amino-terminally modified and evaluated for their ability to modulate aggregation of natsnal ø-amyloid peptides. One subregion that was effective at inhibiting aggregation was Aø~2o (i.e., amino acid residues 6-20 of the natural Aø~,.4o peptide, the amino acid sequence of which is shown in SEQ ID NO: 4). Amino acid residues werc serially deleted from the amino-terminus or carboxy terminus of this subregion to further delineate a minimal subregion that was su~cient for aggregation inhibitory activity. This process defined Aø ~ 7_20 (e. e., amino acid residues 17-20 of the natural Aø 1,.4o peptide) as a minimal subregion that, when appropriately modified. is sufficient for aggregation inhibitory activity.
Accordingly, an "Aø aggregation core domain" within a modulator compound of the invention can be modeled after Aø ~ 7_20. In one embodiment. the Aø
aggregation core domain comprises Aø~7_2o itself (i.e., a peptide comprising the amino acid sequence leucine-valine-phenylalanine-phenylalanine; SEQ ID NO: 12). In other embodiments, the structure of AøI7_~o is used as a model to design an Aø aggregation core domain having similar structure and function to Aøt7.2o. For example, peptidomimetics, derivatives or analogues of Aø ~ 7_20 (as described above) can be used as an Aø aggregation core domain.
In addition to Aa 17-20~ ~e ~~ Aø Peptide is likely to contain other minimal subregions that arc suffcient for aggregation inhibitory activity. Such additional minimal subregions can be identified by the processes described in Examples 7. 8 and 9, wherein a 1 ~mer subregion of Aø l ~o is serially deleted from the amino-terminus or carboxy terminus, the deleted peptides are appropriately modified and then evaluated for aggregation inhibitory activity.
One form of the ø-amyloid modulator compound comprising an Aø aggregation core domain modeled after Aø ~ 7_2o coupled directly or indirectly to at least one modifying group has the formula:
n ( Y-XaamXaa~-Xaa3-Xaa4-Z
wherein Xaal and Xaa3 are amino acid structures;
Xaay is a valine structure;
XaaQ is a phenylalanine structure;
Y, which may or may not be present. is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to I 5;
Z. which may or may not be present. is a peptidic structure having the formula (Xaa)b, wherein Xaa is any amino acid structure and b is an integer from 1 to I 5; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
Xaa~, Xaa3. Y, Z. A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ø-amyloid peptides when contacted with the natural ø-amyloid peptides.
Preferably, a modulator compound of t9he above formula inhibits agon of natiual (3-amyloid peptides when contacted with the natural ~i-amyloid peptides and/or inhibits A~ neurotoxicity. Alternatively, the modulator compound can promote aggregation of natural ~-amyloid peptides when contacted with the natural ~3-amyloid peptides. The type and number of modifying groups ("A") coupled to the modulator are selected such that the compound alters (and preferably inhibits) aggregation of natural ~3-amyloid peptides when contacted with the natural ~i-amyloid peptides. A single modifying group can be coupled to the modulator (i.e., n=1 in the above formula) or, alternatively, multiple modifying groups can be coupled to the modulator. In various embodiments, n is an integer between 1 and 60, between I and 30, between I and 10, between 1 and 5 or between I and 3.
Suitable types of modifying groups are described further in subsection II below.
As demonstrated in Example 9, amino acid positions 18 (Val ~ g) and 20 (Phe2p) of A~3~~_2p (corresponding to Xaa, and Xaa4) are particularly important within the core domain for inhibitory activity of the modulator compound. Accordingly. these positions are conserved within the core domain in the formula shown above. The terms "valise structure"
and "phenylalanine structure" as used in the above formula are intended to include the natural amino acids, as well as non-naturally-occurring analogues, derivatives and mimetics of valise and phenylalanine, respectively, (including D-amino acids) which maintain the functional activity of the compound. Moreover, although Val ~ g and Phe2a have an important functional role, it is possible that Xaa2 and/or Xaa4 can be substituted with other naturally-occurring amino acids that are structurally related to valise or phenylalanine, respectively, while still maintaining the activity of the compound. Thus, the terms "valise structure"
is intended to include conservative amino acid substitutions that retain the activity of valise at Xaa,. and the term "phenylalanine structure" is intended to include conservative amino acid substitutions that retain the activity of phenylalanine at Xaa4. However, the term "valise structure" is not intended to include threonine.
In contrast to positions 18 and 20 of A~i ~ ~.2p, a Phe to Ala substitution at position 19 (corresponding to Xaa3) did not abolish the activity of the modulator, indicating position I 9 may be more amenable to amino acid substitution. In various embodiments of the above formula, positions Xaa~ and Xaa3 are any amino acid structure. The term "amino acid structure" is intended to include natural and non-natural amino acids as well as analogues, derivatives and mimetics thereof, including D-amino acids. In a preferred embodiment of the above formula. Xaal is a leucine structure and Xaa3 is a phenylalanine structure (i.e., modeled after Leu 1 ~ and Phe ~ g, respectively, in the natural A~i peptide sequence). The term "leucine structure" is used in the same manner as valise structure and phenylalanine structure described above. Alternatively, an another embodiment, Xaa3 is an alanine structure.
The four amino acid structure ACD of the modulator of the above formula can be flanked at the amino-terminal side, carboxy-terminal side, or both, by peptidic structures derived either from the natural A~i peptide sequence or from non-A~i sequences. The term "peptidic stin~cnu~e" is intended to include peptide analogues, derivatives and mimetics thereof,. as described above. The peptidic structure is composed of one or more linked amino acid structiues, the type and number of which in the above formula are variable. For example, in one embodiment, no additional amino acid structures flank the Xaat-Xaa,-Xaa3-5 Xaa4 core sequence (i.e., Y and Z are absent in the above formula). In another embodiment, one or more additional amino acid structures flank only the amino-terminus of the core sequences (i. e., Y is present but Z is absent in the above formula). In yet another embodiment, one or more additional amino acid structures flank only the carboxy-terminus of the core sequences (i.e., Z is present but Y is absent in the above formula).
The length of 10 flanking Z or Y sequences also is variable. For example, in one embodiment, a and b are integers from I to 15. More preferably, a and b are integers between I and 10.
Even more preferably, a and b are integers between 1 and 5. Most preferably, a and b are integers between 1 and 3 One form of the ~i-amyloid modulator compound comprising an A~3 aggregation core 15 domain modeled after A~3 ~ ~_~p coupled directly or indirectly to at least one modifying group has the formula: -A-(Y}-XaauXaa~-Xaa;-Xaa4-(Z)-B
wherein Xaai and Xaa3 are amino acids or amino acid mimetics;
20 Xaa~ is valise or a valise mimetic Xaa4 is phenylalanine or a phenylalanine mimetic;
Y, which may or may not be present. is a peptide or peptidomimetic having the formula (Xaa)a, wherein Xaa is any amino acid or amino acid mimetic and a is an integer from 1 to 15:
~ Z. which may or may not be present, is a peptide or peptidomimetic having the formula (Xaa)b, wherein Xaa is any amino acid or amino acid mimetic and b is an integer from I to I5; and A and B, at least one of which is present, are modifying groups attached directly or indirectly to the amino terminus and carboxy terminus, respectively, of the compound;
Xaal, Xaa3, Y, Z, A and B being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ~i-amyloid peptides when contacted with the natural ~i-amyloid peptides.
In this embodiment. the modulator compound is specifically modified at either its amino-terminus, its carboxy-terminus, or both. The terminology used in this formula is the same as described above. Suitable modifying groups are described in subsection II below. In one embodiment, the compound is modified only at its amino terminus (i.e., B
is absent aad the compound comprises the formula: A-(Y)-Xaa ~ -Xaa,-Xaag-Xaa4-(Z)). In another embodiment, the compound is modified only at its carboxy-terminus (i.e., A is absent and the compound comprises the formula: (Y~Xaa~ IXaa,-Xaa3-Xaa4-(Z)-B). In yet another embodiment, the compound is modified at both its amino- and carboxy termini (i.e., the compound comprises the formula: A-(Y~Xaa~-Xaa~-Xaa3-Xaa4-(Z)-B and both A and B are present). As described above, the type and number of amino acid structures which flank the Xa~aZ-Xaa~-Xaa3-Xaa~ core sequences in the above formula is variable. For example, in one embodiment, a and b are integers from 1 to 1 S. More preferably, a and b are integers between I and 10. Even more preferably, a and b are integers between 1 and 5. Most preferably, a and b are integers between 1 and 3.
As demonstrated in Examples 7, 8 and 9, preferred A~i modulator compounds of the invention comprise modified forms of A~ij4.2t (His-GIn-Lys-Leu-Val-Phe-Phe-Ala; SEQ ID
NO: 5), or amino-terminal or carboxy-terminal deletions thereof, with a preferred "minimal core region" comprising A~i 1 ~-2p. Accordingly, in specific embodiments. the invention provides compounds comprising the formula:
A-Xaa~-Xaa,-Xaa3-Xaa4-Xaag-Xaa6-Xaa~-Xaa8-B
wherein Xaa I is a histidine structure;
Xaa2 is a glutamine structure;
Xaa3 is a lysine structure;
Xaa4 is a leucine structure;
XaaS is a valine structure;
Xaa6 is a phenylalanine structure;
Xaa7 is a phenylalanine structure;
Xaa8 is an alanine structure;
A and B are niodifying groups attached directly or indirectly to the amino tenniaus and carboxy terminus. respectively, of the compound;
and wherein Xaa~-Xaa~-Xaa3, Xaa~-Xaa~ or Xaa~ may or may not be present;
Xaag may or may not be present; and at least one of A and B is present.
In one specific embodiment, the compaund comprises the formula: A-Xaa4-Xaas-Xaa6-XaaT-B (e.g, a modified form of A~i~~_2p, comprising an amino acid sequence Leu-Val-Phe-Phe; SEQ ID NO: 12).
In another specific embodiment, the compound comprises the formula: A-Xaa4-Xaag-Xaa6-Xaa~-Xaag-B (e.g, a modified form of A~it~_2~, comprising an amino acid sequence Leu-Val-Phe-Phe-Ala; SEQ ID NO: I 1).
In another specific embodiment, the compound comprises the formula: A-Xaa3-Xaad-XaaS-Xaa~-Xaa~-B (e.g., a modified farm of A(3t6.2p, comprising an amino acid sequence Lys-Leu-Val-Phe-Phe; SEQ ID NO: 10).
In apother specific embodimern, the cornpou~nd comprises the forlaula: A-Xaa3-Xaa4-Xaas~Xaa6-Xaa~-Xaag-B (c g., a modified form of A(3~~.21, comprising an amino acid sequence Lys-Leu-Val-Phe-Phe-Ala; SEQ ID NO: 9).
In another specific embodiment, the compound comprises the formula: A-Xaa2-Xsa3-Xaa4-Xaas-Xaa6-Xaa~-B (e.g., a modified form of A~its-2o~ ~mPnsing an amino acid sequence Gln-Lys-Leu-Val-Phe-Phe; SEQ ID NO: 8).
In another specific embodiment, the compound comprises the formula: A-Xaa2-Xaa3-Xaa4-Xaag-Xaab-Xaa~-Xaag-B (e.g., a modified form of Aøls-21- comprising an amino acid sequence GIn-Lys-Leu-Val-Phe-Phe-Ala; SEQ ID NO: 7).
In another specific embodiment, the compound comprises the formula: A-Xaal-Xaa2-Xaa3-Xaa4-Xaas-Xaa6-Xaa~-B (e.g., a modified form of A~314-2p, comprising an amino acid sequence His-Gln-Lys-Leu-Val-Phe-Phe; SEQ ID NO: 6).
In another specific embodiment the compound comprises the formula: A-Xaa~-Xaa,-Xaa.;-Xaa4-Xaas-Xaa~-Xaa~-Xaag-B (e.g., a modified form of AJ3I4-2 i ~
comprising an amino acid sequence His-Gln-Lys-Leu-Val-Phe-Phe-Ala; SEQ ID NO: 5).
In preferred embodiments of the aforementioned specif c embodiments, A or B is a cholanoyl structure or a biotin-containing structure (described further in subsection II below).
In further experiments to delineate subregions of A~ upon which an A(3 aggregation con domain can be modeled (the results of which are described in Example 11 ), it was demonstrated that a modulator compound having inhibitory activity can comprise as few as three A~i amino acids residues (e.g., VaI-Phe-Phe. which corresponds to A~3I8-2p or Phe-Phe-Ala. which corresponds to A[3 ~ q-2 ~ ). The results also demonstrated that a modulator compound having a modulating group at its carboxy-terminus is effective at inhibiting A(3 aggregation. Still further. the results demonstrated that the cholyl group, as a modulating group, can be manipulated while maintaining the inhibitory activity of the compounds and that an iodotyrosyl can be substituted for phenylalanine (e.g., at position 19 or 20 of the A~
sequence) while maintaining the ability of the compound to inhibit Ap aggregation.
Still ftuther, the results demonstrated that compounds with inhibitory activity can be created using amino acids residues that are derived from the Ap sequence in the region of about positions 17-21 but wherein the amino acid sequence is rearranged or has a substitution with a non-A~i-derived amino acid. Examples of such compounds include PPI-426, in which the sequence of A~i ~ ~-2 t (LVFFA) has been rearranged (FFVLA), PPI-372, in which the sequence ofA~it~.2p (KLVFF) has been rearranged (FKFVL), and PPI-388, -389 and -390, in which the sequence of A(31~-21 (LVFFA) has been substituted at position 17, 18 or 19, respectively, with an alanine residue (AVFFA for PPI-388, LAFFA for PPI-389 and LVAFA
for PPI-390). The inhibitory activity of these compounds indicate that the presence in the compound of an amino acid sequence directly corresponding to a portion of A~i is not essential for inhibitory activity, but rather suggests that maintenance of the hydrophobic nature of this core region, by inclusion of am~2'3no acid residues such as phenylalanine, valise, leucine, regardless of their precise order, can be sufficient for inhibition of Aø aggregation.
Accordingly, an Aø aggregation core domain can be designed based on the direct Aø amino acid sequence or can be designed based on a rearranged Aø sequence which maintains the hydrophobicity of the Aø subregion, e.g., the region around positions 17-20.
This region of Aø contains the amino acid residues Leu, Val and Phe. Accordingly, preferred Aø
aggregation core domains are composed of at least three amino acid structures (as that term is defined hereinbefore, including amino acid derivatives, analogues and mimeties), wherein at least two of the amino acid structures are, independently, either a leucine structure, a valise structure or a phenylalanine structure (as those terms are defined hereinbefore, including derivatives, analogues and mimetics).
Thus, in another embodiment, the invention provides a ø-amyloid modulator compound comprising a formula:
An ( Y-Xaa ~ -Xaa~-Xaa3-Z
wherein Xaal, Xaa,and Xaa3 are each amino acid structures and at least two of Xaat, Xaa., and Xaa3 are. independently, selected from the group consisting of a leucine structure, a phenylalanine structure and a valise structure;
ZO Y, which may or may not be present, is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to 15;
Z, which may or may not be present. is a peptidic structure having the formula (Xaa)b. wherein Xaa is any amino acid structure and b is an integer from 1 to 1 ~; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
Xaal, Xaa~, Xaa3, Y, Z, A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ø-amyloid peptides when contacted with the natural ø-amyloid peptides.
Preferably, the compound inhibits aggregation of natural ø-arnyloid peptides when contacud with the natural ø-amyloid peptides. In preferred embodiments, Xaa~
and Xaa2 are each phenylalanine structures or Xaa2 and Xaag are each phenylalanine structures. "n" can be, for example, an integer between 1 and 5, whereas "a" and "b" can be, for example, integers between 1 and 5. The modifying group "A" preferably comprises a cyclic, heterocyclic or polycyclic group. More preferably, A contains a cis-decalin group, such as cholanoyl structure or a cholyl group In other embodiments, A can comprise a biotin-_.
containing group, a diethylene-triaminepentaacetyl group, a (-)-menthoxyacetyl group, a fluorescein-containing group or an N-acetylneun3minyl group. In yet other embodiments. the compound may promotes aggregation of natural ø-amyloid peptides when contacted with the nataaal ø-amyloid peptides, may be fuztlter modified to alter a pharmacolcinctic property of the compound or may be further modified to label the compound with a detectable substance.
In another embodiment, the invention provides a ø-amyloid modulator compound comprising a formula:
A-(~-~ 1-~2-~3-~Z~'B
wherein Xaa~, Xaa~and Xaa3 are each amino acid structures and at least two of Xaal, Xaa~ and Xaa3 are, independently, selected from the group consisting of a leucine structure, a phenylalanine structure and a valine structure;
Y, which may or may not be present, is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from Z to 15;
Z, which may or may not be present, is a peptidic structure having the formula (Xaa)b, wherein Xaa is any amino acid structure and b is an integer from 1 to 1 ~: and Z S A and B, at least one of which is present are modifying groups attached directly or indirectly to the amino terminus and carboxy terminus.
respectively. of the compound;
Xaa~, Xaa,, Xaa3, Y, Z, A and B being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural ø-amyloid peptides when contacted with the natural ø-amyloid peptides:
Preferably, the compound inhibits aggregation of natural ø-amyloid peptides when contacted with the natural ø-amyloid peptides. In preferred embodiments, Xaa~
and Xaa-, are each phenylalanine structures or Xaa~ and Xaa3 are each phenylalanine structures. In one subembodiment, the compound comprises the formula:
2S A-(y)-~at W?-~3-(Z) In another subembodiment, the compound comprises the formula:
(Y~-Xaai-Xaa~-Xaa3-(Z}-B
"n" can be, for example, an integer between 1 and 5, whereas "a" and "b" can be. for example.
integers between 1 and S. The modifying group "A" preferably comprises a cyclic, heterocyclic or polycyclic group. More preferably, A contains a cis-decalin group. such as cholanoyl structure or a cholyl group In other embodiments. A can comprise a biatin-containing group, a diethylene-triaminepentaacetyl group, a (-)-menthoxyacetyl group, a fluorescein-containing group or an N-acetylneurarninyl group. In yet other embodiments, the compound may promote aggregation of natural ø-amyloid peptides when contacted with the 3S natural ø-amyloid peptides, may be further modified to alter a pharmacokinetic property of the compound or may be further modified to label the compound with a detectable substance.
In preferred specific embodiments, the invention provides a ø-amyloid modulator compound comprising a modifying group attached directly or indirectly to a peptidic structure. wherein the peptidic structure comprises amino acid structures having an amino acid sequence selected From the group consisting of His-Gln-Lys-Leu-Val-Phe~Phe-Ala (SEQ
ID NO: 5), His-Gln-Lys-Leu-Val-Phe-Phe (SEQ ID NO: 6), GIn-Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 7), Gln-Lys-Leu-Val-Phe-Phe (SEQ ID NO: 8), Lys-Leu-VaI-Phe-Phe-Ala (SEQ ID N0: 9), Lys-Leu-Val-Phe-Phe (SEQ ID ~NO: 10), Leu-Val-Phe-Phe-Ala (SEQ
ID
5 NO: I l), Leu-Val-Phe-Phe (SEQ ID NO: 12), Leu-AIa-Phe-Phe-Ala (SEQ ID NO:
13), Val-Phe-Phe (SEQ ID NO: 19), Fhe-Phe-Ala (SEQ ID NO: 20), Phe-Phe-Val-Leu-AIa (SEQ
ID
NO: 21 ), Leu-Val-Phe-Phe-Lys (SEQ ID NO: 22), Leu-Vat-Iodotyrosine-Phe-Ala (SEQ ID
NO: 23), Val-Phe-Phe-Ala (SEQ ID NO: 24), Ala-Vad-Phe-Phe-Ala (SEQ ID NO: ZS), Leu-Val-Phe-Iodotyrosine-Ala (SEQ ID NO: 26), Leu-Val-Phe-Phe-Ala-Glu (SEQ ID NO:
27), 10 Phe-Phe-Val-Leu (SEQ ID NO: 28), Phe-Lys-Phe-VaI-Leu (SEQ ID NO: 29), Lys-Leu-Val-Ala-Phe (SEQ ID NO: 30), Lys-Leu-Val-Phe-Phe-~3Ala (SEQ ID NO: 31 ) and Leu-Val-Phe-Phe-DAIa (SEQ ID NO: 32).
These specific compounds can be further modified to alter a phannacokinetic property of the compound and/or further modified to label the compound with a detectable substance.
15 The modulator compounds of the invention can be incorporated into pharmaceutical compositions (described further in subsection V below) and can be used in detection and treatment methods as described further in subsection VI below.
II. Modifvine Grg~, s 20 Within a modulator compound of the invention, a peptidic structure (such as an A~i derived peptide. or an A~i aggregation core domain. or an amino acid sequence corresponding to a rearranged A~i aggregation core domain) is coupled directly or indirectly to at least one modifying gmup (abbreviated as MG). In one embodiment. a modulator compounds of the invention comprising an aggregation core domain coupled to a modifying group.
the 25 compound can be illustrated schematically as MG-ACD. The term "modifying group" is intended to include structures that are directly attached to the peptidic structure (e.g., by coval~t coupling), as well as those that are indirectly attached to the peptidic structure (e.g., by a stable non-covalent association or by covalent coupling to additional amino acid residues, or mimetics, analogues or derivatives thereof, which may flank the A~i-derived peptidic structure). For example, the modifying group can be coupled to the amino-terminus or carboxy-terminus of an A~i-derived peptidic structure, or to a peptidic or peptidomimetic region flanking the core domain. Alternatively, the modifying group can be coupled to a sidc chain of at least one amino acid residue of an A~i-derived peptidie structure, or to a peptidic or peptidomitnetic region flanking the core domain (e.g.. through the epsilon amino group of a lysyl residue(s). through the carboxyl group of an aspartic acid residues) or a glutamic acid residue(s), through a hydroxy group of a tyrosyl residue(s), a serine residues) or a threonine residues) or other suitable reactive group on an amino acid side chain).
Modifying groups covalently coupled to the pcptidic structure can be attached by means and using~methods well known in the art for linking chemical structures, including, for example, amide, alkylamino, carbamate or urea bonds.
The term "modifying group" is intended to include groups that are not naturally coupled to natural Aø peptides in their native form. Accordingly, the term "modifying S group" is not intended to' include hydrogen. The modifying gmup(s) is selected such that the modulator compound alters, and preferably inhibits, aggregation of natural ø-amyIoid peptides when contacted with the natural ø-amyloid peptides or inhibits the neurotoxicity of natural ø-amyloid peptides when contacted with the natural ø-amyloid peptides.
Although not intending to be limited by mechanism, the modifying groups) of the modulator compounds of the invention is thought to function as a key pharmacophore which is important for conferring on the modulator the ability to disrupt Aø
polymerization.
In a preferred embodiment. the modifying groups) comprises a cyclic, heterocyclic or palycyclic group. The term "cyclic group", as used herein, is intended to include cyclic saturated or unsaturated (i.e., aromatic) group having from about 3 to 10, preferably about 4 to 8. and more preferably about 5 to 7. carbon atoms. Exemplary cyclic groups include cyclopropyl. cyclobutyl, cyclopentyl, cyclohexyl. and cyclooctyl. Cyclic groups may be unsubstituted or substituted at one or more ring positions. Thus. a cyclic group may be substituted with, e.g.. halogens, alkyls, cycloalkyls, alkenyls, alkynyls, aryls, heterocycles, hydroxyls. aminos, nitros, thiols amines, imines. amides, phosphonates.
phosphines, carbonyls, carboxyls, silyls, ethers, thioethers, sulfonyls. sulfonates.
selenoethers, ketones, aldehydes, esters, -CF3, -CN, or the Like.
The term "heterocyclic group" is intended to include cyclic saturated or unsaturated (i.e.. aromatic) group having from about 3 to 10, preferably about 4 to 8, and more preferably about ~ to 7. carbon atoms. wherein the ring structure includes about ane to four heteroatoms.
Heterocyclic groups include pyrrolidine. oxolane. thiolane. imidazole.
oxazole, piperidine, piperazine, morpholine. The heterocyclic ring can be substituted at one or more positions with such substituents as, for example, halogens, alkyls, cycloalkyls, alkenyls, alkynyls, aryls. other heterocycles, hydroxyl, amino. vitro, thiol, amines, imines, amides, phosphonates, phosphines, carbonyls, carboxyls, silyls, ethers, thioethers, sulfonyls, selcnoethers, ketones, aldehydes, esters. -CF3, -CN, or the Like. Heterocycles may also be bridged or fused to other cyclic groups as described below.
The term "polycyclic group" as used herein is intended to refer to two or more saturated or unsaturated (i.e., aromatic) cyclic rings in which two or more carbons are common to two adjoining rings, e.g., the rings are "fused rings". Rings that are joined through non-adjacent atoms are termed "bridged" rings. Each of the rings of the polycyclic group can be substituted with such substituents as described above. as for example, halogens, alkyls, cycloalkyls, alkenyls, alkynyls, hydroxyl, amino. vitro, thiol.
amines, imines, amides, phosphonates, phosphines. carbonyls, carboxyls, silyls, ethers, thioethers, sulfonyls, selenoethers, ketones. aldehydes, esters. -CF;, -CN. or the like.
A preferred polycyclic group is a group containing a cis-decalin stxuctvre.
