CA2401453A1 - G-proteins coupled receptor related polypeptides - Google Patents

G-proteins coupled receptor related polypeptides Download PDF

Info

Publication number
CA2401453A1
CA2401453A1 CA002401453A CA2401453A CA2401453A1 CA 2401453 A1 CA2401453 A1 CA 2401453A1 CA 002401453 A CA002401453 A CA 002401453A CA 2401453 A CA2401453 A CA 2401453A CA 2401453 A1 CA2401453 A1 CA 2401453A1
Authority
CA
Canada
Prior art keywords
nucleic acid
polypeptide
amino acid
seq
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
CA002401453A
Other languages
French (fr)
Inventor
Muralidhara Padigaru
Kumud Majumder
Catherine E. Burgess
Corine A. M. Vernet
Elma Fernandes
Richard A. Shimkets
Velizar T. Tchernev
Vishnu Mishra
Stacie Casman
Kimberly A. Spytek
Bryan Zerhusen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
CuraGen Corp
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US09/795,271 external-priority patent/US20030165829A1/en
Application filed by Individual filed Critical Individual
Publication of CA2401453A1 publication Critical patent/CA2401453A1/en
Abandoned legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/14Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/10Drugs for disorders of the urinary system of the bladder
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/22Anxiolytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/24Antidepressants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10Antimycotics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • A61P33/02Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/04Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Neurosurgery (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Cardiology (AREA)
  • Rheumatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Obesity (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Molecular Biology (AREA)
  • Pulmonology (AREA)
  • Psychiatry (AREA)
  • Hospice & Palliative Care (AREA)
  • Urology & Nephrology (AREA)
  • Psychology (AREA)
  • Virology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Vascular Medicine (AREA)
  • Biochemistry (AREA)

Abstract

Disclosed herein are nucleic acid sequences that encode G-coupled protein- receptor related polypeptides. Also disclosed are polypeptides encoded by these nucleic acid sequences, and antibodies, which immunospecifically-bind to the polypeptide, as well as derivatives, variants, mutants, of fragments of the aforementioned polypeptide, polynucleotide, or antibody. The invention further discloses therapeutic, diagnostic and research methods for diagnosis , treatment, and prevention of disorders involving any one of these novel huma n nucleic acids and proteins.

Description

NOVEL PROTEINS AND NUCLEIC ACIDS ENCODING SAME
BACKGROUND OF THE INVENTION
The invention generally relates to nucleic acids and polypeptides. More particularly, the invention relates to nucleic acids encoding novel G-protein coupled receptor (GPCR) polypeptides, as well as vectors, host cells, antibodies, and recombinant methods for producing these nucleic acids and polypeptides.
SUMMARY OF THE INVENTION
The invention is based in part upon the discovery of nucleic acid sequences encoding novel polypeptides. The novel nucleic acids and polypeptides are referred to herein as GPCRX, or GPCRI, GPCR2, GPCR3, GPCR4, GPCRS, GPCR6, GPCR7, GPCRB, GPCR9, and GPCR10 nucleic acids and polypeptides. These nucleic acids and polypeptides, as well as derivatives, homologs, analogs and fragments thereof, will hereina8er be collectively designated as "GPCRX" nucleic acid or polypeptide sequences.
In one aspect, the invention provides an isolated GPCRX nucleic acid molecule encoding a GPCRX polypeptide that includes a nucleic acid sequence that has identity to the nucleic acids disclosed in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38. In some embodiments, the GPCRX nucleic acid molecule will hybridize under stringent conditions to a nucleic acid sequence complementary to a nucleic acid molecule that includes a protein-coding sequence of a GPCRX nucleic acid sequence. The invention also includes an isolated nucleic acid that encodes a GPCRX polypeptide, or a fragment, homolog, analog or derivative thereof. For example, the nucleic acid can encode a polypeptide at least 80% identical to a polypeptide comprising the amino acid sequences of SEQ ID
NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83. The nucleic acid can be, for example, a genomic DNA fragment or a cDNA molecule that includes the nucleic acid sequence of any of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38.
Also included in the invention is an oligonucleotide, e.g., an oligonucleotide which includes at least 6 contiguous nucleotides of a GPCRX nucleic acid (e.g., SEQ
ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38) or a complement of said oligonucleotide.
Also included in the invention are substantially purified GPCRX polypeptides (SEQ ID
NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83). In certain embodiments, the GPCRX polypeptides include an amino acid sequence that is substantially identical to the amino acid sequence of a human GPCRX polypeptide.
The invention also features antibodies that immunoselectively bind to GPCRX
polypeptides, or fragments, homologs, analogs or derivatives thereof.
In another aspect, the invention includes pharmaceutical compositions that include therapeutically- or prophylactically-effective amounts of a therapeutic and a pharmaceutically-acceptable carrier. The therapeutic can be, e.g., a GPCRX nucleic acid, a GPCRX
polypeptide, or an antibody specific for a GPCRX polypeptide. In a further aspect, the invention includes, in one or more containers, a therapeutically- or prophylactically-effective amount of this pharmaceutical composition.
In a further aspect, the invention includes a method of producing a polypeptide by culturing a cell that includes a GPCRX nucleic acid, under conditions allowing for expression of the GPCRX polypeptide encoded by the DNA. If desired, the GPCRX polypeptide can then be recovered.
In another aspect, the invention includes a method of detecting the presence of a GPCRX polypeptide in a sample. In the method, a sample is contacted with a compound that selectively binds to the polypeptide under conditions allowing for formation of a complex between the polypeptide and the compound. The complex is detected, if present, thereby identifying the GPCRX polypeptide within the sample.
The invention also includes methods to identify specific cell or tissue types based on their expression of a GPCRX.
Also included in the invention is a method of detecting the presence of a GPCRX
nucleic acid molecule in a sample by contacting the sample with a GPCRX
nucleic acid probe or primer, and detecting whether the nucleic acid probe or primer bound to a GPCRX nucleic acid molecule in the sample.
In a further aspect, the invention provides a method for modulating the activity of a GPCRX polypeptide by contacting a cell sample that includes the GPCRX
polypeptide with a compound that binds to the GPCRX polypeptide in an amount sufficient to modulate the activity of said polypeptide. The compound can be, e.g., a small molecule, such as a nucleic acid, peptide, polypeptide, peptidomimetic, carbohydrate, lipid or other organic (carbon containing) or inorganic molecule, as further described herein.
Also within the scope of the invention is the use of a therapeutic in the manufacture of a medicament for treating or preventing disorders or syndromes including, e.g., diabetes, metabolic disturbances associated with obesity, the metabolic syndrome X, anorexia, wasting disorders associated with chronic diseases, metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders, or other disorders related to cell signal processing and metabolic pathway modulation. The therapeutic can be, e.g., a GPCRX nucleic acid, a GPCRX polypeptide, or a GPCRX-specific antibody, or biologically-active derivatives or fragments thereof.
For example, the compositions of the present invention will have efficacy for treatment of patients suffering from: developmental diseases, MHCII and III diseases (immune diseases), taste and scent detectability Disorders, Burkitt's lymphoma, corticoneurogenic disease, signal transduction pathway disorders, Retinal diseases including those involving photoreception, Cell growth rate disorders; cell shape disorders, feeding disorders; control of feeding; potential obesity due to over-eating; potential disorders due to starvation (lack of appetite), noninsulin-dependent diabetes mellitus (NIDDM1), bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm; adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; Albright Hereditary Ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation.
Dentatorubro-pallidoluysian atrophy (DRPLA) Hypophosphatemic rickets, autosomal dominant (2) Acrocallosal syndrome and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome andlor other pathologies and disorders of the like.
The polypeptides can be used as immunogens to produce antibodies specific for the invention, and as vaccines. They can also be used to screen for potential agonist and antagonist compounds. For example, a cDNA encoding GPCRX may be useful in gene therapy, and GPCRX may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to Neoplasm; adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and Treatment of Albright Hereditary Ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome and/or other pathologies and disorders.
The invention further includes a method for screening for a modulator of disorders or syndromes including, e.g., diabetes, metabolic disturbances associated with obesity, the metabolic syndrome X, anorexia, wasting disorders associated with chronic diseases, metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders or other disorders related to cell signal processing and metabolic pathway modulation. The method includes contacting a test compound with a GPCRX polypeptide and determining if the test compound binds to said GPCRX polypeptide. Binding of the test compound to the GPCRX polypeptide indicates the test compound is a modulator of activity, or of latency or predisposition to the aforementioned disorders or syndromes.
Also within the scope of the invention is a method for screening for a modulator of activity, or of latency or predisposition to an disorders or syndromes including, e.g., diabetes, metabolic disturbances associated with obesity, the metabolic syndrome X, anorexia, wasting disorders associated with chronic diseases, metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders or other disorders related to cell signal processing and metabolic pathway modulation by administering a test compound to a test animal at increased risk for the aforementioned disorders or syndromes. The test animal expresses a recombinant polypeptide encoded by a GPCRX nucleic acid. Expression or activity of GPCRX polypeptide is then measured in the test animal, as is expression or activity of the protein in a control animal which recombinantly-expresses GPCRX polypeptide and is not at increased risk for the disorder or syndrome. Next, the expression of GPCRX polypeptide in both the test animal and the control animal is compared. A change in the activity of GPCRX polypeptide in the test animal relative to the control animal indicates the test compound is a modulator of latency of the disorder or syndrome.
In yet another aspect, the invention includes a method for determining the presence of or predisposition to a disease associated with altered levels of a GPCRX
polypeptide, a GPCRX nucleic acid, or both, in a subject (e.g., a human subject). The method includes measuring the amount of the GPCRX polypeptide in a test sample from the subject and comparing the amount of the polypeptide in the test sample to the amount of the GPCRX
polypeptide present in a control sample. An alteration in the level of the GPCRX polypeptide in the test sample as compared to the control sample indicates the presence of or predisposition S to a disease in the subject. Preferably, the predisposition includes, e.g., diabetes, metabolic disturbances associated with obesity, the metabolic syndrome X, anorexia, wasting disorders associated with chronic diseases, metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders.
Also, the expression levels of the new polypeptides of the invention can be used in a method to screen for various cancers as well as to determine the stage of cancers.
In a further aspect, the invention includes a method of treating or preventing a pathological condition associated with a disorder in a mammal by administering to the subject a GPCRX polypeptide, a GPCRX nucleic acid, or a GPCRX-specific antibody to a subject (e.g., a human subject), in an amount sufficient to alleviate or prevent the pathological condition. In preferred embodiments, the disorder, includes, e.g., diabetes, metabolic disturbances associated with obesity, the metabolic syndrome X, anorexia, wasting disorders associated with chronic diseases, metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders.
In yet another aspect, the invention can be used in a method to identity the cellular receptors and downstream effectors of the invention by any one of a number of techniques commonly employed in the art. These include but are not limited to the two-hybrid system, affinity purification, co-precipitation with antibodies or other specific-interacting molecules.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In the case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
Other features and advantages of the invention will be apparent from the following detailed description and claims.

DETAILED DESCRIPTION OF THE INVENTION
The invention is based, in part, upon the discovery of novel nucleic acid sequences that encode novel polypeptides. The novel nucleic acids and their encoded polypeptides are referred to individually as GPCR1, GPCR2, GPCR3, GPCR4, GPCRS, GPCR6, GPCR7, GPCRB, GPCR9, and GPCR10. The nucleic acids, and their encoded polypeptides, are collectively designated herein as "GPCRX".
The novel GPCRX nucleic acids of the invention include the nucleic acids whose sequences are provided in Tables 1A, 1D, 1G, 2A, 3A, 4A, 4C, 4G, 5A, SC, 5G, 6A, 7A, 8A, 9A, 10A, lOC and IOF, inclusive ("Tables 1A - 10F"), or a fragment, derivative, analog or homolog thereof. The novel GPCRX proteins of the invention include the protein fragments whose sequences are provided in Tables 1B, 1E, 1H, 2B, 3B, 4B, 4H, 5B, 5D, 5H, 6B, 7B, 8B, 9B, 10B, 10D, and 10G, inclusive ("Tables 1B - 10G"). The individual GPCRX
nucleic acids and proteins are described below. Within the scope of this invention is a method of using these nucleic acids and peptides in the treatment or prevention of a disorder related to cell signaling or metabolic pathway modulation.
G-Protein Coupled Receptor proteins (GPCRs) have been identified as a large family of G protein-coupled receptors in a number of species. These receptors share a seven transmembrane domain structure with many neurotransmitter and hormone receptors, and are likely to underlie the recognition and G-protein-mediated transduction of various signals.
Human GPCR generally do not contain introns and belong to four different gene subfamilies, displaying great sequence variability. These genes are dominantly expressed in olfactory epithelium. See, e.g., Ben-Arie et al., Hum. Mol. Genet. 1994 3:229-235; and, Online Mendelian Inheritance in Man (OMIM) entry # 164342 (http://www.ncbi.nlm.nih.gov/entrez/
dispomim.cgi?).
The olfactory receptor (OR) gene family constitutes one of the largest GPCR
multigene families and is distributed among many chromosomal sites in the human genome.
See Rouquier et al., Hum. Mol. Genet. 7(9):1337-45 (1998); Malnic et al., Cell 96:713-23 (1999). Olfactory receptors constitute the largest family among G protein-coupled receptors, with up to 1000 members expected. See Vanderhaeghen et al., Genomics 39(3):239-(1997); Xie et al., Mamm. Genome 11(12):1070-78 (2000); Issel-Tarver et al., Proc. Natl.
Acad. Sci. USA 93(20):10897-902 (1996). The recognition of odorants by olfactory receptors is the first stage in odor discrimination. See Krautwurst et al., Cell 95(7):917-26 (1998); Buck et al., Cell 65(1):175-87 (1991). Many ORs share some characteristic sequence motifs and have a central variable region corresponding to a putative ligand binding site. See Issel-Tarver et al., Proc. Natl. Acad. Sci. USA 93:10897-902 (1996).
Other examples of seven membrane spanning proteins that are related to GPCRs are chemoreceptors. See Thomas et al., Gene 178(1-2):1-5 (1996). Chemoreceptors have been identified in taste, olfactory, and male reproductive tissues. See id.;
Walensky et al., J. Biol.
Chem. 273(16):9378-87 (1998); Parmentier et al., Nature 355(6359):453-55 (1992); Asai et al., Biochem. Biophys. Res. Commun. 221(2):240-47 (1996).
GPCRl GPCR1 includes a family of three novel G-protein coupled receptor ("GPCR") proteins disclosed below. The disclosed proteins have been named GPCRIa, GPCRlb, and GPCRIc and are related to olfactory receptors.
GPCRI a A disclosed GPCRla nucleic acid of 1019 nucleotides is shown in Table 1A. The disclosed GPCRla open reading frame ("ORF") begins at the ATG initiation codon at nucleotides 27-29, shown in bold in Table 1A. The encoded polypeptide is alternatively referred to herein as GPCRla or as ba113a10 B. The disclosed GPCRIa ORF
terminates at a TAG codon at nucleotides 984-986. As shown in Table 1A, putative untranslated regions 5' to the start codon and 3' to the stop codon are underlined, and the start and stop codons are in bold letters.
Table 1A. GPCRla nucleotide sequence (SEQ ID NO:1).
CCTTCAGTTGACAGAGGAGATACACTATGGTAAGTGCCAATCAGACAGCCTCTGTGACCGAGTTTATTC
TCCTGGGCCTCTCTGCCCACCCAAAGCTGGAGAAAACGTTCTTTGTGCTCATCCTGCTGATGTACCTGG
TGATCCTACTGGGCAATGGGGTCCTCATCCTGATGACTGTGTCCAACTCCCACCTGCACATGCCCATGT
ACTTCTTCCTGGGGAACCTCTCCTTCCTGGACATCTGCTATACAACATCCTCAGTCCCCCTCATCCTTG
ACAGCTTCTTGACCCCCAGGAAAACCATCTCCTTCTCAGCCTGTGCAGTGCAGATGTTCCTCTCCTTTG
CCATGGGAGCCACAGAGTGTGTTCTCCTGAGCATGATGGCGTTTGATCGCTACGTGGCCATCTGCAACC
CCCTTAGGTACCCTGTGGTCATGAGCAAGGCTGCCTACATGCCCCATAAGGCTGCCGGCTCCTGGGTAG
CTGGAAGCACTGCTTCCATGGTGCAGACATCCCTTGCAATGAGGCTGCCCTTCTGTGGAGACAACATCA
TCAACCACTTCACCTGTGAGATTCTGGCTGTCCTGAAGTTGGCCTGTGCTGATATCTCTGTCAATGTGA
TCAGTATGGGAGTGACCAATGTGATCTTCCTGGGGGTCCCGGTTCTGTTCATCTCTTTCTCCTATGTCT
TCATCATTGCCACCATCCTGAGGATCCCCTCAGCTGAGGGGAGGAAAAAGGCCTTCTCCACCTGCTCTG
CCCACCTCACAGTCGTGGTCATCTTCTATGGGACCATCCTCTTCATGTATGGGAAGCCCAAGTCTAAGG
ACCCGCTGGGGGCAGACAAGCAAGACCTTGCAGACAAACTCATTTCCCTTTTCTATGGGGTGGTGACCC
CCATGCTCAACCCCATCATCTACAGCCTGAGGAACAAGGATGTAAAGGCTGCTGTGAGGGACTTGATAT
TTCAGAAATGCTTTGCCTAGTGATGTTTGGGGGAACAGATGTCCTCATAGCTC
A disclosed encoded GPCRIa protein has 319 amino acid residues, referred to as the GPCRIa protein. The GPCRla protein was analyzed for signal peptide prediction and cellular localization. SignalP results predict that GPCRla is cleaved between position 44 and 55 of SEQ ID N0:2, i.e., at the slash in the amino acid sequence GNG-VL. Psort and Hydropathy profiles also predict that GPCR1 contains a signal peptide and is likely to be localized at the plasma membrane (certainty of 0.6000). The disclosed GPCRI polypeptide sequence is presented in Table 1B using the one-letter amino acid code.
Table 1B. Encoded GPCRla protein sequence (SEQ ID N0:2).
MVSANQTASVTEFILLGLSAHPKLEKTFFVLILLMYLVILLGNG/VLILMTVSNSHLHMPMYFFLGNLS
FLDICYTTSSVPLILDSFLTPRKTISFSACAVQMFLSFAMGATECVLLSMMAFDRYVAICNPLRYPVVM
SKAAYMPHKAAGSWVAGSTASMVQTSLAMRLPFCGDNIINHFTCEILAVLKLACADISVNVISMGVTNV
IFLGVPVLFISFSYVFIIATILRIPSAEGRKKAFSTCSAHLTVVVIFYGTILFMYGKPKSKDPLGADKQ
DLADKLISLFYGVVTPMLNPIIYSLRNKDVKAAVRDLIFQKCFA
GPCR1 a was initially identified on chromosome 9 with a TblastN analysis of a proprietary sequence file for a G-protein coupled receptor probe or homolog, which was run against the Genomic Daily Files made available by GenBank. A proprietary software program (GenScanTM) was used to further predict the nucleic acid sequence and the selection of exons.
The resulting sequences were further modified by means of similarities using BLAST
searches. The sequences were then manually corrected for apparent inconsistencies, thereby obtaining the sequences encoding the full-length protein.
A region of the GPCR1 a nucleic acid sequence has 873 of 1016 bases (85%) identical to a sequence coding for a partial Mus musculus olfactory receptor mRNA (1731 bp), with an E-value of 3.6e 160 (GENBANK-ID: Aj 133427). In all BLAST alignments herein, the "E-value" or "Expect" value is a numeric indication of the probability that the aligned sequences could have achieved their similarity to the BLAST query sequence by chance alone, within the database that was searched. For example, the probability that the subject ("Sbjct") retrieved from the GPCRla BLAST analysis, e.g., the Mus musculus olfactory receptor, matched the Query GPCRIa sequence purely by chance is 3.6x10-160.
A BLASTX search was performed against public protein databases. The full amino acid sequence of the protein of the invention was found to have 274 of 316 amino acid residues (86%) identical to, and 295 of 316 residues (93%) positive with, the 319 amino acid olfactory receptor protein from Mus musculus (ptnr:TREMBLNEW-ACC:CAB55592, E=
1.8 e-142). The disclosed GPCRIa protein (SEQ ID N0:2) has good identity with a number of olfactory receptor proteins. For example, GPCRla has 256/316 (81%) amino acids identical with the 319 amino acid Mus musculus olfactory receptor 37a protein, and 376/316 (87%) amino acids identical, to (Expect = e-128, gig 11276075~ref~IVP-062346.1 ~) olfactory receptor 37a from Mus musculus. The disclosed protein is also similar to the olfactory proteins disclosed in Table 1C.
Table 1C. BLAST
results for GPCRla Gene Index/ Protein/ OrganismLength IdentityPositivesExpect Identifier (aa) gi1114649811refINP_Olfactory 319 255/318 275/318 e-127 062349.11 Receptor (OR) (80$) (86~) 37e Mus musculus gi1112760771refINPOR 37b 318 248/317 276/317 e-127 - Mus musculus (78~) (86~) 062347.11 gi1112760791refINP-OR 37c 318 251/319 274/314 e-127 062348.11 Mus musculus (79~) (86~) gi1100926691refINPOR Family 2, 309 238/306 261/306 e-118 - Subfamily S, (77~) (84$) 063950.11 member 2 Homo sapiens gi137696241gbIAA064OR 227 206/227 217/227 e-102 588.11 (AF091565)Rattus norvegicus (90~) (94g) GPCR1 b A disclosed GPCRIb (also referred to as ba32713 A) nucleic acid of 1015 nucleotides is shown in Table 1D. An open reading frame was identified beginning with an ATG
initiation codon at nucleotides 17-19 and ending with a TAG codon at nucleotides 971-973. A
putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 1D, and the start and stop codons are in bold letters.
Table 1D. GPCRlb Nucleic acid sequence (SEQ ID N0:3).
ACAGAGGAGATACACTATGGTAAGTGCCAATCAGACAGCCTCTGTGACCGAGTTTATTCTCCTGGGCCTC
TCTGCCCACCCAAAGCTGGAGAAAACGTTCTTTGTGCTCATCCTGCTGATGTACCTGGTGATCCTACTGG
GCAATGGGGTCCTCATCCTGATGACTGTGTCCAACTCCCACCTGCACATGCCCATGTACTTCTTCCTGGG
GAACCTCTCCTTCCTGGACATCTGCTATACAACATCCTCAGTCCCCCTCATCCTTGACAGCTTCTTGACC
CCCAGGAAAACCATCTCCTTCTCAGCCTGTGCAGTGCAGATGTTCCTCTCCTTTGCCATGGGAGCCACAG
AGTGTGTTCTCCTGAGCATGATGGCGTTTGATCGCTACGTGGCCATCTGCAACCCCCTTAGGTACCCTGT
GGTCATGAGCAAGGCTGCCTACATGCCCATAGCTGCCGGCTCCTGGGTAGCTGGAAGCACTGCTTCCATG
GTGCAGACATCCCTTGCAATGAGGCTGCCCTTCTGTGGAGACAACATCATCAACCACTTCACCTGTGAGA
TTCTGGCTGTCCTGAAGTTGGCCTGTGCTGATATCTCTGTCAATGTGATCAGTATGGGAGTGACCAATGT
GATCTTCCTGGGGGTCCCGGTTCTGTTCATCTCTTTCTCCTATGTCTTCATCATTGCCACCATCCTGAGG
ATCCCCTCAGCTGAGGGGAGGAAAAAGGCCTTCTCCACCTGCTCTGCCCACCTCACAGTCGTGGTCATCT
TCTATGGGACCATCCTCTTCATGTATGGGAAGCCCAAGTCTAAGGACCCGCTGGGGGCAGACAAGCAAGA
CCTTGCAGACAAACTCATTTCCCTTTTCTATGGGGTGGTGACCCCCATGCTCAACCCCATCATCTACAGC
CTGAGGAACAAGGATGTAAAGGCTGCTGTGAGGGACTTGATATTTCAGAAATGCTTTGCCTAGTGATGTT
TGGGGGAACAGATGTCCTCATAGCTCTTTGCCTCT
In a search of sequence databases, it was found, for example, that the nucleic acid sequence has 869 of 1015 bases (85%) identical to a 1731 by Mus musculus OR
37d pseudogene (GENBANK-ID: MMU133427~acc:AJ133427, E = 5.5 e-161). It was also found that the nucleic acid has 505 of 791 bases identical (63%) to a partial human mRNA for olfactory receptor protein (GENBANK-ID:HSOLFMF~acc:Y14442, E= 9.5 e-49).
The encoded protein having 318 amino acid residues is presented using the one-letter code in Table 1 E. The full amino acid sequence of the protein of the invention was found to have 274 of 315 amino acid residues (86%) identical to, and 296 of 315 residues (93%) positive with, a 319 amino acid residue olfactory receptor protein from Mus musculus (ptnr:
TREMBLNEW-ACC:CAB55592, E= 6.3 e-144.
The disclosed GPCRIb protein differs from the disclosed GPCRIa protein at only two positions. At positions 145 and 146, GPCRla has HK, while GPCRIb has a deletion (~) and an I.
Table 1E. Encoded GPCRlb protein sequence (SEQ ID N0:4).
MVSANQTASVTEFILLGLSAHPKLEKTFFVLILLMYLVILLGNG/VLILMTVSNSHLHMPMYFFLGNLSFL
DICYTTSSVPLILDSFLTPRKTISFSACAVQMFLSFAMGATECVLLSMMAFDRYVAICNPLRYPVVMSKA
AYMPIAAGSWVAGSTASMVQTSLAMRLPFCGDNIINHFTCEILAVLKLACADISVNVISMGVTNVIFLGV
PVLFISFSYVFIIATILRIPSAEGRKKAFSTCSAHLTVWIFYGTILFMYGKPKSKDPLGADKQDLADKL
ISLFYGWTPMLNPIIYSLRNKDVKAAVRDLIFQKCFA
A PSORT analysis predicts that the ba32713 A protein (GPCRIb) is localized in the plasma membrane with a certainty of 0.6000, or with lower certainty in the mitochondrial inner membrane, the mitochondrial intermembrane space or the Golgi body. It is also predicted that the protein has a signal peptide with the most likely cleavage site between residues 44 and 45: GNG-VL, indicated by a slash in Table 1E.
A BLASTX search was performed against public protein databases. The full amino acid sequence of the protein of the invention was found to have 274 of 315 amino acid residues (86%) identical to, and 296 of 315 residues (93%) positive with, the 319 amino acid olfactory receptor protein from Mus musculus (ptnr:TREMBLNEW-ACC:CAB55592, E=
6.3 e-144). The disclosed GPCRIb protein (SEQ ID N0:4) has good identity with a number of olfactory receptor proteins, as shown in Table 1F.
Table BLAST
1F. results for GPCRlb Gene Index/ Protein/OrganismLengthIdentityPositivesExpect Identifier (aa) ($) gi1112760751refINP-OR 37a 319 256/315277/315 e-129 062346.1 Mus sculus (81~) (87~) mu gi1119649811refINP-(OR) 37e 319 255/317276/317 e-128 062349.11 Mus (80~) (86~) musculus gi~11276077~refINP_OR 37b 318 248/316 277/316 e-128 062347.11 Mus musculus (78~) (87~) gi~112760791refINPOR 37c 318 251/313 275/313 e-128 _ Mus musculus (80~) (87~) 062348.11 gip0092669)refINP-OR Family 2, 309 238/305 262/305 e-119 063950.11 Subfamily S, (78~) (85~) member 2 Homo sapiens GPCR1 c A disclosed GPCRIc (also referred to as ba113a10 C) nucleic acid of 1003 nucleotides is shown in Table 1G. An open reading frame was identified beginning with an ATG initiation codon at nucleotides 26-28 and ending with a TGA codon at nucleotides 974-976. Putative untranslated regions S' to the start codon and 3' to the stop codon are underlined in Table 1 G and the start and stop codons are in bold letters.
In a search of sequence databases, it was found, for example, that the nucleic acid sequence has 719 of 899 bases (79%) identical to a Mus musculus GPCR mRNA
(GENBANK-m: AJ133428, E = 1.9e-120).
Table 1G. GPCRIc Nucleic acid sequence (SEQ ID NO:S).
TTTGTACAAGTGACATAGAAACACCATGGTCAGTTCC
AATCAGACCTCCCCTGTGCTGGGGTTCCTTCTCCTGGGGCTCTCTGCCCATCCAAAGCTGGAGAAGACAT
TCTTCGTGCTCATCCTGCTGATGTACCTGGTGATCCTACTGGGCAATGGGGTCCTCATCCTGGTGACCAT
CCTTGACTCCCGCCTGGACACACCCATGTACTTCTTCCTGGGGAACCTCTCCTTCCTGGACATCTGCTAT
ACAACCTCCTCATCCTTGACAGCTTCCCTGACCCCCAGGAAAACCATCTCCTTCTCAGCCTGTGCAGTAC
AGATGTTCCTCTCCCTTGCCATGGGAGCCACAGAGTGTGTTCTCCTGAGCATGATGGCGTTTGATCGCTA
CGTGGCCATCTGCAACCCCCTTTGGTACCCTGAAGTCATGAACAAAGCTACTTATGTGCCCATGGCTGCT
GGCTCCTGGGTAGCTGGAAGCCTCACTGCCATGGTGCAGACACCCCTTGCATTGAGGCTGCCCTTCTGTG
GAGACAACATCATCAATCACTTCACCTGTGAGATTCTGGCTGTCCTGAAGTTGGCCTGTGCTGATATCTC
TGTCAATGTGATCAGTATGGGAGTGGCCAATGTGATCTTCCTGGGGGTCCCTGTTCTGTTCATCTCTTTC
TCCTATGTCTTCATCATTGCCACCATCCTGAGGATCCCCTCAGCTGAGGGGAGGAAAAAGGCCTTCTCCA
CCTGCTCTGCCCACCTCACTGTCGTGATCGTCTTCTACGGGACCATCCTCTTCATGTACGGGAAGCCCAA
GTCTAAGGACCCACTGGGAGCAGACAAACAGGACCTTGCAGACAAACTCATTTCCCTTTTCTATGGGGTG
GTGACCCCCATGCTCAACCCCATCATCTACAGCCTGAGGAACAAGGAAGTGAAGGCTGCTGTGAGGAACC
TGGTATTTCAGAAACGCTTCCTGCAGTGATGGTGGAGGGGTCCTGATGGCTCTGTG
The disclosed GPCRlc protein having 316 amino acid residues is presented using the one-letter code in Table 1H. An analysis using the PSORT program predicts that the ba113a10 C protein localizes in the plasma membrane with a certainty=0.6400;
it may also be localized in the Golgi body with a moderate certainty. It is also predicted that protein has a signal peptide whose most likely cleavage site is between residues 44 and 45:
GNG-VL, indicated by a slash in Table 1H.

Table 1H. Encoded GPCRlc protein sequence (SEQ ID N0:6).
MVSSNQTSPVLGFLLLGLSAHPKLEKTFFVLILLMYLVILLGNG/VLILVTILDSRLDTPMYFFLGN
LSFLDICYTTSSSLTASLTPRKTISFSACAVQMFLSLAMGATECVLLSMMAFDRYVAICNPLWYPEVMNK
ATYVPMAAGSWVAGSLTAMVQTPLALRLPFCGDNIINHFTCEILAVLKLACADISVNVISMGVANVIFLG
VPVLFISFSYVFIIATILRIPSAEGRKKAFSTCSAHLTVVIVFYGTILFMYGKPKSKDPLGADKQDLADK
LISLFYGVVTPMLNPIIYSLRNKEVKAAVRNLVFQKRFLQ
A BLASTX search was performed against public protein databases. The full amino acid sequence of the protein of the invention was found to have 270 of 317 amino acid residues (85%) identical to, and 287 of 317 residues (90%) positive with, a 319 amino acid residue OR from Mus musculus (ptnr:TREMBLNEW-ACC:CAB55596, E= 5.2 e-138). The disclosed GPCRIb protein (SEQ ID N0:6) has good identity with a number of olfactory receptor proteins, as shown in Table 1I.
Table 1I. BLAST
results for GPCRlc Gene Index/ Protein/ LengthIdentityPositivesExpect Identifier Organism (aa) (~k) gi1114649811refINP-OR 37e 319 242/317 257/317 e-120 062349.11 Mus musculus (76~) (80~) gi1112760751refINPOR 37a 319 291/319 256/319 e-119 - Mus musculus (75~) (87~) 062346.11 gi1112760771refINP-OR 37b 318 236/319 255/319 e-116 062347.11 Mus musculus (78~) (87g) gi1112760791refINP-OR 37c 318 235/308 250/308 e-116 062348.11 Mus musculus (76~) (80g) gi1100926691refINP_OR Family 309 220/309 242/309 e-108 2, 063950.11 Subfamily (71~) (78~) S, member 2 Homo Sapiens The amino acids differences between the three GPCR1 proteins are shown in Table 1J.
Deletions are marked by a delta (D). The differences between the three proteins appear to be localized to a few distinct regions. Thus, these proteins may have similar functions, such as serving as olfactory or chemokine receptors (see below).