Although not intending to be limited by mechanism, it is thought that the "bent"
conformation conferred on a modifying group by the presence of a cis-decalin structure contributes to the efficacy of the modifying gmup in disrupting A~ polymerization. Accordingly, other structures which mimic the "bent" configuration of the cis-decalin structure can also be used as modifying groups. An example of a cis-decalin containing structure that can be used as a modifying group is a cholanoyl structure, such as a cholyl group. For example, a modulator compound can be modified at its amino terminus with a cholyl group by reacting the aggregation core domain with cholic acid, a bile acid. as described in Example 4 (the structure of cho1ie acid is illustrated in Figure 2). Moreover, a modulator compound can be modified at its carboxy terminus with a cholyl group according to methods known in the art (see e.g., Wess, G. et al. (1993) Tetrahedron Letters, X4_:817-832; Wess, G.
et aL (1992) Tetrahedron Letters i~:195-198; and Kramer, W. et al. (1992) J. Biol. Chem.
2u7:I8598-18604). Cholyl derivatives and analogues can also be used as modifying groups.
For I S example, a preferred cholyl derivative is Aic (3-(O-aminoethyl-iso)-cholyl). which has a free amino group that can be used to further modify the modulator compound (e.g., a chelation group for 9~Tc can be introduced through the free amino gmup of Aic). As used herein, the term "cholanoyl structure" is intended to include the cholyl group and derivatives and analogues thereof in particular those which retain a four-ring cis-decalin configuration.
Examples of cholanoyl structures include groups derived from other bile acids, such as deoxycholic acid, lithocholic acid, ursodeoxycholic acid, chenodeoxychoiic acid and hyodeoxycholic acid, as well as other related structures such as cholanic acid. bufalin and resibufogenin (although the latter two compounds are not preferred for use as a modifying group). Another example of a cis-decalin containing compound is 5~3-cholestan-3a-of (the cis-decalin isomer of (+~dihydrocholesterol). For further description of bile acid and steroid structure and nomenclature, see Nes, W.R. and McKean, M.L. Biochemisrry of Steroids and Other Isopentanoids, University Park Press, Baltimore, MD, Chapter 2.
In addition to cis-decalin containing groups, other polycyclic groups may be used as modifying groups. For example, modifying groups derived from steroids or (3-lactams may be suitable modifying groups. Moreover, non-limiting examples of some additional cyclic, heterocyclic or polycyclic compounds which can be used to modify an A~3-derived peptidic structure are shown schematically in Figure 2. In one embodiment, the modifying group is a "biotinyI structure", which includes biotinyl groups and analogues and derivatives thereof (such as a 2-iminobiotinyl group). In another embodiment, the modifying group can 3S comprise a "fluorescein-containing group", such as a group derived from reacting an A(3-derived peptidic structure with 5-(and 6-)-carboxvfluorescein, succinimidyl ester or fluorescein isothiocyanate. In various other embodiments, the modifying groups) can comprise an N acetylneuraminyl group, a trans-4-cotininecarboxyl group, a 2-imino-1-imidazolidineacetyl group, an (S}-(-rindoline-2-carboxyl group, a (-~menthoxyacetyl group, a 2-norbonoaaeacetyl group, a Y-oxo-S-acen~~thenebutyryl, a (-)-2-oxo-4-thiazolidinecarboxyl group, a teuahydro-3-furoyl group, a 2-iminobiotinyl group, a diethylenetriaminepentaacetyl group, a 4-morpholinecarbonyl group. a 2-thiopheneacetyl group or a 2-thiophenesulfonyl group.
Prefeaed modifying groups include groups comprising cholyl structures, biotinyl structures, fluorescein-containing groups, a diethylene-triaminepentaacetyl group, a (-)-menthoxyacetyl group, and a N-acetylneuraminyl group. More preferred modifying groups those comprising a cholyl structure or an iminiobiotinyl group.
In addition to the cyclic. heterocyclic and polycyelic groups discussed above, other IO types of modifying groups can be used in a modulator of the invention. For example, small hydrophobic groups may be suitable modifying groups. An example of a suitable non-cyclic modifying group is an acetyl group.
Yet another type of modifying group is a compound that contains a non-natural amino acid that acts as a beta-turn mimetic. such as a dibenzofuran-based amino acid described in Tsang. K.Y. et al. ( 1994) J. Am. Chem. Soc. I 16:3988-400; Diaz H and Kelly.
J. W. ( 1991 Tetrahedron Letters 41:5735-5728; and Diaz. H et aI. (1992) J. Am. Chem. Soc.
114:8316-8318. An example of such a modifying group is a peptide-aminoethyldibenzofiwanyl-proprionic acid (Adp) group (e.g., DDIIL-Adp). This type of modifying gmup further can comprise one or more N-methyl peptide bonds to introduce additional steric hindrance to the aggregation of natural (3-AP when compounds of this type interact with natural ~i-AP.
III. Additional Chemical Modifications of A~i Modulators A p-amyloid modulator compound of the invention can be further modified to alter the specific properties of the compound while retaining the ability of the compound to alter A~i aggregation and inhibit A(3 neurotoxicity. For example. in one embodiment, the compound is further modified to alter a pharmacokinetic property of the compound, such as in vivo stability or half life. In another embodiment. the compound is further modified to label the compound with a detectable substance. In yet another embodiment. the compound is fiurther modified to couple the compound to an additional therapeutic moiety.
Schematically, a modulator of the invention comprising an A~i aggregation core domain coupled directly or indirectly to at least one modifying group can be illustrated as MG-ACD, whereas this compound which has been further modified to alter the properties of the modulator can be illustrated as MG-ACD-CM, wherein CM represents an additional chemical modification.
To further chemically modify the compound, such as to alter the pharmacokinetic properties of the compound, reactive groups can be derivatized. For example, when the modifying group is attached to the amino-terminal end of the aggregation core domain, the earboxy-terminal end of the compound can be further modified. Preferred C-terminal modifications include those which reduce the ability of the compound to act as a substrate for carboxypeptidases. Examples of preferred C-terminal modifiers include an amide group, an ethylamide group and various non-natural amino acids, such as D-amino acids and (3-alanine.
Alternatively, when the modifying group is attached to the carboxy-teTm~inal end of the aggregation core domain, the amino-terminal end of the compound can be further modified, for example, to reduce the ability of the compound to act as a substrate for aminopeptidases.
A modulator compound can be fitrther modified to label the compound by reacting the compound with a detectable substance. Suitable detectable substances include various enzymes, prosthetic groups. fluorescent materials, luminescent materials and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, ~i-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein. fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol: and examples of suitable radioactive material include 14C, 1231, 1241. 12~I? 1311, 99mT~~ 35S or'I~i. In a preferred embodiment, a modulator compound is radioactively labeled with 14C, either by incorporation of 14C
into the modifying group or one or more amino acid structures in the modulator compound. Labeled modulator compounds can be used to assess the in vivo pharmacokinetics of the compounds, as well as to detect A~i aggregation. for example for diagnostic purposes. A~i aggregation can be detected using a labeled modulator compound either in vivo or in an in vitro sample derived from a subject.
Preferably, for use as an in vivo diagnostic agent. a modulator compound of the invention is labeled with radioactive technetium or iodine. Accordingly, in one embodiment, the invention provides a modulator compound labeled with technetium.
preferably ~Tc.
2~ Methods for labeling peptide compounds with technetium are known in the art (see e.g., U.S.
Patent Nos. 5.443,815, 5_5,.180 and 5,405,597, all by Dean et al.: Stepniak-Biniakiewicz D., et al. (1992) J. Med Chem. x:274-279; Fritzberg, A.R., et al. (1988) Proc.
Natl. Acad Sci. USA X5:4025-4029; Baidoo. K.E., et al. (1990) Cancer Res. Suppl. 50:799s-803s; and Regan; L, and Smith, C.K. (1995) Science 270:980-982). A modifying group can be chosen that provides a site at which a chelation group for ggmTc carr be introduced.
such as the Aic derivative of cho1ie acid, which has a free amino group (see Example 11 ). In another embodiment, the invention provides a modulator compound labeled with radioactive iodine.
For example. a phenylalanine residue within the A~i sequence (such as Phe 1 g or Phe2p) can be substituted with radioactive iodotyrosyl (see Example 11 ). Any of the various isotopes of radioactive iodine can be incorporated to create a diagnostic agent.
Preferably, 1231 (half life = 13.2 hours) is used for whole body scintigraphy, 1241 (half life = 4 days) is used for positron emission tomography (PET), 1251 (half life = 60 days) is used for metabolic turnover studies and 1311 (half life = 8 days) is used for whole body counting and delayed low resolution imaging studies.
Fore. an additional modif canon of a modulator compound of the invention can serve to confer an additional therapeutic property on the compound. That is, the additional chemical modification can comprise an additional functional moiety.
For example, a functional moiety which serves to break down or dissolve amyloid plaques can be coupled 5 to the modulator compound. In this form, the MG-ACD portion of the modulator serves to target the compound to Aø peptides and disrupt the polymerization of the Aø
peptides, whereas the additional functional moiety serves to break down or dissolve amyloid plaques after tt~e compound has been targeted to these sites.
In an alternative chemical modification, a ø-amyloid compound of the invention is 10 prepared in a "prodrug" form, wherein the compound itself does not modulate Aø
aggregation, but rather is capable of being transformed, upon metabolism in vivo, into a ø-amyloid modulator compound as defined herein. For example, in this type of compound, the modulating group can be present in a prodrug form that is capable of being converted upon metabolism into the form of an active modulating group. Such a prodrug form of a 15 modifying gmup is referred to herein as a "secondan~ modifying group." A
variety of strategies are known in the art for preparing pepude prodrugs that limit metabolism in order to optimize delivery of the active form of the peptide-based drug (see e.g., Moss, J. (1995) in Peptide-Based Drug Design: Controlling Transport and Metabolism. Taylor, M.D.
and Amidon. G.L. (eds), Chapter 18. Additionally strategies have been specifically tailored to 20 achieving CNS delivery based on "sequential metabolism" (see e.g., Bodor, N., et al. ( 1992) Science 27:1698-1700; Prokai, L., et al. (1994) J. Am. Chem. Soc. 11~f:2643-2644: Bodor, N. and Prokai. L. (1995) in P~tide-Based Drug Des~Qn: Controlling Transport and M oli . Taylor, M.D. and Amidon. G.L. (eds). Chapter 14. In one embodiment of a prodrug form of a modulator of the invention. the modifying group comprises ~an alkyl ester 25 to facilitate blood-brain barrier permeability.
Modulator compounds of the invention can be prepared by standard techniques known in the art. The peptide component of a modulator composed, at least 'in part. of a peptide, can be synthesized using standard techniques such as those described in Bodansky, 30 M. Principles ofPeptide Synthesis,, Springer Verlag, Berlin (1993) and Grant. G.A (ed.).
Synthetic Pegtides: A User's Guide, W.H. Freeman and Company, New York (199?).
Automated peptide synthesizers are commercially available (e.g., Advanced ChemTech Model 396: Milligen/ Biosearch 9600). Additionally, one or more modulating groups can be attached to the Aø-derived peptidic component (e.g.. an Aø aggregation core domain) by standard methods. for example using methods for reaction through an amino group (e.g., the alpha-amino group at the amino-terminus of a peptide), a carboxyl group (e.g., at the carboxy terminus of a peptide), a hydroxyl group (e.g., on a tyrosine, serine or threonine residue) or other suitable reactive group on an amino acid side chain (see e.g., Greene, T.W and Wuts,.
P.G.M. Protective Groups in Organic S ,vnthesis. John Wiley and Sons, Inc., New York ( 1991 ). Exemplary syntheses of preferred p amyloid modulators is described further in Examples 1, 4 and 11.
IV. Screen,~nQ As~avs Another aspect of the invention pertains to a method for selecting a modulator of ~i-amyloid aggregation. In the method, a test compound is contacted with natural ~ amyloid peptides, the aggregation of the natural (3-AP is measured and a modulator is selected based on the ability of thesest compound to alter the aggregation of the natural p-AP (e.g., inhibit or promote aggregation). In a preferred embodiment, the test compound is contacted with a molar excess amount of the natural ~-AP. The amount and/or rate of natural ~i-AP
aggregation in the presence of the test compound can be determined by a suitable assay indicative of ~i-AP aggregation. as described herein (see e.g., Examples 2, ~
and 6).
In a preferred assay, the natural (3-AP is dissolved in solution in the presence of the test compound and aggregation of the natural ~i-AP is assessed in a nucleation assay (see 1 ~ Example 6) by assessing the turbidity of the solution over time. as measured by the apparent absorbance of the solution at 40~ nm (described further in Example 6; see also Jarrett et al.
(1993) Biochemistry 32:4693-4697). In the absence of a ~i-amyloid modulator, the A4og~, of the solution typically stays relatively constant during a lag time in which the (3-AP remains in solution, but then the A4o5nm of the solution rapidly increases as the ~i-AP
aggregates and comes out of solution, ultimately reaching a plateau level (r.e., the A4o;~ of the solution exhibits sigmoidal kinetics over time). In contrast. in the presence of a test compound that inhibits j3-AP aggregation. the A4o5nm of the solution is reduced compared to when the modulator is absent. Thus, in the presence of the inhibitory modulator. the solution may exhibit an increased lag time. a decreased slope of aggregation and/or a lower plateau level 2~ compared to when the modulator is absent. This method for selecting a modulator of ~i-amyloid polymerization can similarly be used to select modulators that promote (3-AP
aggregation. Thus, in the presence of a modulator that promotes ~i-AP
aggregation, the A405nm of the solution is increased compared to when the modulator is absent (e.g., the solution may exhibit an decreased lag time, increase slope of aggregation and/or a higher plateau level compared to when the modulator is absent).
Another assay suitable for use in the screening method of the invention, a seeded extension assay, is also described further in Example 6. In this assay, ~i-AP
monomer and an aggregated j3- .AP "seed" are combined, in the presence and absence of a test compound. and the amount of. (i-fibril formation is assayed based on enhanced emission of the dye Thioflavine T when contacted with ~i-AP fibrils. Moreover, (3-AP aggregation can be .
assessed by electron microscopy (EIvi] of the ~i-AP Preparation in the presence or absence of the modulator. For example, ~i amyloid fibril formation, which is detectable by EM, is reduced in the presence of a modulator that inhibits (i-AP aggregation (i.e., there is a reduced amount or number of ~i-fibrils in the presence of the modulator), whereas ~
fibril formation is increased in-the presence of a modulator that promotes ø-AP aggregation (i.e., there is as increased amount or number of ø-fibrils in the presence of the modulator).
An even more prefentd assay for use in the screening method of the invention to select suitable modulators is the neurotoxicity assay described in Examples 3 and 10.
Compounds are selected which inhibit the formation of neurotoxic Aø aggregates and/or which inhibit the neurotoxicity of preformed Aø fibrils. This neumtoxicity assay is considered to be predictive of neurotoxicity in vivo. Accordingly, inhibitory activity of a modulator compound in the in vitro neurotoxicity assay is predictive of similar inhibitory activity of the compound for neurotoxicity in vivo.
V. ~hg~gubcal Compositions Another aspect of the invention pertains to pharmaceutical compositions of the ø-amyloid modulator compounds of the invention. In one embodiment. the composition includes a ø amyloid modulator compound in a therapeutically or prophylactically effective amount suff cient to alter. and preferably inhibit, aggregation of natural ø-amyioid peptides, and a pharmaceutically acceptable carrier. In another embodiment, the composition includes a ø amyloid modulator compound in a therapeutically or prophylactically effective amount sufficient to inhibit the neurotoxicity of natural ø-amyloid peptides. and a pharmaceutically acceptable carrier. A "therapeutically effective amount" refers to an amount effective, at dosages and for periods of time necessary. to achieve the desired therapeutic result, such as reduction or reversal or ø-amyloid deposition and/or reduction or reversal of Aø
neurotoxicity. A therapeutically effective amount of modulator may vary according to factors such as the disease state, age, seat. and weight of the individual. and the ability of the modulator to elicit a desired response in the individual. Dosage regimens may be adjusted to provide the optimum therapeutic response. A therapeutically effective amount is also one in which any toxic or deuimental effecu of the modulator are outweighed by the therapeuticahy beneficial effects. The potential neurotoxicity of the modulators of the invention can be assayed using the cell-based assay described in Examples 3 and 10 and a therapeutically effective modulator can be selected which daes not exhibit significant neurotoxicity. In a prefetied embodiment, a therapeutically effective amount of a modulator is sufficient to alter, and preferably inhibit. aggregation of a molar excess amount of natural ø-amyloid peptides.
A "prophylactically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result, such as preventing or inhibiting the rate of ø~amyloid deposition and/or Aø neeuotoxicity in a subject predisposed to ø-amyloid deposition. A prophylactically effective amount can be determined as described above for the therapeutically effective amount. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
Onrfactor that may be considered when determining a therapeutically or prophylactically effective amount of a p amyloid modulator is the concentration of natural ~i-AP in a biological compartment of a subject, such as in the cerebrospinal fluid (CSF) of the subject. The concentration of natural /3-AP in the CSF has been estimated at 3 nM
(Schwartzman, (1994) Proc. Natl. Acaci: Sci. USA X1_:8368-8372). A non-limiting range for a therapeutically or prophylactically effective amounts of a ~i amyloid modulator is 0.01 nM-10 pM. It is to be noted that dosage values may vary with the severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
The amount of active compound in the composition may vary according to factors such as the disease state, age. sex. and weight of the individual, each of which may affect the amount of natural (3-AP in the individual. Dosage regimens may be adjusted to provide the optimum therapeutic response. For example. a single bolus may be administered.
several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated;
each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved. and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
As used herein "pharmaceutically acceptable carrier" includes any and all solvents.
dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. In one embodiment. the carrier is suitable for parenteral administration. Preferably, the carrier is suitable for administration into the central nervous system (e.g., intraspinally or intracerebrally).
Alternatively. the carrier can be suitable for intravenous, intraperitoneal or intramuscular administration. In another embodiment, the carrier is suitable for oral administration.
Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound. use thereof in the pharmaceutical compositions of the invention is contemplated. Supplementary active compounds can also be incorporated into the compositions.
Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, S liposome, or other ordered structure suitable to high drug concentration.
The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof., The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it will be preferable to include isotonic agents. for example, sugars, polyalcohols such as manitol, sorbitol, or sodium chloride in the composition.
Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption. for example. monostearate salts and gelatin.
Moreover. the modulators can be administered in a time release formulation, for example in a composition which includes a slow release polymer. The active compounds can be prepared with carriers that will protect the compound against rapid release. such as a controlled release formulation, including implants and microencapsulated delivery systems.
Biodegradable, biocompatible polymers can be used. such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid. collagen, polyorthoesters, polylactic acid and polylactic, polyglycolic copolymers (PLG). Many methods for the preparation of such formulations are patented or generally known to those skilled in the art.
Sterile injectable solutions can be prepared by incorporating the active compound (e.g., ~3-amyloid modulator) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above. as required. followed by filtered sterilization.
2~ Generally. dispersions are prepared by incorporating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions. the preferred methods of preparation are vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
A modulator compound of the invention can be formulated with one or more additional compounds that enhance the solubility of the modulator compound.
Preferred compounds to be added to formulations to enhance the solubility of the modulators are cyclodextrin derivatives, preferably hydroxypropyl-y-cyclodextrin. Drug delivery vehicles containing a cyclodextrin derivative for delivery of peptides to the central nervous system are described in Bodor, N., et al. (1992) Science 257:1698-1700. For the ~3-amyloid modulators described herein. inclusion in the formulation of hydroxypropyl-Y-cyclodextrin at a concentration 50-200 mM increases the aqueous solubility of the compounds. In addition to increased solubility, inclusion of a cyclodextrin derivative in the formulation may have other beneficial effects, since p-cyclodextrin itself has been reported to interact with the Ap peptide and inhibit fibril formation in vitro (Camilleri, P., et al. (1994) FEES
Letters 341:256-2~$.
Accordingly, use of a modulator compound of the invention in combination with a cyclodextrin derivative may result in greater inhibition of A~i aggregation than use of the 5 modulator alone. Chemical modifications of cyclodextrins are known in the art (Hanessian, S., et al. (1995) J. Org. Chem. C0_:4786-4797). In addition to use as an additive in a pharmaceutical composition containing a modulator of the invention, cyclodextrin derivatives may also be useful.as modifying groups and, accordingly, may also be covalently coupled to an A(3 peptide compound to form a modulator compound of the invention.
18 In another embodiment. a pharmaceutical composition comprising a modulator of the invention is formulated such that the modulator is transported across the blood-brain barrier (BBB). Various strategies known in the art for increasing transport across the BBB can be adapted to the modulators of the invention to thereby enhance transport of the riodulators across the BBB (for reviews of such strategies. see e.g., Pardridge. W.M.
(1994) Trends in 15 Biotechnol. 1?:239-24~: Van Hree, J.B. et al. (1993) Pharm. World Sci. 1~:2-9: and Pardridge, W.M. et al. ( 1992) Pharmacol. Toxicol. 7 ~:3-10). In one approach, the modulator is chemically modified to form a prodrug with enhanced transmembrane transport. Suitable chemical modifications include covalent linking of a fatty acid to the modulator through an amide or ester linkage (see e.g., U.S. Patent 4,933,324 and PCT Publication WO
89/07938, 20 both by Shashoua; U.S. Patent 5,284,876 by Hesse et al.; Toth, I. et al.
(1994) J. Drug Target. 2:217-239; and Shashoua, V.E. et al. (1984) J. Med Chem. 27:659-664) and glycating the modulator (see e.g., U.S. Patent 5.260,308 by Poduslo et al.).
Also, N-acylamino acid derivatives may be used in a modulator to form a "lipidic"
prodrug (see e.g., U.S. Patent No. 5,112,863 by Hashimoto et al. issued on May 12'", 1992).
25 In anqther approach for enhancing transport across the BBB, a peptidic or peptidomimetic modulator is conjugated to a second peptide or protein, thereby forming a chimeric protein, wherein the second peptide or protein undergoes absorptive-mediated or receptor-mediated transcytosis through the BBB. Accordingly, by coupling the modulator to this second peptide or protein, the chimeric protein is uamsported across the BBB. The 30 second peptide or protein can be a ligand for a brain capillary endothelial cell receptor ligand.
For example, a preferred ligand is a monoclonal antibody that specifically binds to the transferrin .receptor on brain capillary endothelial cells (see e.g., U.S.
Patents 5,182,107 and 5,154.924 and PCT Publications WO 93/10819 and WO 95/02421, all by Friden et al.).
Other suitable peptides or proteins thai can mediate transport across the BBB
include histot~es 35 (see e.g., U.S. Patent 4,902,505 by Pardridge and Schimmel) and ligands such as biotin, folate, niacin, pantothenic acid, riboflavin, thiamin, pryridoxal and ascorbic acid (see e.g., U.S. Patents 5,416,016 and 5,108,921, both by Heinstein). Additionally, the glucose transporter GLUT-1 has been reported to transport glycopeptides (L-serinyl-~i-D-glucoside analogues of [MetS]enkephalin) across the BBB (Poll, R et al. (1994) Proc.
Natl. Acad Sci.
USA Q1:7114-I778). Accordingly, a modulator compound can be coupled to such a glycopeptide to target the modulator to the GLUT-1 glucose transporter. For example, a modulator compound which is modified at its amino terminus with the modifying group Aic (3-(O-aminoethyl-iso~cholyl, a derivative of cholic acid having a free amino group) can be coupled to a glycopeptide through the amino group of Aic by standard methods.
Chimeric proteins can be formed by recombinant DNA methods (e.g., by formation of a chimeric gene encoding a fusion protein) or by chemical crosslinking of the modulator to the second peptide or protein to form a chimeric protein. Numerous chemical crosslinking agents are known in the (e.g., commercially available from Pierce, Rockford IL). A crosslinking agent can be chosen which allows for high yield coupling of the modulator to the second peptide or protein and for subsequent cleavage of the linker to release bioactive modulator. For example, a biotin-avidin-based linker system may be used.
In yet another approach for enhancing transport across the BBB, the modulator is encapsulated in a carrier vector which mediates transport across the BBB. For example. the modulator can be encapsulated in a liposome. such as a positively charged unilamellar liposome (see e.g., PCT Publications WO 88/07851 and WO 88/07852. both by Faden) or in polymeric microspheres (see e.g., U.S. Patent 5,413,797 by Khan et al.. U.S.
Patent 5 71,961 by Mathiowitz et~al. and 5,019,400 by Gombotz et al.). Moreover. the carrier vector can be modified to target it for transport across the BBB. For example, the carrier vector (e.g., liposome) can be covalently modified with a molecule which is actively transported across the BBB or with a ligand for brain endothelial cell receptors. such as a monoclonal antibody that specifically binds to transferrin receptors (see e.g., PCT
Publications WO 91/04014 by Collies et aL and WO 94/02178 by GreiQ et al.).
In still another approach to enhancing transport of the modulator across the BBB. the modulator is coadministered with another agent which functions to permeabilize the BBB.
Examples of such BBB "permeabilizers" include bradykinin and bradykinin agonists (see e.g., U.S. Patent 5,112.596 by Malfroy-Canine) and peptidic compounds disclosed in U.S.
Patent 5,268,164 by Kozarich et al.