Table1J. for Proteins Differences GPCRl Position4 8 9 11 12 14 49 51 52 53 55 57 58 GPCRlaA A S T E I M V S N H H M

GPCRIbA A S T E I M V S N H H M

GPCRlcS S P L G L V I L D R D T

Position79 80 81 82 89 85 86 106132 135 138 191 193 GPCRlaV P L I D S F F R V S A M

GPCRlbV P L I D S F F R V S A M

GPCRlcS D D D T A S L W E N T V

Position145 146156 157 158 163 2D4251 252 304 311 313 GPCRlaH K T A S S M T V I D D I

GPCRlb0 I T A S S M T V I D D I

Position317 319320 GPCRIaC A D

GPCRlbC A D

GPCRlcR L Q

A ClustalW analysis comparing disclosed proteins of the invention with related OR
protein sequences is given in Table 1K, with GPCRla shown on line 1, and GPCRIc on line 2.
In the ClustalW alignment of the GPCR1 a protein, as well as all other ClustalW
analyses herein, the black outlined amino acid residues indicate regions of conserved sequence (i.e., regions that may be required to preserve structural or functional properties), whereas non-highlighted amino acid residues are less conserved and can potentially be mutated to a much broader extent without altering protein structure or function. Unless specifically addressed as GPCRla GPCRlb, or GPCRIc, any reference to GPCR1 is assumed to encompass all variants. Residue differences between any GPCRX variant sequences herein are written to show the residue in the "a" variant and the residue position with respect to the "a" variant.
GPCR residues in all following sequence alignments that differ between the individual GPCR
variants are highlighted with a box and marked with the (o) symbol above the variant residue in all alignments herein. For example, the protein shown in line 1 of Table 1K
depicts the sequence for GPCRla, and the positions where GPCRlb differs are marked with a (o) symbol and are highlighted with a box. All GPCRl proteins have significant homology to olfactory receptor (OR) proteins: 37a, 37b, 37e, and 37c from Mus musculus and to a human OR
protein member 2 from family 2, subfamily S (see also Tables 1C, 1F, and 1I).

Table 1K. ClustalW Analysis of GPCRl 1) Novel GPCRIa (SEQ ID N0:2) 2) Novel GPCRIc (SEQ ID NO: 6) 3). gill 1276075~ref~NP_062346.1 ~ olfactory receptor 37a Mus musculus (SEQ ID
N0:39) 4) gig 11276077~ref~NP_062347.1 ~ olfactory receptor 37b Mus musculus (SEQ ID
N0:40) 5) gill 1464981 ~ref~NP_062349.1 ~ olfactory receptor 37e Mus musculus (SEQ 1D
N0:41) 6) gi~11276079~reflNP 062348.1 olfactory receptor 37c Mus musculus (SEQ ID
N0:42) 7) gi~10092669~reflNP 063950.1 OR, fam. 2, subfam. S, mem. 2 H. Sapiens (SEQ
ID N0:43) GPCRla . . I....I ....I....I. ... I. ...1. ... .... . ... .. . ... ..
..
S QTAS TEI ~ . . 5:
. ~
~

GPCRlc S QTSP L~ D ' gi1112760751iD ETAP S
i I 11276077E G -QST E~ D
I

g E ~ ~ SSI
gi1119699811 R- ~
KTTP[r 11112760791D V -QTT TE=' S S
u g11100926691----------M - _ .I.. .I.. . .I. . I.. I.. . .I.. .I. ..I. ..I
GPCRla .I. .I.. ~S . . .I. S
~ ' ~
T

GPCRlc ~ S--- T L S
S

g11112760751 ~ ' y e S

g11112760771 ~ 3' , g11114649811 ~

g11112760791 g E ~.m nv ~a 11100926691 mw .I.. .. . ...l..
.I .I. .I....oo .I..
.I..
.I..
.I..
.I..
.I

GPCRla ~ ' ~S n~ ~
~ ST
HK ~
~ ~T

GPCRlc ~ ' E ~ ~ SLT,:ATP
T ~ ' ~
I

g11112760751~ ' ITN
v ~
S T
v g11112760771~ ' S S GAN
~ ~_ w I
v g11119649811~ ' S

SIT~T
I
~~

g1 I 112760791~ ' S ' q~ I
~
I
GAN

g11100926691~ ' ' "" S G
S I m I HT

I
I
I
I
I

GPCRla .I.. .. .I. . . . I.. .I .. . .. .. ..
.I ~ ~ .I. .I. . . . . .
T . .
S

GPCRlc ~ ~
a S

g11112760751 ~
v ~ r F v g11112760771 ~ F
g11114649811 ~ FV

g11112760791 ~ F

g11100926691 ~ E 5 T

I
I
I
I
I
I
I

GPCRld .I. . .. .I. . .. .. .. .. .. . ... ..
.I .I. .~y . . . w. . .
~I v v v GPCRlc g11112760751 ,.

g11112760771 ~ ~ ~ wr~W

g11114699811 : , , w g11112760791 a g1 I 100926691 ~ ~5'~ P

.I.. .. I
GPCRI a I .I CFA-~

GPCRlc _ RFLQ

g11112760751 ~ HLTE

g11112760771 ~ ~ CLIQ

g11114649811 ~ HFKw T

g11112760791 ~ SH CLTF

g11100926691 ~ RP GFTQ

The GPCR1 proteins also have regions of identity with a 321 amino acid human transmembrane receptor (gi~6691937~emb~CAB65797.1 ~ bA150A6.2, novel 7 transmembrane receptor (rhodopsin family), olfactory receptor- like protein (hs6M1-21)), as shown in line 3 of in Table 1L (SEQ ID NO: 44).
Table 1L.
Alignment of GPCRla & c with SEQ ID N0:44 .I....I....I....1....I....1.... 1....1....1....1....1....1 GPCRla ' S S".
GPCR1C S ~ ~P ~ L~ D
g1166919371 L NLN FCT ~ n ER ~ FLL T P
~ T
F

.I.. I.. I.. .I.. .. I
GPCRIa .I.. I.. .I- .I.
. I.. I
GPCR1C ~ .I
gi166919371 .
~
fi~ t FFVG~a 'Li D
S---T
'S
Q"", HL
K~
$

.I....I....I....I....I....1.... 1....1....1....1....1 ....1 GPCRla N' ~H T ~ S
GPCRlC N~ 'E T P
'T ~ '_ g1166919371 w n NA'' ~N F
' ~' H
N' ' TFC
S ~> ' LCNQ-" ~N
SC

.I....I....I....I....I....1.... 1....1....1....1....1 ....1 GPCRla N
GPCR1C ' .v gi166919371 N C
PPa I
S G
T E~LS
FIGWT

.I....I....I....I....I....1.... 1....1....1....1....1 ....1 GPCRIa GPCRlC U

gi166919371 ~ F' 'AT ---- L
'I S
TYS
KK

.1....1....1....1....1....

GPCRla ~ D I C ---------GPCRlc E LQ-_-_____-gi166919371 n' E
T GS'~'PPISSLDSKLTY

The presence of identifiable domains in GPCR1, as well as all other GPCRX
proteins, was determined by searches using software algorithms such as PROSITE, DOMAIN, Blocks, Pfam, ProDomain, and Prints, and then determining the Interpro number by crossing the domain match (or numbers) using the Interpro website (http:www.ebi.ac.uk/
interpro).
DOMAIN results, e.g., for GPCRIa as disclosed in Table 1M, were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST analyses.
This BLAST analysis software samples domains found in the Smart and Pfam collections. For Table 1M and all successive DOMAIN sequence alignments, fully conserved single residues are indicated by black shading and "strong" semi-conserved residues are indicated by grey shading. The "strong" group of conserved amino acid residues may be any one of the following groups of amino acids: STA, NEQK, NHQK, NDEQ, QHRK, MILV, MILF, HY, FYW.

Table 1M lists the domain description from DOMAIN analysis results against GPCRIa. The region from amino acid residue 53 through 239 (SEQ ID N0:2) most probably (E = 2e 19) contains a "seven transmembrane receptor (rhodopsin family) fragment" domain, aligned here with residues 12-180 of the 7tm 1 entry (TM7, SEQ ID N0:45, see Table 1N for the complete sequence) of the Pfam database. This indicates that the GPCRI
sequence has properties similar to those of other proteins known to contain this domain as well as to the 377 amino acid 7tm domain itself. GPCRIa also has identity to another region of the TM7 protein.
The region from amino acid residue 226 through 298 (of SEQ ID N0:2) aligns with amino acid residues 310-377 of TM7 (E = 3e~). GPCRlb and GPCRIc also align to this domain:
residues 53-238 of GPCRIb align with residues 12-180 of TM7 (E = 6e ~9) and residues 225-297 of GPCRIb align with residues 310-377 of TM7 (E = 3e~); residues 55-235 of GPCRIc align with residues 14-180 of TM7 (E = 2e 12) and residues 222-294 of GPCRIc align with residues 310-377 of TM7 (E = 2e~).
Table 1M. Domain Analysis of GPCRla Sbjct: 7 transmembrane receptor Irhodopsin family) fragment GnlIPfamIpfam00001; Length = 377 Score = 89.7 bits 221 Ex ect = 2e-19 ....I....I....~....I....I....I....~....~....I....I....I....I
GPCRla -----------NSH HMPMYF~G~~FA~CY~SS~;.L, DSFPRKT~FSAQ
TM7 GNVLVCMAVSRE QTTTN L m LVp~L YLE GEWK~RIH D F
.I.. .I.. .I.. .I.. .I.. .I.. ~I~~ ~~~~ .I.. .1....I.. .I
TM7Rla ~T~DCTASIN~CPI~'.T CN~.L~PITRY S RRTVMIIS LSS I CPM
..l~.J.I....I....I....I....I....1....1....1....1....1....1....1 GPCRla TSLAMRLPFCGDNIINHFT~E~AVLKLACADI~V~I~G~IVFLGV~,FISF
TM7 LFGLNNTDQNE-------- I~NP-------- F Y~SI FY --- TLL
.I.. .1....I.. .I....I....I....I....~....I....I....I....I
GPCRla IAT L --IPSAE KKA-__________________--_-_________________ TM7 K~YIV~R~RRKRVNTK SSRAFRANLKAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRV
The representative member of the 7 transmembrane receptor family is the D2 dopamine receptor from Bos taurus (SWISSPROT: locus D2DR BOVIN, accession P20288;
gene index 118205). The D2 receptor is an integral membrane protein and belongs to Family 1 of G-protein coupled receptors. The activity of the D2 receptor is mediated by G proteins which inhibit adenylyl cyclase. Chio et al., Nature 343:255-269 (1990).
Residues 51-427 of this 444 amino acid protein are considered to be the representative TM7 domain, shown in Table 1N.

Table 1N Amino Acid sequence for TM7 (SEQ ID N0:45) GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIF
VTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPM
LFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSR
AFRANLKAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPP
ERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKTVNPKIAKIFEIQSMPNG
KTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYS
AFTWLGYVNSAVNPIIY
The 7 transmembrane receptor family includes a number of different proteins, including, for example, serotonin receptors, dopamine receptors, histamine receptors, andrenergic receptors, cannabinoid receptors, angiotensin II receptors, chemokine receptors, opioid receptors, G-protein coupled receptor (GPCR) proteins, olfactory receptors (OR), and the like. Some proteins and the Protein Data Base Ids/gene indexes include, for example:
rhodopsin (129209); 5-hydroxytryptamine receptors; (112821, 8488960, 112805, 231454, 1168221, 398971, 112806); G protein-coupled receptors (119130, 543823, 1730143, 132206, 137159, 6136153, 416926, 1169881, 136882, 134079); gustatory receptors (544463, 462208);
c-x-c chemokine receptors (416718, 128999, 416802, 548703, 1352335); opsins (129193, 129197, 129203); and olfactory receptor-like proteins (129091, 1171893, 400672, 548417);
Expression information for GPCRX RNA was derived using tissue sources including, but not limited to, proprietary database sources, public EST sources, literature sources, andlor RACE sources, as described in the Examples.
The nucleic acids and proteins of GPCR1 are useful in potential therapeutic applications implicated in various GPCR- or olfactory receptor (OR)-related pathologies and/or disorders. For example, a cDNA encoding the G-protein coupled receptor-like protein may be useful in gene therapy, and the G-protein coupled receptor-like protein may be useful when administered to a subject in need thereof. The novel nucleic acid encoding GPCRl protein, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed.
These materials are further useful in the generation of antibodies that bind immunospecifically to the novel substances of the invention for use in therapeutic or diagnostic methods. The GPCRX nucleic acids and proteins are useful in potential diagnostic and therapeutic applications implicated in various diseases and disorders described below and/or other pathologies. For example, the compositions of the present invention will have efficacy for treatment of patients suffering from: cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus, pulmonary stenosis, subaortic stenosis, ventricular septal defect (VSD), valve diseases, tuberous sclerosis, scleroderma, obesity, transplantation, adrenoleukodystrophy, congenital adrenal hyperplasia, fertility, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease, bronchial asthma, and other diseases, disorders and conditions of the like. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from neoplasm, adenocarcinoma, lymphoma, prostate cancer, uterus cancer, immune response, AIDS, asthma, Crohn's disease, multiple sclerosis, and Albright Hereditary Ostoeodystrophy.
Additional GPCR-related diseases and disorders are mentioned throughout the Specification.
Further, the protein similarity information, expression pattern, and map location for GPCR1 suggests that GPCR1 may have important structural and/or physiological functions characteristic of the GPCR family. Therefore, the nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount of the nucleic acid or the protein are to be assessed, as well as potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), and (v) a composition promoting tissue regeneration in vitro and in vivo (vi) biological defense weapon.
These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel GPCR1 substances for use in therapeutic or diagnostic methods.
These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-GPCRX Antibodies"
section below.

An additional GPCR-like protein of the invention, referred to herein as GPCR2, is an Olfactory Receptor ("OR")-like protein. The novel nucleic acid of 1254 nucleotides (11612531-1, SEQ >D N0:7) encoding a novel G-protein coupled receptor-like protein is shown in Table 2A. SeqCalling fragments for GPCR2 came from placenta, indicating that it may be expressed in tissues important for female health.

Table 2A. GPCIt2 Nucleotide Sequence (SEQ ID NO:'n ACGCGCTTCGACATACTATTCCTGGTGGGCTCTTCCTACATATCAGGTCGTTAAATAAGCTGCCAGATTTCTGCCTTTA
CAGCCCAA
GGAGCTTGTCATGGACCATGGGCATGGAGGGTCTTCTCCAGAACTCCACTAACTTCGTCCTCACAGGCCTCATCACCCA
TCCTGCCT
TCCCCGGGCTTCTCTTTGCAATAGTCTTCTCCATCTTTGTGGTGGCTATAACAGCCAACTTGGTCATGATTCTGCTCAT
CCACATGG
ACTCCCGCCTCCACACACCCATGTACTTCTTGCTCAGCCAGCTCTCCATCATGGATACCATCTACATCTGTATCACTGT
CCCCAAGA
TGCTCCAGGACCTCCTGTCCAAGGACAAGACCATTTCCTTCATGGGCTGTGCAGTTCAGATCTTCCTCTACCTGACCCT
GATTGGAG
GGGAATTCTTCCTGCTGGGTCTCATGGCCTATGACCGCTATGTGGCTGTGTGCAACCCTCTACGGTACCCTCTCCTCAT
GAACCGCA
GGGTTTGCTTATTCATGGTGGTCGGCTCCTGGGTTGGTGGTTCCTTGGATGGGTTCATGCTGACTCCTGTCACTATGAG
TTTCCCCT
TCTGTAGATCCCGAGAGATCAATCACTTTTTCTGTGAGATCCCAGCCGTGCTGAAGTTGTCTTGCACAGACACGTCACT
CTATGAGA
CCCTGATGTATGCCTGCTGCGTGCTGATTATCCCTCTATCTGTCATCTCTGTGTCCTACACGCACATCCTCCTGACTGT
CCACAGGA
TGAACTCTGCTGAGGGCCGGCGCAAAGCCTTTGCTACGTGTTCCTCCCACATTATGGTGGTGAGCGTTTTCTACGGGGC
AGCTTTCT
ACACCAACGTGCAGCCCCACTCCTACCACACTCCAGAGAAAGATAAAGTGGTGTCTGCCTTCTACACCATCCTCACCCC
CATGCTCA
ACCCACTCATCTACAGCTTGAGGAATAAAGATGTGGCTGCAGCTCTGAGGAAAGTACTAGGGAGATGTGGCTCCTCCCA
GAGCATCA
GGGTGATGACTGTGTGATCAGGAAGGACTAGCAGGGACTCCCAGAGTATCAGCGTGGTGACTATGATCAGGAAGGACTA
GTGGGGAC
TCCTAGAGCATCAGGGTGGCGACTGTGATCAGGAAGGACTAGCAAGGACTAGCGCAAACATCTGCGGTGCTGCGGCCAA
TAACGCAG
CTATTACAGAAAATATGTTATTGGTTCTGAAGAAGT
An open reading frame (ORF) for GPCR2 was identified from nucleotides 105 to 1058. The disclosed GPCR2 polypeptide (SEQ ID N0:8) encoded by SEQ ID N0:7 is amino acid residues and is presented using the one-letter code in Table 2B.
The GPCR2 protein was analyzed for signal peptide prediction and cellular localization.
SignalPep results predict that GPCR2 is cleaved between position 42 and 43 of SEQ ID N0:8, i.e., at the slash in the amino acid sequence ITA-NL. Psort and Hydropathy profiles also predict that GPCR2 contains a signal peptide and is likely to be localized at the plasma membrane (certainty of 0.6400).
Table 2B. Encoded GPCIZ2 protein sequence (SEQ ID N0:8).
MGMEGLLQNSTNFVLTGLITHPAFPGLLFAIVFSIFVVAITA/NLVMILLIHMDSRLHTPMYFLLSQLS
IMDTIYICITVPKMLQDLLSKDKTISFMGCAVQIFLYLTLIGGEFFLLGLMAYDRYVAVCNPLRYPLLM
NRRVCLFMVVGSWVGGSLDGFMLTPVTMSFPFCRSREINHFFCEIPAVLKLSCTDTSLYETLMYACCVL
IIPLSVISVSYTHILLTVHRMNSAEGRRKAFATCSSHIMVVSVFYGAAFYTNVQPHSYHTPEKDKVVSA
FYTILTPMLNPLIYSLRNKDVAAALRKVLGRCGSSQSIRVMTV
The full amino acid sequence of the protein of the invention was found to have 151 of 216 amino acid residues (69%) identical to, and 177 of 216 residues (81 %) positive with, a 216 amino acid residue olfactory receptor from Homo sapiens (ptnr:SPTREMBL-ACC:
043869) (E = 2.2 a 6'). The protein encoded by GPCR2 (SEQ ID N0:7) has significant homology to olfactory, odorant, and taste chemoreceptors and belongs to the family of G-Protein coupled receptors (GPCRs). This family of genes has been used as a target for small molecule drugs and GPCRs are expressed on the plasma membrane and are also a suitable target for protein drugs like therapeutic antibodies, cytotoxic antibodies and diagnostic antibodies.
As shown in Table 2C, BLAST analysis shows that GPCR2 has significant homology with a number of olfactory receptors.

Table 2C. GPCR2 BLAST results Smallest Sum ReadingHigh Prob.

Sequences producing High-scoring Segment Frame Score P(N) Pairs:

Ptnr:SPTREMBL-ACC:093869 OLFACTORY RECEPTOR827 1.8e-821 - HOMO SAPIENS...

Ptnr:SWISSPROT-ACC:P23275 OLFACTORY RECEPTOR712 2.7e-701 15 (0R3) - M...

Ptnr:SPTREMBL-ACC:Q90808 OLFACTORY RECEPTOR708 7.3e-701 4 - GALLUS GALLUS...

Ptnr:TREMBLNEW-ACC:CAB55593 OLFACTORY RECEPTOR706 1.2e-691 - Mus musculus...

Ptnr:TREMBLNEW-ACC:CAB55599 OLFACTORY RECEPTOR704 1.9e-691 - Mus musculus...

Ptnr:SPTREMBL-ACC:Q63399 OL1 RECEPTOR - 702 3.1e-691 RATTUS NORVEGICUS...

Ptnr:TREMBLNEW-ACC:CAB55592 OLFACTORY RECEPTOR698 8.3e-691 - Mus musculus...

Ptnr:TREMBLNEW-ACC:CAB55596 OLFACTORY RECEPTOR697 1.1e-681 - Mus musculus...

Ptnr:SWISSPROT-ACC:Q95156 OLFACTORY RECEPTOR-LIKE695 1.7e-681 PROTEIN...

Ptnr:SWISSPROT-ACC:Q13606 OLFACTORY RECEPTOR-LIKE694 2.2e-681 PROTEIN...

Ptnr:SWISSPROT-ACC:Q13607 OLFACTORY RECEPTOR-LIKE689 7.5e-681 PROTEIN...

Ptnr:TREMBLNEW-ACC:AAC69376 OLFACTORY RECEPTOR-LIKE685 2.0e-671 PROTEIN...

Other BLAST results including the sequences used for ClustalW analysis is presented in Table 2D.
Table 2D. BLAST
results for GPCRZ

Gene Index/ Protein/ Length IdentityPositivesExpect Identifier Organism (aa) (~) (s) gi139833821gbIAADI3OR E3 223 156/223 184/223 2e-78 319.1 (AF102527)Mus musculus (69~) (81~) gi129216281gbIAAC39OR 216 151/216 177/216 5e-75 611.1 (U86215) Homo Sapiens (69~) (81g) gi1120074231gb1~1AG4T2 OR 316 155/298 205/298 2e-72 5196.1 (AF321234)Mus musculus (52~) (68$) gi1120074241gb~AAG9T3 OR 315 156/309 209/304 2e-72 5197.1 (AF321234)Mus musculus (51~) (68~) gi1120074251gbIAAG4T4 OR 319 152/304 207/304 9e-72 5198.11 (AF321234)Mus musculus (50$) (68$) gi112007422~gbIAAG4T1 OR 316 156/305 207/305 2e-67 5195.1( (AF321234)Mus musculus (51~) (67$) This information is presented graphically in the multiple sequence alignment given in Table 2E (with GPCR2 being shown on line 1) as a ClustalW analysis comparing GPCR2 with related protein sequences.

Table 2E. Information for the ClustalW proteins:
1) Novel GPCR2 (SEQ ID N0:8) 2) gi~3983382~gb~AAD13319.1 ~ olfactory receptor E3 Mus musculus (SEQ ID
N0:46) 3) gi~2921628~gb~AAC39611.1 ~ olfactory receptor Homo Sapiens (SEQ ID N0:47) 4) gi~12007423~gb~AAG45196.1 ~ T2 olfactory receptor Mus musculus (SEQ ID
N0:48) 5) gi~12007424~gb~AAG45197.1 ~ T3 olfactory receptor Mus musculus (SEQ ID
N0:49) 6) gig 12007425~gb~AAG45198.1 ~ T4 olfactory receptor Mus musculus (SEQ ID
NO:50) 7) gi~12007422~gb~AAG45195.1 ~ T1 olfactory receptor Mus musculus (SEQ ID
NO:51 ) 1~

....I....1....I....I....I....1....1....1....1....1....1..._1 GPCR2 MGMEGLLQNSTN~T~i THPAE'~G~F'~IVF'$~~ :V~T~L . H~S~HTm gi139833821 ____________________________________________________________ gi129216281 _____-_______ _______________ _ _ ____________ gi1120079231 -MEPWNSTLGTD I~DDSGS'E C~TFT '~ ~ I ~T ~ TY H ' gi1120074241 -MEVCNSTLRS ~I iLDDND ~'E C~TIT ~YIr-~ T~ G ~T T H ~' gi1120074251 -MEFRNSTMGNGCdI ~ DDSG~D C~TIT T,~T~ G1»,T: R
gi1120074221 -MELWNSTLES..~~I 'i: GSSS~'E C~IVT L ~ I G;L"L Tk H.''~' .I....I....I....I....I....1....1....1....1....1....1....1 GPCR2 ~F~S~ iWT~a IC~T L S~ ~ Y IG F GL
z war ' v r v gi139833821 ----SH ~~~, I T Q T ~ F GL
gi129216281 ________ y,;,.1 T -V~.;. DQ T Y ~ F GL
gi1120079231 ~m T T I ~ S' _ G ~ DL
d V
gi1120074241 L m LT ~T ~ m ~ ~ GT~ DL S
gi 1120074251 L ~'~ ~~M-LT T ~ ~ . ~ ~ E GS DL
gi I 120074221 L ~n=~.r T ";T ~~GS~DL F

.I....I....I....I....I....1....1....1....1....1....1....1 ~ ~, ~ w nw . .~ . N.
GPCR2 ~' P 'LR L G G DGFML P S ' gi13983382/ n ' ~P L CR ~- FG DGFLL PI ~S ' . .
'I N N
gi129216281 m P L R miA FG DGFLL PI S
gi1120074231 ~' ' N d ~RPS ~~ L LGY TY Q S LL
v gi I 12007429 I T L Q C~. ~ S SALGY~IHY Q L
gi I 120079221 m . APT GTI ITAVGI-IVY H ' LL

.I....I....I....I....I....1....1....1....1....1....1....1 GPCR2 - T~ L T ° CC -- ' S TH L H FA
'v41 gi I 3983382 I ~ L T ~ CC L -~ F 1~TI1~ Y S FA
gi129216281 L T CC ° .F~V - T QC S FA
~ y_- l _ h gi1120074231 'P' L'4'e 5L L P N LV
gi1120074241 P' ' ~ ~L ~L FP SL L P ~LV
gi1120074251 'P' ' E~ T L G S fir' L P LV
giI120074221 LP $ ~ L T T '~' T TL S L P LV

.1.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .1.. .I.. .I
GPCR2 ~ S, ~ F~TN 'H ~ ~ E
r--" ~ ".
gi139833821 ~T T.' ~~1'T 'H ' -' T ____________ v ~ v x ~'1111-giI29216281 ~ ~~ H ~ ~I(~T,- = _______________ 'N k: N V
giI120074231 °T G ~ T ~ TG
giI120074241 G ~ ~IV 'S ~ ' w S ~ TG
giI120074251 I G G SL 'SQ ' m ~ TG
gi1120074221 L G ~~T 'S~L K ~N t IG

.1....1....1....1 GPCR2 ~R~L~CGSSQSIRVMTV
gi139833821 _________-__________ gi129216281 ___________________ gi1120074231 I L YIVPAHPTL--ex gi1120074241 7L RLSVQSTF----gi1120074251 LGPAHFLGSSF
gi1120074221 ~ ~L .YILPAHLTL---DOMAIN results for GPCR2 were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST. This BLAST samples domains found in the Smart and Pfam collections. The 7tm_1, a seven transmembrane receptor (rhodopsin family), was shown to have two segments with homology to GPCR2. The region from amino acid residue 43 through 238 aligns with amino acids 2 through 181 of the "seven transmembrane receptor (rhodopsin family) fragment" domain(SEQ ID N0:45, E= 2e-22), and GPCR2 amino acids 226-289 aligned with residues 313-377 of the 7tm-1 entry (SEQ ID N0:45, E= .008) of the Pfam database. This indicates that the GPCR2 sequence has properties similar to those of other proteins known to contain this domain as well as to the 7tm_1 domain itself.
The disclosed GPCR2 is expressed in tissues that are important in female reproductive health and hence GPCR2 may serve as a drug target for, e.g., premature labor, endometriosis, and in vitro fertilization. The homology to the olfactory receptors suggests that an endogenous small molecule ligand regulates this gene and hence drugs structurally similar to the endogenous ligand could serve as agonists and antagonists to regulate the biological effects of GPCR2.
The nucleic acids and proteins of the invention are useful in potential therapeutic applications implicated in various GPCR-related pathological disorders and/or OR-related pathological disorders, described further below. For example, a cDNA encoding the olfactory receptor -like protein may be useful in gene therapy, and the olfactory receptor -like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from neoplasm, adenocarcinoma, lymphoma, uterus cancer, immune response, AIDS, asthma, Crohn's disease, multiple sclerosis, and Albright Hereditary Ostoeodystrophy.
Other GPCR-related diseases and disorders are contemplated.
The novel nucleic acid encoding the GPCR-like protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed. These materials are further useful in the generation of antibodies that bind immunospecifically to the novel substances of the invention for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-GPCRX Antibodies" section below. In one embodiment, a contemplated GPCR3 epitope is from about amino acids105 to 140. These novel proteins can be used in assay systems for functional analysis of various human disorders, which will help in understanding of pathology of the disease and development of new drug targets for various disorders.