A modulator compound of the invention can be formulated into a pharmaceutical composition wherein the modulator is the only active compound or.
alternatively, the pharmaceutical composition can contain additional active compounds. For example, two or more modulator compounds nay be used in combination. Moreover. a modulator compound of the invention can be combined with one or more other agents that have anti-amyloidogenic properties. For example. a modulator compound can be combined with the non-specific cholinesterase inhibitor tacrine (Cognex~, Parke-Davis).
In another embodiment. a pharmaceutical composition of the invention is provided as a packaged formulation. The packaged formulation may include a pharmaceutical composition of the invention in a container and printed instructions for administration of the composition-for treating a subject having a disorder associated with (3-amyloidosis, e.g.
Alzheimer's disease.
VI. Methods of Using Aa Modulators Another aspect of the invention pertains to methods for altering the aggregation or inhibiting the neurotoxicity of natural (3-amyloid peptides. In the methods of the invention, natural p amyloid peptides are contacted with a ~i amyloid modulator such that the aggregation of the aatinal (l amyloid peptides is altered or the neurotoxicity of the natural ~
amyloid peptides is inhibited. In a preferred embodiment, the modulator inhibits aggregation of the natural /3 amyloid peptides. In another embodiment, the modulator promotes aggregation of the natural ~i amyloid peptides. Preferably, aggregation of a molar excess amount of p-AP. relative to the amount of modulator, is altered upon contact with the modulator.
In the method of the invention. natural ~i amyloid peptides can be contacted with a 1 S modulator either in vitro or in vivo. Thus, the term "contacted with" is intended to encompass both incubation of a modulator with a natural ~i-AP preparation in vitro and delivery of the modulator to a site in vivo where natural ~i-AP is present. Since the modulator compound interacts with natural (3-AP, the modulator compounds can be used to detect natural (3-AP, either in vitro or in vivo. Accordingly, one use of the modulator compounds of the invention is as diagnostic agents to detect the presence of natural ~3-AP, either in a biological sample or in vivo in a subject. Furthermore, detection of natural (3-AP utilizing a modulator compound of the invention further can be used to diagnose amyloidosis in a subject.
Additionally, since the modulator compounds of the invention disrupt (3-AP aggregation and inhibit (3-AP
neurotoxicity. the modulator compounds also are useful in the treatment of disorders 2~ associated with (3-amyloidosis, either prophylactically or therapeutically.
Accordingly.
another use of the modulator compounds of the invention is as therapeutic agents to alter aggregation and/or neurotoxicity of natural (i-AP.
In one embodiment. a modulator compound of the invention is used in virro, for example to detect and quantitate natural ~i-AP in sample (e.g., a sample of biological fluid).
To aid in detection. the modulator compound can be modified with a detectable substance.
The source of natural ~i-AP used in the method can be, for example, a sample of cerebrospinal fluid (e.g., from an AD patient, an adult susceptible to AD due to family history, or a normal adult). The natural ~i-AP sample is contacted with a modulator of the invention and aggregation of the (3-AP is measured, such as by as assay described in Examples 2, ~ and 6. Preferably, the nucleation assay and/or seeded extension assay described in Example 6 is used. The degree of aggregation of the ~i-AP sample can then be compared to that of a control samples) of a known concentration of (3-AP, similarly contacted with the modulator and the results can be used as an indication of whether a subject is susceptible to or has a disorder associated with p-amyloidosis. Moreover, ~-AP can be detected by detecting a modulating gmup 'incorporated into the modulator. For example, modulators incorporating a biotin compound as described herein (e.g., an amino-terminally biotinylated ~i-AP peptide) can be detected using a streptavidin or avidin probe which is labeled with a detectable substance (e.g., an enzyme, such as peroxidase).
Detection of natural ~i-AP aggregates mixed with a modulator of the invention using a probe that binds to the modulating group (e.g., biotinlstreptavidin) is described further in Example 2.
In another embodiment, a modulator compound of the invention is used in vivo to detect, and, if desired, quantitate, natural ~i-AP deposition in a subject, for example to aid in the diagnosis of p amyloidosis in the subject. To aid in detection, the modulator compound can be modified with a detectable substance, preferably '~"Tc or radioactive iodine (described further above), which can be detected in vivo in a subject. The labeled ~i-amyloid modulator compound is administered to the subject and, after sufficient time to allow accumulation of the modulator at sites of amyloid deposition, the labeled modulator compound is detected by standard imaging techniques. The radioactive signal generated by the labeled compound can be directly detected (e.g.. whole body counting). or alternatively, the radioactive signal can be converted into an image on an autoradiograph or on a computer screen to allow for imaging of amyloid deposits in the subject. Methods for imaging amyloidosis using radiolabeled proteins are known in the art. For example, serum amyloid P
component (SAP), radioIabeled with either 1~I or ~Te, has been used to image systemic amyloidosis (see e.g., Hawkins, P.N. and Pepys, M.B. (1995) Eur. J. Nucl. Med.
:595-599).
Of the various isotypes of radioactive iodine, preferably 1'-'I (half life =
13.2 hours) is used for whole body scintigraphy, 1241 (half life = 4 days) is used for positron emission tomography (PET). 1'-SI (half life = 60 days) is used for metabolic turnover studies and I3~I
(half life = 8 days) is used for whole body counting and delayed low resolution imaging studies. Analogous to studies using radiolabeled SAP, a labeled modulator compound of the invention can be delivered to a subject by an appropriate route (e.g., intravenously, intraspinally, intracerebrally) in a single bolus, for example containing 100 ~.g of labeled compound carrying approximately 180 MBq of radioactivity.
The invention provides a method for detecting the presence or absence of natural ~i-arnyloid peptides in a biological sample, comprising contacting a biological sample with a compound of the invention and detecting the compound bound to natural /3-amyloid peptides to thereby detect the presence or absence of natural ~i-amyloid peptides in the biological sample. In one embodiment, the ~i-amyloid modulator compound and the biological sample are contacted in vitro. In another embodiment, the ~i-amyloid modulator compound is contacted with the biological sample by administering the ~-amyloid modulator compound to a subject. For in vivo administration, preferably the compound is labeled with radioactive technetium or radioactive iodine.
The invention also provides a method for detecting natural (3-amyloid peptides to facilitate diagnosis of a ~i-amyloidogenic disease. comprising contacting a biological sample with the compound of the invention and det3a~nng the compound bound to natural ~i-amyloid peptides to facilitate diagnosis of a ~-amyloidogenic disease. In one embodiment, the ~i-amyloid modulator compound and the biological sample are contacted in vitro.
In another embodiment, the p-amyloid modulator compound is contacted with the biological sample by administering the (3-amyloid modulator compound to a subject. For in vivo administration, preferably the compound is labeled with radioactive technetium or radioactive iodine.
Preferably, use of the method facilitates diagnosis of Alzheimer's disease.
In another embodiment, the invention provides a method for altering natural ~i-AP
aggregation or inhibiting ~i-AP neurotoxiciry, which can be used prophylactically or therapeutically in the treatment or prevention of disorders associated with (3 amyloidosis, e.g., Alzheimer's Disease. As demonstrated in Example 10, modulator compounds of the invention reduce the toxicity of natural ~3-AP aggregates to cultured neuronal cells.
Moreover. the modulators not only reduce the formation of neurotoxic aggregates but also have the ability to reduce the neurotoxiciry of preformed A~i fibrils.
Accordingly, the modulator compounds of the invention can be used to inhibit or prevent the formation of neurotoxic A(3 fibrils in subjects (e.g., prophylactically in a subject predisposed to ~i-amyloid deposition) and can be used to reverse (3-amyloidosis therapeutically in subjects already exhibiting ~i-amyloid deposition.
A modulator of the invention is contacted with natural ~i amyloid peptides present in a subject (e.g., in the cerebrospinal fluid or cerebrum of the subject) to thereby alter the aggregation of the natural (3-AP and/or inhibit the neurotoxicity of the natural (3-APs. A
modulator compound alone can be administered to the subject. or alternatively, the modulator compound can be administered in combination with other therapeutically active agents (e.g., as discussed above in subsection IV). When combination therapy is employed, the therapeutic agents can be coadministered in a single pharmaceutical composition, coadministered in separate pharmaceutical compositions or administered sequentially.
The modulator may be administered to a subject by any suitable route effective for inhibiting natural ~i-AP aggregation in the subject, although in a particularly preferred embodiment, the modulator is administered parenterally, most preferably to the central nervous system of the subject. Possible routes of CNS administration include intraspinal administration and intracerebral administration (e.g., intracerebrovascular administration).
Alternatively, the compound can be administered, for example, orally, intraperitoneally, intravenously or intramuscularly. For non-CNS administration routes, the compound can be administered in a formulation which allows for transport across the BBB.
Certain modulators may be transported across the BBB without any additional further modification whereas others may need further modification as described above in subsection IV.
Suitable modes and devices for delivery of therapeutic compounds to the CNS of a subject are known in the art, including cerebrovascular reservoirs (e.g., Ommaya or Rikker reservoirs; see e.g., Raney, J.P. et al. (1988) J. Neurosci. Nurs. ?Q:23-29;
Sundaresan, N. et al. (1989) Oncology x:15-22), catbeters for inzrathxal delivery (e.g., Port-a-Cath, Y-cathet«a and the like; see e.g., Plummer, J.L. (1991) Pain 44:215-220; Yaksh, T.L. et al. (1986) Pharmacol. Biochem. Behav. ,x:483-485), injectable intrathecal reservoirs (e.g., Spinalgesic;
see e.g., Brazenor, G.A. (1987) Neurosurgery x:484-491 ), implantable infusion pump 5 systems (e.g., Infusaid; see e.g:, Zierski, J. et al. ( 1988) Acta Neurochem. Suppl. 43:94-99;
Kanoff, R.B. (1994) J. Am. Osteopath. Assoc. 94:487-493) and osmotic pumps (sold by Alza Corporation). A particularly preferred mode of administration is via an implantable, extemal~y programmable infusion pump. Suitable infusion pump systems and reservoir .
systems are also described in U.S. Patent No. 5, 368,562 by Blomquist and U.S.
Patent No.
10 4,731.058 by Doan, developed by Pharmacia Deltec Inc.
The method of the invention for altering ~i-AP aggregation in vivo , and in particular for inhibiting (3-AP aggregation, can be used therapeutically in diseases associated with abnormal ~i amyloid aggregation and deposition to thereby slow the rate of ~i amyloid deposition and/or lessen the degree of (3 amyloid deposition. thereby ameliorating the course 15 of the disease. In a preferred embodiment. the method is used to treat Alzheimer's disease (e.g., sporadic or familial AD, including both individuals exhibiting symptoms of AD and individuals susceptible to familial AD). The method can also be used prophylactically or therapeutically to treat other clinical occurrences of ~i amyloid deposition.
such as in Down's syndrome individuals and in patients with hereditary cerebral hemorrhage with amyloidosis-20 Dutch-type (HCHWA-D). While inhibition of ~3-AP aggregation is a preferred therapeutic method. modulators that promote ~i-AP aggregation may also be useful therapeutically by allowing for the sequestration of (3-AP at sites that do not lead to neurological impairment.
Additionally. abnormal accumulation of ~3-amyloid precursor protein in muscle fibers has been implicated in the pathology of sporadic inclusion body myositis (IBM) (Askana. V.
25 et al. (1996) Proc. NatL Acad Sci. USA 93:1314-1319: Askanas. V. et al.
(1995) Current Opinion in Rhewnatology 7:486-496). Accordingly, the modulators of the invention can be used prophylactically or therapeutically in the treatment of disorders in which ~i-AP. or APP.
is abnormally deposited at non neurological locations, such as treatment of IBM by delivery of the modulators to muscle fibers.
VII. Unmodified A~3 Peptides that Iryibit Ag,Qregation of Natural Q-AP
In addition to. the ~i-amyloid modulators described hereinbefore in which an A(3 peptide is coupled to a modifying group. the invention also provides ~i-amyloid modulators comprised of an unmodified A(3 peptide. It has now been discovered that certain portions of natural (3-AP can alter aggregation of natural j3-APs when contacted with the natural ~i-APs (see Example 12). Accordingly, these unmodified A~i peptides comprise a portion of the natural ~3-AP sequence (i.e., a portion of (3AP~_3g, ~3AP1-40~ ~W-4? ~d ~~'~-43). In particular these unmodified A(3 peptides have at Ieast one amino acid deletion compared to ~~1-39~ ~e ~ortest natural (3-AP, such that the compound alters aggregation of natural.(3-amyloid peptides when contacted with the 4nat ral ~-amyloid peptides. In various embodiments, these unmodified peptide compounds can promote aggregation of natural ~i-amyloid peptides, or, more preferably, can inhibit aggregation of natural ~i-amyl'oid peptides when contacted with the natural (3-amyloid peptides. Even more preferably, the unmodified peptide compound inhibits aggregation of natural ~i-amyloid peptides when contacted with a molar excess amount of natural ~i-amyloid peptides (e.g., a 10-fold, 33-fold or 100-fold molar excess amount of natural ~i-AP).
As discussed above, the unmodified peptide compounds of the invention comprise an amino acid sequence having at least one amino acid deletion compared to the amino acid sequence of (3AP~.3g. Alternatively, the unmodified peptide compound can have at least five, ten, fifteen. twenty, twenty-five, thirty or thirty-five amino acids deleted compared to (~AP1-39~ StilI further the unmodified peptide compound can have 1-~. 1-10, 1-15. I-20, I-25, 1-30 or 1-3~ amino acids deleted compared to (3AP~_39~ The amino acid deletions) may occur at the amino-terminus. the carboxv-terminus. an internal site. or a combination thereof.
of the (3-AP sequence. Accordingly, in one embodiment. an unmodified peptide compound of the invention comprises an amino acid sequence which has at least one internal amino acid deleted compared to ~3AP ~ _;g. Alternatively. the unmodified peptide compound can have at Least five. ten, fi$een, twenty, twenty-five, thirty or thirty-five internal amino acids deleted compared to (3AP~_~g. Still further the unmodified peptide compound can have 1-5, I-10, 1-IS, 1-20, 1-25. 1-30 or 1-35 internal amino acids deleted compared to (3AP~_39~ For peptides with internal deletions, preferably the peptide has an amino terminus corresponding to amino acid residue 1 of natural (3AP and a carboxy terminus corresponding to residue 40 of natural ~iAP and has one or more internal (3-AP amino acid residues deleted (i.e.. a non-contiguous A~ peptide).
In another embodiment. the unmodified peptide compound comprises an amino acid sequence which has at least one N-terminal amino acid deleted compared to (3AP~_39.
Alternatively, the unmodified peptide compound can have at least five, ten, fifteen. twenty, twenty-five. thirty or thirty-five N-terminal amino acids deleted compared to ~3AP~_39. Still further the unmodified peptide compound can have 1-5, 1-10, 1-I~, 1-20. 1-25.
1-30 or 1-35 N-terminal amino acids deleted compared to ~AP~_39~
In yet another embodiment, the unmodified peptide compound comprises an amino acid sequence which has at least one C-terminal amino acid deleted compared to ~iAP 1 _39.
Alternatively, the unmodified peptide compound can have at least five, ten, fifteen. twenty, twenty-five, thim or thirty-five C-terminal amino acids deleted compared to ~iAP~_;g. Still further the unmodified peptide compound can have 1-S, 1-10,' I-15. 1-20, I-25, 1-30 or 1-35 C-terminal amino acids deleted compared to ~iAP~_39~
In addition to deletion of amino acids as compared to ~iAP 1 _39, the peptide compound can have additional non-~i-AP amino acid residues added to it, for example, at the amino terminus, the carboxy-terminus or at an internal site. In one embodiment, the peptide compound has at least one non-/3-amyloid peptide-derived amino acid at iu N-terminus.
Alternatively, the compound can have, for example, 1-3, 1-5, 1-7, I-10, 1-IS
or I-20 non-~-amyloid peptide-derived amino acid at its N-terminus. In another embodiment, the peptide compound has at least one non-~i-amyloid peptide-derived amino acid at iu C-terminus.
Alternatively, the compound can have, for example, I-3, 1-5, 1-7, I-10, 1-16 or 1-20 non-U-amyloid peptide-derived amino acid at its C-terminus.
In specific preferred embodiments,, an unmodified peptide compound of the invention comprises A(3~2p (the amino acid sequence of which is shown in SEQ ID NO: 4), A~i ~ X30 (the amino acid sequence of which is shown in SEQ ID NO: 14), Aril-20, 26-40 (tee ~o acid sequence of which is shown in SEQ ID NO: 15) or EE~HHHHQQ-~iAP~~o (the amino acid sequence of which is shown in SEQ ID NO: 16). In the nomenclature used herein= ~iAP1-2o, 26-4o represents /3AP~-4o in which the internal amino acid residues 21-25 have been deleted.
An unmodified peptide compound of the invention can be chemically synthesized using standard techniques such as those described in Bodansky, M. Principles of Peptide Synthesis. Springer Verlag, Berlin (1993) and Grant. G.A (ed.). Synthetic Peptides: A User's Guide, W.H. Freeman and Company, New York (1992). Automated peptide synthesizers are commercially available (e.g., Advanced ChemTech Model 396; MiIligen/ Biosearch 9600).
Alternatively, unmodified peptide compounds can be prepared according to standard recombinant DNA techniques using a nucleic acid molecule encoding the peptide.
A
nucleotide sequence encoding the peptide can be determined using the genetic code and an oligonucleotide molecule having this nucleotide sequence can be synthesized by standard DNA synthesis methods (e.g., using an automated DNA synthesizer).
Alternatively. a DNA
molecule encoding an unmodified peptide compound can be derived from the natural (3-amyloid precursor protein gene or cDNA (e.g.. using the polvmerase chain reaction and/or restriction enzyme digestion) according to standard molecular biology techniques.
Accordingly. the invention further provides an isolated nucleic acid molecule comprising a nucleotide sequence encoding a /3-amyloid peptide compound, the ~i-amyloid peptide compound comprising an amino acid sequence having at least one amino acid deletion compared to [3AP~-3g such that the p-amyloid peptide compound alters aggregation of natural ~i-amyloid peptides when contacted with the natural ~-amyloid peptides. As used herein. the term "nucleic acid molecule" is intended to include DNA molecules and RNA
molecules and may be single-stranded or double-stranded, but preferably is double-stranded DNA. The isolated nucleic acid encodes a peptide wherein one or more amino acids are deleted from the N-terminus, C-terminus and/or an internal site of ~iAPI_39, as discussed above. In yet other embodiments, the isolated nucleic acid encodes a peptide compound having one or more amino acids deleted compared to ~iAP~-39 and further having at least one non-/3-AP derived amino acid residue added to it, for example, at the amino terminus, the carboxy-terminus or at an internal site. In specific preferred embodiments, an isolated nucleic acid molecule of the invention encodes ~AP6-2o, (3AP 16.3p, SAP ~-20, 26-~0 or EEWHHHFiQQ-~3AP 16-ao~
To facilitate expression of a peptide compound in a host cell by standard recombinant DNA techniques, the isolated nucleic acid encoding the peptide is S incorporated into a recombinant expression vector. Accordingly, the invention also provides recombinant expression vectors comprising the nucleic acid molecules of the invention. As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting anothernucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded DNA loop into which additional DNA segments may be Iigated. Another type of vector is a viral vector, wherein ' additional DNA segments may be Iigated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
Other vectors (e.g., non-episomal mammalian vectors) are inteerated into the genome of a host cell upon introduction into the host cell. and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" or simply "expression vectors". In general. expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" may be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors. such as viral vectors, which serve equivalent functions.
In the recombinant expression vectors of the invention. the nucleotide sequence encoding the peptide compound are operatively linked to one or more regulatory sequences.
selected on the basis of the host cells to be used for expression. The term "operably linked"
is intended to mean that the sequences encoding the peptide compound are linked to the regulatory sequences) in a manner that allows for expression of the peptide compound. The term "regulatory sequence" is intended to includes promoters, enhancers and other expression control elements (e.g., .polyadenylation signals}. Such regulatory sequences are described, for example, in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press. San Diego, CA (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell, those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences) and those that direct expression in a regulatable manner (e.g., only in the presence of an inducing agent). It will be appreciated by those skilled in the art that the design of the expression vector may depend on such factors as the choice of the host cell to be transformed, the level of expression of peptide compound desired, etc. The expression vectors of the invention can be introduced into host cells thereby to produce peptide compounds encoded by nucleic acids as described herein.
The recombinant expression vectors of the invention can be designed for expression of peptide compounds in prokaryotic or eukaryotic cells. For example, peptide compounds can be expressed in bacterial cells such as E. coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology~85, Academic Press, San Diego, CA
( 1990). Alternatively, the recombinant expression vector may be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase. Examples of vectors for expression in yeast S. cerivisae include pYepSecl (Baldari et aL, (1987) EMBOJ. 6:229-234), pMFa (Kurjan and Herskowitz, (1982) Cell 30:933-943), pJRY88 (Schultz et al., (1987) Gene 54:113-123), and pYES2 (Invitrogen Corporation, San Diego, CA). Baculovirus vectors available for expression of proteins or peptides in cultured insect cells (e.g., Sf 9 cells) include the pAc series (Smith et al., (1983) Mol.
Cell. Biol. 3_:2156-2165) and the pVL series (Lucklow. V.A., and Summers, M.D., (1989) Virology 170:31-39).
Examples of mammalian expression vectors include pCDM8 (Seed. B.. (1987) Nature 329:840) and pMT2PC (Kaufman et al. (1987). EMBO J. 6_:187-19~). When used in mammalian cells. the expression vector's control functions are often provided by viral regulatory elements. For example. commonly used promoters are derived from polyoma, Adenovirus 2, cytomegalovirus and Simian Virus 40.
In addition to the regulatory control sequences discussed above. the recombinant expression vector may contain additional nucleotide sequences. For example, the recombinant expression vector may encode a selectable marker gene to identify host cells that have incorporated the vector. Such selectable marker genes are well known in the art.
Moreover. the facilitate secretion of the peptide compound from a host cell.
in particular mammalian host cells. the recombinant expression vector preferably encodes a signal sequence operatively linked to sequences encoding the amino-terminus of the peptide compound such that upon expression. the peptide compound is synthesized with the signal sequence fused to its amino terminus. This signal sequence directs the peptide compound into the secretory pathway of the cell and is then cleaved. allowing for release of the mature peptide compound (i.e., the peptide compound without the signal sequence) from the host cell. Use of a signal sequence to facilitate secretion of proteins or peptides from mammalian host cells is well known in the art.
A recombinant expression vector comprising a nucleic acid encoding a peptide compound that alters aggregation of natural ~i-AP can be introduced into a host cell to thereby produce the peptide compound in the host cell. Accordingly, the invention also provides host cells containing the recombinant expression vectors of the invention. The terms "host cell" and "recombinant host cell" are used interchangeably herein.
It is understood that such terms refer not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be iden~cal to the parent cell, but are still included within the scope of the term as used herein. A host cell may be any prokaryotic or eukaryotic cell. For example, a peptide compound may be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells. Preferably, the peptide compound is expressed in mammalian cells. In a 5 preferred embodiment, the peptide compound is expressed in mammalian cells in vivo in a mammalian subject to treat amyloidosis in the subject through gene therapy (discussed further below). Preferably, the ~i-amyloid peptide compound encoded by the recombinant expression vector issecreted from the host cell upon being expressed in the host cell.
Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional 10 transformation or transfection techniques. As used herein, the terms "transformation" and "transfection" are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, electroporation, microinjection and viral-mediated transfection. Suitable methods for transforming or 15 transfecting host cells can be found in Sambrook et al. (Molecular Cloning:
.4 Laboratory Manual. ?nd Edition, Cold Spring Harbor Laboratory press ( 1989)), and other laboratory manuals. Methods for introducing DNA into mammalian cells in vivo are also known in the art and can be used to deliver the vector DNA to a. subject for gene therapy purposes (discussed further below).
20 For stable transfection of mammalian cells. it is known that, depending upon the expression vector and transfection technique used. only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Preferred selectable markers include those that 25 confer resistance to drugs. such as 6418, hygromycin and methotrexate.
Nucleic acid encoding a selectable marker may be introduced into a host cell on the same vector as that encoring the peptide compound or may be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
30 A nucleic acid of the invention can be delivered to cells in vivo using methods known in the art, such as direct injection of DNA, receptor-mediated DNA uptake or viral-mediated transfeetion. Direct injection has been used to introduce naked DNA into cells in vivo (sec e.g., Acsadi et al. (1991) Nature 332: 815-818; Wolffet al. (1990) Science 247:1465-1468).
A delivery apparatus (e.g., a "gene gun") for injecting DNA into cells in vivo can be used.
35 Such an apparatus is commercially available (e.g., from BioRad). Naked DNA
can also be introduced into cells by complexing the DNA to a canon, such as polylysine, which is coupled to a ligand for a cell-surface receptor (see for example Wu, G. and Wu, C.H. (1988) J. Biol. Chem. 263:14621: Wilson et al. (1992) J. Biol. Chem. 267:963-967; and U.S. Patent No. 5.166320). Binding of the DNA-ligand complex to the receptor facilitates uptake of the DNA by receptor-mediated endocytosis. Additionally, a DNA-ligand complex linked to adenovirus capsids which naturally disrupt endosomes, thereby releasing material into the cytoplasm can be used to avoid degradation of the complex by intracellular lysosomes (see for example Curiel et al. ( 1991 ) Proc. Natl. Acad. Sci. USA 88:8850;
Cristiano et al.