GPC)t3 An additional GPCR-like protein of the invention, referred to herein as GPCR3, is an Olfactory Receptor ("OR")-like protein. The novel nucleic acid was identified on chromosome 6 by TblastN using CuraGen Corporation's sequence file for GPCR
probe or homolog, run against the Genomic Daily Files made available by GenBank. The nucleic acid was further predicted by the program GenScanTM, including selection of exons.
These were further modified by means of similarities using BLAST searches. The sequences were then manually corrected for apparent inconsistencies, thereby obtaining the sequences encoding the full-length protein. The novel nucleic acid of 957 nucleotides (ba145122 B, SEQ ID N0:9) encoding a novel olfactory receptor-like protein is shown in Table 3A. An open reading frame (ORF) was identified beginning with an ATG initiation codon at nucleotides 10-12 and ending with a TGA codon at nucleotides 955-957. Putative untranslated regions upstream from the initiation codon and downstream from the termination codon are underlined in Table 3A, and the start and stop codons are in bold letters.
Table 3A. GPCIR3 Nucleotide Sequence (SEQ ID N0:9) AGATTAGTCATGAAGGCCAACTACAGCGCAGAGGAGCGCTTTCTCCTGCTGGGTTTCTCCGACTGGCCTT
CCCTGCAGCCGGTCCTCTTCGCCCTTGTCCTCCTGTGCTACCTCCTGACCTTGACGGGCAACTCGGCGCT
GGTGCTGCTGGCGGTGCGCGACCCGCGCCTGCACACGCCCATGTACTACTTCCTCTGCCACCTGGCCTTG
GTAGACGCGGGCTTCACTACTAGCGTGGTGCCGCCGCTGCTGGCCAACCTGCGCGGACCAGCGCTCTGGC
TGCCGCGCAGCCACTGCACGGCGCAGCTGTGCGCATCGCTGGCTCTGGGTTCGGCCGAATGCGTCCTCCT
GGCGGTGATGGCTCTGGACCGCGCGGCCGCAGTGTGCCGCCCGCTGCGCTATGCGGGGCTCGTCTCCCCG
CGCCTATGTCGCACGCTGGCCAGCGCCTCCTGGCTAAGCGGCCTCACCAACTCGGTTGCGCAAACCGCGC
TCCTGGCTGAGCGGCCGCTGTGCGCGCCCCGCCTGCTGGGCCACTTCATCTGTGAGCTGCCGGCGTTGCT
CAAGCTGGCCCGCGGAGGCGACGGAGACACTACCGAGAACCAGATGTTCGCCGCCCGCGTGGTCATCCTG
CTGCTGCCGTTTGCCGTCATCCTGGCCTCCTACGGTGCCGTGGCCCGAGCTGTCTGTTGTATGCGGTTCA
GCGGAGGCCGGAGGAGGGCGGTGGGCACGTGTGGGTCCCACCTGACAGCCGTCTGCCTGTTCTACGGCTC
GGCCATCTACACCTACCTGCAGCCCGCGCAGCGCTACAACCAGGCACGGGGCAAGTTCGTATCGCTCTTC
TACACCGTGGTCACACCTGCTCTCAACCCGCTCATCTACACCCTCAGGAATAAGAAAGTGAAGGGGGCAG
CGAGGAGGCTGCTGCGGAGTCTGGGGAGAGGCCAGGCTGGGCAGTGA
A putative splice site is located between nucleotides 15 and 16 in SEQ ID
N0:9. In one embodiment, nucleotides 1-15 come from exon 1 and nucleotides 16-957 are from exon 2.
The disclosed ba145122 B nucleic acid sequence has 592 of 934 bases (63%) identical to a GPCR mRNA (GENBANK-ID: HUMORLMHC~ acc: L35475) from Homo Sapiens (E=
2.4 a 51).
The disclosed GPCR3 polypeptide (SEQ ID NO:10) encoded by SEQ ID N0:9 is 315 amino acid residues and is presented using the one-letter code in Table 3B.
The first 70 amino acids of the disclosed GPCR3 protein were analyzed for signal peptide prediction and cellular localization. SignalP results predict that GPCR3 is cleaved between position 46 and 47 of SEQ m NO:10, i.e., at the slash in the amino acid sequence NSA-LV. Psort and Hydropathy profiles also predict that GPCR3 contains a signal peptide and is likely to be localized at the plasma membrane (certainty of 0.6000).
Table 3B. Encoded GPCR3 protein sequence (SEQ ID NO:10).
MKANYSAEERFLLLGFSDWPSLQPVLFALVLLCYLLTLTGNSA/LVLLAVRDPRLHTPMYYFLCHLALVDA
GFTTSVVPPLLANLRGPALWLPRSHCTAQLCASLALGSAECVLLAVMALDRAAAVCRPLRYAGLVSPRLC
RTLASASWLSGLTNSVAQTALLAERPLCAPRLLGHFICELPALLKLARGGDGDTTENQMFAARVVILLLP
FAVILASYGAVARAVCCMRFSGGRRRAVGTCGSHLTAVCLFYGSAIYTYLQPAQRYNQARGKFVSLFYTV
VTPALNPLIYTLRNKKVKGAARRLLRSLGRGQAGQ
A BLASTX search was performed against public protein databases. The full amino acid sequence of the protein of the invention was found to have 253 of 308 amino acid residues (82%) identical to, and 264 of 308 residues (85%) positive with, the 309 amino acid residue MM17M1-6, 7 transmembrane receptor (OR-like protein) from Mus musculus (ptnr:SPTREMBL-ACC:Q9WV09, SEQ ID N0:52) (E = 1.5 e'2$). The alignment of these proteins is shown in Table 3C.
Table 3C. Alignment of GPCR3 with QpWV09 (SEQ ID N0:52).

.I....I....I....I....I....1....1....1....1....1....1....1 GPCR3 M Y E ~ ~ ' !~ ~ S ~ ~ ~ ~ 60 Q9wv09 --~H~S v ~ ~. ~158 .I....I....I....I....I....1....1....1....1....1....1....1 GPCR3 ~PA~W~'~'-S T~~ ~ 120 Q9WV09 ~V~S S ~~ S 118 .I....I....1....1....1....1....1....1....1....1....1....1 GPCR3 ~R~G~S~S T V~~ ~ ~L~G~ 180 Q9WV09 N~~' TS L~G ~~ ~ C D~ 178 ... .I....I....I....I....I....1....1....1....1....1....1....1 GPCR3 ~~R~DGD~ L : ~RF~C' ~ ~ V~ 2 4 0 Q9WV09 C GRS~ ~ S I~ HS S S 238 .1.. .1.. .1.. .1.. .1.. .I.. .1.. .1.. .1.. .1.. .I.. .~
GPCR3 I ~~ ' ~ ~ 300 Q9wv09 ~T ~ v~T 5 v ~ ~ 298 ....i....1....1 Q9WV09 ~L. .p____ 309 The disclosed GPCR3 protein (SEQ ID NO:10) also has good identity with a number of olfactory receptor proteins, as shown in Table 3D.

Table 3D. BLAST
results for Gene Index/ Protein/ LengthIdentityPositivesExpect Identifier Organism (aa) (~) gi(5051404(embICA573K1.15 309 229/296 240/296 e-108 -B45012.11 mm17M1-6 (77~) (80$) (novel (AL078630) 7 transmembrane receptor) Mus musculus gi1120593591embICOR 312 145/298 191/298 2e-69 AC20487.11 Homo Sapiens (48~) (63~) (AJ302567) (AJ02568) gi1120543551embICOR 312 194/298 191/298 3e-69 AC20485.1~ Homo sapiens (48~) (63$) (AJ302565) (AJ302566)(AJ3025 69)(AJ302570) gi1122310291spIQ1OR 2H3 316 143/294 185/294 3e-68 5062102H3 HUMANHomo Sapiens (48~) (62~) gi197989201gb~AAFOR 303 142/287 183/287 5e-68 98752.1 AF211940_Homo Sapiens (99$) (63$) 1 (AF211940) This information is presented graphically in the multiple sequence alignment given in Table 3E (with GPCR3 being shown on line 1) as a ClustalW analysis comparing GPCR3 with related protein sequences.
Table 3E. Information for the ClustalW proteins:
1) Novel GPCR3 (SEQ ID NO:10) 2) gi~5051404~emb~CAB45012.1~ 573K1.15 (mm17M1-6 (novel 7 transmembrane receptor (rhodopsin family) (olfactory receptor LIKE) protein)) Mus musculus (SEQ ID N0:53) 3) gi~12054359~emb~CAC20487.1 ~ olfactory receptor Homo Sapiens (SEQ ID N0:54) 1 ~ 4) gi~12054355~emb~CAC20485.1 ~ olfactory receptor Homo Sapiens (SEQ ID
N0:55) 5) gi~12231029~sp~Q15062~02H3_HUMAN OLFACTORY RECEPTOR 2H3 (OLFACTORY RECEPTOR-LIKE
PROTEIN FAT11) (SEQ ID N0:56) 6) gi~9798920~gb~AAF98752.1 ~AF211940_1 olfactory receptor Homo Sapiens (SEQ
ID N0:57) io--zo so 4o so so ....I....I....~....I....I....I....
GPCR3 --MK Y E ~ 'S~P T SA

Gi~5051404~---- H SA 5 vP T I
a Gi~120543591MLMK EE H L~ fi ASH
Y
L

611120543551MLMK FE I 'H S ~ L 3 ASH
Y

GiI122310291---MD STPG H' RT FTS TL
y ~

Gi197989201----------- H RT FTS TL

.I.. .I.. .I.. .I.. .I.. .(.. .I.. .I.. .I.. .I.. .(.. .I
GPCR3 ~ C .L~~~ ~ 'P 1 ' LWP H~. ~ CAS ~. ~S
Gi~50514091 C L~:w G 'P SMLQ P CSS
Gi~12054359~ ~ v g 5:.~
Gi112054355~ ~ S~ F ~ ~
Gi1122310291 ~ C ' ~ ~LD ~ I T ~ T
Gi ~ 97989201 ~ C ' ~L LD 1u I s. T ~ T

.I.. .~.. .~.. .~.. .~.. .~.. .~.. .I.. .~.. .I.. .~.. .I
GPCR3 L~' S " ~T ~S. TN ~ ~LLAE ' P'L~ .
r ' ~ v r gi~5051404~ L~'TS ~S'L 'T ~G N LLAA ' '~ 1 gi~120543591 ~' T m 'L ~ S FTT H - a ' R ' n gi~12054355~ n ' T 'L S FTT H , FW ' RH
gi~12231029~ n ' T I ' I E PS LH ' PD D
gi197989201 T ' I E PS LH ' PD' D

.I.. .1....I.. .I.. .I.~ ~I.. .I~~ .I.. .I.. .I~. .I.~ .I
GPCR3 ~'~ .~RGGDGDTT~ F~~ 'j ~ CC R
v Y v w gi ~ 5051904 ~ ~' ~ ~~ RGGRSAT F ~ ~ , ~ S . I ~,~ H~S ' gi~12059359~ V -Q T , S~F, ~' I~ ~ T La L
gi~120543551 Q T S I' I ' S T Le L
gi~12231029~ ~ T' Ey SY I ~,,' ~a ~ T ~ ~~F
gi19798920~ ~ I' E SY ~ , ~ ~ TW~ N ~F

.I.. .I.. .I.. .I.~ .I~. .I.. .I.~ ~I.. ~I~~ .I.. .I.. .I
GPCR3 C ~ .YT t' Q
gi~5051404~ S C TYT ~'THSG
gi ~ 12054359 ~ ~ IP ~ C v P EN~~
gi~120543551 GIP x'C' 'P EN ~= I~,, gi~12231029~ S S ~'K P ~ ~' F G ' T
gi197989201 S 5 P ~ ~ F G ~ T

.I.. .1....1....I
GPCR3 _ RSLGRGQAGQ--gi150514041 ~ L' RSLGRP------~w ' w w gi~120543591 GM-------gi~12054355~ GM-------gi~12231029~ RDSRESWRAA
gi~97989201 ~F ' GLTQS----DOMAIN results for GPCR3 were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST. This BLAST samples domains found in the Smart and Pfam collections. The 7tm 1, a seven transmembrane receptor (rhodopsin family), was shown to have two segments with significant homology to GPCR3. The region from amino acid residue 40 through 226 aligns with amino acids 1 through 167 of the "seven transmembrane receptor (rhodopsin family) fragment" domain(SEQ ID N0:45, E=le-15), and GPCR3 amino acids 219-290 aligned with residues 305-377 of the 7tm_1 entry of the Pfam database (E=.004). This indicates that the GPCR3 sequence has properties similar to those of other proteins known to contain this domain as well as to the 7tm_1 domain itself.
The nucleic acids and proteins of the invention are useful in potential therapeutic applications implicated in various GPCR-related pathological disorders and/or OR-related pathological disorders, described further below. For example, a cDNA encoding the olfactory receptor -like protein may be useful in gene therapy, and the olfactory receptor -like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from neoplasm, adenocarcinoma, lymphoma, prostate cancer, uterus cancer, immune response, AIDS, asthma, Crohn's disease, multiple sclerosis, and Albright Hereditary Ostoeodystrophy. Other GPCR-related diseases and disorders are contemplated.

The novel nucleic acid encoding the GPCR-like protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed. These materials are further useful in the generation of antibodies that bind immunospecifically to the novel substances of the invention S for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-GPCRX Antibodies" section below. These novel proteins can be used in assay systems for functional analysis of various human disorders, which will help in understanding of pathology of the disease and development of new drug targets for various disorders.

GPCR4 includes a family of three nucleic acids disclosed below. The disclosed nucleic acids encode a GPCR-like protein.
GPCR4a The disclosed GPCR4a is encoded by three different nucleic acids, GPCR4a1 (dj408b20 C) GPCR4a2 (dj408b20 C dal), and GPCR4a3 (CG55358-03). A first nucleic acid, dj408b20 C (GPCR4a1), is 947 nucleotides long (SEQ ID NO:11). An open reading frame was identified beginning with an ATG initiation codon at nucleotides 3-5 and ending with a TGA codon at nucleotides 939-941. Putative untranslated regions upstream from the initiation codon and downstream from the termination codon are underlined in Table 4A, and the start and stop codons are in bold letters. The encoded protein having 312 amino acid residues is presented using the one-letter code in Table 4B (SEQ ID N0:12).
Table 4A. GPCR4a1 Nucleotide Sequence (SEQ ID NO:11).
_GTATGGAAAACGATAATACAAGTTCTTTCGAAGGCTTCATCCTGGTGGGCTTCTCTGATCGTCCCCACCT
AGAGCTGATCGTCTTTGTGGTTGTCCTCATCTTTTATCTGCTGACTCTTCTTGGCAACATGACCATTGTC
TTGCTTTCAGCTCTGGATTCCCGGCTGCACACACCAATGTATTTCTTTTTGGCAAACCTCTCATTCCTGG
ACATGTGTTTCACCACAGGTTCCATCCCTCAGATGCTCTACAACCTTTGGGGTCCAGATAAGACCATCAG
CTATGTGGGTTGTGCCATCCAGCTGTACTTTGTCCTGGCCCTGGGAGGGGTGGAGTGTGTCCTCCTGGCT
GTCATGGCATATGACCGCTATGCTGCAGTCTGCAAACCCCTGCACTACACCATCATCATGCACCCACGTC
TCTGTGGACAGCTGGCTTCAGTGGCATGGCTGAGTGGCTTTGGCAATTCTCTCATAATGGCACCCCAGAC
ATTGATGCTACCCCGCTGTGGGCACAGACGAGTTGACCACTTTCTCTGTGAGATGCCAGCACTAATTGGT
ATGGCCTGTGTAGACACCATGATGCTTGAGGCACTGGCTTTTGCCCTGGCAATCTTTATCATCCTGGCAC
CACTCATCCTCATTCTCATTTCTTATGGTTACGTTGGAGGAACAGTGCTTAGGATCAAGTCAGCTGCTGG
GCGAAAGAAAGCCTTCAACACTTGCAGCTCGCATCTAATTGTTGTCTCTCTCTTCTATGGTACAATCATA
TACATGTACCTCCAGCCAGCAAATACTTATTCCCAGGACCAGGGCAAGTTTCTTACCCTTTTCTACACAA
TTGTCACTCCCAGTGTTAACCCCCTGATCTATACACTAAGAAACAAAGATGTTAAAGAGGCCATGAAGAA
GGTGCTAGGGAAGGGGAGTGCAGAAATATAGTAAGGG
The disclosed nucleic acid GPCR4a1 sequence has 624 of 931 bases (67%) identical (with 624/931 positives, 67%) to a 939 by Homo Sapiens olfactory receptor-like protein (OR2C1) gene (GENBANK-ID: AF098664) (E = 3.8e'2). In a search of sequence databases, partial matches were also identified, e.g., the minus strand of nucleotides 719-947 had 229 of 229 bases (100%) identical to a 1320 by synthetic GPCR mRNA (PATENT-ID:
T72050), the sequence around marker 2B8 in HH region of chromosome 6p2.1, and the same region of S GPCR4a1 had 229 of 229 bases (100%) identical to a synthetic GPCR mRNA
(PATENT-ID:
T72050), also sequence around marker 2B8 in HH region of chromosome 6p2.1 (E
value in both cases is 9.6e-47).
The GPCR4a polypeptide (SEQ ID N0:12) encoded by SEQ ID NO:11 is presented using the one-letter amino acid code in Table 4B. The Psort profile for GPCR4a predicts that this sequence has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6000. The most likely cleavage site for a GPCR4a peptide is between amino acids 41 and 42, i.e., at the slash in the amino acid sequence LLG-NM, based on the SignalP
result.
Table 4B. GPCR4a protein sequence (SEQ ID N0:12) MENDNTSSFEGFILVGFSDRPHLELIVFVVVLIFYLLTLLG/NMTIVLLSALDSRLHTPMYFFLANLSF
LDMCFTTGSIPQMLYNLWGPDKTISYVGCAIQLYFVLALGGVECVLLAVMAYDRYAAVCKPLHYTIIMH
PRLCGQLASVAWLSGFGNSLIMAPQTLMLPRCGHRRVDHFLCEMPALIGMACVDTMMLEALAFALAIFI
ILAPLILILISYGYVGGTVLRIKSAAGRKKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFLT
LFYTIVTPSVNPLIYTLRNKDVKEAMKKVLGKGSAEI
1$
The predicted GPCR4a1 sequence, above, was subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such suitable sequences were then used as the forward and reverse primers in a PCR
amplification based on a wide range of cDNA libraries. The resulting amplicon was gel purified, cloned and sequenced to high redundancy, as described in the Examples.
The cloned sequence is disclosed as an alternative embodiment of GPCR4a2 (SEQ
ID
N0:13), referred to herein as the GPCR4a2 and reported in Table 4C. This 945 nucleotide sequence (GPCR4a2) is alternatively referred to herein as dj408b20 C dal .
This nucleic acid is two nucleotides shorter than GPCR4a1 at the 5' UTR: However, CPCR4a2 encodes the same 312 amino acid protein (GPCR4a, SEQ ID N0:12).

Table 4C. GPCR4a2 Nucleotide Sequence (SEQ ID N0:13) GTATGGAAAACGATAATACAAGTTCTTTCGAAGGCTTCATCCTGGTGGGCTTCTCTGATCGTCCCCACCTAGAGCTGAT
C
GTCTTTGTGGTTGTCCTCATCTTTTATCTGCTGACTCTTCTTGGCAACATGACCATTGTCTTGCTTTCAGCTCTGGATT
C
CCGGCTGCACACACCAATGTATTTCTTTTTGGCAAACCTCTCATTCCTGGACATGTGTTTCACCACAGGTTCCATCCCT
C
AGATGCTCTACAACCTTTGGGGTCCAGATAAGACCATCAGCTATGTGGGTTGTGCCATCCAGCTGTACTTTGTCCTGGC
C
CTGGGAGGGGTGGAGTGTGTCCTCCTGGCTGTCATGGCATATGACCGCTATGCTGCAGTCTGCAAACCCCTGCACTACA
C
CATCATCATGCACCCACGTCTCTGTGGACAGCTGGCTTCAGTGGCATGGCTGAGTGGCTTTGGCAATTCTCTCATAATG
G
CACCCCAGACATTGATGCTACCCCGCTGTGGGCACAGACGAGTTGACCACTTTCTCTGTGAGATGCCAGCACTAATTGG
T
ATGGCCTGTGTAGACACCATGATGCTTGAGGCACTGGCTTTTGCCCTGGCAATCTTTATCATCCTGGCACCACTCATCC
T
CATTCTCATTTCTTATGGTTACGTTGGAGGAACAGTGCTTAGGATCAAGTCAGCTGCTGGGCGAAAGAAAGCCTTCAAC
A
CTTGCAGCTCGCATCTAATTGTTGTCTCTCTCTTCTATGGTACAATCATATACATGTACCTCCAGCCAGCAAATACTTA
T
TCCCAGGACCAGGGCAAGTTTCTTACCCTTTTCTACACAATTGTCACTCCCAGTGTTAACCCCCTGATCTATACACTAA
G
The full amino acid sequence of the disclosed GPCR4a polypeptide has 197 of amino acid residues (64%) identical to, and 242 of 305 residues (79%) positive with, the 320 amino acid residue protein from Homo sapiens novel 7 transmembrane receptor (rhodopsin family, olfactory receptor-like protein HS6M1-15, ptnr:SPTREMBL-ACC:Q9Y3N9 DJ88J8.1, E = S.Oe'°g).
BLASTP (Non-Redundant Composite database) analysis of the best hits for alignments with GPCR4a are listed in Table 4D.
Table 4D.
BLASTP
results for GPCR4a Gene Index/Protein/ Organism LengthIdentity PositivesExpect Identifier (aa) ACC:Q9Y3N9Novel 7 Transmembrane320 197/305 242/305 9.4e-DJ88J8.1 Receptor (Rhodopsin (64g) (79~) 109 Family, OR-Like) Hs6m1-15 Homo Sapiens ACC:P23275OLFACTORY RECEPTOR312 190/308 291/308 5.5e-(OR3) Mus musculus (61$) (78$) 104 ACC:076001OR-LIKE PROTEIN 311 193/302 244/302 1.5e-DJ80I19.7 (HS6M1-3) (63~) (80~) 103 Homo sapiens A BLASTX was also performed to determine the proteins that have significant identity with GPCR4a. The BLASTX results are shown in Table 4E.
Table 4E. BLASTX results for GPCR4a Smallest Sum Reading High Prob Sequences producing High-scoring Segment Pairs: Frame Score P(N) N
Ptnr:SPTREMBL-ACC:Q9Y3N9 DJ88J8.1 (NOVEL 7 TRANSMEMBRA... +3 1076 5.6e-108 1 Ptnr:SWISSPROT-ACC:P23275 OLFACTORY RECEPTOR 15 (0R3) ... +3 1031 3.3e-103 1 Ptnr:SPTREMBL-ACC:076001 DJ80I19.7 (OLFACTORY RECEPTOR... +3 1027 8.7e-103 1 Ptnr:SPTREMBL-ACC:095371 OLFACTORY RECEPTOR-LIKE PROTE... +3 992 9.5e-99 1 Ptnr:SPTREMBL-ACC:095918 DJ271M21.2 (HS6M1-12 (7 TRANS... +3 988 1.2e-98 1 Ptnr:SPTREMBL-ACC:Q9WV11 573K1.8 (MM17M1-2 (NOVEL 7 TR... +3 984 3.2e-98 1 Ptnr:SPTREMBL-ACC:Q9WV14 573K1.2 (MM17M1=3 (NOVEL 7 TR... +3 981 6.6e-98 1 Possible SNPs found for GPCR4a2 are listed in Table4F.
Table 4F: SNPs Base Base Base Position Before After 44 T C(20 147 T C(2) 220 T C(2) 271 T C(3) 432 A G(2) 452 C T(2) 493 A G(2) 771 T C(3) GPCR4b The target sequence identified as dj408b20 C (GPCR4a1) was again subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. The cDNA coding for the sequence was cloned by polymerase chain reaction (PCR) using the following primers:
ATACAAGTTCTTTCGAAGGCTTCATCC (SEQ ID N0:14) and CCCTTACTATATTTCTGCACTCCCCTT (SEQ ID NO:15) on pool 1 of human cDNAs containing the following: Adrenal gland, bone marrow, brain - amygdala, brain -cerebellum, brain - hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus.
Primers were designed based on in silico predictions for the full length or part (one or more exons) of the DNA/protein sequence of the invention or by translated homology of the predicted exons to closely related human sequences or to sequences from other species.
Usually multiple clones were sequenced to derive the sequence which was then assembled similar to the SeqCalling process. In addition, sequence traces were evaluated manually and edited for corrections if appropriate. The PCR product derived by exon linking was cloned into the pCR2.1 vector from Invitrogen. The bacterial clone 115843::DJ408B20 C.698322.D10 has an insert covering the entire open reading frame cloned into the pCR2.1 vector from Invitrogen.

In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such primers were designed based on in silico predictions for the full length cDNA, part (one or more exons) of the DNA or protein sequence of the target sequence, or by translated homology of the predicted exons to closely related human sequences from other species.
Typically, the resulting amplicons were gel purified, cloned and sequenced to high redundancy as described in the examples. The resulting sequences from all clones were assembled with themselves, with other fragments in CuraGen Corporation's database and with public ESTs.
Fragments and ESTs were included as components for an assembly when the extent of their identity with another component of the assembly was at least 95% over 50 bp.
In addition, sequence traces were evaluated manually and edited for corrections if appropriate.
These procedures provided a third nucleic acid encoding a GPCR4 protein. The nucleic acid is referred to as GPCR4a3 or CG55358-03. This nucleic acid is 932 nucleotides long (SEQ ID N0:16, Table 4G) and is 16 nucleotides shorter in the S' UTR than GPCR2al.
An open reading frame of the mature protein was identified beginning with an ACA codon which codes for the amino acid threonine at nucleotides 3-5 and ending with a TAG codon at nucleotides 924-926. Putative untranslated regions, if any, are found upstream from the initiation codon and downstream from the termination codon. One silent base substitution is present: C767 is T752 in GPCR4a3. GPCR4b, the protein encoded by GPCR4a3 is identical to GPCR4a, except for the 5 amino acid deletion at the N terminus, as shown in Table 4H
(SEQ ID N0:17).
The GPCR Olfactory Receptor disclosed herein is expressed in at least the following tissues: Apical microvilli of the retinal pigment epithelium, arterial (aortic), basal forebrain, brain, Burkitt lymphoma cell lines, corpus callosum, cardiac (atria and ventricle), caudate nucleus, CNS and peripheral tissue, cerebellum, cerebral cortex, colon, cortical neurogenic cells, endothelial (coronary artery and umbilical vein) cells, palate epithelia, eye, neonatal eye, frontal cortex, fetal hematopoietic cells, heart, hippocampus, hypothalamus, leukocytes, liver, fetal liver, lung, lung lymphoma cell lines, fetal lymphoid tissue, adult lymphoid tissue, Those that express MHC II and III nervous, medulla, subthalamic nucleus, ovary, pancreas, pituitary, placenta, pons, prostate, putamen, serum, skeletal muscle, small intestine, smooth muscle (coronary artery in aortic) spinal cord, spleen, stomach, taste receptor cells of the tongue, testis, thalamus, and thymus tissue. This information was derived by determining the tissue sources of the sequences that were included in the invention including but not limited to SeqCalling sources, Public EST sources, Literature sources, andlor RACE
sources.
In a search of sequence databases, it was found, for example, that the disclosed GPCR4a3 nucleic acid sequence has 614 of 913 bases (67%) identical to a gb:GENBANK-ID:AF098664~acc:AF098664.1 mRNA from Homo Sapiens (Homo Sapiens olfactory receptor-like protein (OR2C 1 ) gene, complete cds, E= 2.1 e-71 ).
Table 4G. GPCR4a3 Nucleotide Sequence (SEQ ID N0:16) A

_ 120 TGATCGTCTTTGTGGTTGTCCTCATCTTTTATCTGCTGACTCTTCTTGGCAACATGACCA

The SignalP, Psort and/or Hydropathy profile for the disclosed GPCR4b Olfactory Receptor-like protein predicts that this sequence has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6000. The SignalP shows a signal sequence is coded for in the first 36 amino acids with a cleavage site at between amino acids 36 and 37, as indicated by a slash between LLG/NM in Table 4H. This is typical of this type of membrane protein.
Table 4H. GPCR4b Amino Acid Sequence (SEQ ID N0:17) GMACVDTMMLEALAFALAIFIILAPLILiLISYGYVGGTVLRIKSAAGRKKAFNTCSSHL 240 The full amino acid sequence of the disclosed GPCR4b protein of the invention was found to have 195 of 299 amino acid residues (65%) identical to, and 239 of 299 amino acid residues (79%) similar to, the 320 amino acid residue ptnr:SPTREMBL-ACC:Q9Y3N9 protein from Homo Sapiens (DJ88J8.1, NOVEL 7 TRANSMEMBRANE RECEPTOR

(RHODOPS1N FAMILY) (OLFACTORY RECEPTOR LIKE) PROTEIN) (HS6M1-15), E=
1.6e-107).
In following positions, one or more consensus positions (Cons. Pos.) of the GPCR4a3 nucleotide sequence have been identified as SNPs. "Depth" represents the number of clones covering the region of the SNP. The Putative Allele Frequency (Putative Allele Freq.) is the fraction of all the clones containing the SNP. A dash ("-"), when shown, means that a base is not present. The sign ">" means "is changed to": Cons. Pos.: 422 Depth: 18 Change: T > C, Putative Allele Freq.: 0.333; Cons. Pos.: 546 Depth: 15 Change: T > C, Putative Allele Freq.: 0.133; Cons. Pos.: 753 Depth: 8 Change: C > T, Putative Allele Freq.:
0.250.
Unless specifically addressed as GPCR4a or GPCR4b, any reference to GPCR4 is assumed to encompass all variants. Residue differences between any GPCRX
variant sequences herein are written to show the residue in the "a" variant and the residue position with respect to the "a" variant. In all following sequence alignments, the GPCR4a protein sequence was used.
The disclosed GPCR4 protein (SEQ ID N0:12) also has good identity with a number of olfactory receptor proteins. The identity information used for ClustalW
analysis is presented in Table 4I.
Table 4I. BLAST
results for Gene Index/ Protein/ OrganismLengthIdentityPositivesExpect Identifier (aa) (~) Gi16679170~ref(NPOR 15 (0R3) 312 174/308216/308 1e-93 _ Mus musculus (56~) (69g) 2788.1 Gi~4826521~emb~CAB92novel 7 tm 320 174/305213/305 2e-93 853.1 receptor protein (57~) (690) (AL035402, dJ88J8.1)(rhodopsin fam., (AJ302594-99) OR-like) (AJ302600-01) (hs6M1-15) Homo Sapiens Gi~120544311embICAC2OR 320 173/305213/305 3e-93 0523.11 (AJ302603)Homo Sapiens (56~) (690) Gi~120544291embICAC2OR 320 173/305213/305 7e-93 0522.11 (AJ302602)Homo Sapiens (56~) (690) Gi~12054347~embICAC2OR 311 170/302211/302 6e-90 0478.11 (AJ302558)Homo sapiens (56~) (69~) This information is presented graphically in the multiple sequence alignment given in Table 4J (with GPCR4 being shown on line 1) as a ClustalW analysis comparing GPCR4 with related OR sequences.

Table 4J Information for the ClustalW proteins:
1) GPCR4 (SEQ ID N0:12) 2) gi~6679170~ref~NP_032788.1 ~ olfactory receptor 15 Mus musculus (SEQ ID
N0:58) 3) gi~4826521 ~emb~CAB42853.1 ~ dJ88J8.1 (novel 7 transmembrane receptor (rhodopsin family) (OR
like) protein) (hs6M1-15)) Homo Sapiens (SEQ ID N0:59) 4) gig 12054431 ~emb~CAC20523.1 ~ olfactory receptor Homo Sapiens (SEQ ID
N0:60) 5) gig 12054429~emb~CAC20522.1 ~ olfactory receptor Homo Sapiens (SEQ ID
N0:61) 6) gi~12054347~emb~CAC20478.1~ olfactory receptor Homo Sapiens (SEQ ID N0:62) .I....I....I....I....I....1....1....1....1....1....1....1 GPCR4 ~~ND---~T FE H~' F L T L
GiI66791701 n VD---N SGT H; T FF ALAS LT ~ L
Gi148265211 QS--- Y LH N ~ S I T L
Gi1120544311 ~ QS--- Y LH 5 I T L
Gi1120544291 QS--- Y LH K SG I T L
Gi I 120543971 ~DDGK EGY H ,V~ F L I L L Y

.I.. .I.. ~I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I
.. . v GPCR9 W~ .GS '~ Y . '~~ ~ FV~
Gi166791701 S S n S~'~~ '~' T ~T
Gi198265211 ~ I ' Gi1120594311 ~ I ' w fi Gi1120544291 ~ I ' '~ ~ a Gi1120543471 S ~ S ' ~ ~ FV T

.I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I
GPCR4 ~ ~ T~I ~S ~SGF ~ .P ~ ~ R ~
_ ~, a v w . w Gi166791701 ~ y . ~. ' S LG ~QS ~RK~~
a ca Gi148265211 n ' T T ~ L I I SIS TyC L N T NI~n Gi I 12054431 I ~' T I L ',~I I SIS r' C L N 'T ~ NIi' ~
Gi 1120544291 m' T I' L~I , I SIS .~ C L N T ~ Ian Gi1120543471 ~'~~T v ~'R HL S SGFT 5~ FW L ~R ~

.I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I
GPCR9 ~ ' G ' n _~" L E~I ~GGT ~ I G -GiI66791701 ~'~_I ' ~ LN ~NG~CTFFT ~ S C 19I EG ' Gi198265211 I' ~ T= 8. ~T. -.T~. - S. ' Gi1120594311 ~,' ~ T '~- T' T S ' ~ ;.,.~~a Gi1120599291 ~ I~ ~ ,~T T' T K~S°' M ~TTGL
Gill'20543471 ' S ~ HVN ' ITSS ~ I' .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. ~I.. .I.. .I
GPCR4 ~ S , I ~ ~ ~' TY ~ m I~"~l a Gi I 66791701 ~ L' KS ~Ii;~S~ ~;S I U
Gi148265211 T ~ v Gi1120549311 T ~ m Gi1120544291 T ~' ~~ 2 ' Gi1120543471 F ~ IPA~C 'PG

.I.. .I.. .I.. .I...
GPCR4 ~G--K~ ----Gi166791701 ~SG,_=GKGRG "a-____--_ Gi148265211 HHK KRNCKS
Gi1120544311 i H KRNCKS
Gi1120544291 t HH KRNCKS
Gi1120543471 iG E------------DOMAIN results for GPCR4 were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST. This BLAST samples domains found in the Smart and Pfam collections. Two regions of GPCR4 have identity to the 377 amino acid 7TM

domain, as described above. The 7tm 1, a seven transmembrane receptor (rhodopsin family), SEQ ID N0:45, above, was shown to have homology to GPCR4. Residues 1-120 of align with residues 41-159 of GPCR4 (E= 7e-22, shown in Table 2K) and residues 224-290 of GPCR4 have identity with residues 310-377 of 7TM (E=2e-04).
Table 4K: Domain Alignment between GPCR4 and 7TM.
TM7R4 ~LAV~RKA~Q~TTNL FLVA~LV~WEVVGWKF~RF
..I....I....~In....I....I....I....I....I....I....I....I....) GPCR ~ D CTASI~I~V I'' T~ CK~ L~NTRYSS~RVTQI ? ~LSBTI~CP~

The nucleic acids and proteins of GPCR4 are useful in potential therapeutic applications implicated in various GPCR-related pathological disorders and/or OR-related pathological disorders, described further below. For example, a cDNA encoding the olfactory receptor-like protein may be useful in gene therapy, and the olfactory receptor-like protein may be useful when administered to a subject in need thereof. The protein similarity information, expression pattern, and map location for the Olfactory Receptor-like protein and nucleic acid disclosed herein suggest that this Olfactory Receptor may have important structural and/or physiological functions characteristic of the Olfactory Receptor family.
Therefore, the nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount of the nucleic acid or the protein are to be assessed, as well as potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), and (v) a composition promoting tissue regeneration in vitro and in vivo (vi) biological defense weapon.
The nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications implicated in various diseases and disorders described below and/or other pathologies. For example, the compositions of the present invention will have efficacy for treatment of patients suffering from: developmental diseases, MHCII and III diseases (immune diseases), taste and scent detectability Disorders, Burkitt's lymphoma, corticoneurogenic disease, signal transduction pathway disorders, retinal diseases including those involving photoreception, cell growth rate disorders; cell shape disorders, feeding disorders; control of feeding; potential obesity due to over-eating; potential disorders due to starvation (lack of appetite), noninsulin-dependent diabetes mellitus (NIDDM1), bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm; adenocarcinoma; lymphoma;
prostate cancer;
uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright Hereditary Ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation, dentatorubro-pallidoluysian atrophy (DRPLA) hypophosphatemic rickets, autosomal dominant (2) acrocallosal syndrome and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome and/or other pathologies and disorders of the like. The polypeptides can be used as immunogens to produce antibodies specific for the invention, and as vaccines. They can also be used to screen for potential agonist and antagonist compounds.
For example, a cDNA encoding the OR -like protein may be useful in gene therapy, and the OR-like protein may be useful when administered to a subject in need thereof.
By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm; adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright Hereditary Ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome.
Other GPCR-4 diseases and disorders are contemplated.
The novel nucleic acid encoding OR-like protein, and the OR-like protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed.
These materials are further useful in the generation of antibodies that bind immu~ospecifically to the novel substances of the invention for use in therapeutic or diagnostic methods and other diseases, disorders and conditions of the like. These materials are further useful in the generation of antibodies that bind immunospecifically to the novel substances of the invention for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-GPCRX Antibodies" section below. In one embodiment, a contemplated GPCR4 epitope is from about amino acids 65 to 85. In another embodiment, a GPCR4 epitope is from about amino acids 115 to 130. In additional embodiments, GPCR4 epitopes are from amino acids 155 to 175, from 215 to 240, from 250 to 275 and from amino acids 280 to 310.
These novel proteins can also be used to develop assay system for functional analysis.
GPCRS
GPCRS includes a family of three similar nucleic acids and three similar proteins disclosed below. The disclosed nucleic acids encode GPCR, OR-like proteins.
GPCRSa The disclosed novel GPCRSa nucleic acid of 1003 nucleotides (also referred to as 115-a-12-A) is shown in Table 5A. An ORF begins with an ATG initiation codon at nucleotides 6-8 and ends with a TAA codon at nucleotides 999-1001. A putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 5A, and the start and stop codons are in bold letters.
Table 5A. GPCRSa Nucleotide Sequence (SEQ ID N0:18) AGACAATGAGTCCTGATGGGAACCACAGTAGTGATCCAACAGAGTTCGTCCTGGCAGGGCTCCCAAATCT
CAACAGCGCAAGAGTGGAATTATTTTCTGTGTTTCTTCTTGTCTATCTCCTGAATCTGACAGGCAATGTG
TTGATTGTGGGGGTGGTAAGGGCTGATACTCGACTACAGACCCCTATGTACTTCTTTCTGGGTAACCTGT
CCTGCCTAGAGATACTGCTCACTTCTGTCATCATTCCAAAGATGCTGAGCAATTTCCTCTCAAGGCAACA
CACTATTTCCTTTGCTGCATGTATCACCCAATTCTATTTCTACTTCTTTCTCGGGGCCTCCGAGTTCTTA
CTGTTGGCTGTCATGTCTGCGGATCGCTACCTGGCCATCTGTCATCCTCTGCGCTACCCCTTGCTCATGA
GTGGGGCTGTGTGCTTTCGTGTGGCCTTGGCCTGCTGGGTGGGGGGACTCGTCCCTGTGCTTGGTCCCAC
AGTGGCTGTGGCCTTGCTTCCTTTCTGTAAGCAGGGTGCTGTGGTACAGCACTTCTTCTGCGACAGTGGC
CCACTGCTCCGCCTGGCTTGCACCAACACCAAGAAGCTGGAGGAGACTGACTTTGTCCTGGCCTCCCTCG
TCATTGTATCTTCCTTGCTGATCACTGCTGTGTCCTACGGCCTCATTGTGCTGGCAGTCCTGAGCATCCC
CTCTGCTTCAGGCCGTCAGAAGGCCTTCTCTACCTGTACCTCCCACTTGATAGTGGTGACCCTCTTCTAT
GGAAGTGCCATTTTTCTCTATGTGCGGCCATCGCAGAGTGGTTCTGTGGACACTAACTGGGCAGTGACAG
TAATAACGACATTTGTGACACCACTGTTGAATCCATTCATCTATGCCTTACGTAATGAGCAAGTCAAGGA
AGCTTTGAAGGACATGTTTAGGAAGGTAGTGGCAGGCGTTTTAGGGAATCTTTTACTTGATAAATGTCTC
AGTGAGAAAGCAGTAAAGTAAAA
The GPCRSa protein encoded by SEQ 1D N0:18 has 331 amino acid residues and is presented using the one-letter code in Table 5B. The Psort profile for GPCRSa predicts that this sequence has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6000, it may also localize to the Golgi body. The most likely cleavage site for a peptide is between amino acids 54 and 55, i.e., at the slash in the amino acid sequence VRA-DT (shown as a slash in TableSB) based on the SignalP result.
Table SB. Encoded GPCRSa protein sequence (SEQ ID N0:19) MSPDGNHSSDPTEFVLAGLPNLNSARVELFSVFLLVYLLNLTGNVLIVGVVRA/DTRLQTPMYFF
LGNLSCLEILLTSVIIPKMLSNFLSRQHTISFAACITQFYFYFFLGASEFLLLAVMSADRYLAIC
HPLRYPLLMSGAVCFRVALACWVGGLVPVLGPTVAVALLPFCKQGAVVQHFFCDSGPLLRLACTN
TKKLEETDFVLASLVIVSSLLITAVSYGLIVLAVLSIPSASGRQKAFSTCTSHLIVVTLFYGSAI
FLYVRPSQSGSVDTNWAVTVITTFVTPLLNPFIYALRNEQVKEALKDMFRKVVAGVLGNLLLDKC
LSEKAVK
The disclosed nucleic acid sequence for GPCRS has 604 of 934 bases (64%) identical to and 604 of 934 bases (64%) positive with Rattus norvegicus olfactory receptor protein mRNA (936 bp) (GENBANK-ID: RATOLFPROD~ acc:M64378) (E= 1.1 a 45).
The full GPCRS amino acid sequence has 149 of 304 amino acid residues (49 %) identical to, and 201 of 304 residues (66%) positive with, the 313 amino acid residue olfactory receptor from Mus musculus (ptnr: SPTREMBL-ACC: Q9Z1V0) (E= 2.6e'4).
GPCRSb GPCRSa (115-a-12-A) was subjected to an exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer.
In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such suitable sequences were then employed as the forward and reverse primers in a PCR
amplification based on a wide range of cDNA libraries. The resulting amplicon was gel purified, cloned and sequenced to high redundancy to provide GPCRSb, which is also referred to as 115-a-12-B.
The nucleotide sequence for GPCRSb (1004 bp, SEQ ID N0:20) is presented in Table 5C. The nucleotide sequence differs from GPCRSa by the addition of a T between AS and A6, and by 6 nucleotide changes (numbered with respect to GPCRSa) C131 >T; T186>C;
6472>A; T579>A; A687>T; C799>T.

Table 5C. GPCRSb Nucleotide Sequence (SEQ ID N0:20) AGACATATGAGTCCTGATGGGAACCACAGTAGTGATCCAACAGAGTTCGTCCTGGCAGGGCTCCCAA
ATCTCAACAGCGCAAGAGTGGAATTATTTTCTGTGTTTCTTCTTGTCTATCTCCTGAATCTGATAGG
CAATGTGTTGATTGTGGGGGTGGTAAGGGCTGATACTCGACTACAGACCCCCATGTACTTCTTTCTG
GGTAACCTGTCCTGCCTAGAGATACTGCTCACTTCTGTCATCATTCCAAAGATGCTGAGCAATTTCC
TCTCAAGGCAACACACTATTTCCTTTGCTGCATGTATCACCCAATTCTATTTCTACTTCTTTCTCGG
GGCCTCCGAGTTCTTACTGTTGGCTGTCATGTCTGCGGATCGCTACCTGGCCATCTGTCATCCTCTG
CGCTACCCCTTGCTCATGAGTGGGGCTGTGTGCTTTCGTGTGGCCTTGGCCTGCTGGGTGGGGGGAC
TCATCCCTGTGCTTGGTCCCACAGTGGCTGTGGCCTTGCTTCCTTTCTGTAAGCAGGGTGCTGTGGT
ACAGCACTTCTTCTGCGACAGTGGCCCACTGCTCCGCCTGGCATGCACCAACACCAAGAAGCTGGAG
GAGACTGACTTTGTCCTGGCCTCCCTCGTCATTGTATCTTCCTTGCTGATCACTGCTGTGTCCTACG
GCCTCATTGTGCTGGCTGTCCTGAGCATCCCCTCTGCTTCAGGCCGTCAGAAGGCCTTCTCTACCTG
TACCTCCCACTTGATAGTGGTGACCCTCTTCTATGGAAGTGCCATTTTTCTCTATGTGCGGTCATCG
CAGAGTGGTTCTGTGGACACTAACTGGGCAGTGACAGTAATAACGACATTTGTGACACCACTGTTGA
ATCCATTCATCTATGCCTTACGTAATGAGCAAGTCAAGGAAGCTTTGAAGGACATGTTTAGGAAGGT
AGTGGCAGGCGTTTTAGGGAATCTTTTACTTGATAAATGTCTCAGTGAGAAAGCAGTAAAGTAAAA
The encoded GPCRSb protein is presented in Table SD. The disclosed protein is amino acids long and is denoted by SEQ ID N0:21. GPCRSb differs from GPCRSa by amino acid residues: T42>I; V 151>I; P265>S. Like GPCRSa, the Psort profile for GPCRSb predicts that this sequence has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6000. The most likely cleavage site for a peptide is between amino acids 54 and 55, i.e., at the slash in the amino acid sequence VRA-DT
(shown as a slash in TableSD) based on the SignalP result.
Table SD. Encoded GPCRSb protein sequence (SEQ ID N0:21) MSPDGNHSSDPTEFVLAGLPNLNSARVELFSVFLLVYLLNLIGNVLIVGVVRA/DTRLQTPMYFFLGN
LSCLEILLTSVIIPKMLSNFLSRQHTISFAACITQFYFYFFLGASEFLLLAVMSADRYLAICHPLRYP
LLMSGAVCFRVALACWVGGLIPVLGPTVAVALLPFCKQGAVVQHFFCDSGPLLRLACTNTKKLEETDF
VLASLVIVSSLLITAVSYGLIVLAVLSIPSASGRQKAFSTCTSHLIVVTLFYGSAIFLYVRSSQSGSV
DTNWAVTVITTFVTPLLNPFIYALRNEQVKEALKDMFRKVVAGVLGNLLLDKCLSEKAVK
BLASTP (Non-Redundant Composite database) analysis of the best hits for alignments with GPCRSb are listed in Table SE.
Table SE.
BLASTP
results for GPCRSb Gene Index/Protein/ OrganismLength IdentityPositivesExpect Identifier (aa) (~) ($) SPTREMBL- OLFACTORY RECEPTOR313 150/304 203/304 9.4e-76 ACC:Q9Z1V0 C6 Mus musculus (49$) (66$) SWISSPROT- OLFACTORY RECEPTOR-311 152/301 199/301 5.2e-75 ACC:P23267 LIKE PROTEIN (50$) (66$) Rattus norvegicus SPTREMBL- HS6M1-17 (NOVEL 306 195/301 197/301 1.1e-67 ACC:Q9Y3P5 (RHODOPSIN FAMILY) (48$) (65$) DJ994E9.5 (OR LIKE PROTEIN) Homo sapiens A BLASTX was also performed to determine the proteins that have significant identity with GPCR4a. The BLASTX results are shown in Table SF.
Table SF. BLASTX results for GPCRSb Smallest Sum Reading High Prob Sequences producing High-scoring Segment Pairs: Frame Score P(N) N
Ptnr:SPTREMBL-ACC:Q9Z1V0 OLFACTORY RECEPTOR C6 - Mus m... +1 769 5.6e-75 1 ptnr:SWISSPROT-ACC:P23267 OLFACTORY RECEPTOR-LIKE PROT... +1 757 3.1e-79 1 ptnr:SWISSPROT-ACC:P23270 OLFACTORY RECEPTOR-LIKE PROT... +1 701 2.7e-68 1 ptnr:SPTREMBL-ACC:Q9Y3P5 DJ994E9.5 (HS6M1-17 (NOVEL 7 ... +1 688 6.3e-67 1 ptnr:SPTREMBL-ACC:070271 OLFACTORY RECEPTOR-LIKE PROTE... +1 688 6.3e-67 1 ptnr:SPTREMBL-ACC:095007 WUGSC:H_DJ0669B10.3 PROTEIN -... +1 680 9.5e-66 1 ptnr:SPTREMBL-ACC:013036 CHICK OLFACTORY RECEPTOR 7 - ... +1 675 1.5e-65 1 ptnr:SPTREMBL-ACC:095222 OLFACTORY RECEPTOR - Homo sap... +1 672 3.1e-65 1 ptnr:SPTREMBL-ACC:070269 OLFACTORY RECEPTOR-LIKE PROTE... +1 670 5.1e-65 1 ptnr:SPTREMBL-ACC:057597 CHICK OLFACTORY RECEPTOR 7 - ... +1 669 6.5e-65 1 ptnr:SPTREMBL-ACC:070270 OLFACTORY RECEPTOR-LIKE PROTE... +1 668 8.4e-65 1 ptnr:TREMBLNEW-ACC:AAF65961 OLFACTORY RECEPTOR P2 - Mu... +1 666 1.9e-69 1 ptnr:SPTREMBL-ACC:Q9WU86 ODORANT RECEPTOR S1 - Mus mus... +1 665 1.7e-64 1 ptnr:SPTREMBL-ACC:Q90808 OLFACTORY RECEPTOR 9 - Gallus... +1 665 1.7e-69 1 ptnr:SWISSPROT-ACC:P37071 OLFACTORY RECEPTOR-LIKE PROT... +1 646 1.8e-62 1 GPCRSC
Another nucleotide sequence resulted when GPCRSa (115-a-12-A) was subjected to an exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such suitable sequences were then employed as the forward and reverse primers in a PCR amplification based on a wide range of cDNA
libraries. The resulting amplicon was gel purified, cloned and sequenced to high redundancy to provide the sequence reported below, which is designated as Accession Number 115 A 12 A
dal, or GPCRSc.
Human tissues providing SeqCalling Fragments of the clone include Pool One:
adrenal gland, bone marrow, brain - amygdala, brain - cerebellum, brain - hippocampus, brain -substantia nigra, brain - thalamus, brain - whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. The tissue origin of the clone is RACE(asm:126603384).

The nucleotide sequence for GPCRSc (1005 bp, SEQ ID N0:22) is presented in Table SG. The GPCRSc nucleotide sequence differs from GPCRSa by having an extra T at the 5' end, an A at the 3' end, and 6 nucleotide changes: (numbered with respect to GPCRSa) T123>C; C131>T; T186>C; G472>A; T579>A; A687>T.
Table SG. GPCRSc Nucleotide Sequence (SEQ ID N0:22) TAGACAATGAGTCCTGATGGGAACCACAGTAGTGATCCAACAGAGTTCGTCCTGGCAGGGCTCCCAAATC
TCAACAGCGCAAGAGTGGAATTATTTTCTGTGTTTCTTCTTGTCTATCTCCCGAATCTGATAGGCAATGT
GTTGATTGTGGGGGTGGTAAGGGCTGATACTCGACTACAGACCCCCATGTACTTCTTTCTGGGTAACCTG
TCCTGCCTAGAGATACTGCTCACTTCTGTCATCATTCCAAAGATGCTGAGCAATTTCCTCTCAAGGCAAC
ACACTATTTCCTTTGCTGCATGTATCACCCAATTCTATTTCTACTTCTTTCTCGGGGCCTCCGAGTTCTT
ACTGTTGGCTGTCATGTCTGCGGATCGCTACCTGGCCATCTGTCATCCTCTGCGCTACCCCTTGCTCATG
AGTGGGGCTGTGTGCTTTCGTGTGGCCTTGGCCTGCTGGGTGGGGGGACTCATCCCTGTGCTTGGTCCCA
CAGTGGCTGTGGCCTTGCTTCCTTTCTGTAAGCAGGGTGCTGTGGTACAGCACTTCTTCTGCGACAGTGG
CCCACTGCTCCGCCTGGCATGCACCAACACCAAGAAGCTGGAGGAGACTGACTTTGTCCTGGCCTCCCTC
GTCATTGTATCTTCCTTGCTGATCACTGCTGTGTCCTACGGCCTCATTGTGCTGGCTGTCCTGAGCATCC
CCTCTGCTTCAGGCCGTCAGAAGGCCTTCTCTACCTGTACCTCCCACTTGATAGTGGTGACCCTCTTCTA
TGGAAGTGCCATTTTTCTCTATGTGCGGCCATCGCAGAGTGGTTCTGTGGACACTAACTGGGCAGTGACA
GTAATAACGACATTTGTGACACCACTGTTGAATCCATTCATCTATGCCTTACGTAATGAGCAAGTCAAGG
AAGCTTTGAAGGACATGTTTAGGAAGGTAGTGGCAGGCGTTTTAGGGAATCTTTTACTTGATAAATGTCT
CAGTGAGAAAGCAGTAAAGTAAAAA
The coding region of GPCRSc is from nucleotide 7 to 1000, giving the encoded GPCRSc protein, as presented in Table SH. The disclosed protein is 331 amino acids long and is denoted by SEQ ID NO: 23. GPCRSc differs from GPCRSa by 3 amino acid residues:
L39>P; T42>I; and V151>I. Like GPCRSa, the Psort profile for GPCRSc predicts that this sequence has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6000. The most likely cleavage site for a peptide is between amino acids 54 and 55, i.e., at the slash in the amino acid sequence VRA-DT (shown as a slash in TableSH) based on the SignalP result.
Table SH. Encoded GPCRSb protein sequence (SEQ ID N0:23) MSPDGNHSSDPTEFVLAGLPNLNSARVELFSVFLLVYLPNLIGNVLIVGVVRA/DTRLQTPMYFFLGNLSC
LEILLTSVIIPKMLSNFLSRQHTISFAACITQFYFYFFLGASEFLLLAVMSADRYLAICHPLRYPLLMSG

that differ between the individual GPCR variants are highlighted with a box and marked with the (o) symbol above the variant residue in all alignments herein. For example, the protein shown in line 1 of Table SJ depicts the sequence for GPCRSa, and the positions where GPCRSb or GPCRSc differs are marked with a (o) symbol and are highlighted with a box. All GPCRS proteins have significant homology to olfactory receptor (OR) proteins:
Table SI. BLAST
results for GPCRS

Gene Index/ Protein/ OrganismLengthIdentityPositivesExpect Identifier (aa) ($) ($) Gi11290911spIP23267OR 15 (0R3) 311 194/301 189/301 7e-67 IOLF6 RAT Rattus norvegicus (47$) (61$) Gi167549321refINP_0OR 99, ORC6 313 195/305 192/305 3e-66 35121.11 (AF102523)Mus musculus (47$) (62$) Gi172421651refINP_0OR 41, ORI7 234 136/304 181/304 9e-61 35113.11 (AF106007)Mus musculus (44$) (58$) (AF321233) Gi173634371refINP_0OR, family 306 139/301 186/301 2e-59 10, 39229.11 subfamily C, (46$) (61$) member 1 Homo Sapiens Gi1120074311gbIAAG4M50 OR 316 129/303 181/303 4e-59 5202.11AF321236Mus musculus (42$) (59$) (AF321236) This information is presented graphically in the multiple sequence alignment given in Table SJ (with GPCRS being shown on line 1) as a ClustalW analysis comparing GPCRS with related protein sequences.
Table SJ Information for the ClustalW proteins:
1) GPCRS (SEQ ID N0:19) 1 S 2) gi~129091~sp~P23267~OLF6_RAT OLFACTORY RECEPTOR-LIKE PROTEIN F6 (SEQ ID
N0:63) 3) gi~6754932~ref~NP_035121.1 ~ olfactory receptor 49 Mus musculus (SEQ ID
N0:64) 4) gi~7242165~ref~NP_035113.1 ~ olfactory receptor 41 Mus musculus (SEQ ID
N0:65) 5) gi~7363437~ref~NP 039229.1 olfactory receptor, family 10, subfamily C, member 1 Homo Sapiens (SEQ ID N0:66) 6) gi~12007431~gb~AAG45202.1~AF321236_1 m50 olfactory receptor Mus musculus (SEQ ID N0:67) .I....I....I....I....I....I....I...ol.o..l....l....l....l GPCR5 -MSPDGN S DP ' LNSA E S~ ~ N T G RADT Q
Gi11290911 MAWSTGQ L TPGP I 'GPRS-R L= rv T' S GAHRC Q
Gi I 67549321 ---- S T': LSDACE~~_ ~ L T I L ~FLVDR Y
Gi172421651 --MERRN TGR~IS PAP FS _ TE F~T~RNHPT HK
Gi17363437W- - ~ SHLAD - S. TI ~ T STD Q
Gi1120074311 ----=MEI~N S 'TAP S FT ;FV~LE ' LT VTGS HK

I....I....I....I I....1....1....1....1....1....1....1 GPCR5 ~G~IN~SRQH----T~F I . FF~~FL
Gi I 129091 I ~C ~ ACS T 'T PRGG--- L ~'~ FS~C~YF

GiI67549321 F - I TNI 'TGHK----T LL FL ~~L F T FF

Gi172421651 ~ ~VT T-' GSEENHGQL FE ~~ L C CV
Gi173634371 RTE G T 'L~ HHL TGRR----H RS L~~ LF CC
Gi1120079311 , ST I T ' ~ ~°FRPN----T FL S C CV

.I....I....I....I....I....I....I....lo...l....l....l....l GPCR5 t~ H' '~ G F$tV~LAC LVPV,~~,GPTV WAL P KQGA
Gi11290911 ~' L' ' GG PG ~L 'C FSAITVPATL S S-R
GiI67599321 ~S m ~.,. K ~ FC _S LLLI PSSI QP P-Gi172921651 W H' H S ~~' FG S KVFL S- P-Gi173634371 ~ E' ' L~ H '~ ~GS C VL~ ~GHTP FS P P-Gi1120074311 ~' '~TG TIS S FTS KVY R~ N-.1....1....1....1....1.. .1....1....1 ...1....1....1....1 GPCR5 ~s~a~ ~S ' ~ T KKL ETD ''SL a 'SS~LL L S ' S
_ Cdr gi 1 1290911 S -' T~ Q~ LVS ~' FC -' GSCG L . Y T I~~ ~ R
giI67599321 N '~E I FL ~ FS' GT TC H Y~» H ' K

gi172421651 T ~ S'm N ~ T~ T LTD ~-~~I GP S G TG .
gi173639371 T P E ~ N LQIITAL 1 CPFGIL A
gi1120074311 ~" S'~TVD~IVFP~SADVL S ' T

.I....I....I....I....I....o....l....l....l....l....l....l v _ ~ . v.
' V 1' W
GPCR5 I T ' '~ '-SQSG ~ - R-TT '~
giI 1290911 'Hrv,~~ ~ T L s T T-SVES LILT ~ '~' NTs' T
~+
I~ 'a ~ N
gi 1 67549321 E' S I 5 = ~ ,S GQG ~H ~ ~H - T 'T T
gi172421651 H ~ T I S ~ LSn ~ V Y ~ 'I C
gi173634371 ~ I S' ~ x.._" SYDPP~.P ,y.- FY ~ 'I S
gi1120074311 T m IAS ~I Y ~ 'I C

.I.. .1....1....1....1....1....1..
GPCRS ' E DMFRKVVAGVLGNLLLDKCLSEKAVK
gi11290911 ' _ ~ 'R~7KGK-___________________ gi167549321 'EH SKFQKFSQT-------------=vr gi172421651 HLAQGQDANTKKSSRDG------gi173634371 ' T QKTVPMEI---------------gi1120D74311 D~~'~~ ~ GGRAPALGESIS----------DOMAIN results for GPCRS were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST. This BLAST samples domains found in the Smart and Pfam collections. The results are listed in Table SK with the statistics and domain description.
Residues 1-115 of 7tm_1 (SEQ ID N0:45) are aligned with GPCRS 43-156 (E = 1e-20), in Table SK. Residues 314-377 of 7tm 1 also have identity with residues (E=2e-OS) of GPCRS.
Table SK. DOMAIN results for GPCRS
gnllPfamlpfam00001, 7tm 1, 7 transmembrane receptor (rhodopsin family) (SEQ ID NO: 45) Length = 377 Statistics for GPCRS: Score = 93.6 bits (231), Expect = 1e-20 1....1....1....1 ...1....I... I ...1....1....1....1....1 GPCRS ~RF~'~PMY~F~G_ CLI T SNFR~HT~FA~ITQ
TM7 "~C~S K TTN L l1YLE= G~WK~RIH DIF
.I....I....I....I....I....1....1....1..../....1....1....1 GPCRS FYFYF~EF~~L~<pCH' R~PLLM-~GAVCFRALA~GGLI-----TM7 VTLDV T SI~~C ° I ~' T ~ L~TRYS~KRRVTV IAI~LSFTISCPM

The nucleic acids and proteins of GPCRS are useful in potential therapeutic applications implicated in various GPCR-related pathological disorders and/or OR-related pathological disorders, described further below. For example, a cDNA encoding the GPCR
(or olfactory-receptor) like protein may be useful in gene therapy, and the receptor -like protein may be useful when administered to a subject in need thereof. The nucleic acids and proteins of the invention are also useful in potential therapeutic applications used in the treatment of infections such as bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm;
adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright Hereditary Ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome and/or other pathologies and disorders. Other GPCR-related diseases and disorders are contemplated.
The polypeptides can be used as immunogens to produce antibodies specific for the invention, and as vaccines. They can also be used to screen for potential agonist and antagonist compounds. For example, a cDNA encoding the GPCR-like protein may be useful in gene therapy, and the GPCR-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm; adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright Hereditary Ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome and/or other pathologies and disorders. The novel nucleic acid encoding GPCR-like protein, and the GPCR-like protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed. These materials are further useful in the generation of antibodies that bind immunospecifically to the novel substances of the invention for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-GPCRX
Antibodies" section below. This novel protein also has value in development of powerful assay system for functional analysis of various human disorders, which will help in understanding of pathology of the disease and development of new drug targets for various disorders.

The disclosed novel GPCR6 nucleic acid of 948 nucleotides (also referred to as 6-L-19-C) is shown in Table 6A. An open reading begins with an ATG initiation codon at nucleotides 7-9 and ends with a TAG codon at nucleotides 940-942. A putative untranslated region upstream from the initiation codon and downstream from the termination codon are underlined in Table 6A, and the start and stop codons are in bold letters.
Table 6A. GPCR6 Nucleotide Sequence (SEQ ID N0:24) GGAGACATGGGCAAGGAAAACTGCACCACTGTGGCTGAGTTCATTCTCCTTGGACTATCAGATGTCCCTG
AGTTGAGAGTCTGCCTCTTCCTGCTGTTCCTTCTCATCTATGGAGTCACGTTGTTAGCCAACCTGGGCAT
GATTGCACTGATTCAGGTCAGCTCTCGGCTCCACACCCCCATGTACTTTTTCCTCAGCCACTTGTCCTCT
GTAGATTTCTGCTACTCCTCAATAATTGTGCCAAAAATGTTGGCTAATATCTTTAACAAGGACAAAGCCA
TCTCCTTCCTAGGGTGCATGGTGCAATTCTACTTGTTTTGCACTTGTGTGGTCACTGAGGTCTTCCTGCT
GGCCGTGATGGCCTATGACCGCTTTGTGGCCATCTGTAACCCTTTGCTATACACAGTCACCATGTCTTGG
AAGGTGCGTGTGGAGCTGGCTTCTTGCTGCTACTTCTGTGGGACGGTGTGTTCTCTGATTCATTTGTGCT
TAGCTCTTAGGATCCCCTTCTATAGATCTAATGTGATTAACCACTTTTTCTGTGATCTACCTCCTGTCTT
AAGTCTTGCTTGCTCTGATATCACTGTGAATGAGACACTGCTGTTCCTGGTGGCCACTTTGAATGAGAGT
GTTACCATCATGATCATCCTCACCTCCTACCTGCTAATTCTCACCACCATCCTGAAGATGGGCTCTGCAG
AGGGCAGGCACAAAGCCTTCTCCACCTGTGCTTCCCACCTCACAGCTATCACTGTCTTCCATGGAACAGT
CCTTTCCATTTATTGCAGGCCCAGTTCAGGCAATAGTGGAGATGCTGACAAAGTGGCCACCGTGTTCTAC
ACAGTCGTGATTCCTATGCTGAACTCTGTGATCTACAGCCTGAGAAATAAAGATGTGAAAGAAGCTCTCA
GAAAAGTGATGGGCTCCAAAATTCACTCCTAGGGAAGA
The disclosed nucleic acid sequence has 617 of 915 bases (67%) identical to a G.
gallus cor4 olfactory receptor 4 DNA (GENBANK-ID: GGCOR4GEN~acc:X94744) (E
value = 8.7e-65).
The GPCR6 protein encoded by SEQ ID N0:24 has 318 amino acid residues, and is presented using the one-letter code in Table 6B (SEQ ID N0:25). The SignalP, Psort and/or Hydropathy profile for GPCR6 predict that GPCR6 has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6000. The SignalP shows a signal sequence is coded for in the first 41 amino acids, i.e., with a cleavage site at the slash in the sequence TLL-AN, between amino acids 40 and 41. This is typical of this type of membrane protein.