(1993) Proc. Natl. Acad. Sci. USA 90:2122-2126).
Defective retroviruses are well characterized for use in gene transfer for gene therapy purposes (for a review see Miller, A.D. (1990) Blood 76:2?1). Protocols for producing recombinant retroviruses and for infecting cells in vitro or in vivo with such viruses can be found in Current Prst~cols in Molecular BioloQ:v, Ausubel, F.M. et al. (eds.) Green Publishing Associates, (1989), Sections 9.10-9.14 and other standard laboratory manuals.
Examples of suitable retroviruses include pLJ, pZIP, pWE and pEM which are well known to those skilled in the art. Examples of suitable packaging virus lines include yrCrip, yrCre, yr2 and yrAm. Retroviruses have been used to introduce a variety of genes into many different cell types, including epithelial cells, endothelial cells, lymphocytes, myoblasts, hepatocytes, bone marrow cells, in vitro and/or in vivo (see for example Eglitis, et al.
(1985) Science 230:1395-1398; Danos and Mulligan (1988) Proc. Natl. Acad. Sci.
USA
85:6460-6464; Wilson et al. (1988) Proc. Natl. Acad. Sci. USA 85:3014-3018;
Armentano et al. (1990) Proc. Natl. Acad. Sci. USA 87:6141-6145; Huber et al. (1991) Proc. Natl.
Acad. Sci. USA 88:8039-8043; Ferry et al. (1991) Proc. Natl. Acad. Sci. USA
88:8377-8381; Chowdhury et al. (1991) Science 254:1802-1805; van Beusechem et al.
(1992) Proc. Natl. Acad. Sci. USA 89:7640-7644; Kay et al. (1992) Human Gene Therapy 3:641-647; Dai et al. (1992) Proc. Natl. Acad Sci. USA 89:10892-10895; Hwu et al.
(1993) ,I.
Immunol. 150:4104-4115; U.S. Patent No. 4,868,116 by Morgan et al., issued on September 29'", 1989; U.S. Patent No. 4,980,286 by Morgan et al., issued on December 25",1990; PCT Application WO 89/07136 (PCT/US89/00422); PCT
Application WO 89/02468 (PCT/US88/03089); PCT Application WO 89/05345 (PCT/US88/04383); and PCT Application WO 92107573 (PCT/US91/08127)).
Alternatively, the genome of an adenovirus can be manipulated such that it encodes .
and expresses a peptide compound but is inactivated in terms of its ability to replicate in a normal lytic viral life cycle. See for example Berlrner et al. (1988) Bio Techniques 6:616;
Rosenfeld et al. (1991) Science 252:431-434; and Rosenfeld et al. (1992) Cell 68:143-155.
46a Suitable adenoviral vectors derived from the adenovirus strain Ad type 5 d1324 or other strains of adenovirus (e.g., Ad2, Ad3, Ad7 etc.) are well known to those skilled in the art.
Recombinant adenoviruses are advantageous in that they do not require dividing cells to be effective gene delivery vehicles and can be used to infect a wide variety of cell types, S including airway epithelium (Rosenfeld et. aL (1992) cited supra), endothelial cells (Lemarchand et al. ( 1992) Proc. Natl. Acad Sci. USA 89:6482-6486), hepatocytes (Herz and Gerard (1993) Proc. Natl. Acad. Sci. USA 90:2812-2816) and muscle cells (Quantin et al. (1992) Proc. Natl. Acad. Sci USA 89:2581-2584). Additionally, introduced adenoviral DNA (and foreign DNA contained therein) is not integrated into the genome of a host cell but remains episomal, thereby avoiding potential problems that can occur as a result of insertional mutagenesis in situations where introduced DNA becomes integrated iato the host genome (e.g., retroviral DNA).
Adeno-associated virus (AAV) can also be used for delivery of DNA for gene therapy purposes. AAV is a naturally occurring defective virus that requires another virus, such as an adenovirus or a herpes virus, as a helper virus for efficient replication and a productive life cycle. (For a review see Muzyczka et al. Curr. Topics in Micro. and Immunol.
(1992) 158:97-129). It is also one of the few viruses that may integrate its DNA into non-dividing cells, and exhibits ~ high frequency of stable integration (see for example Flotte et al. ( 1992}
Am. J. Respir. Cell. Mol. Biol. 7:349-356; Samulski et al. (1989) .l. 1%irol.
63:3822-3828; and MeLaughlin et al. (1989) J. Yirol. 62:1963-1973). Vectors containing as little as 300 base pairs of AAV can be packaged and can integrate. An AAV vector such as that described in Tratschin et al. (1985) Mol. Cell. Biol. 5:325I-3260 can be used to introduce DNA into cells.
A variety of nucleic acids have been introduced into different cell types using AAV vectors (see for example Hermonat et al. (1984) Proc. Natl. Acad Sci. USA 81:6466-6~170; Tratschin et al. (1985) Mol. Cell. Biol. 4:2072-2081: Wondisford et al. (1988) Mol.
Endocrinol. 2:32 39; Tratschin et al. (1984) J. ~iroL 51:611-619; and Flotte et al. (1993) J.
Biol. Chem.
268:3781-3790}.
The invention provides a method for treating a subject for a disorder associated with ø-amyloidosis. comprising administering to the subject a recombinant expression vector encoding a ø-amyloid peptide compound, the compound comprising an amino acid sequence having at least one amino acid deletion compared to øAP~ ;g, such that the ø-amyloid peptide compound is synthesized in the subject and the subject is treated for a disorder associated with ø-amyloidosis. Preferably, the disorder is Alzheimer's disease. In one embodiment the recombinant expression vector directs expression of the peptide compound in neuronal cells. In another embodiment. the recombinant expression vector directs expression of the peptide compound in glial cells. In yet another embodiment, the recombinant expression vector directs expression of the peptide compound in fibroblast cells.
General methods for gene therapy. are known in the art. See for example, U.S.
Patent No. 5,399,346 by Anderson et al. A biocompatible capsule for delivering genetic material is described in PCT Publication WO 95/05452 by Baetge et al. Methods for grafting genetically modified cells to mat central nervous system disorders are described in U.S.
Patent No. 5,082,670 and in PCT Publications WO 90/06757 and WO 93/10234, all by Gage et al. Isolation and/or genetic modification of multipotent neural stem cells or neuro-derived fetal cells are described in PCT Publications WO 94/02593 by Anderson et al., by Weiss et al., and WO 94/23754 by Major et al. Fibroblasts transduced with genetic material are described in PCT Publication WO 89/02468 by Mulligan et aL
Adenovirus vectors for transfering genetic material into cells of the central nervous system are described in PCT Publication WO 94/08026 by Kahn et al. Herpes simplex virus vectors suitable for treating neural disorders are described in PCT Publications WO 94104695 by Kaplitt and WO
90/09441 by-Geller et al. Promoter elements of the filial fibrillary acidic protein that cxn confer astrocyte specific expression on a linked gene or gene fragment, and which thus can be used for expression of Aø peptides specifically in ast<ocytes, is described in PCT Publication WO 93!07280 by Brenner et al. Furthermore, alternative to expression of an Aø
peptide to modulate amyloidosis, an antisense oligonucleotide that is complementary to a region of the ø-amyloid precursor protein mRNA corresponding to the peptides described herein can be e~cpressed in a subject to modulate amyloidosis. General methods for expressing antisense oligonu~leotides to modulate nervous system disorders are described in PCT
Publication WO
95!09236.
Alternative to delivery by gene therapy, a peptide compound of the invention comprising an amino acid sequence having at least one amino acid deletion compared to øAP~.3g can be delivered to a subject by directly administering the peptide compound to the subject as described further herein for the modified peptide compounds of the invention. The peptide compound can be formulated into a pharmaceutical composition comprising a therapeutically effective amount of the ø-amyloid peptide compound and a pharmaceutically acceptable carrier. The peptide compound can be contacted with natural ø-amyloid peptides with a ø-amyloid peptide compound such that aggregation of the natural ø-amyloid peptides is inhibited. Moreover, the peptide compound can be administered to the subject in a therapeutically effective amount such that the subject is treated for a disorder associated with ø-amyloidosis, such as Alzheimer's disease.
VIII. Qther Embodiments Although the invention has been illustrated hereinbefore with regard to Aø
peptide compounds, the principles described. involving attachment of a modifying groups) to a peptide compound. are applicable to any arnyloidogenic protein or peptide as a means to create a modulator compound that modulates. and preferably inhibits. amyloid aggregation.
Accordingly, the invention provides modulator compounds that can be used to treat amyloidosis is a variety of forms and clinical settings.
Amyloidosis is a general term used to describe pathological conditions characterized by the presence of amyloid. Amyloid is a general term referring to a group of diverse but specific extracellular protein deposits which are seen in a number of different diseases.
Though diverse in their occurrence. all amyloid deposits have common morphologic properties, stain with specific dyes (e.g., Congo red), and have a characteristic red-green birefringent appearance in polarized light after staining. They also share common ultrastructural features and common x-ray diffraction and infrared spectra.
Amyloidosis can be classified clinically as primary, secondary, familial andlor isolated.
Primary amyloid appears de »ovo without any preceding disorder. Secondary amyloid is that form which appears as a complication of a previously existing disorder. Familial amyloid is a genetically inherited form found in particular geographic populations. Isolated forms of amyloid are those that tend to involve a single organ system.
Different amyloids are characterized by the type of pmtein(s) or peptides) present in the deposit. For example, as described hereinbefore, amyloid deposits associated with Alzheimer's disease comprise the (3-amyloid peptide and thus a modulator compound of the invention for detecting and/or treating Alzheimer's disease is designed based on modification of the ~i-arnyloid peptide. The identities of the proteins) or peptides) present in amyloid deposits associatedwith a number of other amyloidogenic diseases have been elucidated. ' Accordingly, modulator compounds for use in the detection andlor treatment of these other amyloidogenic diseases can be prepared in a similar fashion to that described herein for ~i-AP-derived modulators. In vitro assay systems can be established using an amyloidogenic protein or peptide which forms fibrils in vitro, analogous to the A~i assays described herein.
Modulators can be identified using such assay systems, based on the ability of the modulator to disrupt the ~i-sheet structure of the fibrils. Initially, an entire amyloidogenic pmtein can be modified or. more preferably, a peptide fragment thereof that is known to form fibrils in vitro can be modified (e.g., analogous to Aril-40 described herein). Amino acid deletion and substitution analyses can then be performed on the modified protein or peptide (analogous to the studies described in the Examples) to delineate an aggregation core domain that is suffcient, when modified. to disrupt fibril formation.
Non-limiting examples of amyloidogenic proteins or peptides, and their associated amyloidogenic disorders. include:
Transthvretin (TTR) - Amyloids containing transthyretin occur in familial amyloid polyneuropathy (Portuguese. Japanese and Swedish types), familial amyloid cardiomyopathy (Danish type). isolated cardiac amyloid and systennic senile amyloidosis.
Peptide fragments 2~ of transthvretin have been shown to form amyloid fibrils in vitro. For example. TTR 10-20 and TTR 105-11 ~ form amyloid-like fibrils in 20-30% acetonitrile/water at room temperature (Jarvis, J.A., et al.(I994) Int. J. Pept. Protein Res. 44:388-398). Moreover, familial cardiomyopathy !Danish type) is associated with mutation of Leu at position 111 to Met. and an analogue of TTR 105-l la in which the wildtype Leu at position 111 has been substituted with Met (TTR 10~-115Met111 ) also forms amyloid-like fibrils in vitro (see e.g., Hermansen, L.F., et al. (1995) Eur. J. Biochem. 227:772-779; Jarvis et al.
supra). Peptide firagrnents .of TTR that form amyloid fibrils in vitro are also described in Jarvis, J.A., et al.
( 1993 ) Biochem. Biophys. Res. Commun. 192:991-998 and Gustavsson, A., et al.
( 1991 ) Biochem. Biophys. Res. Commu». 17 :1159-1104. A peptide fragment of wildtype or .
mutated transthyretin that forms amyloid fibrils can be modified as described herein to create a modulator of amvloidosis that can be used in the detection or treatment of familial amyloid polyneuropathy (Portuguese. Japanese and Swedish types), familial amyloid cardiomyopathy (Danish type). isolated cardiac amyloid or systemic senile amyloidosis.
S
dip (PrP) - Amyloids in a number of spongiform encxphslopathies, including scrapie in sheep, bovine spongiform encephalopathy in cows and Creutzfeldt-Jakob disease (CJ) and Gerstrnann-Straussler-Scheinker syndrome (GSS) in himzans, contain PrP.
Limited proteolysis of PrPSc (the prion protein associated with scrapie) leads to a 27-30 kDa fragment (PrP27-30) that polymerizes into rod-shaped amyloids (see e.g., Pan, K.M., et al.
(1993) Proc. Natl. Acad Sci. USA 9:10962-10966; Gusset, M., et al. (1993) Proc. Natl.
Acad Sci. USA 90:1-5). Peptide fragments of PrP from humans and other mammals have been shown to form amyloid fibrils in vitro. For example, polypeptides corresponding to sequences encoded by normal and mutant alleles of the PRNP gene (encoding the precursor of the prion protein involved in CJ), in the regions of codon 178 and codon 200, spontaneously form amyloid fibrils in vitro (see e.g., Goldfarb, L.G., et al.
(1993) Proc. Natl.
Acad Sci. USA X0_:4451-4454). A peptide encompassing residues 106-126 of human PrP has been reported to form straight fibrils similar to those extracted from GSS
brains, whereas a peptide encompassing residues 127-147 of human PrP has been reported to form twisted fibrils resembling scrapie-associated fibrils (Tagliavini. F.. et al. ( 1993) Proc. Natl. Acad Sci. USA 90:9678-9682). Peptides of Syrian hamster PrP encompassing residues 109-122, 113-127,113-120, 178-191 or 202-218 have been reported to form amyloid fibrils, with the most amyloidogenic peptide being Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala (SEQ ID NO:
17), which corresponds to residues 113-120 of Syrian hamster PrP but which is also conserved in PrP from other species (Gusset, M., et al. (1992) Proc. Natl. Acad Sci. USA
89:10940-10944). A peptide fragment of PrP that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of scrapie. bovine spongiform encephalopathy, Creutzfeldt-Jakob disease or Gerstmann-Straussler-Scheinker syndrome.
I,~let Amvioid Polvge tp ide (IAPP. also known as amylin) - Amyloids containing IAPP
occur in adult onset diabetes and insuIinoma. IAPP is a 37 amino acid polypeptide formed from an 89 amino acid precursor protein (see e.g., Betsholtz. C., et al.
(1989) Exp. Cell. Res.
,3:484-493; V~%estermark, P., et al. (1987) Proc. Natl. Acad. Sci. USA ~4-:3881-3885). A
peptide corresponding to IAPP residues 20-29 has been reported to form amyloid-Iike fibrils in vitro, with residues 25-29, having the sequence Ala-Ile-Leu-Ser-Ser (SEQ ID
N0: 18), being strongly amyloidogenic (Westetmark, P., et al. (1990) Proe. Natl. Acad Sci. USA
X7:5036-5040; Glenner, G.G., et al. (1988) Biochem. Biophys. Res. Common.
X55:608-614).
A peptide fragment of IAPP that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of adult onset diabetes or insulinoma.
Atrial Natriuretic Factor (ANF) - Amyloids containing ANF are associated with isolated atrial amyloid (see e.g., Johansson, B., et al. (198'7) Biochem.
Biophys. Res.
Com~nun. x:1087-1092). ANF corresponds to amino acid residues 99-126 (proANF99-126) ofthe ANF prohormone (proANPl-126) (Pucci, A., et al. (1991) J. Pathol.
165:235-241 ). ANF, er a fiagment thereof,, that forms ~yloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of isolated atrial amyloid.
KaBoa ~r Lambda Light - Amyloids containing kappa or lambda light chains are associated idiopathic (primary) amyloidosis, myeloma or macroglobulinemia-associated amyloidosis, and primary localized cutaneous nodular amyloidosis associated with Sjogren's syndrome. The structure of amyloidogenic kappa and lambda light chains, including amino acid sequence analygis, has been characterized (see e.g., Buxbaum, J.N., et al. (1990) Ann.
Intern. Med _1:455-464; Sehormann, N., et al. (1995) Proc. Natl. Aead Sei. USA
92:9490-9494; Hurle, M.R., et al. (1994) Proc. Natl. Acad Sci. USA X1_:5446-5450;
Liepnieks, J.J., et al. (1990) Mol. Immunol. 27:481-485; Gertz, M.A., et al. (1985) Scand J.
Immunol. 2:245-250; Inazumi, .T., et al. (1994) Dermatology 18Q:125-128). Kappa or lambda light chains, or a peptide fragment thereof that forms amyloid fibrils, can be modified as descriued herein to create a modulator of amyloidosis that can be used in the detection or treatmem of idiopathic (primary) amyloidosis, myeloma or macroglobulinemia-associated amyloidosis or primary localized cutaneous nodular amyloidosis associated with Sjostren's syndrome.
Amvloid A - Amyloids containing the amyloid A protein (AA protein), derived from serum amyloid A, are associated with reactive (secondary) amyloidosis (see e.g., Liepnieks, J.J., et al. (1995) Biochim. Biophys. Acta x:81-86), familial Mediterranean Fever and familial amyloid nephropathy with urticaria and deafness (Muckle-Wells syndrome) (see e.g., Linke. R.P., et al. (1983) Lab. Invest. 48:698-704). Recombinant human serum amylvid A
forms amyloid-like fibrils in vitro (Yamada, T., et al. (1994) Biochim.
Biophys. Acta 1 6:323-329) and circular dichroism studies revealed a predominant ~i sheet/turn structure (McCubbin, W.D., et al. (1988) Biochem J. x,56:775-783). Serum amyloid A, amyloid A
protein or a fraatnent thereof that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of reactive (secondary) amyloidosis, familial Mediterranean Fever and familial amyloid nephropathy with urticaria and deafness (Muckle-Wells syndrome).
sta ' C - Amyloids containing a variant of cystatin C are associated with hereditary cerebral hemorrhage with amyIoidosis of Icelandic type. The disease is associated with a leucine to glycine mutation at position 68 and cystatin C containing this mutation aggregates in vitro (Abrahatrtson, M. and Grubb, A. (1994) Proc. Natl. Acad Sci. USA
Ql_:1416-1420). Cystatin C or a peptide fragment thereof that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of hereditary cerebral hemorrhage with amyloidosis of Icelandic type.
13 micrqglobulin - Amyloids containing X32 microglobulin (~i2M) are a major complication of long term hemodialysis (see e.g., Stein, G., et al. (1994) Nephrol. Dial.
Transplant. 9:48-50; Floege, J., et al. (1992) Kidney Int. Suppl. 38:S78-S85;
Maury, C.P.
(1990) Rheumatol. Int. 10:1-8). The native ~32M protein has been shown to fomn amyloid fibrils in vitae (Connors, L.H., et al. (1985) Biochem. Biophys. Res. Common.
131:1063-1068; Ono, K., et al. (1994) Nephron 66:404-407). ~i2~I, or a peptide fragment thereof that forms amyloid fibrils, can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of amyloidosis associated with long term hemodialysis.
Ap~lip~»rotein A-I (ApoA-I) - Amyloids containing variant forms of ApoA-I have been found in hereditary non-neuropathic systemic amyloidosis (familial amyloid polyneutopathy III). For example. N-tttminal fragments (residues 1-86,1-92 and 1-93) of an ApoA-I variant having a Trp to Arg mutation at position SD have been detected in amyloids (Booth, D.R., et al. ( I 995) QJM $$:695-702). In another family, a Ieucine to arginine mutation at position 60 was found (Soutar, A.K., et at. ( 1992) Proc. Natl.
Acad Sci. USA
89:7389-7393). ApoA-I or a peptide fragment thereof that fomns amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of hereditary non-neumpathic systemic amyloidosis.
1 ~ Ge oli - Amyloids containing variants of gelsolin are associated with familial amyloidosis of Finnish type. Synthetic gelsoIin peptides that have sequence homology to wildtvpe or mutant geIsolins and that form amyloid fibrils in vitro are reported in Maury, C.P. et al. (1994) Lab. Invest. 70:558-564. A nine residue segment surrounding residue 187 (which is mutated in familial gelsolin amyloidosis) was defined as an amyloidogenic region (Maury, et al., supra; see also Maury, C.P., et al. (1992) Biochem. Biophys.
Res. Common.
11:227-231: Maury, C.P. (1991) J. Clin. Invest. 87:I I95-1 I99). Gelsolin or a peptide fragment thereof that forms amyloid fibrils can be modified as described herein to create a modulator of amvloidosis that can be used in the detection or treatment of familial amyloidosis of Finnish type.
Procalcitonin or calcnto~,n - Amyloids containing procalcitonin. calcitonin or caleitonin-like immunoreactivity have been detected in amyloid fibrils associated with medullary carcinoma of the thymid (see e.g., Butler, M. and Khan, S. ( 1986) Arch. Pathol.
Lab. Med. 110:647-649; Sletten, K., et al. ( 1976) J. Exp. Med. 143:993-998).
Calcitonin has been shown to form a nonbranching fibrillar structure in vitro (Kedar, L, et al. ( 1976) Isr. J.
Med. Sei. 12:1137-1140). Procalcitonin. calcitonin or a fragment thereof that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that can be used in the detection or treatment of amyloidosis associated with medullary carcinoma of the thyroid.
Fibrinogen - Amyloids containing a variant form of fibrinogen alpha-chain have been found in hereditary renal amyloidosis. An arginine to Ieucine mutation at position 534 has been reported in amyloid fibril protein isolated from postmortem kidney of an affected individual (Benson. M.D., et al. (1993) Nature Genetics x:252-255). Fibrinogen alpha-chain or a peptide fragment thereof that forms amyloid fibrils can be modified as described herein to create a modulator of amyloidosis that cur be used in the detection or treatment of fibrinogen-associated hereditary renal amyloidosis.
vso a - Amyloids containing a variant form of lysozyme have been found in hereditary systemic amyloidosis. In one family the disease was associated with a threonine to isoleucine mutation at position ~6, whereas in another family the disease was associated with a histidine to aspartic acid mutation at position 67 (Pepys, M.B., et al.
(1993) Nature 362:53-5~7). Lysozyme or a peptide fragment thereof that forms amyloid fibrils can be modified as describFd herein to create a modulator of amyloidosis that can be used in the detection or treatment of lysozyme-associated hereditary systemic amyloidosis.
This invention is further illustrated by the following examples which should not be construed as limiting. A modulator's ability to alter the aggregation of (3-amyloid peptide in the assays described below are predictive of the modulator's ability to perform the same function in vivo.
1~
EXAMPLE 1: Construction of [3-Amyloid Modulators A ~i-amyloid modulator composed of an amino-terminally biotinylated (3-amyloid 20 peptide of the amino acid sequence:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGW
(positions 1 to 40 of SEQ ID NO: 1 ) was prepared by solid-phase peptide synthesis using an Na-9-fluorenylinethyloxycarbonyl (FMOC)-based protection strategy as follows.
Starting with 2.~ mmoles of FMOC-Val-Vliang resin. sequential additions of each amino acid wen 25 performed using a four-fold excess of protected amino acids.. l-hydroxybenzotriazole (HOBt) and diisopmpyl carbodiimide (DIC). Recouplings were performed when necessary as determined by ninhydrin testing of the resin after coupling. Each synthesis cycle was minimally described by a three minute deprotection (25 % piperidine/N-methyl-pyrrolidone (NMP)), a 1 ~ minute deprotection, five one minute NMP washes, a 60 minute coupling cycle, 30 five NMP washes and a ninhydrin test. To a 700 mg portion of the fully assembled peptidc-resin, biotin (obtained commercially from Molecular Probes, Ine.) was substituted. for an FMOC-amino acid was coupled by the above protocol. The peptide was removed from the resin by treatment with trifluoroacetic acid (TFA) (82.~ %), water (5 %), thioanisole (5 %), phenol (5 %). ethanedithiol (2.5 %) for two hours followed by precipitation of the peptide in 35 cold ether. The solid was pelleted by centrifugation (Z400 rpm x 10 min.), and the ether decanted. It was resuspended in ether, pelIeted and decanted a second time.
The solid. was dissolved in 10 % acetic acid and lyophilized to dryness to yield 230 mg of crude biotinylated peptide. 60 mg of the solid was dissolved in 25 % acetonitrile (ACN) /0.1 %
TFA and applied to a C 18 reversed phase high performance liquid chromatography (HPLC) column.
Biotinyl ~A~~.4p was eluted usiag a linar Sg adient of 30-45 %
acetonitrilel0.1 % TFA over 40 miautes. One primary fraction (4 mg) and several side fractions were isolated. The main fraction yielded a mass spectrum of 4556 (matrix-assisted laser desorption ionization -time of flight) which matches the theoretical (4555) for this peptide.
A p-amyloid modulator composed of an amino-terminally biotinylated [3-amyloid peptide of the amino acid sequence:
DAEFRHDSGYEVHHQ
(positiops 1 to 15 of SEQ ID NO: 1) was prepared on an Advanced ChemTech Model multiple peptide synthesizer using an automated protocol established by the manufacturer for 0.025 mrnole scale synthesis. Double couplings were performed on all cycles using 2-(1H-benzotriazol-1-y1r1,1,3,3-tetramethyluronium hexafluorophosphate (HBTU)/N,N-diisopropylethylamine (DIEA)/HOBt/FMOC-AA in four-fold excess for 30 minutes followed by DIC/HOBtlFMOC-AA in four-fold excess for 4~ minutes. The peptide was deprotected and removed from the resin by treatment with TFA/water (95 %/5 %) for three hours and precipitated with ether as described above. The pellet was resuspended in 10 %
acetic acid and lyophilized. The material was purified by a preparative HPLC using 15 %-40 acetonitrile over 80 minutes on a Vydac C18 column (21 x 250 mm). The main isolate eluted as a single symmetrical peak when analyzed by analytical HPLC and yielded the expected molecular weight when analyzed by electrospray mass spectrometry. Result =
2052.6 (2052 theoretical).
~-amyloid modulator compounds comprising other regions of the ~i-AP amino acid sequence (e.g.. an A~i aggregation core domain) were similarly prepared using the synthesis methods described above. Moreover, modulators comprising other amyloidogenic peptides can be similarly prepared.
EXAMPLE 2: Inhibition of p-Amyloid Aggregation by Modulators The ability of ~3-amyloid modulators to inhibit the aggregation of natural ~i-AP when combined with the natural (3-AP was examined in a series of aggregation assays. Natural (3-AP (~i-APl,.4p) was obtained commercially from Bachem (Torrance, CA). Amino-terminally biotinylated ~i-AP modulators were prepared as described in Example 1.
A. (optical Density Assay In one assay, (3-AP aggregation was measured by determining the increase in turbidity of a solution of natural /3-AP over time in the absence or presence of various concentrations of the modulator. Turbidity of the solution was quantitated by determining the optical density at 400 nm (AQpp ~,) of the solution over time.
The aggregation of natural (3-AP in the absence of modulator was determined as follows. (3-AP~-4o was dissolved in hexafluoro isopropanol (HFIP; Aldrieh Chemical Co., SS
Inc.) at 2 mglml. Aliquou of the HFIP solution (87 ~1) were transferred to individual 10 mm x 75 mm test tubes. A stream of argon gas was passed through each tube to evaporate the HFIP. To the resulting thin film of peptide, dimethylsulfoxide (DMSO; Aldrich Chemical Co., Inc.) (25 ~1) was added to dissolve the peptide. A 2 mm x 7 mmTeflon-coated magnetic stir bar was added to each tube. Buffer (475 pL of 100 mM NaCI, 10 mM sodium phosphate, pH 7.4) was added to the DMSO solution with stirring. The resulting mixture was stirred continuously and the optical density was monitored at 400 nm to observe the formation of insoluble peptide aggregates.
Alternatively, (3-AP~.,40 was dissolved in DMSO as described above at 1.6 mM (6.9 mg/ml) and aliquots (25 p1) were added to stirred buffer (475 ~1), followed by monitoring of absorbance at 400 nm.
For inhibition studies in which a ~3-amyloid modulator was dissolved in solution together with the natural (3-AP, the modulators were dissolved in DMSO either with or without prior dissolution in HFIP. These compounds were then added to buffer with stirring, followed by addition of ~i-AP ~ ~0 in DMSO. Alternatively. HFIP solutions of modulators were combined with ~i-AP ~ ~0 in HFIP followed by evaporation and redissolution of the mixture in DMSO. Buffer was then added to the DMSO solution to initiate the assay. The amino-terminally biotinylated ~3-amyloid peptide modulators N-biotinyl-~iAP
1~0, and N-biotinyl-(iAP 1 _ 15 were tested at concentrations of 1 % and 5 % in the natural ~i-AP ~ ~0 solution.
A representative example of the results is shown graphically in Figure 1, which depicts the inhibition of aggregation of natural ~i-AP ~ ~0 by N-biotinyl-~iAP
~ ~0. In the absence of the modulator. the optical density of the natural p-AP solution showed a characteristic sigmoidal curve. with a lag time prior to aggregation (approximately 3 hours in Figure 1 ) in which the A400 nm w~ low . followed by rapid increase in the A4o0 nm~ which quickly reached a plateau level. representing aggregation of the natural ~i amyloid peptides.
In contrast. in the presence of as little as 1 % of the N-biotinyl-(3AP1~0 modulator, aggregation of the natural [3 amyloid peptides was markedly inhibited, indicated by an increase in the lag time, a decrease in the slope of aggregation and a decrease in the plateau level reached for the turbidity of the solution (see Figure 1 ). N-biotinyl-~iAP t.40 at a concentration of 5 % similarly inhibited aggregation of the natural ~i amyloid peptide.
Furthermore, similar results were observed when N-biotinyl-~iAP 1 _ 15 ''Was used as the modulator. These results demonstrate that an N-terminally biotinylated [3-AP
modulator can effectively inhibit the aggregation of natural ~i amyloid peptides, even when the natural ~i amyloid peptides are present at as much as a 100-fold molar excess concentration.
B. Fluorescence Assav In a second assay, (3-AP aggregation was measured using a fluorometric assay essentially as described in Levine, H. (1993) Protein Science 2_:404-410. In this assay, the dye thioflaviae T (ThT) is contacted with the ~i-AP solution. Association of ThT with aggregated ~i-AP, but not monomeric or loosely associated ~-AP, gives rise to a new excitation (ex) maximum at 450 nm and an enhanced emission (em) at 482 nm, compared to the 385 nm (ex) and 445 nm (em) for the free dye. ~i-AP aggregation was assayed by this method as follows. Aliquots (2.9 ~1) of the solutions used in the aggregation assays as described above in section A were removed from the samples and diluted in 200 p1 of potassium phosphate buffer (50 mM, pH 7.0) containing thiotlavin T ( 10 ~uM;
obtained commerFially from Aldrich Chemical Co., Inc.). Excitation was set at 450 nm and emission was measured at 482 nm. Similar to the results observed with the optical density assay described above in section A, as little as 1 % of the N-biotinylated ~-AP
modulators was effective at inhibiting the aggregation of natural (3 amyloid peptides using this fluorometric assay.
C. Static gre~ation A~av In a third assay, [3-AP aggregation was measured by visualization of the peptide aggregates using SDS-polyacrylamide gel electrophoresis (SDS-PAGE). In this assay, ~i-AP
solutions were allowed to aggregate over a period of time and then aliquots of the reaction were run on a standard SDS-PAGE gel. Typical solution conditions were 200 pM
of J3-APB.
4p in PBS at 37 °C for 8 days or 200 ~M ~i-AP~~p in 0.1 M sodium acetate at 37 °C for 3 days. The peptide aggregates were visualized by Coomassie blue staining of the gel or, for ~3-AP solutions that included a biotinylated [3-AP modulator, by western blotting of a filter prepared from the gel with a streptavidin-peroxidase probe, followed by a standard peroxidase assay. The ~i-AP aggregates are identifiable as high molecular weight, low mobility bands on the gel, which are readily distinguishable from the low molecular weight, high mobility (3-AP monomer or dimer bands.
When natural (3-AP~.Qp aggregation was assayed by this method in the absence of any ~i amyloid modulators, high molecular weight aggregates were readily detectable on the gel.
In contrast, when N-biotinyl-~i-AP~.,4p modulator self aggregation was assayed (i.e., aggregation of the N-biotinyl peptide alone, in the absence of any natural (3-AP), few if any high molecular weight aggregates were observed, indicating that the ability of the modulator to self aggregate is significantly reduced compared to natural ~i-AP. Finally, when aggregation of a mixture of natural ~3-AP ~ ~p and N.biotinylated ~3-AP ~ ~p was assayed by this method, reduced amounts of the peptide mixture associated into high molecular weight aggregates, thus demonstrating that the ~i amyloid modulator is effective at inhibiting the aggregation of the natural ~i amyloid peptides.
Nenroto:ieity AnsiyaT~ of (3-Amyioid Modulators The neumtoxicity of the p-amyloid modulators is tested in a cell-based assay using the neuronal precursor cell line PC-12, or primary neuronal cells, and the viability indicator 3,(4,4-dimethylthiazol-2-yl)2,5-Biphenyl-tetrazolium bromide (MT'I~. (See Shearman. M.S.
et al. (I994) Proc. Natl. Acad Sci. USA x:1470-1474; Hansen, M.B. et al.
(1989) J. Immun.
Methods x_9:203-210). PC-12 is a rat adrenal pheochromocytoma cell line and is available from the American,Type Culture Collection, Rockville, MD (ATCC CRL 1721 ). MTT
(commercially available from Sigma Chemical Co. ) is a chromogenic substrate that is converted from yellow to blue in viable cells, which can be detected spectrophotometrically.
To test the neurotoxicity of a p-amyloid modulator (either alone or combined with natural p-AP). cells first are plated in 96-well plates at 7,000-10,000 cells/well and allowed to adhere by overnight culture at 37 °C. Serial dilutions of freshly dissolved or "aged"
modulators (either alone or combined with natural (3-AP) in phosphate buffered saline (PBS) I S are added to the wells in triplicate and incubation is continued for two or more days. Aged modulators are prepared by incubating an aqueous solution of the modulator at 37 °C
undisturbed for a prolonged period (e.g., five days or more). For the final two hours of exposure of the cells to the modulator preparation, MTT is added to the media to a final concentration of 1 mg/ml and incubation is continued at 37 °C.
Following the two hour incubation with MTT, the media is removed and the cells are lysed in isopropanoU0.4N HCl with agitation. An equal volume of PBS is added to each well and the absorbance of each well at 570 nm is measured to quantitate viable cells. Alternatively, MTT is solubilized by addition of 50 % N.N-dimethyl formamide/20 % sodium dodecyl sulfate added directly to the . media in the v~°ells and viable cells are likewise quantitated by measuring absorbance at 570 nm. The relative neurotoxicity of a ~i-amyloid modulator (either alone or in combination with mtural ~i-AP) is determined by comparison to natural ~i-AP alone (e.g., (31-40, p1-42), whica exhibits neurotoxicity in this assay and thus can serve as a positive control.
EXAMPLE 4: Syntheses of Additional Modified p-Amyloid Peptide Compounds In this example. a series of modified p-APs. having a variety of N terminal or random side chain modifications were synthesized.
A series ofN terminally modified p-amyloid peptides was synthesized using standard methods. Fully-protected resin-bound peptides corresponding to Ap(I-15) and Ap(I-40) were prepared as described in Example 1 on Wang resin to eventually afford carboxyl terminal peptide acids. Small portions of each peptide resin (13 and 20 ~cmoles, respectively) were aliquoted into the wells of the reaction block of an Advanced ChemTech Model 396 Multiple Peptide Synthesizer. The N-terminal FMOC protecting group of each sample was removed in the standard manner with 25% piperidine in NMP followed by extensive washing SO
with NMP.-The unprotected N terminal a-amino group of each peptide-resin sample was modified using one of the following methods:
Metho~g, coupling of modifying reagents containing free carboxylic acid groups:
The modifying reagent (five equivalents) was predissolved in NMP, DMSO or a mixture of those two solvents. HOBT and DIC (five equivalents of each reagent) were added to the dissolved modifier and the resulting solution was added to one equivalent of free-amino peptide-resin. Coupling was allowed to proceed overnight, followed by washing.
If a ninhydFin test on a small sample of peptide-resin showed that coupling was not complete, the coupling was repeated using I-hydroxy-7-azabenzotriazole (HOAt) in place of HOBt.
N~ethod B. coupling of modifying reagents obtained in preactivated forms: The modifying reagent (five equivalents) was predissolved in NMP, DMSO or a mixture of these two solvenu and added to one equivalent of peptide-resin.
Diisopropylethylamine (DIEA;
six equivalents) was added to the suspension of activated modifier and peptide-resin.
Coupling was allowed to proceed overnight, followed by washing. If a ninhydrin test on a I 5 small sample of peptide-resin showed that coupling was not complete. the coupling was repeated.
After the second coupling (if required) the N terminally modified peptide-resins were dried at reduced pressure and cleaved from the resin with removal of side-chain protecting groups as described in Example 1. Analytical reversed-phase HPLC was used to confirm that a major product was present in the resulting crude peptides which were purified using Millipore Sep-Pak cartridges or preparative reverse-phase HPLC. Mass spectrometry was used to confirm the presence of the desired compound in the product.
Method A was used to couple N aeetylneuraminic acid, cholic acid. trans-4-cotininecarboxylic acid. 2-imino-I-imidazolidineacetic acid, (S')-(-)-indoline-2-carboxylic acid, (-)-menthoxyacetic acid. 2-norbornaneacetic acid. r-oxo-5-acenaphthenebutyric acid.
(-~2-oxo-4-thiazolidinecarboxylic acid, and tetrahydro-3-furoic acid. Method B
was.used to couple 2-iminobiotin N hydroxysuccinimide ester. diethylenetriaminepentaacetic dianhydride, 4-morpholinecarbonyl chloride, 2-thiopheneacetyl chloride, and 2-thiophenesulfonyl chloride.
In a manner similar to the construction of N terminally modified A~(1-IS) and Ap(1-40) peptides described above, N fluoresceinyl Ap(I-IS) and Aa(I-40) were prepared in two alternative manners using the preactivated reagents ~-(and 6)-carboxyfluorescein succinimidyl ester and fluorescein-5-isothiocyanate (FITC Isomer I). Both reagents were obtained from Molecular Probes Ine. Couplings were performed using four equivalents of reagent per equivalent of peptide-resin with DIEA added to make the reaction solution basic to wet pH paper. Couplings of each reagent to A~i(1-IS)-resin appeared to be complete aRer a single overnight coupling. Coupling to Aa( 1-40)-resin was slower as indicated by a positive ninhydrin test and both reagents were recoupled to this peptide-resin overnight in te~hydrofiaan-NMP ( 1 ~ v/v). The resulting N urminally modified peptide-resins were cleaved, deprotected and purified as described in Example A.
In addition to the N fluoresceinyl A(i peptides described above, a p-amyloid modulator comprised of random modification of Ap(1-40) with fluorescein was prepared.
Ap(1-40) purchased from Bachem was dissolved in DMSO at approximately 2 mg/mL.
(and-6)-Carboxyfluorescein purchased from Molecular Probes was added in a 1.5 molar excess and DIEA was added to make the solution basic to wet pH paper. The reaction was allowed to proceedfor 1 hour at mom temperature and was then quenched with triethanolamine. The product was added to assays as this crude mixture.
(3-amyloid modulator compounds comprising other regions of the p-AP amino acid sequence (e.g., an Aj3 aggregation core domain) were similarly prepared using the synthesis methods described above. Moreover, modulators comprising other amyloidogenic peptides can be similarly prepared.
1 S E~AMP~ S: Identification of Additional [i-Amyloid Modulators In this Example, two assays of A~i aggregation were used to identify ~i-amyloid modulators which can inhibit this process.
The first assay is referred to as a seeded static assay (SSA) and was performed as follows:
To prepare a soitition of A(3 monomer. the appropriate quantity of A(3(1-40) peptide (Bachem) was weighed out on a micro-balance (the amount was corrected for the amount of water in the preparation, which, depending on lot number,.was 20-30% w/w). The peptide was dissolved in 1125 volume of dimethysulfoxide (DMSO), followed by water to volume and 1l2 volume 2x PBS (10x PBS: NaCI 137 mM. KCl 2.7 mM Na~HP04 ~ 7H~0 4.3 mM. KH2P04 1.4 mM pH 7.2) to a final concentration of 200 pM.
To prepare a stock seed, l ml of the above A(3 monomer preparation. was incubated for 8 days at 37 °C and sheared sequentially through an 18, 23, 26 and 30 gauge needle 25, 25, 50, and 100 times respectively. 2 ~1 samples of the sheared material was taken for fluorescence measurements after every 50 passes through the 30 gauge needle until the fluorescence units (FU) had plateaued (approx. 100-150x).
To prepare a candidate inhibitor, the required amount of candidate inhibitor was weighed out and the stock dissolved in lx PBS to a final concentration of 1 mM
(10x stock).
If insoluble. it was dissolved in 1/10 volume of DMSO and diluted in lx PBS to 1 mM. A
further 1/10 dilution was also prepared to test each candidate at both 100 pM
and 10 ~eM.
For the aggregation assay, each sample was set up in tirplicate [50 ~1 of 200 ~M
monomer,125 FU sheared seed (variable quantity dependent on the batch of seed.
routinely 3-6 ~1), 10 ~1 of lOx inhibitor solution, final volume made up to 100 ~1 with lx PBS]. Two concentrations of each inhibitor were tested 100 ~M and 10 ~M, equivalent to a 1:1 and a 1:10 molar ratio of monomer to inhibitor. The controls included an unneeded reaction to confirm that the fresh monomer contained no seed, and a seeded reaction in the absence of inhibitor, as a reference to compare against putative inhibitors. The assay was incubated at 37 °C for 6 h, taking 2 ~1 samples hourly for fluorescence measuremenTM. To measure 5 fluorescence, a 2 g1 sample of A/3 was added to 400 p1 of Thioflavin-T
solution (50 mM
Potassium Phosphate 10 mM Thioflavin-T pH 7.5). The samples were vortexed and the fluorescence was read in a 0.~ ml micro quartz cuvette at EX 450 nm and EM 482 nm (Hitach14~00 ~luorlmeter). ~i-aggregation results in enhanced emission of Thioflavin-TT'"' Accordingly, samples including an effective inhibitor compound exhibit reduced emission as 10 compared to control samples without the inhibitor compound.
The second assay is referred to as a shaken plate aggregation assay and was performed as follows:
A~3(.1-40) peptide from Bachem (Torrance. CA) was dissolved in HFIP
(1,I,I,3,3,3-1 ~ Hexafluoro-?-proganol: Aldrich I0.5?2-8) at a concentration of 2 mg peptide/ml and incubated at room temperature for 30 min. HFIP solubilized peptide was sonicated in a waterbath sonicator for ~ min at highest setting. then evaporated to dryness under a stream of argon. The peptide film was resuspended in anhydrous dimethylsulfoxide (DMSO) at a concentration of 6:9 mglml, sonicated for ~ min as before, then filtered through a 0.2 micron nylon syringe filter 20 (VWR cat. No. 28196-050). Candidate inhibitors were dissolved directly in DMSO, generally at a molar concentration 4 times that of the A~3(1-40) peptide.
Candidates were assayed in triplicate. For each candidate to be tested, 4 parts A~i{1-40) peptide in DMSO were combined with 1 part candidate inhibitor in DMSO in a glass vial, and mixed to produce a 1:1 molar ratio of A(i peptide to candidate. For different molar ratios, 25 candidates were diluted with DMSO prior to addition to A~i( 1-40). in order to keep the final DMSO and A~i(1-40) concentrations constant. Into an ultra low binding 96 well plate (Corning Costar cat. No. 2500, Cambridge MA) 100 ~1 PTL buffer ( 150 mM NaCI,10 mM
NaH?P04;
pH 7.4) was aliquotted per well. For each candidate, 10 ~1 of peptide mixture in DMSO was aliquotted into each of three wells containing bt~'er. The covered plate was vigorously 30 vortexed on a plate shaker at high speed for 30 seconds. An additional 100 ~1 of PTL buffer was added to each well and again the plate was vortexed vigorously for 30 sec.
Absorbance at 405 nnZ was immediately read in a plate reader for a baseline reading. The plate was returned to the plate shaker and vortexed at moderate speed for 5 hours at room temperature, with absorbance readings taken at 15-20 min intervals. Increased absorbance indicated aggregation.
35 Accordingly, effective inhibitor compounds cause a decrease in absorbance in the test sample as compared to a control sample without the inhibitor compound.
Representative results of the static seeded assay and shaken plate assay with prefentd ~-arnyloid modulators are shown below in Table I.
TABLE I
' CandidsteA~ Amino Modifying Ene~ m i Errec><
~ m Inhibitor ~ Reagent shaken plate. Seeded Static Acids I, ~ ,sss I Assa ' i ~
Cholic Complete ,~",~, ~ acid ' ~
174 A 1-15 ~ inhibition at 100% conc Diethylene- Decreased ,~"~, I
~
176 ' ' A~i1-15 ~ Plateau . triamine yenta .
. ;
f acetic acid i ; None "~,~, (-)-Menthoxy ~
180 ~ A~1-15 ~ . .
i acetic acid I
i Fluorescein Decreased ~ ,~"~, ;
;
190 A~i1-15 . Plateau carboxylic acid ;
(FICO) h-EVHHHHQ~K- Complete ++
220 ~ A~i16-40 ' inhibition IAIi at (16-40)]-OH
100%, increased mutant ' i i to at 10 %
Increased ~ ~",~, ~ I tag 224 A(31-40 F~sFzo-'T~sT2o mutant ~
' . I. accelerated i ~,~, L33 H17~5-lU ~VC«v awu , oyy cyouv~ ~ w ~ 10% ConC
* '~"~' = A strong inhibitor of aggregation. The rate of aggregation in the presence of the inhibitor was decreased compared to the control by at feast 30-50%
These results indicate that (3-APs modified by a wide variety of N-terminal modifying groups are effective at modulating (3-amyloid aggregation.
EXAMPLE 6: Additional [3-Amyloid Aggregation Assays Most preferably, the ability of (3-amyloid modulator compounds to modulate (e.g., inhibit or promote) the aggregation of natural ~-AP when combined with the natural (3-AP is examined in one or both of the aggregation assays described below. Natural ~i-AP (~i-AP t gyp) for use in the aggregation assays is commercially available from Bachem (Torrance, CA).
A. Nucleation Assay, The nucleation assay is employed to determine the ability of test compounds to alter (e.g. inhibit) the early events in formation of p-AP fibers from monomeric (3-AP.
Characteristic of a nucleated polymerization mechanism, a lag time is observed prior to nucleation, after which the peptide rapidly forms fibers as reflected in a linear rise in turbidity. The time delay before polymerization of (i-AP monomer can be quantified as well as the extent of formation of insoluble fiber by light scattering (turbidity).
Polymerization reaches equilibrium when the maximum turbidity reaches a plateau. The turbidity of a solution of natural ~i-AP in the absence or presence of various concentrations of a ~i-amyloid modulator compound is determined by measuring the apparent absorbance of the solution at 405nm (A4o5 "",) over time. The threshold of sensitivity for the measurement of turbidity is in the rapge of 15-20 pM (3-AP. A decrease in turbidity over time in the presence of the modulator. as compared to the turbidity in the absence of the modulator, indicates that the modulator inhibits fornzation of ~i-AP fibers from monomeric (3-AP. This assay can be performed using stirring or shaking to accelerate polymerization. thereby increasing the speed of the assay. Moreover the assay can be adapted to a 96-well plate format to screen multiple compounds.
To perform the nucleation assay, first A~i~.~p peptide is dissolved in HFIP
(1,1,1,3,3.3-Hexafluoro-2-propanoh Aldrich 10.522-8) at a concentration of 2 mg peptide/ml and incubated at room temperature for 30 min. HFIP-solubilized peptide is sonicated in a waterbath sonicator for ~ min at highest setting, then evaporated to dryness under a stream of argon. The peptide film is resuspended in anhydrous dimethylsulfoxide (DMSO) at a concentration of 6.9 mg/ml (25x concentration), sonicated for 5 min as before.
then filtered through a 0.2 micron nylon syringe filter (VWR cat. No. 28196-050). Test compounds are dissolved in DMSO at a 100x concentration. Four volumes of 25x A(3 tip peptide in DMSO
are combined with one volume of test compound in DMSO in a glass vial. and mixed to produce a 1:1 molar ratio of A(3 peptide to test compound. For different molar ratios, test compounds are diluted with DMSO prior to addition to A(3 ~-4p, in order to keep the final DMSO and A~t.~p concentrations constant. Control samples do not contain the test compound. Ten microliters of the mixture is then added to the bottom of a well of a Corning Costar ultra low binding 96-well plate (Corning Costar, Cambridge MA; cat. No.
2500).
Ninety microliters of water is added to the well, the plate is shaken on a rotary shaken at a constant speed at room temperature for 30 seconds, an additional 100 ~I of 2x PTL buffer (20 mM NaH2P04, 300 mM NaCI, pH 7.4) is added to the well, the plate is reshaken for 30 seconds and a baseline (t=0) turbidity reading is taken by measuring the apparent absorbance at 405 nm using a Hio-Rad Model 450 Microplate Reader. The plate is then returned to the shaker and shaken continuously for 5 hours. Turbidity readings are taken at 1 ~ minute intervals.
~i-amyloid aggregation in the absence of any modulators results in enhanced turbidity of the natural ~-AP solution (i.e., an increase in the apparent absorbance at 405 nm over time). Accordingly, a solution including an effective inhibitory modulator compound exhibits reduced turbidity as compared to the control sample without the modulator compound (f. e., less apparent absorbance at 405 nm over time as compared to the control sample).
B. Seeded Extension Assay The seeded extension assay can be employed to measure the rate of A~3 fiber formed in a solution of Ap monomer following addition of polymeric A~ fiber "seed".