Table 6B. Encoded GPCR6 protein sequence (SEQ ID N0:25).
MGKENCTTVAEFILLGLSDVPELRVCLFLLELLIYGVTLL/ANLGMIALIQVSSRLHTPMYFFLSHLSSVD
FCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCVVTEVFLLAVMAYDRFVAICNPLLYTVTMSWKV
RVELASCCYFCGTVCSLIHLCLALRIPFYRSNVINHFFCDLPPVLSLACSDITVNETLLFLVATLNESVT
IMIILTSYLLILTTILKMGSAEGRHKAFSTCASHLTAITVFHGTVLSIYCRPSSGNSGDADKVATVFYTV
VIPMLNSVIYSLRNKDVKEALRKVMGSKIHS
The full amino acid sequence of the protein of the invention was found to have 166 of 307 amino acid residues (54%) identical to, and 217 of 307 residues (70%) positive with, the 314 amino acid residue human olfactory receptor-like protein OLF1 (ptnr:SWISSPROT-ACC:Q13606) (E value = 5.8e-86) The GPCR6 target sequence identified previously (6 L-19 C) was subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached.
The cDNA coding for the sequence was cloned by polymerase chain reaction (PCR) using the following primers: CACTGTGGCTGAGTTCATTCTCCTT (SEQ ID N0:26) and TCTTCCCTAGGAGTGAATTTTGGAGC (SEQ ID N0:27) on the following pool of human cDNAs: Pool 1 - Adrenal gland, bone marrow, brain - amygdala, brain -cerebellum, brain -hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Primers were designed based on in silico predictions for the full length or part (one or more exons) of the DNA/protein sequence of the invention or by translated homology of the predicted exons to closely related human sequences or to sequences from other species. Usually multiple clones were sequenced to derive the sequence which was then assembled similar to the SeqCalling process. In addition, sequence traces were evaluated manually and edited for corrections if appropriate.
The PCR product derived by exon linking was cloned into the pCR2.1 vector from Invitrogen. The bacterial clone 55446::6 L-19 C.698018.M1 has an insert covering the entire open reading frame cloned into the pCR2.1 vector from Invitrogen.
Usually the resulting amplicons were gel purified, cloned and sequenced to high redundancy. The resulting sequences from all clones were assembled with themselves, with other fragments in CuraGen Corporation's database and with public ESTs.
Fragments and ESTs were included as components for an assembly when the extent of their identity with another component of the assembly was at least 95% over 50 bp. In addition, sequence traces were evaluated manually and edited for corrections if appropriate. These procedures provide the sequence reported below, which is designated Accession Number CG50383_O1 which does not differ from GPCR6 (6 L-19 C) in amino acid or nucleotide sequence.
The disclosed GPCR6-Olfactory Receptor-like protein is expressed in at least the following tissues: Apical microvilli of the retinal pigment epithelium, arterial (aortic), basal forebrain, brain, Burkitt lymphoma cell lines, corpus callosum, cardiac (atria and ventricle), caudate nucleus, CNS and peripheral tissue, cerebellum, cerebral cortex, colon, cortical neurogenic cells, endothelial (coronary artery and umbilical vein) cells, palate epithelia, eye, neonatal eye, frontal cortex, fetal hematopoietic cells, heart, hippocampus, hypothalamus, leukocytes, liver, fetal liver, lung, lung lymphoma cell lines, fetal lymphoid tissue, adult lymphoid tissue, tissues that express MHC II and III, nervous tissue, medulla, subthalamic nucleus, ovary, pancreas, pituitary, placenta, pons, prostate, putamen, serum, skeletal muscle, small intestine, smooth muscle (coronary artery in aortic) spinal cord, spleen, stomach, taste receptor cells of the tongue, testis, thalamus, and thymus tissue. This information was derived by determining the tissue sources of the sequences that were included in the invention including but not limited to SeqCalling sources, Public EST sources, Literature sources, and/or RACE sources.
The disclosed GPCR6 protein (SEQ ID N0:25) has good identity with a number of olfactory receptor proteins. The identity information used for ClustalW
analysis is presented in Table 6C. The GPCR6 protein has significant identity to olfactory receptor (OR) proteins:
Table 6C. BLAST
results for Gene Index/ Protein/ OrganismLengthIdentityPositivesExpect Identifier (aa) Gi157299601ref~NPOR fam. 5, 314 159/307 200/307 2e-72 _ subfam. I, (50~) (64~) 06628.11 mem 1 Homo Sapiens Gi124950541spIQ9515OR-like prt 311 152/308 207/308 8e-70 510LF2 CANFA Canis familiaris (99~) (66$) Gi1116925191gbIAAG3OR 41, K11 314 150/308 199/308 8e-69 9B56.11AF282271 Mus musoulus (98~) (63~) (AF282271) Gi137464431gbIAAC63OR, OR93ch 314 151/306 199/306 1e-68 969.1 (AF045577)Pan troglodytes (99~) (64$) Gi137464481gbIAAC63OR OR93Gib 313 149/305 198/305 3e-68 971.11 (AF095580)Hylobates (98~) (64~) lar This information is presented graphically in the multiple sequence alignment given in Table 6D (with GPCR6 being shown on line 1) as a ClustalW analysis comparing with related protein sequences.
Table 6D Information for the ClustalW proteins:
1) GPCR6 (SEQ ID N0:25) 2) gi~5729960~ref]NP_006628.1 ~ OR, family 5, subfamily I, member 1 Homo Sapiens (SEQ ID N0:25) 3) gi~2495054~sp~Q95155~OLF2_CANFA OR-LIKE PROTEIN OLF2 (SEQ ID N0:25) 4) gi~11692519Igb~AAG39856.1~AF282271_1 odorant receptor K11 Mus musculus (SEQ
ID N0:25) 5) gi~3746443~gb~AAC63969.1~ olfactory receptor OR93Ch [Pan troglodytes] (SEQ
ID N0:25) 6) gi~3746448~gb~AAC63971.1~ olfactory receptor OR93Gib [Hylobates lar] (SEQ
ID N0:25) .. .I_.__I....1....I....1....1....1....1....1....1....1....1 GPCR6 ---~GK C T L ~'D ~~ ~ C GI', _VS
g1157299601 -MEFTD L L FPT T-~ ISI ~ LL~'~ 3 PH Q
g1124950591 --- DG CAS N ~N G~ T T I ~ I~V
g1111692519 MND TS~ CT ~E'~~ P G T GS H
g1137464931 -- N~ FT~YN~TT~T
g1 l 37464481 -- N FT YNIIa T- Si~~T

.1.. .1.. .1.. .I.. .I.. .1.. .I.. .1.. .I.. .1.. .I.. .I
GPCR6 Sn m~ Iw ~ ~IFND ~L ~ F L.CTC ~T
g1157299601 L ~ D V~ V LS ~Y ~ F CT DT S
g1124950541 S IAN ~ P YS ~, L CT D L
g11116925191 S ~ T~ T KNI P T L LI I
g1137464431 ~~ ~ SF~ L ~ Q G
g1137464481 I S~ T~ F L N Q G

.I....I....1....1....1....1....1....1....1....1....1....1 1' GPCR6 ~ ~ m T C ~R~E SCC FC aC s' I LCL ~ L P YRS
g1 1 57299601 ~ ~ RG~G LS = S ' S ~ I K , D
g1124950541 m~ S ~ F Si S~tSL "~ ~ D.'SV ILT - C~ ES
g1 I 116925191 ~ ~ T Y ~Yr ~ S ~ C' S ' GFM ~' KL
g1137464431 ,~ ~ Q P :~~~TN~ ' P GP
g1137464981 ~~ S Q "jV P ~T TN~ - P GL

.1.. .1.. .I.. .I.. .1....1.. .I.. .1.. .1.. .I.. .I.. .I
GPCR6 ~ WP S g ~ S IT ~ T '~~LATLNES.aT.II~ TT ~_-,~ ~ ~H
g1157299601 ~ P~ N T~ T~' ~.STYGSSVE°CF I a:= F, $. ~ FS
g1124950541 ~ P~ L S S~ Q 'V'~T~FGFIE-I SG~3 C~, T~A~~ N
g11116925191 m L~ ~ ~N Y~; LFFGTLNI ~-PI T ~I~ - ~ T S
g1 I 37464931 n S S - ~ I~AGAAG~ ~~~.,; ~ ~ C
1137464481 n"S S I GAVG G ~ C

.1.. .1.. .I.. .I.. .1.. .I.. .1.. .I.. .I.. .I.. .1.. .I
GPCR6 ~T ,, H , LS ~C~ ~GN v ~T ~ S
g1157299601 T~. S T~L S~~ yL' P.T. T . T
g1 124950541 L ~ S W - I~I ~ S
g1 l 116925191 S L~ ~,~ S $ L~~ ~ VS n S ~ T
g1137464431 T S yLY S ~ L
g1137464981 T S FLY 5 P~ L7 ~, .I.. .I.. .I..
GPCR6 ~~ GS IHS-Y
&~
g1157299601 E :--RS DSS-gi124950541 rv~wKN y H--gi I 116925191 ~~~~K~ E
g1137469431 H T T CKA
g1 I 37464981 H T ~T,' CKA

The presence of identifiable domains in GPCR6 was determined by searches using algorithms such as PROSITE, Blocks, Pfam, ProDomain, Prints and then determining the Interpro number by crossing the domain match (or numbers) using the Interpro website (http:www.ebi.ac.uk/interpro~.
DOMAIN results for GPCR6 were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST. This BLAST samples domains found in the Smart and Pfam collections. The results are listed in Table 6E with the statistics and domain description. The results indicate that this protein contains the 7tm-1 (InterPro) 7 transmembrane receptor (rhodopsin family) (as defined by Interpro) at residues 42-203, which align with residues 2-158 of the 7TM domain. This indicates that the sequence of GPCR6 has properties similar to those of other proteins known to contain this/these domains) and similar to the properties of these domains.
Table 6E. DOMAIN results for GPCR6 gnl~Pfamlpfam00001, 7tm 1, 7 transmembrane receptor (rhodopsin family) Length = 377 (SEQ ID N0:45).
Score = 86.3 bits (212), Expect = 2e-18 .. .I.. .1....1.. .I.. .1.. .I.. .1.. .1.. .I.. .I.. .1.. .I
TM7R6 G~~L~CQREKA~Q~TTN~L~...SS~, 9~LLY,S~I~I3~ ~ ~YLE~V~VG~WKf~R~H~D~Q
.I....I....1....1....1....1....1....1....1....1....1....1 GPCR6 FY.FCTCVVTE'FL Y ' ~,RCN ,~ TVT E~AS-CC FCGTVC LIH
TM7 VT~DVMMCTAS LNBC ~~IT~ TRY S R~' T'r~~TMIAI LSFTI~CPM
..I....I....I....I....1....~....1.. .I.. .1....I.. .1....1 GPCR6 .CL-ALRIPFYR--------SNVINHFFCDLPPV-- L LA .DITVNETLL~ A ---TM7 ~FGLNNTDQNE--------CIIANP--------AFVVY~SIV~FYV----PFI TLLVYI
The similarity information for the GPCR6 protein and nucleic acid disclosed herein suggest that GPCR6 may have important structural and/or physiological functions characteristic of the Olfactory Receptor family and the GPCR family.
Therefore, the nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount of the nucleic acid or the protein are to be assessed, as well as potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), and (v) a composition promoting tissue regeneration in vitro and in vivo (vi) biological defense weapon. The novel nucleic acid encoding GPCR6, and the GPCR6 protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed.
The nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications implicated in various diseases and disorders described below and/or other pathologies. For example, the compositions of the present invention will have efficacy for treatment of patients suffering from: developmental diseases, MHCII and III diseases (immune diseases), taste and scent detectability disorders, Burkitt's lymphoma, corticoneurogenic disease, signal transduction pathway disorders, retinal diseases including those involving photoreception, cell growth rate disorders; cell shape disorders, feeding disorders; control of feeding; potential obesity due to over-eating; potential disorders due to starvation (lack of appetite), noninsulin-dependent diabetes mellitus (NIDDM1), bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm; adenocarcinoma; lymphoma;
prostate cancer;
uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright hereditary ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation dentatorubro-pallidoluysian atrophy(DRPLA) hypophosphatemic rickets, autosomal dominant (2) acrocallosal syndrome and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome and/or other pathologies and disorders of the like.
The polypeptides can be used as immunogens to produce antibodies specific for the invention, and as vaccines. They can also be used to screen for potential agonist and antagonist compounds. For example, a cDNA encoding the OR -like protein may be useful in gene therapy, and the OR-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to Neoplasm; adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright hereditary ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome and/or other pathologies and disorders.
The novel nucleic acid encoding OR-like protein, and the OR-like protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed.
These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel GPCR6 substances for use in therapeutic or diagnostic methods.
These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-GPCRX Antibodies"
section below. In one embodiment, a contemplated GPCR6 epitope is from about as 225 to 240. In another embodiment, a GPCR6 epitope is from about as 255 to 275. In additional embodiments, GPCR6 epitopes are from as 280 to 310.

A novel GPCR nucleic acid was identified by TblastN using CuraGen Corporation's sequence file for GPCR probes or homologs, and run against the Genomic Daily Files made available by GenBank. The nucleic acid was further predicted by the program GenScanTM, including selection of exons. These were further modified by means of similarities using BLAST searches. The sequences were then manually corrected for apparent inconsistencies, thereby obtaining the sequences encoding the full-length protein. The disclosed novel GPCR7 nucleic acid of 1013 nucleotides (also referred to as dj313i6 D) is shown in Table 7A. An open reading begins with an ATG initiation codon at nucleotides 5-7 and ends with a TAG
codon at nucleotides 997-999. A putative untranslated region upstream from the initiation codon and downstream from the termination codon are underlined in Table 7A, and the start and stop codons are in bold letters.
Table 7A. GPCR7 Nucleotide Sequence (SEQ ID N0:28) TACAATGGAAAGAGCTAACGACAGCACCTTCTCTGGATTCATCCTCCTGGGCTTCTCCAACAGGCCTCAGCTGGAAAC
AGCTCTCTTTGTGGTCATCTTGATCATCTACTTTCTGAGCTTTCTGGGCAATGGCACCATTATACTTTTATCCATTGT
AGATCCTCGCCTCCATACCCCTATGTATTTCTTCCTCTCCAATCTCTCTTTTATGGATCTTTGTTTGACCACTTGTAC
TGTCCCTCAGACACTGGTCAACTTTAAGGGGAAGGACAAGACCATCACCTATGGTGGCTGCGTGACCCAGCTATTCAT
TGCCTTGGGACTCGGGGGGGGAGTGGAGTGTGTCTTATTGTCTGCCATGGCCTATGACCGCTATGCAGCCGTCTGCCG
CCCACTCCACTACATGGTGAGCATGCATCCCCAACTTTGCTTGCAGTTGGTTGTAACCACTTGGCTCACAGGGTTTGG
CAATTCTGTGATACAGACAGCATTGACCATGACTCTCCCCCTCTGTGATAAAAACCAAGTGGATCATTTCTTCTGTGA
AGTTCCAGTGATGCTGAAACTGTCCTGCACCAACACCTCCATCAACGAGGCTGAAATCTTTGCTGTCAGTGTCTTCTT
CTTGGTGGTGCCTCTCTCACTCATCTTAGCATCCTATGGTCACATTACTCATGCAGTCCTGAAGATAAAGTCAGCTCA
AGGGAGGCAGAAGGCTTTTGGAACCTGTGGTTCTCACCTCCTGGTAGTGATCATTTTCTTTGGGACACTCATCTCCAT
GTACCTCCAGCCTCCCTCCAGTTATTCACAGGATGTGAACAAAAGCATTGCACTCTTCTATACTCTGGTGACTCCTCT
ACTGAATCCCCTAATTTACACTCTGAGGAACAAGGAAGTCAAAGGGGCAACTAAGAAGACTAGTGGGGAGGACCATAG
ATGCATGAGAAAGTTAACGCAGGGTTTGCAGTTCCAAACATTTGTGCACTAGAAGACTGCTGAGAAGCTACAAACTA

The disclosed nucleic acid sequence has 615 of 939 bases (65%) identical to a Homo Sapiens olfactory receptor-like protein (OR2C1) gene (GENBANK-ID: AF098664) (E
value =
1.7e-6').
The GPCR7 protein encoded by SEQ ID N0:28 has 327 amino acid residues, and is presented using the one-letter code in Table 7B (SEQ ID N0:29). The SignalP, Psort and/or Hydropathy profile for GPCR7 predict that GPCR7 has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6000. The SignalP shows a signal sequence is coded for in the first 44 amino acids, i.e., with a cleavage site at the slash in the sequence GNG-TI, between amino acids 43 and 44. This is typical of this type of membrane protein.
Table 7B. Encoded GPCR7 protein sequence (SEQ ID N0:29).
MERANDSTFSGFILLGFSNRPQLETALFVVILIIYFLSFLGNG/TIILLSIVDPRLHTPMYFFLSNL
SFMDLCLTTCTVPQTLVNFKGKDKTITYGGCVTQLFIALGLGGGVECVLLSAMAYDRYAAVCRPLHY
MVSMHPQLCLQLVVTTWLTGFGNSVIQTALTMTLPLCDKNQVDHFFCEVPVMLKLSCTNTSINEAEI
FAVSVFFLVVPLSLILASYGHITHAVLKIKSAQGRQKAFGTCGSHLLVVIIFFGTLISMYLQPPSSY
SQDVNKSIALFYTLVTPLLNPLIYTLRNKEVKGATKKTSGEDHRCMRKLTQGLQFQTFVH
The full amino acid sequence of the protein of the invention was found to have 183 of 304 amino acid residues (60%) identical to, and 229 of 304 residues (75%) positive with, the 313 amino acid residue OL1 receptor protein from Rattus norvegicus (ptnr:SPTREMBL-ACC:Q63394) (E value = 2.6e-9'). Further BLAST analysis produced the significant results listed in Table 7C. The disclosed GPCR7 protein (SEQ m N0:29) has good identity with a number of olfactory receptor proteins.
Table 7C. BLAST
results for Gene Index/ Protein/ LengthIdentityPositivesExpec Identifier Organism (aa) (~) (~) t gi1111779061refINPOR 313 168/304 209/304 2e-86 68632.11 (L34079)Rattus (55~) (680) norve icus gi1109445161embICACInovel 7 TM 313 169/304 207/309 2e-85 -OR

4158.11 (AL133267)family (hS6M1- (55$) (67~) dJ408B20.2 32) Homo Sapiens gi1120544111embICAC2OR 41, K11 357 166/304 206/309 1e-83 0513.11 (AJ302593)Homo Sapiens (54~) (67~) gi1120543931embICAC2OR 357 165/304 206/304 4e-83 0504.11 (AJ302589Homo Sapiens (54~) (67$) -592) gi130804671embICABI1OR 310 165/304 206/304 4e-83 427.11 (Z98744) Homo Sapiens (54~) (67~) The presence of identifiable domains in GPCR7 was determined by searches using algorithms such as PROSITE, Blocks, Pfam, ProDomain, Prints and then determining the Interpro number by crossing the domain match (or numbers) using the Interpro website (http:www.ebi.ac.uk/interpron.
DOMAIN results for GPCR7 were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST. This BLAST samples domains found in the Smart and Pfam collections. The results are listed in Table 7E with the statistics and domain description. The results indicate that this protein contains the following protein domains (as defined by Interpro) at the indicated positions: domain name 7tm 1 (InterPro) transmembrane receptor (rhodopsin family). Residues 61-142 of 7tm_1 (SEQ ID
N0:45) are aligned with GPCR7 41-180 (E = Se-18) in Table 7E. Residues 307-377 of 7tm-1 also have identity with residues 222-291 (E=0.001) of GPCR7. This indicates that the sequence of GPCR7 has properties similar to those of other proteins known to contain this/these domains) and similar to the properties of these domains.
Table 7E. DOMAIN results for GPCR7 gnl~Pfamlpfam00001, 7tm 1, 7 transmembrane receptor (rhodopsin family) Length = 377 (SEQ ID N0:45).
Score = 85.1 bits (209), Expect = Se-18 .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I
TM7R~ ~1L~CAVSRKA~Q~TTN L~5 ~V ~ L'T LV~VYLEVVGWKE'~RIF~VDIF
.1....I....1....1....I....I....1....1....1....1.._..1....1 TM7R7 T ~ D :GjtCTASILN~C,~~DRYT~VAMPNI~NTRYSSKP - TW~FTI~CP
.I....I....I....I....I....1....1....1....1....1....1....1 GPCR7 QT. T LP--L--------CD QVDHFFC-----------------------------TM7 LFG~NN~DQNE--------CIIA~P--------AFVVYSSIVSFYV----PFIVTLLVYI
The similarity information for the GPCR7 protein and nucleic acid disclosed herein suggest that GPCR7 may have important structural and/or physiological functions characteristic of the Olfactory Receptor family and the GPCR family.
Therefore, the nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount of the nucleic acid or the protein are to be assessed, as well as potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), and (v) a composition promoting tissue regeneration in vitro and in vivo (vi) biological defense weapon. The novel nucleic acid encoding GPCR7, and the GPCR7 protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed.
The nucleic acids and proteins of the invention are useful in potential therapeutic applications implicated in used in the treatment of infections such as bacterial, fungal, protozoa) and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to Neoplasm; adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright hereditary ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome andlor other pathologies and disorders.
The disclosed GPCR7 polypeptides can be used as immunogens to produce antibodies specific for the invention, and as vaccines. They can also be used to screen for potential agonist and antagonist compounds. For example, a cDNA encoding the GPCR-like protein may be useful.in gene therapy, and the GPCR-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from bacterial, fungal, protozoa) and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm; adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright hereditary ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome and/or other pathologies and disorders. The novel nucleic acid encoding GPCR-like protein, and the GPCR-like protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed. These materials are further useful in the generation of antibodies that bind immunospecifically to the novel substances of the invention for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-GPCRX
Antibodies" section below.

A novel nucleic acid was identified on chromosome 6 by TblastN using CuraGen Corporation's sequence file for GPCR probes or homologs and , run against the Genomic Daily Files made available by GenBank. The nucleic acid was further predicted by the program GenScanTM, including selection of exons. These were further modified by means of similarities using BLAST searches. The sequences were then manually corrected for apparent inconsistencies, thereby obtaining the sequences encoding the full-length protein. The disclosed novel GPCR8 nucleic acid of 958 nucleotides (also referred to as dj408b20 A) is shown in Table SA. An open reading begins with an ATG initiation codon at nucleotides 4-6 and ends with a TGA codon at nucleotides 955-957. A putative untranslated region upstream from the initiation codon and downstream from the termination codon are underlined in Table 8A, and the start arid stop codons are in bold letters.
Table 8A. GPCR8 Nucleotide Sequence (SEQ ID N0:30) _GCAATGGAAAAATCCAATGTCAGCTCAGTGTATGGTTTTATCTTGGTGGGTTTCTCTGATCGTCCCAAGCTG
GAGATGGTGCTCTTTACAGTAAATTTTATTCTGTATTCAGTGGCTGTGCTGGGAAATTCAACCATAATCC
TTGTGTGTATATTAGACTCTCAACTTCATACCCCAATGTACTTCTTTCTGGCAAATCTTTCCTTTCTAGA
TCTCTGCTTCAGTACTAGTTGCATCCCACAAATGCTGGTAAACCTCTGGGGCCCTGACAAGACTATTAGC
TGTGCTGGCTGTGTTGTCCAGCTTTTCTCTTTCCTTTCTGTCAGGGGAATTGAGTGCATCCTTCTGGCTG
TCATGGCCTATGACAGCTATGCTGCAGTCTGCAAACCGTTGCGCTATCTGGTCATTATGCACCTCCAGCT
GTGTCTAGGACTGATGGCTGCAGCCTGGGGGAGTGGACTGGTCAATGCCGTTGTCATGTCACCACTAACA
ATGACCCTCTCCAGAAGTGGCCGCCGCCGAGTTAACCATTTCCTCTGTGAAAAGCCAGCACTGATCAAGA
TGGCTTGTTTGGATGTTCGTGCAGTGGAAATGCTGGCTTTTGCTTTTGCCGTTCTCATTGTCCTACTGCC
CCTCACTCTTATTCTTGTCTCCTACGGCTACATTGCTGCAGCTGTGCTAAGCATCAAGTCAGCTGCCAGG
CAATGGAAGGCCTTCCATACCTGTAGCTCTCACCTCACAGTGGTCTCCCTGTTTTATGGGAGCATCATCT
ATATGTATATGCAGCCAGGAAACAGTTCTTCCCAAGACCAAGGCAAGTTTCTCACTCTCTTCTACAACCT
GGTGACTCCTATGTTGAATCTGCTCATCTATACTTTAAGGAATAAGGAGGTGAAAGGAGCACTGAAGAAG
GTTTTGGGGAGGCAAAATGAACTGGAGAAATATGATAAGTTGTGAA
The disclosed nucleic acid sequence has 768 of 1148 bases (66%) identical to a Homo Sapiens OR-like (gb:GENBANK-ID:HS88J8~acc:AL035402 Human DNA sequence from clone 88J8 on chromosome 6p21.31-21.33. Contains a gene for a novel 7 transmembrane receptor (rhodopsin family) (olfactory receptor like) protein, pseudogene similar to olfactory receptor genes and a GTP binding protein SARA (mouse) pseudogene. Contains ESTs, an STS and GSS, complete sequence - Homo Sapiens, 47216 bp.) (E value = 1.3e 81).
The GPCR8 protein encoded by SEQ ID N0:30 has 317 amino acid residues, and is presented using the one-letter code in Table 8B (SEQ ID N0:31). The SignalP, Psort and/or Hydropathy profile for GPCR8 predict that GPCR8 has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6850. The SignalP shows a signal sequence is coded for in the first 42 amino acids, i.e., with a cleavage site at the slash in the sequence VLG-NS, between amino acids 41 and 42. This is typical of this type of membrane protein.
Table 8B. Encoded GPCR8 protein sequence (SEQ ID N0:31).
MEKSNVSSVYGFILVGFSDRPKLEMVLFTVNFILYSVAVLG/NSTIILVCILDSQLHTPMYFFLANLSF
LDLCFSTSCIPQMLVNLWGPDKTISCAGCVVQLFSFLSVRGIECILLAVMAYDSYAAVCKPLRYLVIMH
LQLCLGLMAAAWGSGLVNAVVMSPLTMTLSRSGRRRVNHFLCEKPALIKMACLDVRAVEMLAFAFAVLI
VLLPLTLILVSYGYIAAAVLSIKSAARQWKAFHTCSSHLTWSLFYGSIIYMYMQPGNSSSQDQGKFLT
LFYNLVTPMLNLLIYTLRNKEVKGALKKVLGRQNELEKYDKL
The full amino acid sequence of the protein of the invention was found to have 187 of 305 amino acid residues (61%) identical to, and 239 of 305 residues (78%) positive with, the 320 amino acid residue novel transmembrane receptor (rhodopsin family, OR-like, HS6M1-15) protein from Homo Sapiens (ptnr:SPTREMBL-ACC:Q9Y3N9) (E value = 2.4e-log).
Further BLAST analysis produced the significant results listed in Table 8C.
The disclosed GPCR8 protein (SEQ ID N0:31) has good identity with a number of olfactory receptor proteins.
Table 8C. BLAST
results for Gene Index/ Protein/ OrganismLengthIdentitPositivesExpect Identifier (aa) y ($) ($) Gi148265211embICAB42novel 7 tm 320 177/305226/305 5e-92 853.11 receptor protein (58~) (79~) (AL035402, dJ88J8.1)(rhodopsin fam., (AJ302594-99) OR-like) (AJ302600-O1) (hs6Ml-15) Homo Sapiens Gi112059431)embICAC2OR 320 176/305226/305 1e-91 0523.11 (AJ302603)Homo Sapiens (57~) (73$) Gi1120544291embICAC2OR 320 177/305225/305 1e-91 0522.11 (AJ302602)Homo Sapiens (58~) (73~) 03 OR 15 (0R3) 312 166/307211/307 2e-81 Gi166791701refINP

_ Mus musculus (54~) (68~) 2788.11 Gi1122310291spIQ1506OR 2H3 316 163/306208/306 5e-81 2102H3 HUMAN Homo Sapiens (53$) (67~) This information is presented graphically in the multiple sequence alignment given in Table 8D (with GPCR8 being shown on line 1) as a ClustalW analysis comparing with related protein sequences.

Table 8D. Information for the ClustalW proteins:
1) GPCRB (SEQ ID N0:31) 2) gi~4826521 ~emb~CAB42853.1 ~ dJ88J8. l (novel 7 TM receptor (rhodopsin family) (OR like) protein) (hs6M1-15)) Homo Sapiens (SEQ ID N0:59) 3) gi~12054431~emb~CAC20523.1~ olfactory receptor Homo Sapiens (SEQ ID N0:60) 4) gig 12054429~emb~CAC20522.1 ~ olfactory receptor Homo Sapiens (SEQ ID
N0:61) 5) gi~6679170~ref~NP_032788.1 ~ olfactory receptor 15 Mus musculus (SEQ ID
N0:58) 6) gi~12231029~sp~Q15062~02H3 HUMAN OR 2H3 (OR-LIKE PRT FAT11) (SEQ ID N0:56) .I....I....I....I....I....1....1....1....1....1....1....1 V
GPCRB FT L S Y ~T CST ~
~i V !h Y
Gi l 48265211 A~~ Y °' Y S
Gi1120544311 _~ Y ~ ' ~ S
GiI120544291 ~~~ Y _ S
Gi166791701 D N SGT H~ FF LAS LT L ~
Gi1122310291 -MD TP E G~ RT F FTS L L ~P S~

.I....I....I....I....I....I....I....I....I.~..I....I....1 GPCRB ~ S C ~ '~ C '~'~ ~S y S,, R I
L
Gi148265211 I ~ ~ I
gi1120544311 ~ I '~ ISO
gi1120544291 ~ I - .~ ;~ ° , gi166791701 S S ~ S'~ '~ ~ ~ = T
gi I 122310291 S ~ C ~ S IE'~i. = S T T

.I....I....I..~.I....I...~1....1....1....1....1....1....1 GPCR8 S ' L L G GS SP ~'T SRS RR
1148265211 ~ T z rn~H I~~~I I S S ~C T '"NI°'~~

g11120544311 T ~ ~H I I 5 S ~C 'T Ie g11120544291 ~ ~T ~ 'H n I I S~S C 'T ~NI'~
g1166791701 '...~ ~ ~' L G, S LG QS - t g11122310291 V T S, E QTPS PRQ D

.I....I....I....I....I....1....1.~..1....1....1....1....1 GPCR8 K~~ I R~ y L ~F L' T ~ SI
g1198265211 A Z ~ T 1S G ;I T~ I I~ ~_ 'T KeS ' gi112054431j I ~ T 5 GI T~ I 3 ~;~ T K~S ' g11120549291 I ~ 'T S G T I ~ ' 'T S
g1166791701 I ~ ~ ~LN VIG CTFFT ~'S-' C ~ ~_ h EG ' g11122310291 ' I ~~ E ~YN Q~AVAS' S TW~ IN KG ' F

.1.. .I.. .I.. .I.. .I.. .I.. .I.. .1.. ~I.. .I.. ~I.. .I
GPCR8 ~ S ~ S ~ w ~ M.- ~ L
g1 1 9826521: .- . >, m T ~ " D
g11120549311 ~~ ~ ~~~~ ~ I ~ ~~ D
g11120549291 m I, D
g1166791701 F= L~ KS S 5 g11122310291 S Sft- K~PY - F TR

.I.. .I.. .1....I
GPCR8 GRQ: LE~YD~,L---gi148265211 ~ RFH' T I,'~~1~,',', CKS
g11120549311 RFH T IKNCKS
g1 1120549291 ~ FH T I.N.ItliINCKS
91166791701 G~ GKGRG------AS--gi1122310291 F,~ = KERD RCS AA--I~
The presence of identifiable domains in GPCR8 was determined by searches using algorithms such as PROSITE, Blocks, Pfam, ProDomain, Prints and then determining the Interpro number by crossing the domain match (or numbers) using the Interpro website (http:www.ebi.ac.uklinterpro~.

DOMAIN results for GPCR8 were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST. This BLAST samples domains found in the Smart and Pfam collections. The results are listed in Table 8E with the statistics and domain description. The results indicate that GPCR8 contains the 7tm_1 (InterPro) 7 transmembrane receptor (rhodopsin family)domain (as defined by Interpro) at amino acid positions residues 41-170. This indicates that the sequence of GPCR8 has properties similar to those of other proteins known to contain this/these domains) and similar to the properties of these domains.
Table 8E. DOMAIN results for GPCR8 gnllPfamlpfam00001, 7tm 1, 7 transmembrane receptor (rhodopsin family) Length = 377 (SEQ ID N0:95).
Score = 85.9 bits (211), Expect = 3e-18 .1....1....1....1 .1....1..._.1....1 ...1....1....1....1 TM7R$ ~e VL C~VSR~KA~Q~TTNL L~ LV~LVW _ YLEVVG~WKF~RIH~D~F
~....1....1....1....1....1....1....1 I....I....1....~
TM7R$ TL~CTASIN~CAIBS T~ C ~ L~NTRYSSKRVTG ~'I GLSFTICP~
....I....i....I....I....I....1....1....1....1....1....1....1 GPCRB SPL-T LSRSG-_____-_________________-_______________-_____--The similarity information for the GPCR8 protein and nucleic acid disclosed herein suggest that GPCR8 may have important structural and/or physiological functions characteristic of the Olfactory Receptor family and the GPCR family.
Therefore, the nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount of the nucleic acid or the protein are to be assessed, as well as potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), and (v) a composition promoting tissue regeneration in vitro and in vivo (vi) biological defense weapon. The novel nucleic acid encoding GPCRB, and the GPCR8 protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed.
The disclosed GPCR8 nucleic acids and proteins of the invention are useful in potential therapeutic applications implicated in neoplasm; adenocarcinoma; lymphoma;
prostate cancer;
uterus cancer; immune response; AIDS; asthma; Crohn's disease; multiple sclerosis; and treatment of Albright hereditary ostoeodystrophy and/or other pathologies and disorders. For example, a cDNA encoding the GPCR-like protein may be useful' in gene therapy, and the GPCR-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from neoplasm; adenocarcinoma; lymphoma;
prostate cancer;
uterus cancer; immune response; AIDS; asthma; Crohn's disease; multiple sclerosis; and treatment of Albright hereditary ostoeodystrophy. The novel nucleic acid encoding GPCR-like protein, and the GPCR-like protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed. These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel GPCR8 substances for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-GPCRX
Antibodies" section below.

A novel nucleic acid was identified on chromosome 11 by TblastN using CuraGen Corporation's sequence file for GPCR probe or homolog, run against the Genomic Daily Files made available by GenBank. The nucleic acid was further predicted by the program GenScanTM, including selection of exons. These were further modified by means of similarities using BLAST searches. The sequences were then manually corrected for apparent inconsistencies, thereby obtaining the sequences encoding the full-length protein. The disclosed novel GPCR9 nucleic acid of 946 nucleotides (also referred to as 6-L-19-B) is shown in Table 9A. An open reading begins with an ATG initiation codon at nucleotides 5-7 and ends with a TAA codon at nucleotides 932-934. A putative untranslated region upstream from the initiation codon and downstream from the termination codon are underlined in Table 9A, and the start and stop codons are in bold letters.
In a search of sequence databases, it was found, for example, that the nucleic acid sequence has 563 of 902 bases (62%) identical to (E= 8.5e-47) a Mus musculus gene for odorant receptor A16 (GENBANK-ID: GENBANK-ID:AB030896~acc:AB030896). In a search of sequence databases, partial matches (353 of 373 bases, 94%
identical) were also identified with the nucleotides 1- 372 of GPCR9 identical with nucleotides 306-678 of a Homo Sapiens GPCR EST (GENBANK-ID: GENBANK-ID: AW182678~acc:AW182678;
xj45d11.x1 Soares NFL T GBC S1 Homo Sapiens cDNA clone IMAGE:2660181 3' similar to TR:Q9Z1V0 Q9Z1V0 OLFACTORY RECEPTOR C6). This 94% match (E=l.le-69) between regions of the public sequence and regions of the present invention (gene) suggests that the present invention (gene) could be a splice variant of the public GPCR
EST (partial mRNA). This also supports identification of GPCR9 as a GPCR. In a search of sequence databases, partial matches (94 of 100 bases, 94% identical) of nucleotides 893-794 of GPCR9 with nucleotides 251-348 of a Homo Sapiens GPCR EST (GENBANK-ID:
AA206680~acc:AA206680: zq51c1l.rl Stratagene neuroepithelium (#937231) Homo Sapiens cDNA clone IMAGE:645140 5' similar to contains Ll.b2 L1 repetitive element).
This 94%
match between nucleotides of the public sequence and nucleotides of the GPCR9 sequence suggests that GPCR9 may be a splice variant of the public GPCR EST (partial mRNA).
Table 9A. GPCR9 Nucleotide Sequence (SEQ ID N0:32) GTTCATGGAAAATAGGAATATTGTCACTGTCTTTATTCTCCTGGGACTTTCTCAAAACAAGAACATTGAA
GTTTTTTGGTTTGTATTATTTGTATTTTGCTACATTGCTATTTGGATGGAAAACTTCATCATAATGATTT
CTATCATGTACATTTGGCTAATTGACCAACCCATGTATTTCTTCCTTAATTACCTCGCACTCTCAGATCT
TTGCTACATATCCACTGTGGCCCCCAAGCTAATGATTGACCTACTAACAGAAAGGAAGATCGTTTCCTAT
AATAACTGCATGATACAGCTATTTATCACTCACTTCCTTGGAGACATTGAGATCTTCATACTCAAAGCAA
TGGCCTATGACCACTACATAGCCATCTGCAAGCACCTGCACTACACCATCATCACGACCAAGCAAAGCTG
TAACACCATCATCATAGCTTGTTGTACTGGGGGATTTATACACTCTGCCAGTCAGTTTCTTCTTACCATC
TTCTTACCGTTCTGTGGTCTTAATGAGATAGATCAGTACTTCTGCTATGTGTATCCTCTGCTGAAGTTGG
CTCGCATTGATATATACAGAATTGGTTTCTTGGTAATTGTTAATTCAGGCCTGATTTCTTTGTTGGCTTT
TGTGATTTTGATGGTGTCTTATTATTTGATATTATCCACCATCAGGGTTTACTCTGCTGAGAGTCATACC
AAAGCTCTTTCAACCTGTAGCTCTCACATAATAGTTGTGGTCCTATTCTTTGTGCCTGCCCTCTTCATTT
ACATCAGACCAGCCATAACTTTTCCAGAAGATAAAGTGTTTGTTCTCTTCTGTGCCATCATTGCTCCCAT
GTTCAGTCTTCTTATCTACATGCTGAGAAAGGTGGAGATGAAGAACGCTGTAAGGAAAATGTGGTGTCAT
CAATTGCTTCTGGCAAGGAAGTAACTTGTATGAAAG
The GPCR9 protein encoded by SEQ ID N0:32 has 309 amino acid residues, and is presented using the one-letter code in Table 9B (SEQ ID N0:33). The SignalP, Psort and/or Hydropathy profile for GPCR9 predict that GPCR9 has a signal peptide and is likely to be localized at the endoplasmic reticulum membrane with a certainty of 0.6850 or to the plasma membrane with a certainty of 0.6400. The SignalP predicts a cleavage site at the sequence IWM-EN between amino acids 38 and 39 as indicated by the slash in Table 9B.
Table 9B. Encoded GPCR9 protein sequence (SEQ ID N0:33) MENRNIVTVFILLGLSQNKNIEVFWFVLFVFCYIAIWM/ENFIIMISIMYIWLIDQPMYFFLNYLALSDLC
YISTVAPKLMIDLLTERKIVSYNNCMIQLFITHFLGDIEIFILKAMAYDHYIAICKHLHYTIITTKQSCN
TIIIACCTGGFIHSASQFLLTIFLPFCGLNEIDQYFCYVYPLLKLARIDIYRIGFLVIVNSGLISLLAEV
ILMVSYYLILSTIRVYSAESHTKALSTCSSHIIVWLFFVPALFIYIRPAITFPEDKVFVLFCAIIAPMF
SLLIYMLRKVEMKNAVRKMWCHQLLLARK
The full amino acid sequence of the protein of the invention was found to have 140 of 300 amino acid residues (46%) identical to, and 193 of 300 residues (64%) positive with, the 302 amino acid residue odorant receptor A16 protein from Mus musculus (ptnr:TREMBLNEW-ACC:BAA86127) (E value = 1.0e-72). Further BLAST analysis produced the significant results listed in Table 9C. The disclosed GPCR8 protein (SEQ ID
N0:33) has good identity with a number of olfactory receptor proteins.
S
Table 9C. BLAST
results for Gene Index/ Protein/ LengthIdentityPositivesExpect Identifier Organism (aa) (~) Gi1114962491refINP_odorant receptor308 140/300 185/300 1e-59 067343.11 MOR18 Mus (46~) (61~) (AB030895) musculus Gi1114649951refINP_odorant receptor302 137/300 185/300 2e-59 065261.11 AB030896)A16 Mus musculus (45~ (61~) Gi14237021pirIIS297olfactory 307 142/303 186/303 6e-57 receptor OR1B (46~) (60~) -rat Gi1114699931refINP_odorant receptor308 133/297 182/297 7e-55 065260.11 MOR83 Mus (44~) (60~) (AB030894) musculus Gi1106495191gbIAAG2odorant receptor264 124/262 169/262 6e-51 1324.11AF271051Mus musculus (47~) (64$) (AF271051) This information is presented graphically in the multiple sequence alignment given in Table 9D (with GPCR9 being shown on line 1) as a ClustalW analysis comparing with related protein sequences.
Table 9D. Information for the ClustalW proteins:
1) GPCR9 (SEQ ID N0:33) 2) gi~11496249~ref~NP_067343.1~ odorant receptor 16 Mus musculus (SEQ ID
N0:78) 3) gi~11464995~ref~NP_065261.1~ gene for odorant receptor A16 Mus musculus (SEQ ID N0:79) 4) giI423702~pir~~S29710 olfactory receptor OR18 - rat (SEQ ID N0:80) 5) gig 11464993~ref~NP_065260.1 ~ gene for odorant receptor MOR83 Mus musculus (SEQ ID N0:81) 6) gi~10644519~gb~AAG21324.1~AF271051_1 odorant receptor Mus musculus (SEQ ID
N0:70) .I....I....I....I....I....1....1....1....1....1....1....1 GPCR9 --~ENRNI I~ KN V FC IW E ~S" ' IWL D ' 1' Gi I 114962491 --i iEIPHN ~ RPE ~YL ~';~ C ~rt S
Gi 1119649951 -- DSPRN . P L G r"°tl I~T ~ P-.
6i14237021 -- GENNN= I PDGRKAL ~ ~, L ~I P-I~
Gi 1119699931 MGALNQT I mD VIP T T y ~~P;~H
Gi1106445191 _________________________~C ~ :P ~ ~ I K

.I....I....I....I....I....1....1....1....1....1....1....1 GPCR9 ~ Y _LS~L I T I~ T I NN 'I~ IT FL DI Fg~L
Gi1114962491 FW T S ~S Y GT ° ,"~~ G FL G
Gi1114649951 aY F T C T' S H~G" LL GT
Gi14237021 S L L. S~ ~ Y~_ IE L G
611106945191 Y L~~IL~ TV~ FTC N~I P~~~~ FL FFF~VT m .I....I....I....I....I....1....1....1....1....1....1....1 GPCR9 . H ~ I H IT~QS T '~,~~IACCT ~ S FL TL E ~0- Y
gi1114962491 ~ TT ~ H V y L IF
v gi I 119649951 TT YI~H" ' V _~ I ' T
gi14237021 ~' L - ~T IF T T ~ FVYN ~ ~ ~I
gi1106945191 ~~ ' I T ~~PL H~~~ T~T~P ~ ~ ;S

.I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .1....I.. .I
GPCR9 ~RI~I1 ~ S~ ~ ~Y_ S ~ ~ SHT
N
gi1114962991 .,Y~ ~ m - _ ~ C c~ I H~c~S.
gi1114699951 ~ ' E ' ~ ~ ~ C N I ~S
gi I 423702 I , V ' ~ ~ T I~',, "~NCi ~I T ~ G'T
gi1119699931 P~ ~~ ' ~ T I~IVS T~S "-C T T ~K ~ w gi 1106995191 ~ ~ ~ :FU~~4: F ~FSFS 'S~I Y a ~

.I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I.. .I
I ~ ~ ~i ~ v N v GPCR9 ~~I' I ' I~F~PE~ FVv' C ' FL K ~_ ~,~;K
gi1114962491 G FT T S ''ST LP ~ ~ D~ K
U N
gi1114649951 G' FT I ~~~ LS ~ V C " ~ N
gi14237021 ~ I' I , ~ ' YN P C T T ~ ~ S ~ SC K
gi1114649931 ~ F T m T~'D 6. 5 ~ T -- !7 T~ H
gi1106445191 ~5 I~= ~ ~ ~ TE T~

.1....I.
GPCR9 ~,,CHQLLLARK
gi1114962491 ~SEVVGA
gi1114699951 ----gi14237021 C LHAD-gi1119649931 R . RICS--gi1106445191 ----------The presence of identifiable domains in GPCR9 was determined by searches using algorithms such as PROSITE, Blocks, Pfam, ProDomain, Prints and then determining the Interpro number by crossing the domain match (or numbers) using the Interpro website (http:www.ebi.ac.uk/interpro~.
DOMAIN results for GPCR9 were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST. This BLAST samples domains found in the Smart and Pfam collections. The results are listed in Table 9E with the statistics and domain description. The results indicate that GPCR9 contains the 7tm 1 (InterPro) 7 transmembrane receptor (rhodopsin family)domain (as defined by Interpro) at amino acid positions residues 56-234. This indicates that the sequence of GPCR9 has properties similar to those of other proteins known to contain this/these domains) and similar to the properties of these domains.

Table 9E. DOMAIN results for GPCR9 gnl~Pfam~pfam00001, 7tm 1, 7 transmembrane receptor (rhodopsin family) Length = 377 (SEQ ID N0:45).
Score = 73.6 bits (179), Expect = 1e-14 ....1....1....1....1.. .1.. .1....1.. .I.. .I....1.. .1.. .I
GPCR9 -----------PMYF~NY~CYI~TIDLERKI~YN~Q
TM7 GNVLVCMAVSREKALQTTTNY~L S LV L Ta YLE GEWK RI D F
....I....I....I....1....I....1....1....1....1....1....1....1 TM7R9 T DVI~CTAS~LN~CI~tFt~T CKPL~I~RYRVTVAIVWVLS~TI~CPM
.I....I....I....1....1....1....1....1....1....1....1....1 GPCR9 FLL-TIFLPFCGLNEIDQYFCYVY~LLKLARIDIRGFL---VI~SGLIS- F ~ L
TM7 LFGLNNTDQNE--------CIIAN~--------A V YSSIVSFY ----PF TL , .1....I.. .I.. .1....1....1....1....1....1....1..../....1 GPCR9 VS~Y ~ LSTI~VY~ASH;,,~-________________________________-_____ TM7 KI I ~-RRR RV T RS FRANLKAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRV
The similarity information for the GPCR9 protein and nucleic acid disclosed herein suggest that GPCR9 may have important structural and/or physiological functions characteristic of the Olfactory Receptor family and the GPCR family.
Therefore, the nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount of the nucleic acid or the protein are to be assessed, as well as potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), and (v) a composition promoting tissue regeneration in vitro and in vivo (vi) biological defense weapon. The novel nucleic acid encoding GPCR9, and the GPCR9 protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed.
The nucleic acids and proteins of the invention are useful in potential therapeutic applications implicated in used in the treatment of infections such as bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm; adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright hereditary ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome and/or other pathologies and disorders.
The polypeptides can be used as immunogens to produce antibodies specific for the invention, and as vaccines. They can also be used to screen for potential agonist and antagonist compounds. For example, a cDNA encoding the GPCR-like protein may be useful in gene therapy, and the GPCR-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm; adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright hereditary ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome andlor other pathologies and disorders. The novel nucleic acid encoding GPCR-like protein, and the GPCR-like protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed.
These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel GPCR9 substances for use in therapeutic or diagnostic methods.
These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-GPCRX Antibodies"
section below.

GPCR10 includes a family of three similar nucleic acids and three similar proteins disclosed below. The disclosed nucleic acids encode GPCR, OR-like proteins.
GPCRIOa The disclosed novel nucleic acid was identified on chromosome 11 by TblastN
using CuraGen Corporation's sequence file for GPCR probe or homolog, run against the Genomic Daily Files made available by GenBank. The nucleic acid was further predicted by the program GenScanTM, including selection of exons. These were further modified by means of similarities using BLAST searches. The sequences were then manually corrected for apparent inconsistencies, thereby obtaining the sequences encoding the full-length protein. GPCRIOa is a 948 by long nucleic acid (also referred to as 6-L-19-A) as shown in Table 10A (SEQ ID
N0:34). An ORF begins with an ATG initiation codon at nucleotides 7-9 and ends with a TAA codon at nucleotides 934-936. A putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 10A, and the start and stop codons are in bold letters.
Table 10A. GPCRIOa Nucleotide Sequence (SEQ ID N0:34) TGAGAAATGGAAAATCAAAACAATGTGACTGAATTCATTCTTCTGGGTCTCACAGAGAACCTGGAGCTGT
GGAAAATATTTTCTGCTGTGTTTCTTGTCATGTATGTAGCCACAGTGCTGGAAAATCTACTTATTGTGGT
AACTATTATCACAAGTCAGAGTCTGAGGTCACCTATGTATTTTTTTCTTACCTTCTTGTCCCTTTTGGAT
GTCATGTTCTCATCTGTCGTTGCCCCCAAGGTGATTGTAGACACCCTCTCCAAGAGCACTACCATCTCTC
TCAAAGGCTGCCTCACCCAGCTGTTTGTGGAGCATTTCTTTGGTGGTGTGGGGATCATCCTCCTCACTGT
GATGGCCTATGACCGCTACGTGGCCATCTGTAAGCCCCTGCACTACACGATCATCATGAGTCCACGGGTG
TGCTGCCTAATGGTAGGAGGGGCTTGGGTGGGGGGATTTATGCACGCAATGATACAACTTCTCTTCATGT
ATCAAATACCCTTCTGTGGTCCTAATATCATAGATCACTTTATATGTGATTTGTTTCAGTTGTTGACACT
TGCCTGCACGGACACCCACATCCTGGGCCTCTTAGTTACCCTCAACAGTGGGATGATGTGTGTGGCCATC
TTTCTTATCTTAATTGCGTCCTACACGGTCATCCTATGCTCCCTGAAGTCTTACAGCTCTAAAGGGCGGC
ACAAAGCCCTCTCTACCTGCAGCTCCCACCTCACGGTGGTTGTATTGTTCTTTGTCCCCTGTATTTTCTT
GTACATGAGGCCTGTGGTCACTCACCCCATAGACAAGGCAATGGCTGTGTCAGACTCAATCATCACACCC
ATGTTAAATCCCTTGATCTATACACTGAGGAATGCAGAGGTGAAAAGTGCCATGAAGAAACTCTGGATGA
AATGGGAGGCTTTGGCTGGGAAATAACTGCAATGCTGA
The GPCRIOa protein encoded by SEQ ID N0:34 has 309 amino acid residues, and is presented using the one-letter code in Table lOB (SEQ ID N0:35). The SignalP, Psort and/or Hydropathy profile for GPCRIOa predict that GPCRlOa has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6000. The SignalP
predicts a cleavage site at the sequence VLE-NL, between amino acids 39 and 40, as indicated by the slash in Table 10B.
In a search of sequence databases, it was found, for example, that the nucleic acid sequence has 625 of 908 bases (68%) identical to a 909 by Mus musculus gene for odorant receptor A16 mRNA (GENBANK-ID: AB030896~acc:AB030896) (E= 3.0e-75).
Table 10B. Encoded GPCRIOa protein sequence (SEQ ID N0:35).
MENQNNVTEFILLGLTENLELWKIFSAVFLVMYVATVLE/NLLIVVTIITSQSLRSPMYFFLTFLSLLDVM
FSSWAPKVIVDTLSKSTTISLKGCLTQLFVEHFFGGVGIILLTVMAYDRYVAICKPLHYTIIMSPRVCC
LMVGGAWVGGFMHAMIQLLFMYQIPFCGPNIIDHFICDLFQLLTLACTDTHILGLLVTLNSGMMCVAIFL
ILIASYTVILCSLKSYSSKGRHKALSTCSSHLTVVVLFFVPCIFLYMRPVVTHPIDKAMAVSDSIITPML
NPLIYTLRNAEVKSAMKKLWMKWEALAGK
The full amino acid sequence of the protein of the invention was found to have 183 of 302 amino acid residues (60%) identical to, and 232of 302 residues (76%) positive with, the 307 amino acid residue OR18 odorant receptor protein from Rattus sp.(ptnr:
TREMBLNEW-ACC:G264618).
GPCRIOb GPCRIOa (6-L-19-A) was subjected to an exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer.
In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such suitable sequences were then employed as the forward and reverse primers in a PCR
amplification based on a wide range of cDNA libraries. The resulting amplicon was gel purified, cloned and sequenced to high redundancy to provide GPCRIOb, which is also referred to as 6-L-19-A 1.
The nucleotide sequence for GPCRIOb (948 bp, SEQ ID N0:36) is presented in Table l OC. The nucleotide sequence differs from GPCRIOa by one nucleotide change (numbered with respect to GPCRIOa) T404 >C.
Table 10C. GPCRIOb Nucleotide Sequence (SEQ ID N0:36) TGAGAAATGGAAAATCAAAACAATGTGACTGAATTCATTCTTCTGGGTCTCACAGAGAACCTGGAGCTGTGGAAAATAT
T
TTCTGCTGTGTTTCTTGTCATGTATGTAGCCACAGTGCTGGAAAATCTACTTATTGTGGTAACTATTATCACAAGTCAG
A
GTCTGAGGTCACCTATGTATTTTTTTCTTACCTTCTTGTCCCTTTTGGATGTCATGTTCTCATCTGTCGTTGCCCCCAA
G
GTGATTGTAGACACCCTCTCCAAGAGCACTACCATCTCTCTCAAAGGCTGCCTCACCCAGCTGTTTGTGGAGCATTTCT
T
TGGTGGTGTGGGGATCATCCTCCTCACTGTGATGGCCTATGACCGCTACGTGGCCATCTGTAAGCCCCTGCACTACACG
A
TCACCATGAGTCCACGGGTGTGCTGCCTAATGGTAGGAGGGGCTTGGGTGGGGGGATTTATGCACGCAATGATACAACT
T
CTCTTCATGTATCAAATACCCTTCTGTGGTCCTAATATCATAGATCACTTTATATGTGATTTGTTTCAGTTGTTGACAC
T
TGCCTGCACGGACACCCACATCCTGGGCCTCTTAGTTACCCTCAACAGTGGGATGATGTGTGTGGCCATCTTTCTTATC
T
TAATTGCGTCCTACACGGTCATCCTATGCTCCCTGAAGTCTTACAGCTCTAAAGGGCGGCACAAAGCCCTCTCTACCTG
C
AGCTCCCACCTCACGGTGGTTGTATTGTTCTTTGTCCCCTGTATTTTCTTGTACATGAGGCCTGTGGTCACTCACCCCA
T
AGACAAGGCAATGGCTGTGTCAGACTCAATCATCACACCCATGTTAAATCCCTTGATCTATACACTGAGGAATGCAGAG
G
TGAAAAGTGCCATGAAGAAACTCTGGATGAAATGGGAGGCTTTGGCTGGGAAATAACTGCAATGCTGA
The encoded GPCRIOb protein is presented in Table l OD. The disclosed protein is 309 amino acids long and is denoted by SEQ ID N0:37. GPCRIOb differs from GPCRlOa by one amino acid residues: I133>T. Like GPCRIOa, the Psort profile for GPCRIOb predicts that this sequence has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6000. The most likely cleavage site for a peptide is between amino acids 39 and 40, i.e., at the slash in the amino acid sequence VLE-NL (shown as a slash in TablelOD) based on the SignalP result.

Table 10D. Encoded GPCRIOb protein sequence (SEQ ID N0:37) MENQNNVTEFILLGLTENLELWKIFSAVFLVMYVATVLE/NLLIWTIITSQSLRSPMYFFLTFLSLLD
VMFSSWAPKVIVDTLSKSTTISLKGCLTQLFVEHFFGGVGIILLTVMAYDRYVAICKPLHYTITMSPR
VCCLMVGGAWVGGFMHAMIQLLFMYQIPFCGPNIIDHFICDLFQLLTLACTDTHILGLLVTLNSGMMCV
AIFLILIASYTVILCSLKSYSSKGRHKALSTCSSHLTVWLFFVPCIFLYMRPVVTHPIDKAMAVSDSI
ITPMLNPLIYTLRNAEVKSAMKKLWMKWEALAGK
Table 10E presents the BLASTP results for GPCRIOb.
Table 10E. BLASTP Results for GPCRIOb Score = 999 (351.7 bits), Expect= 1.2e-100, P = 1.2e-100 Identities = 182/302 (60%), Positives =
231/302 (76%) with PIR-ID:S29710 olfactory receptor OR18 - rat Score = 757 (266.5 bits), Expect = 5.2e-75, P = 5.2e-75 Identities = 144/298 (48%), Positives =
200/298 (67%) with ACC:095013 WiJGSC:H_DJ0855D21.1 PROTEIN - Homo Sapiens lHumanl. 312 aa.
Score = 757 (266.5 bits), Expect = 5.2e-75, P = 5.2e-75 Identities = 144/298 (48%), Positives =
200/298 (67%) with ACC:095013 WUGSC:H DJ0855D21.1 PROTEIN - Homo Sapiens (Human), 312 aa.
Score = 667 (234.8 bits), Expect = 1.1e-64, P = 1.1e-64 Identities = 131/300 (43%), Positives =
194/300 (64%), Frame =+1 with ACC:043749 OLFACTORY RECEPTOR - Homo Sapiens (Human), 312 aa.
GPCRIOc Another nucleotide sequence resulted when GPCRIOa (6-L-19-A) was subjected to an exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such suitable sequences were then employed as the forward and reverse primers in a PCR amplification based on a wide range of cDNA
libraries.
These primers were then employed in PCR amplification based on the following pool of human cDNAs: adrenal gland, bone marrow, brain - amygdala, brain -cerebellum, brain -hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Usually the resulting amplicons were gel purified, cloned and sequenced to high redundancy. The resulting sequences from all clones were assembled with themselves, with other fragments in CuraGen Corporation's database and with public ESTs. Fragments and ESTs were included as components for an assembly when the extent of their identity with another component of the assembly was at least 95% over 50 bp.

In addition, sequence traces were evaluated manually and edited for corrections if appropriate.
The resulting amplicon was gel purified, cloned and sequenced to high redundancy to provide the sequence reported below, which is designated as Accession Number 6-L-19-A-dal, or GPCRl Oc.
The nucleotide sequence for GPCRIOc (943 bp, SEQ ID N0:38) is presented in Table IOF. The GPCRIOc nucleotide sequence differs from GPCRIOa by having six fewer nucleotides at the 5' end and two nucleotide changes: (numbered with respect to GPCRIOa) .
6466>A and C834>T.
Table 10F. GPCRIOc Nucleotide Sequence (SEQ ID N0:38) ATGGAAAATCAAAACAATGTGACTGAATTCATTCTTCTGGGTCTCACAGAGAACCTGGAGCTGTGGAAAA
TATTTTCTGCTGTGTTTCTTGTCATGTATGTAGCCACAGTGCTGGAAAATCTACTTATTGTGGTAACTAT
TATCACAAGTCAGAGTCTGAGGTCACCTATGTATTTTTTTCTTACCTTCTTGTCCCTTTTGGATGTCATG
TTCTCATCTGTCGTTGCCCCCAAGGTGATTGTAGACACCCTCTCCAAGAGCACTACCATCTCTCTCAAAG
GCTGCCTCACCCAGCTGTTTGTGGAGCATTTCTTTGGTGGTGTGGGGATCATCCTCCTCACTGTGATGGC
CTATGACCGCTACGTGGCCATCTGTAAGCCCCTGCACTACACGATCATCATGAGTCCACGGGTGTGCTGC
CTAATGGTAGGAGGGGCTTGGGTGGGGGGATTTATGCACACAATGATACAACTTCTCTTCATGTATCAAA
TACCCTTCTGTGGTCCTAATATCATAGATCACTTTATATGTGATTTGTTTCAGTTGTTGACACTTGCCTG
CACGGACACCCACATCCTGGGCCTCTTAGTTACCCTCAACAGTGGGATGATGTGTGTGGCCATCTTTCTT
ATCTTAATTGCGTCCTACACGGTCATCCTATGCTCCCTGAAGTCTTACAGCTCTAAAGGGCGGCACAAAG
CCCTCTCTACCTGCAGCTCCCACCTCACGGTGGTTGTATTGTTCTTTGTCCCCTGTATTTTCTTGTACAT
GAGGCCTGTGGTCACTCACCCCATAGACAAGGCAATGGCTGTGTCAGACTCAATCATTACACCCATGTTA
AATCCCTTGATCTATACACTGAGGAATGCAGAGGTGAAAAGTGCCATGAAGAAACTCTGGATGAAATGGG
AGGCTTTGGCTGGGAAATAACTGCAATGCTGA
The coding region of GPCRIOc is from nucleotide 1 to 928, giving the encoded GPCRIOc protein, as presented in Table 10G. The disclosed protein is 309 amino acids long and is denoted by SEQ ID NO: 83. GPCRIOc differs from GPCRIOa by one amino acid residue: A154>T. Like GPCRIOa, the Psort profile for GPCRSc predicts that this sequence 1 S has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0.6000. The most likely cleavage site for a peptide is between amino acids 39 and 40, i.e., at the slash in the amino acid sequence VLE-NL (shown as a slash in TablelOG) based on the SignalP result.
Table 10G. Encoded GPCRIOc protein sequence (SEQ ID N0:83) MENQNNVTEFILLGLTENLELWKIFSAVFLVMYVATVLE/NLLIVVTIITSQSLRSPMYFFLTFLSLLDVM
FSSVVAPKVIVDTLSKSTTISLKGCLTQLFVEHFFGGVGIILLTVMAYDRYVAICKPLHYTIIMSPRVCC
LMVGGAWVGGFMHTMIQLLFMYQIPFCGPNIIDHFICDLFQLLTLACTDTHILGLLVTLNSGMMCVAIFL
ILIASYTVILCSLKSYSSKGRHKALSTCSSHLTVVVLFFVPCIFLYMRPVVTHPIDKAMAVSDSIITPML
NPLIYTLRNAEVKSAMKKLWMKWEALAGK
Possible SNPs found for GPCR10 are listed in TablelOH.