The ability of test compounds to prevent further deposition of monomeric A~i to previously deposited amyloid is determined using a direct indicator of ~i-sheet formation using fluorescence. In contrast with the nucleation assay, the addition of seed provides immediate nucleation and continued growth of preformed fibrils without the need for continuous mixing, and thus results in the absence of a lag time before polymerization starts. Since this assay uses static polymerization conditions, the activity of positive compounds in the nucleation assay can be confirmed in this second assay under different conditions and with an addition2i probe of amvloid structure.
In the seeded extension assay. monomeric A~il~p is incubated in the presence of a "seed" nucleus (approximately ten mole percent of Al3 that has been previously allowed to polymerize under controlled static conditions). Samples of the solution are then diluted in thioflavin T (Th-T). The polymer-specific association of Th-T with A~i produces a fluorescent complex that allows the measurement of the extent of fibril fornnation (Levine, H.
(1993) Protein Science 2_:404-410). In particular. association of Th-T with aggregated (3-AP, but not monomeric or loosely associated ~3-AP, gives rise to a new excitation (ex) maximum at 450 nm and an enhanced emission (em) at 482 nm, compared to the 38~ nm (ex) and 445 nm (em) for the free dye. Small aliquots of the polymerization mixture contain sufficient fibril to be mixed with Th-T to allow the monitoring of the reaction mixture by repeated 2~ sampling. A linear growth curve is observed in the presence of excess monomer. The formation of thioflavin T responsive (3-sheet fibrils parallels the increase in turbidity observed using the nucleation assay.
A solution of A(3 monomer for use in the seeded extension assay is prepared by dissolving an appropriate quantity of A~i~"4p peptide in 1/25 volume of dimethysulfoxide (DMSO), followed by water to 1/2 volume and 1/2 volume 2x PBS (10x PBS: NaCI
137 mM, KCI 2.7 mM Na2HP04 ~ 7H20 4.3 mM, KH2P041.4 mM pH 7.2) to a final concentration of 200 ~M. To prepare the stock seed, 1 ml of the A~i monomer preparation, is incubated for approximately 8 days at 37 °C and sheared sequentially through an 18, 23, 26 and 30 gauge needle 25, 25, 50, and 100 times respectively. 2 p1 samples of the sheared material is taken for fluorescence measurements after every 50 passes through the 30 gauge needle until the fluorescence units (F~ plateau (approx.100-150x). Test compounds are prepared by dissolving ar. :.ppropriate amount of test compound in lx PBS to a final concentration of 1 mM (1 Ox stock). If insoluble. the compound is dissolved in 1/10 volume of DMSO and diluted in la PBS to 1 mM. A further 1/10 dilution is also prepared to test each candidate at both 100 pM and 10 ~M.
To perform the seeded extension assay, each sample is set up with 50 ~:1 of 200 pM
monomer, 125 FU sheared seed (a variable quantity dependent on the batch of seed. routinely 3-6 p1) and 10 ~1 of l Ox modulator solution. The sample volume is then adjusted to a final volume of 100 p1 with lx PBS. Two concentrations of each modulator typically are tested:
100 ~M and 10 ~M, equivalent to a 1:1 and a 1: I 0 molar ratio of monomer to modulator.
The controls include an unneeded reaction to confirm that the fresh monomer contains no seed, and a seeded reaction in the absence of any modulators, as a reference to compare IO against candidate modulators. The assay is incubated at 37 °C for 6 h. taking 2 ~1 samples hourly for fluorescence measurements. To measure fluorescence, a 2 ~I sample of A/3 is added to 400 gel of Thioflavin-T solution (50 mM Potassium Phosphate 10 mM
Thioflavin-T~
pH 7.5). The samples are vortexed and the fluorescence is read in a 0.~ ml micro Quartz TM
cuvette at EX 450 nm and EM 482 nm (Hitachi 4500 Fluorimeter).
15 p-amyloid aggregation results in enhanced emission of Thioflavin-T.
Accordingly, samples including an effective inhibitory modulator compound exhibit reduced emission as compared to control samples without the modulator compound.
~XAMPI~ 7: Ef~'ect of Different Amino Acid Subregions of A[3 Peptide on the 20 Inhibitory Activity of ~i~Amyloid Modulator Compounds To determine the effect of various subregions of A~i »p on the inhibitory activity of a a ~i-amyloid modulator. overlapping A/3 peptide 1 Smers were constructed. For each 1 Smer, four different amino-terminal modif crs were tested: a cholyl group, an iminobiotinyl group.
25 an N-acetyl neuraminyl group (NANA) and a 5-(and 6-~carboxyfluoresceinyl group (FICO).
The modulators were evaluated in the nucleation and seeded extension assays described in Example 6.
The results of the nucleation assays are summarized below in Table II. The concentration of Aj3l.dp used in the assays was 50 pM. The "mole %" value listed in Table II
30 refers to the % concentration of the test compound relative to A(3~-4p.
Accordingly, 100%
indicates that A~i ~,.4p and the test compound were equimolar. Mole % values less than 100%
indicate that A~i ~~p was in molar excess relative to the test compound (e.g.,10% indicates that A~i l.~p was in 10-fold molar excess relative to the test compound). The results of the nucleation assays for each test compound are presented in Table II in two ways. The "fold 35 increase in lag time". which is a measure of the ability of the compound to delay the onset of aggregation, refers to the ratio of the observed lag time in the presence of the test compound to the observed lag time in the control without the test compound. Accordingly a fold increase in lag time of 1.0 indicates no change in lag time. whereas numbers >
1.0 indicate an increase in lag time. The "% inhibition of plateau", which is a measure of the ability of the compound to dect~se the total amount of aggregation, refers to the reduction of the final turbidity in the presence of the test compound expressed as a percent of the control without the test compound. Accordingly, an inhibitor that abolishes aggregation during the course of the assay will have a % inhibition of 100. N-terminally modified A~i subregions which 5 exhibited inhibitory activity are indicated in bold in Table II.
Table II
N-terminal Fotd iacresse% Inhibition Reference lylodificationg,,d Peptide1e "/ a Lay Tjtnef atea #
PPI-174 cholyl A~ - 10 0 >4.5 100 PPI-264 c6olyl A~ p 100 >4.5 100 PPI-269 cholyl A(3 _~ 100 1.5 ~-,0 PPI-274 choiyl A~i ~ p 100 >4.5 100 PPI-279 cholyl A l_ 100 1.6 51 PPI-284 cholyl A(3 ~ 100 >4.5 87 PPI-173 NANA A~i ~ _ 100 -1 ~0 PPI-266 NANA A~i6.2 100 1.3 64 PPI-271 NANA A(3 _Z 100 13 77 PPI-276 ~1ANA A(31 p 100 ~1 ~-~0 ' PPI-281 NANA A(32 _3 100 1 53 PPI-286 NANA A ~p 100 1.3 -~0 PPI-172 IminobiotinylA/3 _~ 100 1.2 -r0 PPI267 IminobiotinylA~i Ip 100 1.6 44 ~
PPI-272 IminobiotinylA~ _2 100 1.2 40 PPI-277 IminobiotinylA~t~3e 100 1.2 55 PPI-282 IminobiotinylA 100 -1 66 PPI-287 IminobiotinylA~i ~ ' 100 2.3 -~0 PPI-190 FICO A~ _ 100 -1 30 PPI-268 FICO A~i _2 100 1.9 .r0 PPI-2?3 FICO A~i -Z 100 1.7 34 PPI-278 FICO A~i ~. 100 1.6 59 PPI-283 FICO A~ 100 L2 25 PPI-288 FICO A~i2~p 100 2 75 These results indicate that certain subregions of A~3l~p, when modified with an 10 appropriate modifying group, are effective at inhibiting the aggregation of A[3~.~p. A cholyl group was an effective modifying group for several subregions. Cholic acid alone was tested for inhibitory activity but had no effect on A(3 aggregation. The A(3~2o subregion exhibited high levels of inhibitory activity when modified with several different modifying gmups (cholyl, NANA. in~inobiotinyl), with choIyl-A~36.2p (PPI-264) being the most active fonm.
Accordingly, this modulator compound was chosen for fiuther analysis.
described in Example 8.
EXAMPLE 8: Identification of a Five Amino Acid Subregion of A~ Peptide Sufficient for Inhibitory Activity of a ~i-Amyloid Modulator Compound To further delineate a minimal subregion of cholyl-A(3~2o su~cient for inhibitory activity,, a series of amino terminal and carboxy terminal amino acid deletions of cholyl-A~3~2o were constructed. The modulators all had the same cholyl amino-terminal modification. Additionally, for the peptide series having carboxy terminal deletions, the carboxy terminus was further modified to an amide. The modulators were evaluated as described in Example 7 and the results are summarized below in Table III.
wherein the data is presented as described in Example 7.
1 S Table III
N-Terns. C-Term. Fold increase~0 Inhibition ~
Ref # ~d. A Pe 'de Mod. Mole in LaQ of Plateau % Time PPI-264 cholyl A~~~o - 100 >4.5 100 PPI-341 cholyl A~-2o - 100 >4.5 100 33 2 .-0 PPI-342 cholyl A(3g_ - 100 1.~ --0 33 2.1 -r0 PPI-343 cholyl A/39_ o - 33 2.0 --0 344 cholyl = -.i j. 2.1 -r0 PPI -A(It -20 PPI-345 cholyl A~3 _~o - 33 1.5 ~.-0 PPI-346 cholvl A~3 _~o - 33 2.1 --U
PPI-347 cholyl A~3~3- - 33 2.6 ~-0 o PPI-348 cholyl A~itZp - 33 2.0 49 PPI-349 cholyl A[3 Z - 33 2.3 50 PPI-350 cholyl A(31~20 - 38 3.4 23 PPI-296 cholyl A~i p amide 33 1.8 ~0 PPI-321 cholyl A(3~~9 amide 33 1.4 -~-0 PPI-325 cholyl A/3 ~ ~ amide 33 1.8 ~.0 PPi-331 cholyl A~i~~4 amide 33 1.0 29 PPI-339 cholyl A[3~1o amide 33 1.1 13 These results indicate that activity of the modulator is maintained when amino acid residue 6 is removed from the amino terminal end of the modulator (i.e., cholyl-A~i~-2o retained activity) but activity is lost as the peptide is deleted further at the amino-terminal end by removal of amino acid position 7 through to amino acid position 12 (s. e..
cholyl-A(3g.2o through cholyl-A~ilg-20 did inhibit the plateau level of A~ agony. However, fi>rtber deletion of amino acid position 13 resulted in a compound (i.e., cholyl-A~314-20) in which inhibitory activity is restored. Furthermore, additional deletion of amino acid position 14 (i.e., cholyl-A(ils_2o) or Positions 14 and 15 (i.e:, cholyl-A~i16.2o) still maintained inhibitory activity. Thus, amino terminal deletions of A~i~zo identified A~i 120 ~ a subregion which is sufficient for inhibitory activity when appropriately modified. In contrast, carboxy terminal deletion of amino acid position 20 resulted in loss of activity which was not fully restored as the peptide was deleted further at the carboxy-terminal end. Thus, maintenance of position 20 within the modulator may be important for inhibitory activity.
~.XAMPLE 9: Identification of a Four Amino Acid Subregion of A~i Peptide Sufficient for Inhibitory Activity of a (3-Amyloid Modulator Compound In this example, the smallest effective modulator identified in the studies described in Example 8. cholyl-A~i 1 X20 (PPI-3 SO), was analyzed further. Additional amino-and carboxy-terminal deletions were made with eholyl-A~i 16.20, as well as an amino acid substitution (Val1 g->Thr), to identify the smallest region sufficient for the inhibitory activity of the modulaxor. A peptide comprised of five alanine residues, (AIa)5, modified at its amino-terminus with cholic acid, was used as a specificity control. The modulators were evaluated as described in Example 7 and the results are summarized below in Table IV, wherein the data is presented as described in Example 7.
Table IV
N-Term. C-Term. Fold Increase% lnhib'rcion ef. ~ ~ A~i Mod. le % !~ Time of Plateau Pe ric a PPI-264 cbolyl A~6. - 10 2.0 43 ~ o PPI-347 cbolyl A~t~zo - 10 ZZ 57 PPI-349 cbotyl A~i1 - 100 >5.0 100 33 2.6 35 10 2.1 --~0 PPI-350 cboiyl A lit - 100 >5.0 100 o 10 2.4 40 PPI368 cbolyl A~l~-Zt - 100 >5.0 100 PPI-374 imino- Apl6.2o - 100 13 86 ~ biotinyl PPI-366 cholyl A(31 - 100 3.1 --0 10 1.6 --0 PPI-369 cholyl A~i - 100 ~ 1 --0 x.20 (Val 8->Thr) PPI-370 cholyl A(3t6-2p - 100 2.6 73 ~ (Phe Ala) PPI-365 cholyl (Ala) - 100 --1 -0 ( PPI-319 _ cholylA[3 smide 33 S.6 ~-4 ~
10 2.7 ~0 PPI-321 cholyl A~ amide 100 1.2 0 PPI-377 - A~ - 100 ~l --0 As shown in Table IV, cholyl-A~il~2o (PPI-350) and cholyl-A~i~~-z~ (PPI-368) both exhibited inhibitory activity, indicating that the four-amino acid minimal subregion of positions 17-20 is sufficient for inhibitory activity. Loss of.position 20 (e.g., in PPI-366 and PPI-321) resulted in loss of inhibitory activity, demonstrating the importance of position 20.
Moreover, mutation of valine at position 18 to threonine (in PPI-369) also resulted in loss of activity, demonstrating the importance of position 18. In contrast, mutation of phenylalanine at position 19 to alanine (cholyl-A~316-2o Phel9->Ala; PPI-370) resulted in a compound which still retained detectable inhibitory activity. Accordingly, the phenylalanine at position 19 is more amenable to substitution, preferably with another hydrophobic amino acid residue.
Cholyl-penta-alanine (PPI-365) showed no inhibitory activity. demonstrating the specificity of the A~i peptide portion of the modulator. Moreover, unmodified A~i~6-2o (PPI-377) was not inhibitory, dern~onstrating the functional importance of the amino-terminal modifying group. The specific functional group influenced the activity of the modulator.
For example, iminobiotinyl-A~it~2o (PPI-374) exhibited inhibitory activity similar to cholyl-A(3i~2o, whereas an N-acetyl neuraminic acid (NANA)-modified A~i 1 X20 was not an effective inhibitory modulator (not listed in Table IV). A C-terminal amide derivative of cholyl-A~i~6.
20'(PPI-319) retained high activity is delaying the lag time of aggregation, indicating that the carboxy-terminus of the modulator can be derivatized without loss of inhibitory activity.
Although this amide-derivatized compound did not inhibit the overall plateau level of aggregation over time. the compound was not tested at concentrations higher than mole 33 %.
Higher concentrations of the amide-derivatized compound are predicted to inhibit the overall plateau level of aggregation, similar to cholyl-A(31~20 (PPI-350).
EXAMPLE 10: Effect of ~-Amyloid Modulators on the Neurotoxicity of Natural (3-Amyloid Peptide Aggregates The neurotoxicity of natural ~i-amyloid peptide aggregates, in either the presence or.
absence of a (3-amyloid modulator, is tested in a cell-based assay using either a rat or human neuronally-derived cell line (PC-12 cells or NT-2 cells, respectively) and the viability indicator 3,(4,4-dimethylthiazol-2-yl)2,5-diphenyl-tetrazolium bromide (MT'17.
(See e.g., Shearman, M.S. et al. (1994) Proc. Natl. Acad Sci. USA 9_x:1470-1474; Hansen, M.B. et al.
(1989) J. Immun. Methods 11 :203-210 for a description of similar cell-based viability assays). PC-12 is a rat adrenal pheochromocytoma cell line and is available from the American Type Culture Collection, Roclcville, MD (ATCC CRL 1721 ). MTT
(commercially available from Sigma Chemical Co.) is a chromogeaic substrate that is converted from yellow to blue in viable cells, which can be detected specuophotometrically.
To test the neurotoxicity of natural ~3-amyloid peptides, stock solutions of fresh A(3 monomers and aged A~ aggregates were first prepared. A~i~~p in I00% DMSO was prepared from lyophilized powder and immediately diluted in one half the final volume in H20 and then one half the final volume in 2X PBS so that a final concentration of 200 ~M
peptide, 4% DMSO is achieved. Peptide prepared in this way and tested immediately on cells is referred to ~s "fresh" A~ monomer. To prepare "aged" A~i aggregates, peptide TM
solution was placed in a 1.~ ml Eppendorf tube and incubated at 37 °C
for eight days to allow fibrils to form. Such "aged" A~ peptide can be tested directly on cells or frozen at -80°C. The neurotoxicity of fresh monomers and aged aggregates were tested using PC12 and NT2 cells. PC12 cells were routinely cultured in Dulbeco's modif:ed Eagle's medium (DNIEM) containing 10% hone serum, 5% fetal calf serum, 4mM glutamine, and I%
genumycin. NT2 cells were routinely cultured in OPTI-MEM medium (GIBCUBRL CAT.
16 31985) supplemented with 10% fetal calf serum, 2 mM glutamine and 1 %
gentamycin.
Cells were plated at 10-15,000 cells per well in 90 p1 of fresh medium in a 96 -well tissue culture plate 3-4 hours prior to treaunent. The fresh or aged A~ peptide solutions ( I 0 pL) were then diluted 1:10 directly into tissue culture medium so that the final concentration was in the range of I-I O pM peptide. Cells are incubated in the presence of peptide without a change in media for 48 hours at 37°C. For the final three hours of exposure of the cells to the (3-AP preparation. MTI' was added to the media to a final concentration of 1 mglml and incubation was continued at 37 °C. Following the two hour incubation with MTT, the media was removed and the cells were Iysed in 100 pL isopropanoU0.4N HCI with agitation. An equal volume of PBS was added to each well and the plates were agitated for an additional 10 minutes. Absorbance of each well at 570 nm was measured using a microtiter plate reader to quantitate viable cells.
The neurotoxicity of aged (S day or 8 day) A~ Lip aggregates alone, but not fresh A~3 ~.~p monomers alone, was confirmed in an experiment the results of which are shown in Figure 3, which demonstrates that incubating the neuronal cells with increasing amounts of fresh A~i ~.~p monomers was not significantly toxic to the cells whereas incubating the cells with increasing amounts of 5 day or 8 day A(31~p aggregates led to increasing atriount of neurotoxicity. The ECSO for toxicity of aged A~i~.~p aggregates was I-2 pM for both the PC12 cells and the NT2 cells.
To determine the effect of a ~i-amyloid modulator compound on the neurotoxicity of A~~.4p aggregates. a modulator compound, cholyl-A~iøZp (PPI-264), was preincubated with A~il~p monomers under standard nucleation assay conditions as described in Example 6 and at particular time intervals post-incubation, aliquots of the ~-AP/modulator solution were removed and 1 ) the turbidity of the solution was assessed as a measure of aggregation and 2) the solution was applied to cultured neuronal cells for 48 hours at which time cell viability was assased~usiag IvtTT to determine the n'eurotoxicity of the solution. The results of the turbidity analysis are shown in Figure 4, panels A, B and C. In panel A, Aø
1.4p and cholyl-Aø6.zp were both present at 64 pM. In panel B, Aøt.~p was print at 30 ~NI and cholyl-Aø~.2p was present at 64 E,eM. In panel C, Aøl.~p was present at 10 ~M and cholyl-Aø6.2o was present at 64 pM. These data show that an equimolar amount of cholyl-Aø~.2p is effective at inhibiting aggregation of Aø1"4p (see Figure 4, panel A) and that as the concentration of Aø lip is reduced, the amount of detectable aggregation of the Aø 1-4p monomer is cowespondingly reduced (compare Figure 4, panels B and C with panel A). The corresponding results of the neurotoxicity analysis are shown in Figure 4, panels D, E, and F.
These insults demonstrate that the ø-amyloid modulator compound not only inhibits aggregation of Aø~.4p monomers but also inhibits the neurotoxicity of the Aø~~p solution, illustrated by the reduced percent toxicity of the cells when incubated with the' Aø~.4plmodulator solution as compared to Aø~.~p alone (see e.g., Figure 4, panel D).
Moreover, even when Aø l.dp aggregation was not detectable as measured by light scattering, the modulator compound inhibited the neurotoxicity of the Aø ~.4p solution (see Figure 4, panels E and F). Thus, the formation of neumtoxic Aø t.~p aggregates precedes the fonaation of insoluble aggregates detectable by light scattering and the modulator compound is effective at inhibiting the inhibiting the formation and/or activity of these neurotoxic aggregates. Similar results were seen with other modulator compounds, such as iminobiotinyl-Aø6_2p (PPI-267), cholyl-Aø»2p (PPI-350) and cholyl-Aø1~2o-amide (PPI-319).
Additionally, the ø-amyloid modulator compounds have been demonstrated to reduce the neurotoxicity of preformed Aø ~.4p aggregates. In these experiments, Aø
~.~p aggregates were preformed by incubation of the monomers in the absence of any modulators.
The modulator compound was then incubated with the preformed A(3~.4p aggregates for 24 hours ai 37 °C, after which time the ø-AP/modulator solution was collected and its neurotoxicity evaluated as described above. Incubation of preformed Aøl.~p aggregates with the modulator compound prior to applying the solution to neuronal cells resulted in a decrease in the neurotoxicity of the Aø~-4p solution. These results suggest that the modulator can either bind to Aø fibrils or soluble aggregate and modulate their inherent neurotoxicity or that the modulator can perivrb the equilibrium between monomeric and aggregated forms of Aø1.4p in favor of the non-neurotoxic form.
EXAMPLE 11: Characterization of Additional ø-Amyioid Modulator Compounds In this example, additional modulator compounds designed based upon amino acids 17-20 of Aø, LVFF (identified in Example 9), were prepared and analyzed to further delineau the structural features necessary for inhibition of ø-amyloid aggregation. Types of compounds analyzed included ones having only three amino acid residues of an Aø
aggregation-core domain. compounds in which the amino acid residues of an A~
aggregation core domain were rearranged or in which amino acid substitutions had been made, compounds modified with a carboxy-terminal modifying group and compounds in which the modifying group had been derivaxized. Abbreviations used in this example are:
h- (free amino terminus), -oh (free carboxylic acid terminus), -nh2 (amide terminus), CA (cholyl, the aryl portion of cholic acid), NANA (N acetyl neuraminyl), IB (iminobiotinyl), ~iA (~i-alanyl), DA (D-alanyl), Adp (aminoethyldibenzofiuanylpropanoic acid), Aic (3-(O~-aminoethyl-iso~
cholyI, a derivative,of cholic acid), IY (iodotyrosyl), o-methyl (carboxy-terminal methyl ester), N me (N methyl peptide bond), DeoxyCA (deoxycholyl) and LithoCA
(lithocholyl).
Modulator compounds having am Aic modifying group at either the amino- or carboxy-terminus (e.g., PPI-408 and PPI-418) were synthesized using known methods (see e.g., Wess, G, et al. (1993) Tetrahedron Letters, x:817-822; Wess, G. et al.
(1992) Tetrahedron Letters x:195-198). Briefly, 3-iso-O-(2-aminoethyl)-cholic acid (3(3-(2-aminoethoxy)-7a.12a-dihydroxy-S~i-cholanoic acid) was converted to the FMOC-protected derivative using FMOC-OSu (the hydroxysuccinimide ester of the FMOC group, which is commercially available) to obtain a reagent that was used to introduce the cholic acid derivative into the compound. For N-terminal introduction of the cholic acid moiety, the FMOC-protected reagent was coupled to the N-terminal amino acid of a solid-phase peptide in the standard manner, followed by standard FMOC-deprotection conditions and subsequent cleavage from the resin, followed by HPLC purification. For C-terminal introduction of the cholic acid moiety, the FMOC-protected reagent was attached to 2-chlorotrityl chloride resin in the standard manner. This amino aryl derivatized resin was then used in the standard manner to synthesize the complete modified peptide.
The modulators were evaluated in the nucleation and seeded extension assays described in Example 6 and the results are summarized below in Table V. The change in lag time (~L,ag) is presented as the ratio of the lag time observed in the presence of the test compound to the lag time of the control. Data are reported for assays in the presence of 100 mole % inhibitor relative to the concentration of A~ii".4p, except for PPI-315, PPI-348, PPI-380, PPI-407 and PPI-418, for which the data is reported in the presence of 33 mole inhibitor. Inhibition (% Inuclv) is listed as the percent reduction in the maximum observed turbidity in the control at the end of the assay time .~iod: .. inhibition in the extension assay ('~o Ice") is listed as the percent reduction of thioflavin-T $tmraceace of ~i-structure in the presence of 25 mole % inhibitor. Compounds with a % Inucl'n of at least 30%
are highlighted in bold.
T~~,1~ V 72 N-Tens. C-Tam.
PPI-293 CA - -oh 1.0 0 ND*
PPI-315 CA HQKLVFF 1.1 5 ND
PPI-316 NANA HQKLYFF -ah 1.5 -15 ND
PPI-319 CA KLVFF -nh 5.4 70 52 PPI-339 CA HDSGY 1.1- -18 ND
PPI-348 CA HQKLVFF -06 2.0 70 ND
PPI-349 CA Q KLVFF -06 >5 100 56 PPI-350 CA KLVFF -06 1.8 72 11 PPI-365 CA AAAAA -oh 0.8 -7 0 PPI366 CA QKLVF -oh 3.1 -23 ND
PPI-368 CA LVFFA -06 >5 100 91 PPI-369 CA KLTFF oh 1.1 -16 44 PPI-370 CA KLVAF -oh 2.6 73 31 PPI-371 CA KLVFF(A) -oh 2.5 76 80 PPI-372 CA FKFVL -06 0.8 45 37 PFI-373 NANA KLVFF -oh 0.9 16 8 PPI-374 IB KLVFF -oh 13 86 0 PPI-375 CA KTVFF -oh 1.2 18 21 PPI-377 h- KLVFF -oh 1.1 0 8 ~PPI-379 CA LVFFAE -oh 1.4 55 16 PPI-380 CA LVFF -06 1.8 72* 51 PPI-381 CA LVFF(DA) -oh 23 56 11 PPI-382 CA LVFFA -nh~ 1.0 -200 91 PPI-383 h-asLa~o~VFF -oh 0.4 14 0 PPI-386 h- LVFFA -oh 1.0 15 11 PPI-387 h- KLVFF -nh~ 1.3 ~ -9 39 PPI-388 CA AVFFA -06 1.4 68 44 PPI-389 CA LAFFA -oh 1.5 47 b6 PPI390 CA LVAFA -oh 2.7 25 0 PPI-392 CA VFFA -06 2.0 76 10 PPI393 CA LVF -oh 1.3 I 0 PPI-394 CA VFF -oh 1.8 55 0 PPI-395 CA FFA -oh 1.0 51 6 PPI-39b CA LV(IY)FA -oh >5 100 71 PPI-401 CA LVFFA -o-methylND . ND 0 PPI-405 h- LVFFA -ah~ 1.3 11 70 PPI-407 CA LVFFK -oh >5 100** 85 -.
PPI-408 6- LVFFA (Aic)-oh3.5 46 3 PPI-418 h-(Aic) LVFFA -oh >5 100** 87 PPI-426 CA FFVLA -oh >5 100 89 PPI-391 CA LVFAA -oh 1.6 40 ND
PPI-397 CA LVF(IY)A -06 >5 95 ND
PPI-400 CA AVAFA -oh 1.0 -I S ND
PPI-403 * * * HQKLVFF -oh 1.4 -75 0 PPI-404 * * * LKLVFF -oh 1.8 -29 7 *
PPI-424 DeoxyCA LVFFA -oh 3.0 -lI4 82 PPI-425 LithoCA LVFFA -oh 2.8 -229 0 PPI-428 CA FF -oh 1.7 -78 15 PPI-429 CA FFV -oh Z.2 -33 7 PPI-430 CA FFYL -oh 4.1 33 75 PPI-433 CA LVFFA -oh 2.8 27 ND
(all D amino acids) PPI-435 t-Boc LVFFA -oh 3.0 -5 ND
PPI-438 CA GFF -oh 1.0 0 ND
' ND = not done " = 33 mol "" = h-DDIII(N Me-Val)DLL(Adp) ""= h-DDII(N Me-Leu)VEH(Adp) Certain compounds shown in Table V (PPI-319, PPI-349, PPI-350, PPI-368 and PPI-426) also were tested in neurotoxicity assays such as those described in Example Z 0. For each compound. the delay of the appearance of neurotoxicity relative to control coincided with the delay in the time at which polymerization of A~i began in the nucleation assays.
This correlation between the prevention of formation of neurotoxic A~i species and the prevention of polymerization of A~i was consistently observed for all compounds tested.
The results shown in Table V demonstrate that at an effective modulator compound can comprise as few as three A~i amino acids residues (see PPI-394, comprising the amino acid sequence VFF, which corresponds to A~3I$_2o, and PPI-395, comprising the amino acid sequence FFA. which corresponds to A(3I9-21 )- The results also demonstrate that a modulator compound having a modulating group at its carboxy-terminus is effective at inhibiting A~i aggregation (see PPI-408, modified at its C-terminus with Aic). Still further.
the results demonstrate that the cholyl gmup, as a modulating group, can be manipulated while maintaining.the inhibitory activity of the compounds (see PPI-408 and PPI-418, both of which comprise the cholyI derivative Aic). The free amino group of the Aic derivative of cholic acid represents a position at which a chelation group for ~nTc can be introduced, e.g., to create a diagnostic agent. Additionally, the ability to substitute iodotyrosyl for phenylalanine at position 19 or 20 of the A~i sequence (see PPI-396 and PPI-397) while maintaining the ability of the compound to inhibit A~i aggregation indicates that the compound could be labeled with radioactive iodine, e.g., to create a diagnostic agent, without loss of the inhibitory activity of the compound.
Finally, compounds with inhibitory activity were created using A~i derived amino acids but wherein the amino acid sequence was rearranged or had a substitution with a non-A~-derived amino acid. Exarnples of such compounds include PPI-426, in which the seQuence of A~i 1 ~-21 (LVFFA) has been reawanged (FFVLA), PPI-372, in which tire sequence of~Pr~t~.2o (KLVFF~ has been reaeraanged (FKF'VL), and PPI-388, -389 and -390, in which the sequence of A~i t 7_21 (LVFFA) has been substituted at position 17,18 or 19, respectively, with an alanine residue (AVFFA for PPI-388, LAFFA for PPI-389 and LVAFA
for PPI-390). The inhibitory activity of these compounds indicate that the presence in the compound of an amino acid sequence directly corresponding to a portion of A~i is not essential for inhibitory activity, but rather suggests that maintenance of the hydrophobic nature of this core region, by inclusion of amino acid residues such as phenylalaaine, valine, leucine"regardless of their precise order, can be sufficient for inhibition of A~i aggregation.
EXAMPLE IZ: Characterization of ~i-Amyloid Modulator Compounds Comprising an Unmodified ~i-Amyloid Peptide To examine the ability of unmodified A~ peptides to modulate aggregation of natural j3-AP, a series of A~ peptides having amino- and/or carboxy terminal deletions as compared to A~it~o, or having intenzal amino acids deleted (i.e.. noncontiguous peptides), were prepared. One peptide (PPI-220) had additional, non-A/3-derived amino acid rasidues at its amino-terminus. These peptides all had a free amino group at the amino-terminus and a free carboxylic acid at the carboxy-terminus. These unmodified peptides were evaluated in assays as described in Example 7. The results are summarized below in Table VI, wherein the data is presented as described in Example 7. Compounds exhibiting at least a 1.5 fold increase in lag time are highlighted in bold.
Table VI
Fold Increase% Inhibition lteferenc~#~ o % _ in g Timeo f plateau AIi Peo '~,ie PPI ZZ6 ~ ~ 100 i.66 76 A
PPI-227 A~ i 100 -1 47 PPI-Z28 A ~ 100 >4.5 100 PPI-229 A 1 ~ N
PPI-230 A 100 0.8 -.0 o PPI-231 A~ l~- - ~1 18 -PPI-247 A~i I00 ~-1 -.~0 .
(Q3I-35) PPI-?.48 A ~i I00 1.58 -0 _2 (d26-30) PPI-249 A ~ 100 237 -~0 _ o (A21-25) PPI-I50 A~3 100 1.55 --0 ,1 (A1620) PPI-251 A~ 100 ~1.2 ~-0 .
o t o (A11-15) PPI 152 A~i 100 1.9 33 -(A6-10) PPI-253 A~ 100 1.9 -~0 PPI?SO EEVVHHHHQQ-A/3 100 >4 100 The results shown in ?able VI demonstrate that limited portions of the A~
sequence can have a significant inhibitory effect on natural ~-AP aggregation even when the peptide is not modified by a modifying group. Preferred unmodified peptides are Aj3g,2o (PPI-226), A~1~-30 (PPl-228), A(31-20, 26.40 (fPI-249) and EEwHHHHQQ-A~mo (PPI-Z20), the amino 5 acid sequences of which are shown in SEQ ID NOs: 4,14,15, and 16, respectively.
Foaming part of this disclosure is th,e appended Sequence Listing, the contents of Which STC summarize in Tabla VII below.
Table VII
SEO I_D NO: gmino A_~ ~gtide Sequence 1 43 amino acids Aft 2 143 amino acids APP C-terminus 3 43 amino acids A(3t~ (19. 20 muted) 4 HDSGYEVHHQKLVFF A~i~
5 HQKLVFFA A(3 4_ t 6 HQKLVFF A~t~. o 7 QKLVFFA A~ t 5-8 Q~CLVFF A~i 9 KLVFFA A~t6_2t 10 KLVFF A~3t 12 LVFF A(it~_ 13 LAFFA A~ ~. t ~ t ~A) 14 KLVFFAEDVGSNKGA Aft o 15 3 5 amino acids ~ A~i t _ 16 35 amuio acids EEWHHHHQQ-~iAP t ~o 17 AGAAAAGA FrP peptide 18 AILSS amylin peptide 19 VFF A~it~
21 FFVLA A(3 ~_ t (scrambled) 22 LVFFK A(31~- t (AZ -~K) 23 ~ LV(I~FA A~ t ~- t ~ t 9-~1~
24 VFFA A~i t g_ t 25 AVFFA A~i ~_ (Lt~-~A) 26 LVF(I~A A~t~- (F2o~I~
27 LVFFAE A(3 ~ ~. ~
28 FFVL A~it~_ (scrambled) 29 - FKFVL A ~ (scrambled) 30 KLVAF A~i ~
(F
~
->A) 31 KLVFF(~A) A ~ (A2 ->~A) 32 LVFF(DA) A ~i~~. (A2~-FDA) Those skilled in the art will recognize, or be able to ascertain using no more than mutine experimentation, many equivalents to the specific embodiments of the invention dcsaibed herein. Such equivalents are intended to be encompassed by the following claims.
(1) GgNBRAL INFORMATION:
S (i) APPLICANT:
(A) NAME: PHARMACBUTICAL PEPTIDES INCORPORATED
(B) STREET: ONE HAMPSHIRE STREET
(C) CITY: CAMBRIDGB
(D) STATE: MASSACHUSETTS
IO (E) COUNTRY: USA
(F) POSTAL CODE (ZIP): 02139-1572 (G) TELEPHONE: (617) 494-8400 (H) TELEFAX: (617) 494-8414 1S (ii) TITLE OF INVENTION: Modulators of Amyloid Aggregation (iii) NUMBER OF SEQUENCES: 32 (iv) CORRESPONDENCE ADDRESS:
ZO (A) ADDRESSEE: LAIiIVE & COCRFIELD
(B) STREET: 60 State Street, Suite 510 (C) CITY: Boston (D) STATE: Massachusetts (E) COUNTRY: USA
ZS (F) ZIP: 02109-1875 (v) COMPUTER READABLE FORM:
(A) MEDIUM TYPE: Floppy disk (B) COMPUTER: IBM PC compatible 3O (C) OPERATING SYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: PatentIn Release #1.0, Version #1.25 (vi) CURRENT APPLICATION DATA:
(A) APPLICATION NUMBER: 000000 3S (B) FILING DATE: Herewith (C) CLASSIFICATION:
(vii) PRIOR APPLICATION DATA:
(A) APPLICATION NU1'~ER: USSN 08/404,831 40 (B) FILING DATE: 14-MAR-1995 (vii) PRIOR APPLICATION DATA:
(A) APPLICATION NUMBER: USSN 08/475,579 (B) FILING DATE: 07-JLJN-1995 (vii) PRIOR APPLICATION DATA:
(A) APPLICATION NL1MBER: USSN 08/548, 998 (B) FILING DATE: 27-OCT-1995 SO (viii) ATTORNEY/AGENT INFORMATION:
(A) NAME: DeConti, Giulio A.
(B) REGISTRATION NON~ER: 31,503 (C) REFERENCE/DOCKET NDf~ER: PPI-002C2PC
SS (ixf TELECOMMUNICATION INFORMATION:
(A) TELEPHONE: (617) 227-7400 (B) TELEFAX: (617)227-5941 (2) INP~RMATION FOR SFQ ID NO:1:
(i) SEQUENCE CHAR.P~CTERISTICS:
(A) LENGTH: 43 amino acids (B) TYPE; amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide IO (v) FRAGMENT TYPE: internal (xi) SEQUENCE DESCRIPTION: SEQ ID NO: l:
Asp Ala Glu Phe Arg His Asp Ser Gly Tyr Glu Val His His Gln Lys Leu Val Phe Phe Ala Glu Asp Val Gly Ser Asn Lys Gly Ala Ile Ile 20 Gly Leu Met Val Gly Gly Val Val Ile Ala Thr (2) INFORMATION FOR SEQ ID N0:2:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 103 amigo acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal 3S (xi) SEQUENCE DESCRIPTION: SEQ ID N0:2:
Glu Val Lys Met Asp Ala Glu Phe Arg His Asp Ser Gly Tyr Glu Val His His Gln Lys Leu Val Phe Phe Ala Glu Asp Val Gly Ser Asn Lys Gly Ala Ile Ile Gly Leu Met Val Gly Gly Val Val Ile Ala Thr Val Ile Val Ile Thr Leu Val Met Leu Lys Lys Lys Gln Tyr Thr Ser Ile His His Gly Val Val Glu Val Asp Ala Ala Val Thr Pro Glu Glu Arg 50 ss ~o ~s so His Leu Ser Lys Met Gln Gln Asn Gly Tyr Glu Asn Pro Thr Tyr Lys SS Phe Phe Glu Gln Met Gln Asn (2) INFORMATION FOR SEQ ID N0:3:
° i , (i) SEQU8NCE CiiARACTERISTICS:
(A) LENGTH: 43 amino :cads (B) TYPE: amino acid S (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal (ix) FEATURE:
(A) NAME/I~Y: Modified site (B) LOCATION: 19 (D) OTHER INFORMATION: /note= Xaa is a hydrophobic amino acid (ix) FEATURE:
(A) NAME/I~Y: Modified site (B) IACATION: 20 (D) OTHER INFORMATION: /note= Xaa is a hydrophobic amino acid (xi) SEQUENCE DESCRIPTION: SEQ ID N0:3:
2S Asp Ala Glu Phe Arg His Asp Ser Gly Tyr Glu Val His His Gln Lys Leu Val Xaa Xaa Ala Glu Asp Val Gly Ser Asn Lys Gly Ala Ile Ile Gly Leu Met Val Gly Gly Val Val Ile Ala Thr 35 (2) INFORMATION FOR SEQ ID N0:4:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 15 amino acids (8) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:4:
His Asp Ser Gly Tyr Glu Val His His Gln Lys Leu Val Phe Phe SO (2) INFORMATION FOR SEQ ID N0:5:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 8 amino acids (B) TYPE: amino acid SS (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:5:
His Gln Lys Leu Val Pht phe Ala (2) INFORMATION
FOR
SEQ
ID N0:6:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 7 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 1$ (xi) SEQUENCE DESCRIPTION: SEQ ID
N0:6:
His Gln Lys Leu Val Phe Phe (2) INFORMATION FOR SEQ ID N0:7:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 7 amino acids 2$ (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 3O (xi) SEQUENCE DESCRIPTION: SEQ ID N0:7:
Gln Lys Leu Val Phe Phe Ala (2) INFORMATION FOR SEQ ID N0:8:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 6 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 4$ (xi) SEQUENCE DESCRIPTION: SEQ ID NO: B:
Gln Lys Leu Val Phe Phe $0 (2) INFORMATION FOR SEQ ID N0:9:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 6 amino acids $$ (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide ~1 (xi_) SEQ~1C8 DBSCRIPTION: SBQ ID
N0:9:
Lys Leu Val Phe Phe Ala (2) INFORMATION
FOR
SEQ
ID NO:10:
(i) SEQUENCE CHARrACTERISTICS:
(A) LBNGTH: 5 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID
NO:10:
Lys Leu Val Phe Phe S
(2) INFORMATION
FOR
SEQ
ID NO:11:
(i) SEQUENCE C$AR.ACTERISTICS
(A) LENGTH: 5 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID
NO:11:
Leu Val Phe Phe Ala (2) INFORMATION FOR SEQ ID N0:12:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 4 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:12:
Leu Val Phe Phe (2) INFORMATION FOR SEQ ID N0:13:
(i) SEQUENCE CHARACTERISTICS:
SS (A) LENGTH: 5 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal S (xi) SEQUENCE DESCRIPTION: SEQ ID N0:13:
Leu Ala Phe Phe Ala (2) INFORMATION FOR SEQ ID N0:14:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 15 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal (xi) SEQUENCE DESCRIPTION: SEQ ID N0:14:
2S Lys Leu Val Phe Phe Ala Glu Asp Val Gly Ser Asn Lys Gly Ala (2) INFORMATION FOR SEQ ID N0:15:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 35 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal (xi) SEQUENCE DESCRIPTION: SEQ ID N0:15:
Asp Ala Glu Phe Arg His Asp Ser Gly Tyr Glu Val His His Gln Lys 1 . 5 IO 15 Leu Val Phe Phe Ser Asn Lys Gly Ala Ile Ile Gly Leu Met Val Gly Gly Val Val SO 3s (2) INFORMATION FOR SEQ ID N0:16:
SS (i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 35 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (i~,) MOLECULE TYPE: peptide 83 (v) FRAGMENT TYPE: internal $
(xi) SEQUENCE DESCRIPTION: SEQ ID N0:16:
Glu Glu Val Val His His His His Gln Gln Lys Leu Val Phe Phe Ala 1 s 10 is Glu Asp Val Gly Ser Asn Lys Gly Ala Ile Ile Gly Leu Met Val Gly 2s 30 Gly Val Val 1$ 3s (2) INFORMATION FOR SEQ ID N0:17:
ZO (i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 8 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear 2$ (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal 3O (xi) SEQUENCE DESCRIPTION: SEQ ID N0:17:
Ala Gly Ala Ala Ala Ala Gly Ala 3$
(2) INFORMATION FOR SEQ ID N0:18:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: s amino acids 40 (B) TYPE: amino acid (D) TOPOLOGY: linear iii) MOLECULE TYPE: peptide 4$ (v) FRAGMENT TYPE: internal (xi) SEQUENCE DESCRIPTION: SEQ ID N0:18:
$0 Ala Ile Leu Ser Ser (2) INFORMATION FOR SEQ ID N0:19:
$$
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 3 amino'acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 84 (xi) SEQUENCE DESCRIPTION: SEQ ID N0:19:
S
Val Phe Phe (2) INFORMATION FOR SEQ ID N0:20:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 3 amino acids (8) TYPE: amino acid 1S (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:20:
Phe Phe Ala 2S (2) INFORMATION
FOR SEQ
ID N0:21:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: S amino acids (8) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID
N0:21:
Phe Phe Val Leu Ala (2) INFORMATION
FOR SEQ
ID N0:22:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 5 amino acids (B) TYPE: amino acid 4S (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID
N0:22:
Leu Val Phe Phe Lys SS (2) INFORMATION FOR SEQ ID N0:23:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 5 amino acids (B) TYPE: amino acid r (D) TOPOLOGY: linear 85 (ii) MOLECULE TYKE: peptide (ix) FEATURE:
(A) NAME/I~Y: Modified site (B) LOCATION: 3 (D) OTBER INFORMATION: /note= Xaa is iodotyrosyl 1O (xi) SEQUENCE DESCRIPTION: SEQ ID N0:23:
Leu Val Xaa Phe Ala is (2) INFORMATION FOR SEQ ID N0:24:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 4 amino acids 20 (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 25 (xi) SEQUENCE DESCRIPTION: SEQ ID N0:24:
Val Phe Phe Ala _ (2) INFORMATION
FOR SEQ
ID N0:25:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 5 amino acids (B) TYPE: amino acid (D) TOFOLDaY: linear (ii) MOLECULE TYPE: peptide 4O (xi) SEQUENCE DESCRIPTION: SEQ ID
N0:25:
Ala Val Phe Fhe Ala (2) INFORMATION FOR SEQ ID N0:26:
(i) SEQUENCE CHARACITsRISTICS:
(A) LENGTH: 5 amino acids SO (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide SS (ix) FEATURE:
(A) NAME/REY: Modified site (B) LOCATION: 4 (D) OTHER INFORMATION: /note= Xaa is iodotyrosyl r (x~ SBQUErtCE DESCRIPTION: SEQ ID N0:26:
Leu Val Phe Xaa Ala (2) INFORMATION FOR SEQ ID N0:27:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 6 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:27:
Leu Val Phe Phe Ala Glu (2) INFORMATION FOR SEQ ID N0:28:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 4 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:28:
Phe Phe Val Leu 1 s (2) INFORMATION FOR SEQ ID N0:29:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: s amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:29:
Phe Lys Phe Val Leu (2) INFORMATION FOR SEQ ID N0:30:
(i) SEQUENCE CHARACTERISTICS:
$$ (A) LENGTH: 5 amino acids (B) TYPE: amino acid (D ) TOPOLOGY : l inear (ii) MOLECULE TYPE: peptide (xi) SEQDENCB DBSCRIPTI~1: SEQ ID N0:30:
Lys Leu Val Ala Phe (2) INFORMATION FOR SEQ ID N0:31:
1U (i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 6 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear 15 (ii) I~LECVLE TYPE: peptide (ix) FEATURE:
(A) NAME/KEY: Modified site (B) LOCATION: 6 2~ (D1 OTHER INFORMATION: /note= Xaa is beta-alanyl (xi) SEQUENCE DESCRIPTION: SEQ ID N0:31:
Lys Leu Val Phe Phe Xaa 25 i (2) INFORMATION FOR SEQ ID N0:32:
3U (i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 5 amino acids (B) TYPE: amino acid (D) TOPOLOGY: liaear 35 (ii) MOLECULE TYPE: peptide (ix) FEATURE:
(A) NAME/KEY: Modified site (B) LOCATION: 5 4() (D) OTHER INFORMATION: /note= Xaa is D-alanyl (xi) SEQUENCE DESCRIPTION: SEQ ID N0:32:
Leu Val Phe Phe Xaa 45 i
(F
~
->A) 31 KLVFF(~A) A ~ (A2 ->~A) 32 LVFF(DA) A ~i~~. (A2~-FDA) Those skilled in the art will recognize, or be able to ascertain using no more than mutine experimentation, many equivalents to the specific embodiments of the invention dcsaibed herein. Such equivalents are intended to be encompassed by the following claims.
(1) GgNBRAL INFORMATION:
S (i) APPLICANT:
(A) NAME: PHARMACBUTICAL PEPTIDES INCORPORATED
(B) STREET: ONE HAMPSHIRE STREET
(C) CITY: CAMBRIDGB
(D) STATE: MASSACHUSETTS
IO (E) COUNTRY: USA
(F) POSTAL CODE (ZIP): 02139-1572 (G) TELEPHONE: (617) 494-8400 (H) TELEFAX: (617) 494-8414 1S (ii) TITLE OF INVENTION: Modulators of Amyloid Aggregation (iii) NUMBER OF SEQUENCES: 32 (iv) CORRESPONDENCE ADDRESS:
ZO (A) ADDRESSEE: LAIiIVE & COCRFIELD
(B) STREET: 60 State Street, Suite 510 (C) CITY: Boston (D) STATE: Massachusetts (E) COUNTRY: USA
ZS (F) ZIP: 02109-1875 (v) COMPUTER READABLE FORM:
(A) MEDIUM TYPE: Floppy disk (B) COMPUTER: IBM PC compatible 3O (C) OPERATING SYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: PatentIn Release #1.0, Version #1.25 (vi) CURRENT APPLICATION DATA:
(A) APPLICATION NUMBER: 000000 3S (B) FILING DATE: Herewith (C) CLASSIFICATION:
(vii) PRIOR APPLICATION DATA:
(A) APPLICATION NU1'~ER: USSN 08/404,831 40 (B) FILING DATE: 14-MAR-1995 (vii) PRIOR APPLICATION DATA:
(A) APPLICATION NUMBER: USSN 08/475,579 (B) FILING DATE: 07-JLJN-1995 (vii) PRIOR APPLICATION DATA:
(A) APPLICATION NL1MBER: USSN 08/548, 998 (B) FILING DATE: 27-OCT-1995 SO (viii) ATTORNEY/AGENT INFORMATION:
(A) NAME: DeConti, Giulio A.
(B) REGISTRATION NON~ER: 31,503 (C) REFERENCE/DOCKET NDf~ER: PPI-002C2PC
SS (ixf TELECOMMUNICATION INFORMATION:
(A) TELEPHONE: (617) 227-7400 (B) TELEFAX: (617)227-5941 (2) INP~RMATION FOR SFQ ID NO:1:
(i) SEQUENCE CHAR.P~CTERISTICS:
(A) LENGTH: 43 amino acids (B) TYPE; amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide IO (v) FRAGMENT TYPE: internal (xi) SEQUENCE DESCRIPTION: SEQ ID NO: l:
Asp Ala Glu Phe Arg His Asp Ser Gly Tyr Glu Val His His Gln Lys Leu Val Phe Phe Ala Glu Asp Val Gly Ser Asn Lys Gly Ala Ile Ile 20 Gly Leu Met Val Gly Gly Val Val Ile Ala Thr (2) INFORMATION FOR SEQ ID N0:2:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 103 amigo acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal 3S (xi) SEQUENCE DESCRIPTION: SEQ ID N0:2:
Glu Val Lys Met Asp Ala Glu Phe Arg His Asp Ser Gly Tyr Glu Val His His Gln Lys Leu Val Phe Phe Ala Glu Asp Val Gly Ser Asn Lys Gly Ala Ile Ile Gly Leu Met Val Gly Gly Val Val Ile Ala Thr Val Ile Val Ile Thr Leu Val Met Leu Lys Lys Lys Gln Tyr Thr Ser Ile His His Gly Val Val Glu Val Asp Ala Ala Val Thr Pro Glu Glu Arg 50 ss ~o ~s so His Leu Ser Lys Met Gln Gln Asn Gly Tyr Glu Asn Pro Thr Tyr Lys SS Phe Phe Glu Gln Met Gln Asn (2) INFORMATION FOR SEQ ID N0:3:
° i , (i) SEQU8NCE CiiARACTERISTICS:
(A) LENGTH: 43 amino :cads (B) TYPE: amino acid S (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal (ix) FEATURE:
(A) NAME/I~Y: Modified site (B) LOCATION: 19 (D) OTHER INFORMATION: /note= Xaa is a hydrophobic amino acid (ix) FEATURE:
(A) NAME/I~Y: Modified site (B) IACATION: 20 (D) OTHER INFORMATION: /note= Xaa is a hydrophobic amino acid (xi) SEQUENCE DESCRIPTION: SEQ ID N0:3:
2S Asp Ala Glu Phe Arg His Asp Ser Gly Tyr Glu Val His His Gln Lys Leu Val Xaa Xaa Ala Glu Asp Val Gly Ser Asn Lys Gly Ala Ile Ile Gly Leu Met Val Gly Gly Val Val Ile Ala Thr 35 (2) INFORMATION FOR SEQ ID N0:4:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 15 amino acids (8) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:4:
His Asp Ser Gly Tyr Glu Val His His Gln Lys Leu Val Phe Phe SO (2) INFORMATION FOR SEQ ID N0:5:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 8 amino acids (B) TYPE: amino acid SS (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:5:
His Gln Lys Leu Val Pht phe Ala (2) INFORMATION
FOR
SEQ
ID N0:6:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 7 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 1$ (xi) SEQUENCE DESCRIPTION: SEQ ID
N0:6:
His Gln Lys Leu Val Phe Phe (2) INFORMATION FOR SEQ ID N0:7:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 7 amino acids 2$ (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 3O (xi) SEQUENCE DESCRIPTION: SEQ ID N0:7:
Gln Lys Leu Val Phe Phe Ala (2) INFORMATION FOR SEQ ID N0:8:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 6 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 4$ (xi) SEQUENCE DESCRIPTION: SEQ ID NO: B:
Gln Lys Leu Val Phe Phe $0 (2) INFORMATION FOR SEQ ID N0:9:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 6 amino acids $$ (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide ~1 (xi_) SEQ~1C8 DBSCRIPTION: SBQ ID
N0:9:
Lys Leu Val Phe Phe Ala (2) INFORMATION
FOR
SEQ
ID NO:10:
(i) SEQUENCE CHARrACTERISTICS:
(A) LBNGTH: 5 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID
NO:10:
Lys Leu Val Phe Phe S
(2) INFORMATION
FOR
SEQ
ID NO:11:
(i) SEQUENCE C$AR.ACTERISTICS
(A) LENGTH: 5 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID
NO:11:
Leu Val Phe Phe Ala (2) INFORMATION FOR SEQ ID N0:12:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 4 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:12:
Leu Val Phe Phe (2) INFORMATION FOR SEQ ID N0:13:
(i) SEQUENCE CHARACTERISTICS:
SS (A) LENGTH: 5 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal S (xi) SEQUENCE DESCRIPTION: SEQ ID N0:13:
Leu Ala Phe Phe Ala (2) INFORMATION FOR SEQ ID N0:14:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 15 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal (xi) SEQUENCE DESCRIPTION: SEQ ID N0:14:
2S Lys Leu Val Phe Phe Ala Glu Asp Val Gly Ser Asn Lys Gly Ala (2) INFORMATION FOR SEQ ID N0:15:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 35 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal (xi) SEQUENCE DESCRIPTION: SEQ ID N0:15:
Asp Ala Glu Phe Arg His Asp Ser Gly Tyr Glu Val His His Gln Lys 1 . 5 IO 15 Leu Val Phe Phe Ser Asn Lys Gly Ala Ile Ile Gly Leu Met Val Gly Gly Val Val SO 3s (2) INFORMATION FOR SEQ ID N0:16:
SS (i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 35 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (i~,) MOLECULE TYPE: peptide 83 (v) FRAGMENT TYPE: internal $
(xi) SEQUENCE DESCRIPTION: SEQ ID N0:16:
Glu Glu Val Val His His His His Gln Gln Lys Leu Val Phe Phe Ala 1 s 10 is Glu Asp Val Gly Ser Asn Lys Gly Ala Ile Ile Gly Leu Met Val Gly 2s 30 Gly Val Val 1$ 3s (2) INFORMATION FOR SEQ ID N0:17:
ZO (i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 8 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear 2$ (ii) MOLECULE TYPE: peptide (v) FRAGMENT TYPE: internal 3O (xi) SEQUENCE DESCRIPTION: SEQ ID N0:17:
Ala Gly Ala Ala Ala Ala Gly Ala 3$
(2) INFORMATION FOR SEQ ID N0:18:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: s amino acids 40 (B) TYPE: amino acid (D) TOPOLOGY: linear iii) MOLECULE TYPE: peptide 4$ (v) FRAGMENT TYPE: internal (xi) SEQUENCE DESCRIPTION: SEQ ID N0:18:
$0 Ala Ile Leu Ser Ser (2) INFORMATION FOR SEQ ID N0:19:
$$
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 3 amino'acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 84 (xi) SEQUENCE DESCRIPTION: SEQ ID N0:19:
S
Val Phe Phe (2) INFORMATION FOR SEQ ID N0:20:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 3 amino acids (8) TYPE: amino acid 1S (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:20:
Phe Phe Ala 2S (2) INFORMATION
FOR SEQ
ID N0:21:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: S amino acids (8) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID
N0:21:
Phe Phe Val Leu Ala (2) INFORMATION
FOR SEQ
ID N0:22:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 5 amino acids (B) TYPE: amino acid 4S (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID
N0:22:
Leu Val Phe Phe Lys SS (2) INFORMATION FOR SEQ ID N0:23:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 5 amino acids (B) TYPE: amino acid r (D) TOPOLOGY: linear 85 (ii) MOLECULE TYKE: peptide (ix) FEATURE:
(A) NAME/I~Y: Modified site (B) LOCATION: 3 (D) OTBER INFORMATION: /note= Xaa is iodotyrosyl 1O (xi) SEQUENCE DESCRIPTION: SEQ ID N0:23:
Leu Val Xaa Phe Ala is (2) INFORMATION FOR SEQ ID N0:24:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 4 amino acids 20 (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 25 (xi) SEQUENCE DESCRIPTION: SEQ ID N0:24:
Val Phe Phe Ala _ (2) INFORMATION
FOR SEQ
ID N0:25:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 5 amino acids (B) TYPE: amino acid (D) TOFOLDaY: linear (ii) MOLECULE TYPE: peptide 4O (xi) SEQUENCE DESCRIPTION: SEQ ID
N0:25:
Ala Val Phe Fhe Ala (2) INFORMATION FOR SEQ ID N0:26:
(i) SEQUENCE CHARACITsRISTICS:
(A) LENGTH: 5 amino acids SO (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide SS (ix) FEATURE:
(A) NAME/REY: Modified site (B) LOCATION: 4 (D) OTHER INFORMATION: /note= Xaa is iodotyrosyl r (x~ SBQUErtCE DESCRIPTION: SEQ ID N0:26:
Leu Val Phe Xaa Ala (2) INFORMATION FOR SEQ ID N0:27:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 6 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:27:
Leu Val Phe Phe Ala Glu (2) INFORMATION FOR SEQ ID N0:28:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 4 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:28:
Phe Phe Val Leu 1 s (2) INFORMATION FOR SEQ ID N0:29:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: s amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID N0:29:
Phe Lys Phe Val Leu (2) INFORMATION FOR SEQ ID N0:30:
(i) SEQUENCE CHARACTERISTICS:
$$ (A) LENGTH: 5 amino acids (B) TYPE: amino acid (D ) TOPOLOGY : l inear (ii) MOLECULE TYPE: peptide (xi) SEQDENCB DBSCRIPTI~1: SEQ ID N0:30:
Lys Leu Val Ala Phe (2) INFORMATION FOR SEQ ID N0:31:
1U (i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 6 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear 15 (ii) I~LECVLE TYPE: peptide (ix) FEATURE:
(A) NAME/KEY: Modified site (B) LOCATION: 6 2~ (D1 OTHER INFORMATION: /note= Xaa is beta-alanyl (xi) SEQUENCE DESCRIPTION: SEQ ID N0:31:
Lys Leu Val Phe Phe Xaa 25 i (2) INFORMATION FOR SEQ ID N0:32:
3U (i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 5 amino acids (B) TYPE: amino acid (D) TOPOLOGY: liaear 35 (ii) MOLECULE TYPE: peptide (ix) FEATURE:
(A) NAME/KEY: Modified site (B) LOCATION: 5 4() (D) OTHER INFORMATION: /note= Xaa is D-alanyl (xi) SEQUENCE DESCRIPTION: SEQ ID N0:32:
Leu Val Phe Phe Xaa 45 i
Claims (15)
1. A .beta.-amyloid modulator compound consisting of an A.beta. aggregation core domain (ACD) from 4 to 7 amino acids in length and modeled after amino acid positions 17 to 20 of natural .beta.-amyloid peptide coupled directly or indirectly to at least one modifying group (MG) that is not naturally coupled to natural .beta.-amyloid peptides in their native form such that the compound modulates the aggregation or inhibits the neurotoxicity of natural .beta.-amyloid peptides when contacted with the natural .beta.-amyloid peptides, wherein said .beta.-amyloid modulator compound comprises at least one D-amino acid residue.
2. A .beta.-amyloid modulator compound consisting of an A.beta. aggregation core domain (ACD) modeled after amino acid positions 17 to 20 of natural .beta.-amyloid peptide coupled directly or indirectly to at least one modifying group (MG) that is not naturally coupled to natural .beta.-amyloid peptides in their native form such that the compound modulates the aggregation or inhibits the neurotoxicity of natural .alpha.-amyloid peptides when contacted with the natural .beta.-amyloid peptides, wherein said .beta.-amyloid modulator compound is from 4 to 7 amino acids in length.
3. A .beta.-amyloid modulator compound comprising a formula:
wherein Xaa1, Xaa2 and Xaa3 are each amino acid structures and at least two of Xaa1, Xaa2 and Xaa3 are independently, selected from the group consisting of a leucine structure, a phenylalanine structure and a valine structure, and at least one of Xaa1, Xaa2 and Xaa3 is a D-amino acid;
Y, which may or may not be present, is a peptide structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to 15;
Z, which may or may not be present, is a peptidic structure having the formula (Xaa)b, wherein Xaa is any amino acid structure and b is an integer from 1 to 15; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
Xaa1, Xaa2, Xaa3, Y, Z, A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural .beta.-amyloid peptides when contacted with the .beta.-amyloid peptides.
wherein Xaa1, Xaa2 and Xaa3 are each amino acid structures and at least two of Xaa1, Xaa2 and Xaa3 are independently, selected from the group consisting of a leucine structure, a phenylalanine structure and a valine structure, and at least one of Xaa1, Xaa2 and Xaa3 is a D-amino acid;
Y, which may or may not be present, is a peptide structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to 15;
Z, which may or may not be present, is a peptidic structure having the formula (Xaa)b, wherein Xaa is any amino acid structure and b is an integer from 1 to 15; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
Xaa1, Xaa2, Xaa3, Y, Z, A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural .beta.-amyloid peptides when contacted with the .beta.-amyloid peptides.
4. A .beta.-amyloid modulator compound comprising a formula:
wherein Xaa1 and Xaa3 are amino acid structures;
Xaa2 is a valine structure;
Xaa4 is a phenylalanine structure;
at least one of Xaa1, Xaa2, Xaa3 and Xaa4 being a D-amino acid;
Y, which may or may not be present, is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to 15;
Z, which may or may not be present, is a peptidic structure having the formula (Xaa)b, wherein Xaa is any amino acid structure and b is an integer from 1 to 15; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
Xaa1, Xaa3, Y, Z, A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural .beta.-amyloid peptides when contacted with the natural .beta.-amyloid peptides.
wherein Xaa1 and Xaa3 are amino acid structures;
Xaa2 is a valine structure;
Xaa4 is a phenylalanine structure;
at least one of Xaa1, Xaa2, Xaa3 and Xaa4 being a D-amino acid;
Y, which may or may not be present, is a peptidic structure having the formula (Xaa)a, wherein Xaa is any amino acid structure and a is an integer from 1 to 15;
Z, which may or may not be present, is a peptidic structure having the formula (Xaa)b, wherein Xaa is any amino acid structure and b is an integer from 1 to 15; and A is a modifying group attached directly or indirectly to the compound and n is an integer;
Xaa1, Xaa3, Y, Z, A and n being selected such that the compound modulates the aggregation or inhibits the neurotoxicity of natural .beta.-amyloid peptides when contacted with the natural .beta.-amyloid peptides.
5. A .beta.-amyloid modulator compound comprising the formula:
A-Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-B
wherein Xaa1 is a histidine structure;
Xaa2 is a glutamine structure;
Xaa3 is lysine structure;
Xaa4 is a leucine structure;
Xaa5 is a valine structure;
Xaa6 is a phenylalanine structure;
Xaa7 is a phenylalanine structure;
Xaa8 is a alanine structure;
A and B are modifying groups attached directly or indirectly to the amino terminus and carboxy terminus, respectively, of the compound, said modifying groups being groups that are not naturally coupled to natural .beta.-amyloid peptides in their native form;
and wherein Xaa1-Xaa2-Xaa3, Xaa1-Xaa2 or Xaa1 may or may not be present;
Xaa8 may or may not be present;
at least one of A and B is present and wherein said compound comprises at least one D-amino acid residue.
A-Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-B
wherein Xaa1 is a histidine structure;
Xaa2 is a glutamine structure;
Xaa3 is lysine structure;
Xaa4 is a leucine structure;
Xaa5 is a valine structure;
Xaa6 is a phenylalanine structure;
Xaa7 is a phenylalanine structure;
Xaa8 is a alanine structure;
A and B are modifying groups attached directly or indirectly to the amino terminus and carboxy terminus, respectively, of the compound, said modifying groups being groups that are not naturally coupled to natural .beta.-amyloid peptides in their native form;
and wherein Xaa1-Xaa2-Xaa3, Xaa1-Xaa2 or Xaa1 may or may not be present;
Xaa8 may or may not be present;
at least one of A and B is present and wherein said compound comprises at least one D-amino acid residue.
6. A .beta.-amyloid modulator compound comprising the formula:
A-Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa6-Xaa8-B
wherein Xaa1 is a histidine structure;
Xaa2 is a glutamine structure;
Xaa3 is lysine structure;
Xaa4 is a leucine structure;
Xaa5 is a valine structure;
Xaa6 is a phenylalanine structure;
Xaa7 is a phenylalanine structure;
Xaa8 is a alanine structure;
A and B are modifying groups attached directly or indirectly to the amino terminus and carboxy terminus, respectively, of the compound, said modifying groups being groups that are not naturally coupled to natural .beta.-amyloid peptides in their native form; wherein Xaa1-Xaa2-Xaa3, Xaa1-Xaa2 or Xaa1 may or may not be present;
Xaa8 may or may not be present; and at least one of A and B is present, and wherein said .beta.-amyloid modulator compound is from 4 to 7 amino acids in length.
A-Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa6-Xaa8-B
wherein Xaa1 is a histidine structure;
Xaa2 is a glutamine structure;
Xaa3 is lysine structure;
Xaa4 is a leucine structure;
Xaa5 is a valine structure;
Xaa6 is a phenylalanine structure;
Xaa7 is a phenylalanine structure;
Xaa8 is a alanine structure;
A and B are modifying groups attached directly or indirectly to the amino terminus and carboxy terminus, respectively, of the compound, said modifying groups being groups that are not naturally coupled to natural .beta.-amyloid peptides in their native form; wherein Xaa1-Xaa2-Xaa3, Xaa1-Xaa2 or Xaa1 may or may not be present;
Xaa8 may or may not be present; and at least one of A and B is present, and wherein said .beta.-amyloid modulator compound is from 4 to 7 amino acids in length.
7. A .beta.-amyloid modulator compound comprising a modifying group attached directly or indirectly to a peptidic structure, wherein the peptidic structure comprises amino acid structures having an amino acid sequence selected from the group consisting of His-Gln-Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 5), His-Gln-Lys-Leu-Val-Phe-Phe (SEQ ID
NO:
6), Gln-Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 7), Gln-Lys-Leu-Val-Phe-Phe (SEQ
ID
NO: 8), Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 9), Lys-Leu-Val-Phe-Phe (SEQ ID
NO:
10), Leu-Val-Phe-Phe-Ala (SEQ ID NO: 11), Leu-Val-Phe-Phe (SEQ ID NO: 12), Leu-Ala-Phe-Phe-Ala (SEQ ID NO: 13), Val-Phe-Phe (SEQ ID NO: 19), Phe-Phe-Ala (SEQ
ID NO: 20), Phe-Phe-Val-Leu-Ala (SEQ ID NO: 21), Leu-Val-Phe-Phe-Lys (SEQ ID
NO:
22), Leu-Val-Iodotyrosine-Phe-Ala (SEQ ID NO: 23), Val-Phe-Phe-Ala (SEQ ID NO:
24), Ala-Val-Phe-Phe-Ala (SEQ ID NO: 25), Leu-Val-Phe-Iodotyrosine-Ala (SEQ ID
NO:
26), Leu-Val-Phe-Phe-Ala-Glu (SEQ ID NO: 27), Phe-Phe-Vat-Leu (SEQ ID NO: 28), Phe-Lys-Phe-Val-Leu (SEQ ID NO: 29), Lys-Leu-Val-Ala-Phe (SEQ ID NO: 30), Lys-Leu-Val-Phe-Phe-.beta.Ala (SEQ ID NO: 31) and Leu-Val-Phe-Phe-DAla (SEQ ID NO:
32), wherein said .beta.-amyloid modulator compound comprises at least one D-amino acid residue.
NO:
6), Gln-Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 7), Gln-Lys-Leu-Val-Phe-Phe (SEQ
ID
NO: 8), Lys-Leu-Val-Phe-Phe-Ala (SEQ ID NO: 9), Lys-Leu-Val-Phe-Phe (SEQ ID
NO:
10), Leu-Val-Phe-Phe-Ala (SEQ ID NO: 11), Leu-Val-Phe-Phe (SEQ ID NO: 12), Leu-Ala-Phe-Phe-Ala (SEQ ID NO: 13), Val-Phe-Phe (SEQ ID NO: 19), Phe-Phe-Ala (SEQ
ID NO: 20), Phe-Phe-Val-Leu-Ala (SEQ ID NO: 21), Leu-Val-Phe-Phe-Lys (SEQ ID
NO:
22), Leu-Val-Iodotyrosine-Phe-Ala (SEQ ID NO: 23), Val-Phe-Phe-Ala (SEQ ID NO:
24), Ala-Val-Phe-Phe-Ala (SEQ ID NO: 25), Leu-Val-Phe-Iodotyrosine-Ala (SEQ ID
NO:
26), Leu-Val-Phe-Phe-Ala-Glu (SEQ ID NO: 27), Phe-Phe-Vat-Leu (SEQ ID NO: 28), Phe-Lys-Phe-Val-Leu (SEQ ID NO: 29), Lys-Leu-Val-Ala-Phe (SEQ ID NO: 30), Lys-Leu-Val-Phe-Phe-.beta.Ala (SEQ ID NO: 31) and Leu-Val-Phe-Phe-DAla (SEQ ID NO:
32), wherein said .beta.-amyloid modulator compound comprises at least one D-amino acid residue.
8. A .beta.-amyloid modulator compound comprising a modifying group attached directly or indirectly to a peptidic structure, wherein the peptidic structure comprises amino acid structures having an amino acid sequence selected from the group consisting of Leu-Ala-Phe-Phe-Ala (SEQ ID NO: 13), Phe-Phe-Val-Leu-Ala (SEQ ID NO: 21), Leu-Val-Phe-Phe-Lys (SEQ ID NO: 22), Leu-Val-Iodotyrosine-Phe-Ala (SEQ ID NO: 23), Ala-Val-Phe-Phe-Ala (SEQ ID NO: 25), Leu-Val-Phe-Iodotyrosine-Ala (SEQ ID NO: 26), Phe-Phe-Val-Leu (SEQ ID NO: 28), Phe-Lys-Phe-Val-Leu (SEQ ID NO: 29), Lys-Leu-Val-Ala-Phe (SEQ ID NO: 30), Lys-Leu-Val-Phe-Phe-.beta.Ala (SEQ ID NO: 31) and Leu-Val-Phe-Phe-DAla (SEQ ID NO: 32).
9. A pharmaceutical composition comprising a therapeutically effective amount of a .beta.-amyloid modulator compound of any one of claims 1 to 8, and a pharmaceutically acceptable carrier.
10. A commercial package containing a .beta.-amyloid modulator compound of any one of claims 1 to 8, together with instructions for its use for the treatment of a disorder associated with .beta.-amyloidosis.
11. The commercial package of claim 10, wherein the instructions are for use of the compound for treatment of Alzheimer's disease.
12. A method for inhibiting aggregation of natural .beta.-amyloid peptides, comprising contacting the natural .beta.-amyloid peptides with a .beta.-amyloid modulator compound of any one of claims 1 to 8, such that aggregation of the natural .beta.-amyloid peptides is inhibited.
13. Use of the .beta.-amyloid modulator compound of any one of claims 1 to 8, for the treatment of a disorder associated with .beta.-amyloidosis.
14. Use of the .beta.-amyloid modulator compound of any one of claims 1 to 8, for the manufacture of a medicament for the treatment of a disorder associated with .beta.-amyloidosis.
15. The use of claim 13 or 14, wherein said disorder is Alzheimer's disease.
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US08/404,831 US5817626A (en) | 1995-03-14 | 1995-03-14 | Modulators of beta-amyloid peptide aggregation |
US08/404,831 | 1995-03-14 | ||
US08/475,579 | 1995-06-07 | ||
US08/475,579 US5854215A (en) | 1995-03-14 | 1995-06-07 | Modulators of β-amyloid peptide aggregation |
US54899895A | 1995-10-27 | 1995-10-27 | |
US08/548,998 | 1995-10-27 | ||
CA002214247A CA2214247C (en) | 1995-03-14 | 1996-03-14 | Modulators of amyloid aggregation |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002214247A Division CA2214247C (en) | 1995-03-14 | 1996-03-14 | Modulators of amyloid aggregation |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2449296A1 true CA2449296A1 (en) | 1996-09-19 |
Family
ID=30773554
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002449296A Abandoned CA2449296A1 (en) | 1995-03-14 | 1996-03-14 | Modulators of amyloid aggregation |
Country Status (1)
Country | Link |
---|---|
CA (1) | CA2449296A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2020121071A1 (en) * | 2018-12-12 | 2020-06-18 | Levim Biotech Llp | Acylation process for preparation of n-substituted peptide |
-
1996
- 1996-03-14 CA CA002449296A patent/CA2449296A1/en not_active Abandoned
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2020121071A1 (en) * | 2018-12-12 | 2020-06-18 | Levim Biotech Llp | Acylation process for preparation of n-substituted peptide |
US11702446B2 (en) | 2018-12-12 | 2023-07-18 | Levim Biotech Llp | Acylation process for preparation of N-substituted peptide |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP0815134B1 (en) | Modulators of amyloid aggregation | |
AU741199B2 (en) | Modulators of beta-amyloid peptide aggregation comprising D-amino acids | |
US5985242A (en) | Modulators of β-amyloid peptide aggregation comprising D-amino acids | |
US6303567B1 (en) | Modulators of β-amyloid peptide aggregation comprising D-amino acids | |
US6689752B2 (en) | Modulators of β-amyloid peptide aggregation comprising D-amino acids | |
WO1998008868A9 (en) | MODULATORS OF β-AMYLOID PEPTIDE AGGREGATION COMPRISING D-AMINO ACIDS | |
CA2362834C (en) | Modulators of beta-amyloid peptide aggregation comprising d-amino acids | |
CA2449296A1 (en) | Modulators of amyloid aggregation | |
AU759036B2 (en) | Modulators of amyloid aggregation | |
AU5252496A (en) | Modulators of amyloid aggregation | |
AU2003208150A1 (en) | Modulators of amyloid aggregation | |
AU2007202669A1 (en) | Modulators of amyloid aggregation | |
AU769915B2 (en) | Modulators of beta-amyloid peptide aggregation comprising D-amino acids | |
EP1870419A2 (en) | Modulators of beta-amyloid peptide aggregation comprising d-amino acids | |
AU2004202014A1 (en) | Modulators of beta-amyloid peptide aggregation comprising D-amino acids | |
AU2005203579A1 (en) | Modulators of beta-amyloid peptide aggregation comprising D-amino acids |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
FZDE | Dead |