Table IOH:
SNPs Base Base Base Position Before After 65 T A(2) 120 T Gap(2) 147 T C(2) 234 A G(3) 412 T C(7) 471 G A(2) 814 A G(3) The disclosed GPCR10 protein (SEQ ID N0:35) has good identity with a number of olfactory receptor proteins. The identity information used for ClustalW
analysis is presented in Table 10I. Unless specifically addressed as GPCRIOa GPCRIOb, or GPCRIOc, any reference to GPCR10 is assumed to encompass all variants. Residue differences between any GPCRX variant sequences herein are written to show the residue in the "a"
variant and the residue position with respect to the "a" variant. GPCR residues in all following sequence alignments that differ between the individual GPCR variants are highlighted with a box and marked with the (o) symbol above the variant residue in all alignments herein.
For example, the protein shown in line 1 of Table l OJ depicts the sequence for GPCRIOa, and the positions where GPCRIOb or GPCRIOc differs are marked with a (o) symbol and are highlighted with a box. All GPCR10 proteins have significant homology to olfactory receptor (OR) proteins:
Table 10I. BLAST
results for GPCR10 Gene Index/ Protein/ Length IdentityPositivesExpect Identifier Organism (aa) (~) ($) Gi111496249~refINP_0Odorant 308 184/306 291/306 6e-91 67343.11 (AB030895)receptor (60~) (78~) Mus musculus Gi1423702~pirIIS2971OR OR18 307 183/302 232/302 2e-88 - rat 0 (60$) (760) Gi1119649951ref~NP_0Odorant 302 175/302 232/302 8e-86 65261.11 AB030896)receptor (57~) (75~) Mus musculus Gi1114649931refINPOdorant 308 157/297 208/297 3e-72 _ receptor (52~) (69~) 65260.11 (AB030894)MOR83 Mus musculus Gi1106445171gbIAAG21Odorant 264 155/260 202/260 2e-71 323.1~AF271050_1 receptor (59~) (77~) (AF271050) Rattus norvegicus This information is presented graphically in the multiple sequence alignment given in Table lOJ (with GPCR10 being shown on line 1) as a ClustalW analysis comparing with related protein sequences.
Table lOJ Information for the ClustalW proteins:
1) GPCR10 (SEQ ID N0:35) 2) gi~11496249~ref)NP_067343.1~ odorant receptor 16 Mus musculus (SEQ ID
N0:78) 3) gi~423702~pir~~S29710 olfactory receptor OR18 - rat (SEQ ID N0:80) 4) gig 11464995 ~ref)NP_065261.1 ~ gene for odorant receptor A 16 Mus musculus (SEQ ID N0:79) . 5) gi~11464993~ref)NP_065260.1 ~ gene for odorant receptor MOR83 Mus musculus (SEQ ID N0:81) 6) gi~10644517~gb~AAG21323.1~AF271050_1 odorant receptor Rattus norvegicus (SEQ ID N0:82) ..I.. .I.. .I.. .I.. .1....I.. .1.. .1.. .1.. .I.. .1.. .I
GPCR10 .ENQ I' ~T~ LE - FS ~E 7 IT .
gi1119962491 iEIP QRPEQ - L ~ I . C ~ T S
gi I 423702 I GEN t - I T(;~ PDG L I F T~ ~ i I P
_ . I, gi I 119699951 iDSP - F~,PQ~Q z L G ~~r'I,VS ~ ~~ 'T~P
gi 1119699931 GAL QT I D VEI3 P T T ~~~ V~P
gi1106995171 _________________________'-C ~ P', NI

.I....I....I....I....I....1....1....1....1....1....1....1 GPCR10 L m ~T S~ ST L~T~ E 3 ,.~
gi1119962491 .~N F~ TC'- S ~ ~S ~:~GT ' Y ~' G FL
gi19237021 S L=~ L- S' ~ ~L ; Q~,/ ~5~ IE L
gi 111464995 I Y F ~TCC~T' ,~ ~S ~~ R~~~~LL T~ I ~
gi1114649931 m IC T EGL L DN I~~~ FL L CS I ~
gi1106445171 Y L. IL T T~L I, L F T

.I....I....o....I....I....I....lo...l....l....l....l....l GPCR10 IP CL~ G ' I L Y~ T
gi 1114962491 ~ ~ . TT~ H' ~ ~ ~ L - F, gi14237021 - ~' LAT -I T T V YN
gi I 114649951 ~' TTi F~~H I ' T FaL9L> ' gi 111464993,1 ~ I' ~N"~ KAL ~ T~ TF,~~TI ' ~ ~Sj, gi1106445171 ~ T ~~P H GTIP ~ ' I

.I....I....I....I....I....1....1....1....1....1....1....1 GPCR10 ~ F ~ T Hy~ TL ~ I I ,I°"~ T ,~ ,_ 'H
gi111496249j Y' ~ I
gi14237021 S' ~ ~ T ~ Tp G
gi1114649951 Y ~ ~ I ~ L I ~ ~
gi I 114649931 P ~ T ~ ,~~ T~S~; C , T T K
gi1106945171 ~H ~ F x F S FP ~ I

.I....i....I....I....I....l....l....l..._1....1....1....1 GPCR10 ~~~LT ' ~ HP ~ SDI ' S K
gi l 119962491 G ~ FT T S ~ "SLP ~ ~ ~ ' E D~ t~K
gi14237021 ~ IL Iv ' YNFP ~ C~T ~ ' ' S ~ SC~ K
gi1114649951 G FT ~ ~':SLS ~ I ~ C ' N
gi1114649931 F T ~ T' D FS yY~ ' E T~ H
gi1106945171 ~ I - BYTE L ~~ ~ __________ .I....1.
GPCR10 ~~~-;WEALAGK
gi1119962491 T SEVVGA-gi14237021 ~C~~ LHAD--gi1114649951 ------gi1114649931 RQ~RICS---gi1106445171 --- -------The presence of identifiable domains in GPCR10 was determined by searches using algorithms such as PROSITE, Blocks, Pfam, ProDomain, Prints and then determining the Interpro number by crossing the domain match (or numbers) using the Interpro website (http:www.ebi.ac.uk/interpro~.
DOMAIN results for GPCR10 were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST. This BLAST samples domains found in the Smart and Pfam collections. The results are listed in Table lOK with the statistics and domain description. The results indicate that this protein contains the following protein domains (as defined by Interpro) at the indicated positions: domain name 7tm 1 (InterPro) transmembrane receptor (rhodopsin family) at amino acid positions 39 to 213.
This indicates that the sequence of GPCR10 has properties similar to those of other proteins known to contain this domain and similar to the properties of this domain.
Table 10K. DOMAIN results for GPCR10 gnllPfam~pfam00001, 7tm 1, 7 transmembrane receptor (rhodopsin family) Length = 377 (SEQ ID N0:45).
Score = 93.6 bits (231), Expect = 1e-20 I.. 1....1....I ...I.. I . .~....I....I....I....I....I
GPCR10 E~'V~TITS ~ S ~PMY F~T ~ L~'. VDTSKSTT~LK~LTQ
TM7 C SRE ° ° TTN L 5 ' 'YLE VGEWK RIH DIF
~....I....I....(....I....1....1....1....1....1....(....1 GPCR10 F~HFFGGV L TV v Y~' C H TIIM- P CC GG G H IQ
TM7 TVMMCTAS~~~N~C = I~ T ' YL~NTRYS~K'~RVT~'~~~AI~L~ICPM
.I....I....I....I....I....1....1....(....1....1....1....1 TM7 ~FGLNNTDQNE--------CIIANP--------AFVVYSIVFYV----PFITLL~YI
GPCR10 VAIF'=LI-___________________________________________________ The similarity information for the GPCR10 protein and nucleic acid disclosed herein suggest that GPCR10 may have important structural and/or physiological functions characteristic of the Olfactory Receptor family and the GPCR family.
Therefore, the nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount of the nucleic acid or the protein are to be assessed, as well as potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), and (v) a composition promoting tissue regeneration in vitro and in vivo (vi) biological defense weapon. The novel nucleic acid encoding GPCR10, and the GPCR10 protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed.
The nucleic acids and proteins of the invention are useful in potential therapeutic applications implicated in used in the treatment of infections such as bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm; adenocarcinoma; lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease; multiple sclerosis; and treatment of Albright hereditary ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome and/or other pathologies and disorders. The polypeptides can be used as immunogens to produce antibodies specific for the invention, and as vaccines.
They can also be used to screen for potential agonist and antagonist compounds. For example, a cDNA
encoding the GPCR-like protein may be useful in gene therapy, and the GPCR-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HIV-2), pain, cancer (including but not limited to neoplasm;
adenocarcinoma;
lymphoma; prostate cancer; uterus cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease;
multiple sclerosis; and treatment of Albright hereditary ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome andlor other pathologies and disorders. These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel GPCR10 substances for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-GPCRX Antibodies" section below.

A summary of the GPCRX nucleic acids and proteins of the invention is provided in Table 11.
TABLE 11: Summary Of Nucleic Acids And Proteins Of The Invention Name Tables Clone; Description of Homolog NucleicAmino Acid Acid SEQ SEQ
ID ID

NO NO

GPCR1 1A, GPCRla: ba113a10_B, olfactory 1 2 1B, receptor 1D, GPCRlb: ba32713_A, olfactory 3 4 1E, receptor 1G, GpCRlc: ba113a10_C, olfactory 5 6 1H receptor GPCR2 2A, GPCR2: 11612531-1, olfactory 7 8 2B receptor GPCR3 3A, GPCR3: ba145L22_B, olfactory 9 10 3B receptor GPCR4 4A, GPCR4a1: dj408b20 C, olfactory11 12 4B, receptor 4C, GPCR4a2: dj408b20 C dal, olfactory13 17 receptor 4G, GPCR4a3: CG55358 03, olfactory16 4H receptor GPCRS 5A, GPCRSal: 115-a-12-A, olfactory18 19 5B, receptor 5C, GPCRSa2: 115-a-12-B, olfactory20 21 SD receptor SG, GPCR5a3: 115-a-12-A dal, olfactory22 23 5H receptor GPCR6 6A, GPCR6: 6-L-19-C, olfactory 24 25 6B receptor GPCR7 7A, GPCR7: dj313i6_D olfactory 28 29 7B receptor GPCR8 8A, GPCRB: dj408b20_A, olfactory 30 31 8B receptor GPCR9 9A, GPCR9: 6-L-19-B, olfactory 32 33 9B receptor GPCR10 10A, GPCRIOa: 6-L-19-A, olfactory 34 35 10B, receptor IOC, GPCRIOb: 6-L-19-A1, olfactory 36 37 IOD, receptor IOF, GPCRIOc: 6-L-19-A dal, olfactory38 83 lOG receptor GPCRX Nucleic Acids and Polypeptides One aspect of the invention pertains to isolated nucleic acid molecules that encode GPCRX polypeptides or biologically active portions thereof. Also included in the invention are nucleic acid fragments sufficient for use as hybridization probes to identify GPCRX-encoding nucleic acids (e.g., GPCRX mRNAs) and fragments for use as PCR
primers for the amplification and/or mutation of GPCRX nucleic acid molecules. As used herein, the term "nucleic acid molecule" is intended to include DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., mRNA), analogs of the DNA or RNA generated using nucleotide analogs, and derivatives, fragments and homologs thereof. The nucleic acid molecule may be single-stranded or double-stranded, but preferably is comprised double-stranded DNA.
An GPCRX nucleic acid can encode a mature GPCRX polypeptide. As used herein, a "mature" form of a polypeptide or protein disclosed in the present invention is the product of a naturally occurnng polypeptide or precursor form or proprotein. The naturally occurnng polypeptide, precursor or proprotein includes, by way of nonlimiting example, the full-length gene product, encoded by the corresponding gene. Alternatively, it may be defined as the polypeptide, precursor or proprotein encoded by an ORF described herein. The product "mature" form arises, again by way of nonlimiting example, as a result of one or more naturally occurring processing steps as they may take place within the cell, or host cell, in which the gene product arises. Examples of such processing steps leading to a "mature" form of a polypeptide or protein include the cleavage of the N-terminal methionine residue encoded by the initiation codon of an ORF, or the proteolytic cleavage of a signal peptide or leader sequence. Thus a mature form arising from a precursor polypeptide or protein that has residues 1 to N, where residue 1 is the N-terminal methionine, would have residues 2 through N remaining after removal of the N-terminal methionine. Alternatively, a mature form arising from a precursor polypeptide or protein having residues 1 to N, in which an N-terminal signal sequence from residue 1 to residue M is cleaved, would have the residues from residue M+1 to residue N remaining. Further as used herein, a "mature" form of a polypeptide or protein may arise from a step of post-translational modification other than a proteolytic cleavage event.
Such additional processes include, by way of non-limiting example, glycosylation, myristoylation or phosphorylation. In general, a mature polypeptide or protein may result from the operation of only one of these processes, or a combination of any of them.
The term "probes", as utilized herein, refers to nucleic acid sequences of variable length, preferably between at least about 10 nucleotides (nt), 100 nt, or as many as approximately, e.g., 6,000 nt, depending upon the specific use. Probes are used in the detection of identical, similar, or complementary nucleic acid sequences.
Longer length probes are generally obtained from a natural or recombinant source, are highly specific, and much slower to hybridize than shorter-length oligomer probes. Probes may be single- or double-stranded and designed to have specificity in PCR, membrane-based hybridization technologies, or ELISA-like technologies.
The term "isolated" nucleic acid molecule, as utilized herein, is one, which is separated from other nucleic acid molecules which are present in the natural source of the nucleic acid.
Preferably, an "isolated" nucleic acid is free of sequences which naturally flank the nucleic acid (a.e., sequences located at the 5'- and 3'-termini of the nucleic acid) in the genomic DNA
of the organism from which the nucleic acid is derived. For example, in various embodiments, the isolated GPCRX nucleic acid molecules can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA of the cell/tissue from which the nucleic acid is derived (e.g., brain, heart, liver, spleen, etc.). Moreover, an "isolated" nucleic acid molecule, such as a cDNA molecule, can be substantially free of other cellular material or culture medium when produced by recombinant techniques, or of chemical precursors or other chemicals when chemically synthesized.
A nucleic acid molecule of the invention, e.g., a nucleic acid molecule having the nucleotide sequence of SEQ >D NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, or a complement of this aforementioned nucleotide sequence, can be isolated using standard molecular biology techniques and the sequence information provided herein. Using all or a portion of the nucleic acid sequence of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 as a hybridization probe, GPCRX molecules can be isolated using standard hybridization and cloning techniques (e.g., as described in Sambrook, et al., (eds.), MOLECULAR CLONING: A LABORATORY MANUAL 2°a Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; and Ausubel, et al., (eds.), CURRENT
PROTOCOLS rN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993.) A nucleic acid of the invention can be amplified using cDNA, mRNA or alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques. The nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis. Furthermore, oligonucleotides corresponding to GPCRX nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer.
As used herein, the term "oligonucleotide" refers to a series of linked nucleotide residues, which oligonucleotide has a sufficient number of nucleotide bases to be used in a PCR reaction. A short oligonucleotide sequence may be based on, or designed from, a genomic or cDNA sequence and is used to amplify, confirm, or reveal the presence of an identical, similar or complementary DNA or RNA in a particular cell or tissue.
Oligonucleotides comprise portions of a nucleic acid sequence having about 10 nt, 50 nt, or 100 nt in length, preferably about 15 nt to 30 nt in length. In one embodiment of the invention, an oligonucleotide comprising a nucleic acid molecule less than 100 nt in length would further comprise at least 6 contiguous nucleotides of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, or a complement thereof.
Oligonucleotides may be chemically synthesized and may also be used as probes.
In another embodiment, an isolated nucleic acid molecule of the invention comprises a nucleic acid molecule that is a complement of the nucleotide sequence shown in SEQ ID

NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, or a portion of this nucleotide sequence (e.g., a fragment that can be used as a probe or primer or a fragment encoding a biologically-active portion of an GPCRX polypeptide). A nucleic acid molecule that is complementary to the nucleotide sequence shown in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, is one that is sufficiently complementary to the nucleotide sequence shown in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, that it can hydrogen bond with little or no mismatches to the nucleotide sequence shown SEQ ID NOS:1, 3, 5, 7, 9, I 1, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, thereby forming a stable duplex.
As used herein, the term "complementary" refers to Watson-Crick or Hoogsteen base pairing between nucleotides units of a nucleic acid molecule, and the teen "binding" means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof. Binding includes ionic, non-ionic, van der Waals, hydrophobic interactions, and the like. A physical interaction can be either direct or indirect. Indirect interactions may be through or due to the effects of another polypeptide or compound. Direct binding refers to interactions that do not take place through, or due to, the effect of another polypeptide or compound, but instead are without other substantial chemical intermediates.
Fragments provided herein are defined as sequences of at least 6 (contiguous) nucleic acids or at least 4 (contiguous) amino acids, a length sufficient to allow for specific hybridization in the case of nucleic acids or for specific recognition of an epitope in the case of amino acids, respectively, and are at most some portion less than a full length sequence.
Fragments may be derived from any contiguous portion of a nucleic acid or amino acid sequence of choice. Derivatives are nucleic acid sequences or amino acid sequences formed from the native compounds either directly or by modification or partial substitution. Analogs are nucleic acid sequences or amino acid sequences that have a structure similar to, but not identical to, the native compound but differs from it in respect to certain components or side chains. Analogs may be synthetic or from a different evolutionary origin and may have a similar or opposite metabolic activity compared to wild type. Homologs are nucleic acid sequences or amino acid sequences of a particular gene that are derived from different species.
Derivatives and analogs may be full length or other than full length, if the derivative or analog contains a modified nucleic acid or amino acid, as described below.
Derivatives or analogs of the nucleic acids or proteins of the invention include, but are not limited to, molecules comprising regions that are substantially homologous to the nucleic acids or proteins of the invention, in various embodiments, by at least about 70%, 80%, or 95%
identity (with a preferred identity of 80-95%) over a nucleic acid or amino acid sequence of identical size or when compared to an aligned sequence in which the alignment is done by a computer homology program known in the art, or whose encoding nucleic acid is capable of hybridizing to the complement of a sequence encoding the aforementioned proteins under stringent, moderately stringent, or low stringent conditions. See e.g.
Ausubel, et al., CURRENT
PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993, and below.
A "homologous nucleic acid sequence" or "homologous amino acid sequence," or variations thereof, refer to sequences characterized by a homology at the nucleotide level or amino acid level as discussed above. Homologous nucleotide sequences encode those sequences coding for isoforms of GPCRX polypeptides. Isoforms can be expressed in different tissues of the same organism as a result of, for example, alternative splicing of RNA.
Alternatively, isoforms can be encoded by different genes. In the invention, homologous nucleotide sequences include nucleotide sequences encoding for an GPCRX
polypeptide of species other than humans, including, but not limited to: vertebrates, and thus can include, e.g., frog, mouse, rat, rabbit, dog, cat cow, horse, and other organisms. Homologous nucleotide sequences also include, but are not limited to, naturally occurring allelic variations and mutations of the nucleotide sequences set forth herein. A homologous nucleotide sequence does not, however, include the exact nucleotide sequence encoding human GPCRX
protein.
Homologous nucleic acid sequences include those nucleic acid sequences that encode conservative amino acid substitutions (see below) in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, as well as a polypeptide possessing GPCRX biological activity. Various biological activities of the GPCRX proteins are described below.
An GPCRX polypeptide is encoded by the open reading frame ("ORF") of an GPCRX
nucleic acid. An ORF corresponds to a nucleotide sequence that could potentially be translated into a polypeptide. A stretch of nucleic acids comprising an ORF is uninterrupted by a stop codon. An ORF that represents the coding sequence for a full protein begins with an ATG
"start" codon and terminates with one of the three "stop" codons, namely, TAA, TAG, or TGA. For the purposes of this invention, an ORF may be any part of a coding sequence, with or without a start codon, a stop codon, or both. For an ORF to be considered as a good candidate for coding for a bona fide cellular protein, a minimum size requirement is often set, e.g., a stretch of DNA that would encode a protein of 50 amino acids or more.
The nucleotide sequences determined from the cloning of the human GPCRX genes allows for the generation of probes and primers designed for use in identifying and/or cloning GPCRX homologues in other cell types, e.g. from other tissues, as well as homologues from other vertebrates. The probe/primer typically comprises substantially purified oligonucleotide. The oligonucleotide typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12, 25, 50, 100, 150, 200, 250, 300, 350 or 400 consecutive sense strand nucleotide sequence of SEQ ID
NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38; or an anti-sense strand nucleotide sequence of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38; or of a naturally occurring mutant of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38.
Probes based on the human GPCRX nucleotide sequences can be used to detect transcripts or genomic sequences encoding the same or homologous proteins. In various embodiments, the probe further comprises a label group attached thereto, e.g.
the label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used as a part of a diagnostic test kit for identifying cells or tissues which mis-express an GPCRX protein, such as by measuring a level of an GPCRX-encoding nucleic acid in a sample of cells from a subject e.g., detecting GPCRX mRNA levels or determining whether a genomic GPCRX gene has been mutated or deleted.
"A polypeptide having a biologically-active portion of an GPCRX polypeptide"
refers to polypeptides exhibiting activity similar, but not necessarily identical to, an activity of a polypeptide of the invention, including mature forms, as measured in a particular biological assay, with or without dose dependency. A nucleic acid fragment encoding a "biologically-active portion of GPCIRX" can be prepared by isolating a portion SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 that encodes a polypeptide having an GPCRX biological activity (the biological activities of the GPCRX proteins are described below), expressing the encoded portion of GPCRX protein (e.g., by recombinant expression in vitro) and assessing the activity of the encoded portion of GPCRX.
GPCRX Nucleic Acid and Polypeptide Variants The invention further encompasses nucleic acid molecules that differ from the nucleotide sequences shown SEQ ID NOS:1, 3, 5, 7, 9, 1.1, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 due to degeneracy of the genetic code and thus encode the same GPCRX
proteins as that encoded by the nucleotide sequences shown in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38. In another embodiment, an isolated nucleic acid molecule of the invention has a nucleotide sequence encoding a protein having an amino acid sequence shown in SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83.
In addition to the human GPCRX nucleotide sequences shown in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 it will be appreciated by those skilled in the art that DNA sequence polymorphisms that lead to changes in the amino acid sequences of the GPCRX polypeptides may exist within a population (e.g., the human population). Such genetic polymorphism in the GPCRX genes may exist among individuals within a population due to natural allelic variation. As used herein, the terms "gene" and "recombinant gene" refer to nucleic acid molecules comprising an open reading frame (ORF) encoding an GPCRX
protein, preferably a vertebrate GPCRX protein. Such natural allelic variations can typically result in 1-5% variance in the nucleotide sequence of the GPCRX genes. Any and all such nucleotide variations and resulting amino acid polymorphisms in the GPCRX
polypeptides, which are the result of natural allelic variation and that do not alter the functional activity of the GPCRX polypeptides, are intended to be within the scope of the invention.
Moreover, nucleic acid molecules encoding GPCRX proteins from other species, and thus that have a nucleotide sequence that differs from the human sequence SEQ
ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 are intended to be within the scope of the invention. Nucleic acid molecules corresponding to natural allelic variants and homologues of the GPCRX cDNAs of the invention can be isolated based on their homology to the human GPCRX nucleic acids disclosed herein using the human cDNAs, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions.
Accordingly, in another embodiment, an isolated nucleic acid molecule of the invention is at least 6 nucleotides in length and hybridizes under stringent conditions to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38. In another embodiment, the nucleic acid is at least 10, 25, 50, 100, 250, 500, 750, 1000, 1500, or 2000 or more nucleotides in length. In yet another embodiment, an isolated nucleic acid molecule of the invention hybridizes to the coding region. As used herein, the term "hybridizes under stringent conditions" is intended to describe conditions for hybridization and washing under which nucleotide sequences at least 60% homologous to each other typically remain hybridized to each other.
Homologs (i.e., nucleic acids encoding GPCRX proteins derived from species other than human) or other related sequences (e.g., paralogs) can be obtained by low, moderate or high stringency hybridization with all or a portion of the particular human sequence as a probe using methods well known in the art for nucleic acid hybridization and cloning.
As used herein, the phrase "stringent hybridization conditions" refers to conditions under which a probe, primer or oligonucleotide will hybridize to its target sequence, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures than shorter sequences. Generally, stringent conditions are selected to be about 5 °C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which SO% of the probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present at excess, at Tm, 50% of the probes are occupied at equilibrium. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M
sodium ion (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes, primers or oligonucleotides (e.g., 10 nt to 50 nt) and at least about 60°C for longer probes, primers and oligonucleotides. Stringent conditions may also be achieved with the addition of destabilizing agents, such as formamide.
Stringent conditions are known to those skilled in the art and can be found in Ausubel, et al., (eds.), CURRENT PROTOCOLS ~ MOLECULAR BIOLOGY, John Wiley & Sons, N.Y.
(1989), 6.3.1-6.3.6. Preferably, the conditions are such that sequences at least about 65%, 70%, 75%, 85%, 90%, 95%, 98%, or 99% homologous to each other typically remain hybridized to each other. A non-limiting example of stringent hybridization conditions are hybridization in a high salt buffer comprising 6X SSC, 50 mM Tris-HCl (pH
7.5), 1 mM
EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 mg/ml denatured salmon sperm DNA
at 65°C, followed by one or more washes in 0.2X SSC, 0.01% BSA at 50°C. An isolated nucleic acid molecule of the invention that hybridizes under stringent conditions to the sequences of SEQ ID NOS:I, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 corresponds to a naturally-occurring nucleic acid molecule. As used herein, a "naturally-occurnng" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural protein).
In a second embodiment, a nucleic acid sequence that is hybridizable to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 or fragments, analogs or derivatives thereof, under conditions of moderate stringency is provided. A non-limiting example of moderate stringency hybridization conditions are hybridization in 6X SSC, 5X Denhardt's solution, 0.5% SDS and 100 mg/ml denatured salmon sperm DNA at 55°C, followed by one or more washes in 1X SSC, 0.1% SDS at 37°C. Other conditions of moderate stringency that may be used are well-known within the art. See, e.g., Ausubel, et al. (eds.), 1993, CURRENT
PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NY, and Kriegler, 1990;
GENE
TRANSFER AND EXPRESSION, A LABORATORY MANUAL, StOCktOn PreSS, NY.
In a third embodiment, a nucleic acid that is hybridizable to the nucleic acid molecule comprising the nucleotide sequences of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 or fragments, analogs or derivatives thereof, under conditions of low stringency, is provided. A non-limiting example of low stringency hybridization conditions are hybridization in 35% formamide, 5X SSC, 50 mM Tris-HCl (pH 7.5), 5 mM
EDTA, 0.02% PVP, 0.02% Ficoll, 0.2% BSA, 100 mg/ml denatured salmon sperm DNA, 10%
(wt/vol) dextran sulfate at 40°C, followed by one or more washes in 2X
SSC, 25 mM Tris-HCl (pH 7.4), 5 mM EDTA, and 0.1% SDS at 50°C. Other conditions of low stringency that may be used are well known in the art (e.g., as employed for cross-species hybridizations). See, e.g., Ausubel, et al. (eds.), 1993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NY, and Kriegler, 1990, GENE TRANSFER AND EXPRESSION, A LABORATORY
MANUAL, Stockton Press, NY; Shilo and Weinberg, 1981. Proc Natl Acad Sci USA
78:
6789-6792.
Conservative Mutations In addition to naturally-occurring allelic variants of GPCRX sequences that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequences of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 thereby leading to changes in the amino acid sequences of the encoded GPCRX proteins, without altering the functional ability of said GPCRX
proteins. For example, nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83. A "non-essential" amino acid residue is a residue that can be altered from the wild-type sequences of the GPCRX proteins without altering their biological activity, whereas an "essential" amino acid residue is required for such biological activity. For example, amino acid residues that are conserved among the GPCRX proteins of the invention are predicted to be particularly non-amenable to alteration. Amino acids for which conservative substitutions can be made are well-known within the art.
Another aspect of the invention pertains to nucleic acid molecules encoding GPCRX
proteins that contain changes in amino acid residues that are not essential for activity. Such GPCRX proteins differ in amino acid sequence from SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83 yet retain biological activity. In one embodiment, the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherein the protein comprises an amino acid sequence at least about 45% homologous to the amino acid sequences of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83.
Preferably, the protein encoded by the nucleic acid molecule is at least about 60% homologous to SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83; more preferably at least about 70% homologous to SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83; still more preferably at least about 80%
homologous to SEQ ID
NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83; even more preferably at least about 90% homologous to SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83; and most preferably at least about 95% homologous to SEQ ID
NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83.
An isolated nucleic acid molecule encoding an GPCRX protein homologous to the protein of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83 can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein.
Mutations can be introduced into SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83 by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions axe made at one or more predicted, non-essential amino acid residues. A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined within the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
Thus, a predicted non-essential amino acid residue in the GPC1RX protein is replaced with another amino acid residue from the same side chain family. Alternatively, in another embodiment, mutations can be introduced randomly along all or part of an GPCItX coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for GPCRX biological activity to identify mutants that retain activity. Following mutagenesis of SEQ ID NOS:1, 3, 5, 7, 9, 1 l, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, the encoded protein can be expressed by any recombinant technology known in the art and the activity of the protein can be determined.
The relatedness of amino acid families may also be determined based on side chain interactions. Substituted amino acids may be fully conserved "strong" residues or fully conserved "weak" residues. The "strong" group of conserved amino acid residues may be any one of the following groups: STA, NEQK, NHQK, NDEQ, QH1RK, MILV, MILF, HY, FYW, wherein the single letter amino acid codes are grouped by those amino acids that may be substituted for each other. Likewise, the "weak" group of conserved residues may be any one of the following: CSA, ATV, SAG, STNK, STPA, SGND, SNDEQK, NDEQHK, NEQH1ZK, VLIM, HFY, wherein the letters within each group represent the single letter amino acid code.
In one embodiment, a mutant GPCRX protein can be assayed for (i) the ability to form protein:protein interactions with other GPCRX proteins, other cell-surface proteins, or biologically-active portions thereof, (ii) complex formation between a mutant GPC1RX protein and an GPCRX ligand; or (iii) the ability of a mutant GPC1RX protein to bind to an intracellular target protein or biologically-active portion thereof; (e.g.
avidin proteins).
In yet another embodiment, a mutant GPCRX protein can be assayed for the ability to regulate a specific biological function (e.g., regulation of insulin release).
Antisense Nucleic Acids Another aspect of the invention pertains to isolated antisense nucleic acid molecules that are hybridizable to or complementary to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, or fragments, analogs or derivatives thereof. An "antisense" nucleic acid comprises a nucleotide sequence that is complementary to a "sense" nucleic acid encoding a protein (e.g., complementary to the coding strand of a double-stranded cDNA molecule or complementary to an mltNA sequence). In specific aspects, antisense nucleic acid molecules are provided that comprise a sequence complementary to at least about 10, 25, 50, 100, 250 or 500 nucleotides or an entire GPCRX coding strand, or to only a portion thereof. Nucleic acid molecules encoding fragments, homologs, derivatives and analogs of an GPCRX protein of SEQ ID
NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, or antisense nucleic acids complementary to an GPCRX nucleic acid sequence of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, are additionally provided.
In one embodiment, an antisense nucleic acid molecule is antisense to a "coding region" of the coding strand of a nucleotide sequence encoding an GPCRX
protein. The term "coding region" refers to the region of the nucleotide sequence comprising codons which are translated into amino acid residues. In another embodiment, the antisense nucleic acid molecule is antisense to a "noncoding region" of the coding strand of a nucleotide sequence encoding the GPCRX protein. The term "noncoding region" refers to 5' and 3' sequences which flank the coding region that are not translated into amino acids (i.e., also referred to as 5' and 3' untranslated regions).
Given the coding strand sequences encoding the GPCRX protein disclosed herein, antisense nucleic acids of the invention can be designed according to the rules of Watson and Crick or Hoogsteen base pairing. The antisense nucleic acid molecule can be complementary to the entire coding region of GPCRX mRNA, but more preferably is an oligonucleotide that is antisense to only a portion of the coding or noncoding region of GPCRX
mRNA. For example, the antisense oligonucleotide can be complementary to the region surrounding the translation start site of GPCRX mRNA. An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length. An antisense nucleic acid of the invention can be constructed using chemical synthesis or enzymatic ligation reactions using procedures known in the art. For example, an antisense nucleic acid (e.g., an antisense oligonucleotide) can be chemically synthesized using naturally-occurnng nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids (e.g., phosphorothioate derivatives and acridine substituted nucleotides can be used).
Examples of modified nucleotides that can be used to generate the antisense nucleic acid include: 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2-carboxypiopyl) uracil, (acp3)w, and 2,6-diaminopurine.
Alternatively, the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA
transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in the following subsection).
The antisense nucleic acid molecules of the invention are typically administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA andlor genomic DNA encoding an GPCRX protein to thereby inhibit expression of the protein (e.g., by inhibiting transcription and/or translation). The hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule that binds to DNA duplexes, through specific interactions in the major groove of the double helix. An example of a route of administration of antisense nucleic acid molecules of the invention includes direct injection at a tissue site. Alternatively, antisense nucleic acid molecules can be modified to target selected cells and then administered systemically. For example, for systemic administration, antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface (e.g., by linking the antisense nucleic acid molecules to peptides or antibodies that bind to cell surface receptors or antigens). The antisense nucleic acid molecules can also be delivered to cells using the vectors described herein. To achieve sufficient nucleic acid molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred.
In yet another embodiment, the antisense nucleic acid molecule of the invention is an a-anomeric nucleic acid molecule. An a-anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual [3-units, the strands run parallel to each other. See, e.g., Gaultier, et al., 1987. Nucl.
Acids Res. 15: .
6625-6641. The antisense nucleic acid molecule can also comprise a 2'-o-methylribonucleotide (see, e.g., moue, et al. 1987. Nucl. Acids Res. 15:
6131-6148) or a chimeric RNA-DNA analogue (see, e.g., moue, et al., 1987. FEBS Lett. 215: 327-330.
Ribozymes and PNA Moieties Nucleic acid modifications include, by way of non-limiting example, modified bases, and nucleic acids whose sugar phosphate backbones are modified or derivatized.
These modifications are carned out at least in part to enhance the chemical stability of the modified nucleic acid, such that they may be used, for example, as antisense binding nucleic acids in therapeutic applications in a subject.
In one embodiment, an antisense nucleic acid of the invention is a ribozyme.
Ribozymes are catalytic RNA molecules with ribonuclease activity that are capable of cleaving a single-stranded nucleic acid, such as an mRNA, to which they have a complementary region. Thus, ribozymes (e.g., hammerhead ribozymes as described in Haselhoff and Gerlach 1988. Nature 334: 585-591) can be used to catalytically cleave GPCRX
mRNA transcripts to thereby inhibit translation of GPCRX mRNA. A ribozyme having specificity for an GPCRX-encoding nucleic acid can be designed based upon the nucleotide sequence of an GPCRX cDNA disclosed herein (i.e., SEQ ID NOS:1, 3, 5, 7, 9, 1 l, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38). For example, a derivative of a Tetrahymena L-19 IVS
RNA can be constructed in which the nucleotide sequence of the active site is complementary to the nucleotide sequence to be cleaved in an GPCRX-encoding mRNA. See, e.g., U.S.
Patent 4,987,071 to Cech, et al. and U.S. Patent 5,116,742 to Cech, et al.
GPCRX mRNA can also be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules. See, e.g., Bartel et al., (1993) Science 261:1411-1418.
Alternatively, GPCRX gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region of the GPCRX nucleic acid (e.g., the GPCRX promoter and/or enhancers) to form triple helical structures that prevent transcription of the GPCRX gene in target cells. See, e.g., Helene, 1991. Anticancer Drug Des. 6: 569-84;
Helene, et al. 1992. Ann. N. Y. Acad. Sci. 660: 27-36; Maher, 1992. Bioassays 14: 807-15.
In various embodiments, the GPCRX nucleic acids can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., the stability, hybridization, or solubility of the molecule. For example, the deoxyribose phosphate backbone of the nucleic acids can be modified to generate peptide nucleic acids. See, e.g., Hyrup, et al:, 1996.
Bioorg Med Chem 4: 5-23. As used herein, the terms "peptide nucleic acids" or "PNAs"
refer to nucleic acid mimics (e.g., DNA mimics) in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleobases are retained.
The neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength. The synthesis of PNA oligomers can be performed using standard solid phase peptide synthesis protocols as described in Hyrup, et al., 1996. supra;
Perry-O'Keefe, et al., 1996. Proc. Natl. Acad. Sci. USA 93: 14670-14675.
PNAs of GPCRX can be used in therapeutic and diagnostic applications. For example, PNAs can be used as antisense or antigene agents for sequence-specific modulation of gene expression by, e.g., inducing transcription or translation arrest or inhibiting replication. PNAs of GPCRX can also be used, for example, in the analysis of single base pair mutations in a gene (e.g., PNA directed PCR clamping; as artificial restriction enzymes when used in combination with other enzymes, e.g., S~ nucleases (see, Hyrup, et al., 1996.supra); or as probes or primers for DNA sequence and hybridization (see, Hyrup, et al., 1996, supra;
Perry-O'Keefe, et al., 1996. supra).
In another embodiment, PNAs of GPCRX can be modified, e.g., to enhance their stability or cellular uptake, by attaching lipophilic or other helper groups to PNA, by the formation of PNA-DNA chimeras, or by the use of liposomes or other techniques of drug delivery known in the art. For example, PNA-DNA chimeras of GPCRX can be generated that may combine the advantageous properties of PNA and DNA. Such chimeras allow DNA
recognition enzymes (e.g., RNase H and DNA polymerases) to interact with the DNA portion while the PNA portion would provide high binding affinity and specificity. PNA-DNA
chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking, number of bonds between the nucleobases; and orientation (see, Hyrup, et al., 1996. supra).
The synthesis of PNA-DNA chimeras can be performed as described in Hyrup, et al., 1996.
supra and Finn, et al., 1996. Nucl Acids Res 24: 3357-3363. For example, a DNA
chain can be synthesized on a solid support using standard phosphoramidite coupling chemistry, and modified nucleoside analogs, e.g., 5'-(4-methoxytrityl)amino-5'-deoxy-thymidine phosphoramidite, can be used between the PNA and the 5' end of DNA. See, e.g., Mag, et al., 1989. Nucl Acid Res 17: 5973-5988. PNA monomers are then coupled in a stepwise manner to produce a chimeric molecule with a 5' PNA segment and a 3' DNA segment.
See, e.g., Finn, et al., 1996. supra. Alternatively, chimeric molecules can be synthesized with a 5' DNA
segment and a 3' PNA segment. See, e.g., Petersen, et al., 1975. Bioorg. Med.
Chem. Lett. 5:
1119-11124.
In other embodiments, the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger, et al., 1989. Proc. Natl. Acad. Sci.
U.S.A. 86:
6553-6556; Lemaitre, et al., 1987. Proc. Natl. Acad. Sci. 84: 648-652; PCT
Publication No.
W088/09810) or the blood-brain barner (see, e.g., PCT Publication No.
W0'89/10134). In addition, oligonucleotides can be modified with hybridization triggered cleavage agents (see, e.g., Krol, et al., 1988. BioTechniques 6:958-976) or intercalating agents (see, e.g., Zon, 1988.
Pharm. Res. 5: 539-549). To this end, the oligonucleotide may be conjugated to another molecule, e.g., a peptide, a hybridization triggered cross-linking agent, a transport agent, a hybridization-triggered cleavage agent, and the like.
GPCRX Polypeptides A polypeptide according to the invention includes a polypeptide including the amino acid sequence of GPCRX polypeptides whose sequences are provided in SEQ ID
NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83. The invention also includes a mutant or variant protein any of whose residues may be changed from the corresponding residues shown in SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83 while still encoding a protein that maintains its GPCIRX activities and physiological functions, or a functional fragment thereof.
In general, an GPCRX variant that preserves GPCRX-like function includes any variant in which residues at a particular position in the sequence have been substituted by other amino acids, and further include the possibility of inserting an additional residue or residues between two residues of the parent protein as well as the possibility of deleting one or more residues from the parent sequence. Any amino acid substitution, insertion, or deletion is encompassed by the invention. In favorable circumstances, the substitution is a conservative substitution as defined above.
One aspect of the invention pertains to isolated GPCIRX proteins, and biologically-active portions thereof, or derivatives, fragments, analogs or homologs thereof. Also provided are polypeptide fragments suitable for use as immunogens to raise anti-GPC12X
antibodies. In one embodiment, native GPCRX proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques. In another embodiment, GPCRX proteins are produced by recombinant DNA techniques.
Alternative to recombinant expression, an GPC1RX protein or polypeptide can be synthesized chemically using standard peptide synthesis techniques.
An "isolated" or "purified" polypeptide or protein or biologically-active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the GPCItX protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized. The language "substantially free of cellular material" includes preparations of GPCRX proteins in which the protein is separated from cellular components of the cells from which it is isolated or recombinantly-produced. In one embodiment, the language "substantially free of cellular material" includes preparations of GPCRX proteins having less than about 30% (by dry weight) of non-GPCRX
proteins (also referred to herein as a "contaminating protein"), more preferably less than about 20% of non-GPCRX proteins, still more preferably less than about 10% of non-GPCRX
proteins, and most preferably less than about 5% of non-GPCRX proteins. When the GPCRX
protein or biologically-active portion thereof is recombinantly-produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume of the GPCRX protein preparation.
The language "substantially free of chemical precursors or other chemicals"
includes preparations of GPCRX proteins in which the protein is separated from chemical precursors or other chemicals that are involved in the synthesis of the protein. In one embodiment, the language "substantially free of chemical precursors or other chemicals"
includes preparations of GPCRX proteins having less than about 30% (by dry weight) of chemical precursors or non-GPCRX chemicals, more preferably less than about 20% chemical precursors or non-GPCRX chemicals, still more preferably less than about 10% chemical precursors or non-GPCRX chemicals, and most preferably less than about 5% chemical precursors or non-GPCRX chemicals.
Biologically-active portions of GPCRX proteins include peptides comprising amino acid sequences sufficiently homologous to or derived from the amino acid sequences of the GPCRX proteins (e.g., the amino acid sequence shown in SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83) that include fewer amino acids than the full-length GPCRX proteins, and exhibit at least one activity of an GPCRX protein.
Typically, biologically-active portions comprise a domain or motif with at least one activity of the GPCRX protein. A biologically-active portion of an GPCRX protein can be a polypeptide which is, for example, 10, 25, 50, 100 or more amino acid residues in length.
Moreover, other biologically-active portions, in which other regions of the protein are deleted, can be prepared by recombinant techniques and evaluated for one or more of the functional activities of a native GPCRX protein.
In an embodiment, the GPCRX protein has an amino acid sequence shown in SEQ ID
NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83. In other embodiments, the GPCRX protein is substantially homologous to SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, and retains the functional activity of the protein of SEQ ID

NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, yet differs in amino acid sequence due to natural allelic variation or mutagenesis, as described in detail, below.
Accordingly, in another embodiment, the GPCRX protein is a protein that comprises an amino acid sequence at least about 45% homologous to the amino acid sequence SEQ ID
NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, and retains the functional activity of the GPCRX proteins of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83.
Determining Homology Between Two or More Sequences To determine the percent homology of two amino acid sequences or of two nucleic acids, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are homologous at that position (i.e., as used herein amino acid or nucleic acid "homology" is equivalent to amino acid or nucleic acid "identity") The nucleic acid sequence homology may be determined as the degree of identity between two sequences. The homology may be determined using computer programs known in the art, such as GAP software provided in the GCG program package. See, Needleman and Wunsch, 1970. JMoI Biol 48: 443-453. Using GCG GAP software with the following settings for nucleic acid sequence comparison: GAP creation penalty of 5.0 and GAP
extension penalty of 0.3, the coding region of the analogous nucleic acid sequences referred to above exhibits a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99%, with the CDS (encoding) part of the DNA sequence shown in SEQ ID NOS:1, 3, S, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38.
The term "sequence identity" refers to the degree to which two polynucleotide or polypeptide sequences are identical on a residue-by-residue basis over a particular region of comparison. The term "percentage of sequence identity" is calculated by comparing two optimally aligned sequences over that region of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I, in the case of nucleic acids) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the region of comparison (i. e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. The term "substantial identity" as used herein denotes a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 80 percent sequence identity, preferably at least 85 percent identity and often 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison region.
Chimeric and Fusion Proteins The invention also provides GPCRX chimeric or fusion proteins. As used herein, an GPCRX "chimeric protein" or "fusion protein" comprises an GPCRX polypeptide operatively linked to a non-GPCRX polypeptide. An "GPCRX polypeptide" refers to a polypeptide having an amino acid sequence corresponding to an GPCRX protein (SEQ ID
NOS:2,.4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83), whereas a "non-GPCRX
polypeptide"
refers to a polypeptide having an amino acid sequence corresponding to a protein that is not substantially homologous to the GPCRX protein, e.g., a protein that is different from the GPCRX protein and that is derived from the same or a different organism.
Within an GPCRX
fusion protein the GPCRX polypeptide can correspond to all or a portion of an GPCRX
protein. In one embodiment, an GPCRX fusion protein comprises at least one biologically-active portion of an GPCRX protein. In another embodiment, an GPCRX fusion protein comprises at least two biologically-active portions of an GPCRX protein. In yet another embodiment, an GPCRX fusion protein comprises at least three biologically-active portions of an GPCRX protein. Within the fusion protein, the term "operatively-linked" is intended to indicate that the GPCRX polypeptide and the non-GPCRX polypeptide are fused in-frame with one another. The non-GPC1RX polypeptide can be fused to the N-terminus or C-terminus of the GPCRX polypeptide.
In one embodiment, the fusion protein is a GST-GPCRX fusion protein in which the GPCRX sequences are fused to the C-terminus of the GST (glutathione S-transferase) sequences. Such fusion proteins can facilitate the purification of recombinant GPCRX
polypeptides.
In another embodiment, the fusion protein is an GPCRX protein containing a heterologous signal sequence at its N-terminus. In certain host cells (e.g., mammalian host cells), expression and/or secretion of GPCRX can be increased through use of a heterologous signal sequence.

In yet another embodiment, the fusion protein is an GPCRX-immunoglobulin fusion protein in which the GPCRX sequences are fused to sequences derived from a member of the immunoglobulin protein family. The GPCRX-immunoglobulin fusion proteins of the invention can be incorporated into pharmaceutical compositions and administered to a subject to inhibit an interaction between an GPCRX ligand and an GPCRX protein on the surface of a cell, to thereby suppress GPCRX-mediated signal transduction in vivo. The GPCRX-immunoglobulin fusion proteins can be used to affect the bioavailability of an GPCRX
cognate ligand. Inhibition of the GPCRX ligand/GPCRX interaction may be useful therapeutically for both the treatment of proliferative and differentiative disorders, as well as modulating (e.g. promoting or inhibiting) cell survival. Moreover, the GPCRX-immunoglobulin fusion proteins of the invention can be used as immunogens to produce anti-GPCRX antibodies in a subject, to purify GPCRX ligands, and in screening assays to identify molecules that inhibit the interaction of GPCRX with an GPCRX ligand.
An GPCRX chimeric or fusion protein of the invention can be produced by standard recombinant DNA techniques. For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, e.g., by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. In another embodiment, the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers. Alternatively, PCR amplification of gene fragments can be carned out using anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamplified to generate a chimeric gene sequence (see, e.g., Ausubel, et al. (eds.) CURRENT PROTOCOLS IN
MOLECULAR
BIOLOGY, John Wiley & Sons, 1992). Moreover, many expression vectors are commercially available that already encode a fusion moiety (e.g., a GST polypeptide). An GPCRX-encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the GPCRX protein.
GPCRX Agonists and Antagonists The invention also pertains to variants of the GPCRX proteins that function as either GPCRX agonists (i.e., mimetics) or as GPCRX antagonists. Variants of the GPCRX
protein can be generated by mutagenesis (e.g., discrete point mutation or truncation of the GPCRX
protein). An agonist of the GPCRX protein can retain substantially the same, or a subset of, the biological activities of the naturally occurring form of the GPCRX
protein. An antagonist of the GPCRX protein can inhibit one or more of the activities of the naturally occurnng form of the GPCRX protein by, for example, competitively binding to a downstream or upstream member of a cellular signaling cascade which includes the GPCRX protein. Thus, specific biological effects can be elicited by treatment with a variant of limited function. In one embodiment, treatment of a subject with a variant having a subset of the biological activities of the naturally occurnng form of the protein has fewer side effects in a subj ect relative to treatment with the naturally occurring form of the GPCRX proteins.
Variants of the GPCRX proteins that function as either GPCRX agonists (i.e., mimetics) or as GPCRX antagonists can be identified by screening combinatorial libraries of mutants (e.g., truncation mutants) of the GPCRX proteins for GPCRX protein agonist or antagonist activity. In one embodiment, a variegated library of GPCRX variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library. A variegated library of GPCRX variants can be produced by, for example, enzymatically ligating a mixture of synthetic oligonucleotides into gene sequences such that a degenerate set of potential GPCRX sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of GPCRX sequences therein. There are a variety of methods which can be used to produce libraries of potential GPCRX variants from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be performed in an automatic DNA
synthesizer, and the synthetic gene then ligated into an appropriate expression vector. Use of a degenerate set of genes allows for the provision, in one mixture, of all of the sequences encoding the desired set of potential GPCRX sequences. Methods for synthesizing degenerate oligonucleotides are well-known within the art. See, e.g., Narang, 1983.
Tetrahedron 39: 3;
Itakura, et al., 1984. Annu. Rev. Biochem. 53: 323; Itakura, et al., 1984.
Science 198: 1056;
Ike, et al., 1983. Nucl. Acids Res. 11: 477.
Polypeptide Libraries In addition, libraries of fragments of the GPCRX protein coding sequences can be used to generate a variegated population of GPCRX fragments for screening and subsequent selection of variants of an GPCRX protein. In one embodiment, a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of an GPCRX coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double-stranded DNA that can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with S ~ nuclease, and ligating the resulting fragment library into an expression vector. By this method, expression libraries can be derived which encodes N-terminal and internal fragments of various sizes of the GPCRX
proteins.
Various techniques are known in the art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA
libraries for gene products having a selected property. Such techniques are adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of GPCRX proteins.
The most widely used techniques, which are amenable to high throughput analysis, for screening large gene libraries typically include cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates isolation of the vector encoding the gene whose product was detected.
Recursive ensemble mutagenesis (REM), a new technique that enhances the frequency of functional mutants in the libraries, can be used in combination with the screening assays to identify GPCRX variants.
See, e.g., Arkin and Yourvan, 1992. Proc. Natl. Acad. Sci. USA 89: 7811-7815;
Delgrave, et al., 1993. Protein Engineering 6:327-331.
Anti-GPCRX Antibodies The invention encompasses antibodies and antibody fragments, such as Fab or (Fab)2, that bind immunospecifically to any of the GPCRX polypeptides of said invention.
An isolated GPCRX protein, or a portion or fragment thereof, can be used as an immunogen to generate antibodies that bind to GPCRX polypeptides using standard techniques for polyclonal and monoclonal antibody preparation. The full-length GPCRX
proteins can be used or, alternatively, the invention provides antigenic peptide fragments of GPCRX proteins for use as immunogens. The antigenic GPCRX peptides comprises at least 4 amino acid residues of the amino acid sequence shown in SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83 and encompasses an epitope of GPCItX such that an antibody raised against the peptide forms a specific immune complex with GPCItX.
Preferably, the antigenic peptide comprises at least 6, 8, 10, 15, 20, or 30 amino acid residues.
Longer antigenic peptides are sometimes preferable over shorter antigenic peptides, depending on use and according to methods well known to someone skilled in the art.

In certain embodiments of the invention, at least one epitope encompassed by the antigenic peptide is a region of GPCRX that is located on the surface of the protein (e.g., a hydrophilic region). As a means for targeting antibody production, hydropathy plots showing regions of hydrophilicity and hydrophobicity may be generated by any method well known in the art, including, for example, the Kyte Doolittle or the Hopp Woods methods, either with or without Fourier transformation (see, e.g., Hopp and Woods, 1981. Proc. Nat.
Acad. Sci. USA
78: 3824-3828; Kyte and Doolittle, 1982. f Mol. Biol. 157: 105-142, each incorporated herein by reference in their entirety).
As disclosed herein, GPCRX protein sequences of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, or derivatives, fragments, analogs or homologs thereof, may be utilized as immunogens in the generation of antibodies that immunospecifically-bind these protein components. The term "antibody" as used herein refers to immunoglobulin molecules and immunologically-active portions of immunoglobulin molecules, i. e., molecules that contain an antigen binding site that specifically-binds (immunoreacts with) an antigen, such as GPCRX. Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, Fab and F~ab~~z fragments, and an Fab expression library. In a specific embodiment, antibodies to human GPCRX
proteins are disclosed. Various procedures known within the art may be used for the production of polyclonal or monoclonal antibodies to an GPCRX protein sequence of SEQ ID
NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, or a derivative, fragment, analog or homolog thereof. Some of these proteins are discussed below.
For the production of polyclonal antibodies, various suitable host animals (e.g., rabbit, goat, mouse or other mammal) may be immunized by injection with the native protein, or a synthetic variant thereof, or a derivative of the foregoing. An appropriate immunogenic preparation can contain, for example, recombinantly-expressed GPCRX protein or a chemically-synthesized GPCRX polypeptide. The preparation can further include an adjuvant.
Various adjuvants used to increase the immunological response include, but are not limited to, Freund's (complete and incomplete), mineral gels (e.g., aluminum hydroxide), surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), human adjuvants such as Bacille Calmette-Guerin and Corynebacterium parvum, or similar immunostimulatory agents. If desired, the antibody molecules directed against GPCRX can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as protein A chromatography to obtain the IgG
fraction.

The term "monoclonal antibody" or "monoclonal antibody composition", as used herein, refers to a population of antibody molecules that contain only one species of an antigen binding site capable of immunoreacting with a particular epitope of GPCRX. A
monoclonal antibody composition thus typically displays a single binding affinity for a particular GPCRX
protein with which it immunoreacts. For preparation of monoclonal antibodies directed towards a particular GPCRX protein, or derivatives, fragments, analogs or homologs thereof, any technique that provides for the production of antibody molecules by continuous cell line culture may be utilized. Such techniques include, but are not limited to, the hybridoma technique (see, e.g., Kohler & Milstein, 1975. Nature 256: 495-497); the trioma technique; the human B-cell hybridoma technique (see, e.g., Kozbor, et al., 1983. Immunol.
Today 4: 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see, e.g., Cole, et al., 1985. In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96).
Human monoclonal antibodies may be utilized in the practice of the invention and may be produced by using human hybridomas (see, e.g., Cote, et al., 1983. Proc Natl Acad Sci USA
80: 2026-2030) or by transforming human B-cells with Epstein Barr Virus in vitro (see, e.g., Cole, et al., 1985. In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R.
Liss, Inc., pp. 77-96). Each of the above citations is incorporated herein by reference in their entirety.
According to the invention, techniques can be adapted for the production of single-chain antibodies specific to an GPCRX protein (see, e.g., U.S. Patent No. 4,946,778).
In addition, methods can be adapted for the construction of Fab expression libraries (see, e.g., Huse, et al., 1989. Science 246: 1275-1281) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for an GPCRX protein or derivatives, fragments, analogs or homologs thereof. Non-human antibodies can be "humanized" by techniques well known in the art. See, e.g., U.S. Patent No. 5,225,539.
Antibody fragments that contain the idiotypes to an GPCRX protein may be produced by techniques known in the art including, but not limited to: (i) an F~ab')z fragment produced by pepsin digestion of an antibody molecule; (ii) an Fab fragment generated by reducing the disulfide bridges of an F~ab')z fragment; (iii) an Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent; and (iv) F,, fragments.
Additionally, recombinant anti-GPCRX antibodies, such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, which can be made using standard recombinant DNA techniques, are within the scope of the invention. Such chimeric and humanized monoclonal antibodies can be produced by recombinant DNA
techniques known in the art, for example using methods described in International Application No. PCT/US86/02269; European Patent Application No. 184,187; European Patent Application No. 171,496; European Patent Application No. 173,494; PCT
International Publication No. WO 86/01533; U.S. Patent No. 4,816,567; U.S. Pat. No.
5,225,539; European Patent Application No. 125,023; Better, et al., 1988. Science 240: 1041-1043;
Liu, et al., 1987.
Proc. Natl. Acad. Sci. USA 84: 3439-3443; Liu, et al., 1987. J. Immunol. 139:
3521-3526; Sun, et al., 1987. Proc. Natl. Acad. Sci. USA 84: 214-218; Nishimura, et al., 1987.
Cancer Res. 47:
999-1005; Wood, et al., 1985. Nature 314 :446-449; Shaw, et al., 1988. J.
Natl. Cancer Inst.
80: 1553-1559); Mornson(1985) Science 229:1202-1207; Oi, et al. (1986) BioTechniques 4:214; Jones, et al., 1986. Nature 321: 552-525; Verhoeyan, et al., 1988.
Science 239: 1534;
and Beidler, et al., 1988. J. Immunol. 141: 4053-4060. Each of the above citations are incorporated herein by reference in their entirety.
In one embodiment, methods for the screening of antibodies that possess the desired specificity include, but are not limited to, enzyme-linked immunosorbent assay (ELISA) and other immunologically-mediated techniques known within the art. In a specific embodiment, selection of antibodies that are specific to a particular domain of an GPCRX
protein is facilitated by generation of hybridomas that bind to the fragment of an GPCRX
protein possessing such a domain. Thus, antibodies that are specific for a desired domain within an GPCRX protein, or derivatives, fragments, analogs or homologs thereof, are also provided herein.
Anti-GPCRX antibodies may be used in methods known within the art relating to the localization and/or quantitation of an GPCRX protein (e.g., for use in measuring levels of the GPCRX protein within appropriate physiological samples, for use in diagnostic methods, for use in imaging the protein, and the like). In a given embodiment, antibodies for GPCRX
proteins, or derivatives, fragments, analogs or homologs thereof, that contain the antibody derived binding domain, are utilized as pharmacologically-active compounds (hereinafter "Therapeutics").
An anti-GPCRX antibody (e.g., monoclonal antibody) can be used to isolate an GPCRX polypeptide by standard techniques, such as affinity chromatography or immunoprecipitation. An anti-GPCRX antibody can facilitate the purification of natural GPCRX polypeptide from cells and of recombinantly-produced GPCRX polypeptide expressed in host cells. Moreover, an anti-GPCRX antibody can be used to detect GPCRX
protein (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the GPCRX protein. Anti-GPCRX antibodies can be used diagnostically to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to, for example, determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance.
Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials.
Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, (3-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include l2sh 13~I, 3sS or 3H.
GPCRX Recombinant Expression Vectors and Host Cells Another aspect of the invention pertains to vectors, preferably expression vectors, containing a nucleic acid encoding an GPCRX protein, or derivatives, fragments, analogs or homologs thereof. As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded DNA loop into which additional DNA
segments can be ligated. Another type of vector is a viral vector, wherein additional DNA
segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as "expression vectors". In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
In the present specification, "plasmid" and "vector" can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
The recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, "operably-linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequences) in a manner that allows for expression of the nucleotide sequence (e.g., in an in S vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
The term "regulatory sequence" is intended to includes promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, iri Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN
1O ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can.depend on such factors as the choice of the host cell to be 15 transformed, the level of expression of protein desired, etc. The expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., GPCRX
proteins, mutant forms of GPCRX proteins, fusion proteins, etc.).
The recombinant expression vectors of the invention can be designed for expression of 20 GPCRX proteins in prokaryotic or eukaryotic cells. For example, GPCRX
proteins can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSTON TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and 25 translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerise.
Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus of the recombinant protein. Such fusion vectors 30 typically serve three purposes: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL
(New England Biolabs, Beverly, Mass.) and pRIT$ (Pharmacia, Piscataway, N.J.) that fuse $ glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein.
Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amrann et al., (1988) Gene 69:301-31$) and pET l 1d (Studier et al., GENE
EXPRESSION
TECHNOLOGY: METHODS IN ENZYMOLOGY 18$, Academic Press, Sari Diego, Calif.
(1990) 60-89).
One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein. See, e.g., Gottesman, GENE EXPRESSION TECHNOLOGY: METHODS IN
ENZYMOLOGY
18$, Academic Press, San Diego, Calif. (1990) 119-128. Another strategy is to alter the 1$ nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E.
coli (see, e.g., Wada, et al., 1992. Nucl. Acids Res. 20: 2111-2118). Such alteration of nucleic acid sequences of the invention can be carned out by standard DNA synthesis techniques.
In another embodiment, the GPCRX expression vector is a yeast expression vector.
Examples of vectors for expression in yeast Saccharomyces cerivisae include pYepSecl (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kurjan and Herskowitz, 1982. Cell 30:
933-943), pJRY88 (Schultz et al., 1987. Gene $4: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).
Alternatively, GPCRX can be expressed in insect cells using baculovirus expression 2$ vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3:
21$6-216$) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
In yet another embodiment, a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987.
EMBO
J. 6: 187-19$). When used in mammalian cells, the expression vector's control functions are often provided by viral regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, and simian virus 40. For other suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al., MOLECULAR CLONING: A LABORATORY MArrUAt,. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
In another embodiment, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987.
Genes Dev. 1:
268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol.
43:
235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J.
8: 729-733) and immunoglobulins (Banerji, et al., 1983. Cell 33: 729-740;
Queen and Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al., 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally-regulated promoters are also encompassed, e.g., the murine hox promoters (Kessel and Gruss, 1990. Science 249: 374-379) and the a-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546).
The invention further provides a recombinant expression vector comprising a DNA
molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively-linked to a regulatory sequence in a manner that allows for expression (by transcription of the DNA molecule) of an RNA molecule that is antisense to GPCRX mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen that direct the continuous expression of the antisense RNA
molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen that direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. For a discussion of the regulation of gene expression using antisense genes see, e.g., Weintraub, et al., "Antisense RNA
as a molecular tool for genetic analysis," Reviews-Trends in Genetics, Vol. 1(1) 1986.
Another aspect of the invention pertains to host cells into which a recombinant expression vector of the invention has been introduced. The terms "host cell"
and "recombinant host cell" are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
A host cell can be any prokaryotic or eukaryotic cell. For example, GPCRX
protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art.
Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. As used herein, the terms "transformation" and "transfection" are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989), and other laboratory manuals.
For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Various selectable markers include those that confer resistance to drugs, such as 6418, hygromycin and methotrexate. Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding GPCRX or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
A host cell of the invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) GPCRX protein. Accordingly, the invention further provides methods for producing GPCRX protein using the host cells of the invention. In one embodiment, the method comprises culturing the host cell of invention (into which a recombinant expression vector encoding GPCRX protein has been introduced) in a suitable medium such that GPCRX protein is produced. In another embodiment, the method further comprises isolating GPCRX protein from the medium or the host cell.

Transgenic GPCRX Animals The host cells of the invention can also be used to produce non-human transgenic animals. For example, in one embodiment, a host cell of the invention is a fertilized oocyte or an embryonic stem cell into which GPCItX protein-coding sequences have been introduced.
Such host cells can then be used to create non-human transgenic animals in which exogenous GPCRX sequences have been introduced into their genome or homologous recombinant animals in which endogenous GPCRX sequences have been altered. Such animals are useful for studying the function and/or activity of GPCRX protein and for identifying and/or evaluating modulators of GPCRX protein activity. As used herein, a "transgenic animal" is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more of the cells of the animal includes a transgene. Other examples of transgenic animals include non-human primates, sheep, dogs, cows, goats, chickens, amphibians, etc. A transgene is exogenous DNA that is integrated into the genome of a cell from which a transgenic animal develops and that remains in the genome of the mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues of the transgenic animal. As used herein, a "homologous recombinant animal" is a non-human animal, preferably a mammal, more preferably a mouse, in which an endogenous GPCItX gene has been altered by homologous recombination between the endogenous gene and an exogenous DNA molecule introduced into a cell of the animal, e.g., an embryonic cell of the animal, prior to development of the animal.
A transgenic animal of the invention can be created by introducing GPCRX-encoding nucleic acid into the male pronuclei of a fertilized oocyte (e.g., by microinjection, retroviral infection) and allowing the oocyte to develop in a pseudopregnant female foster animal. The human GPCRX cDNA sequences of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 can be introduced as a transgene into the genome of a non-human animal. Alternatively, a non-human homologue of the human GPCRX gene, such as a mouse GPC1RX gene, can be isolated based on hybridization to the human GPC1RX cDNA
(described further supra) and used as a transgene. Intronic sequences and polyadenylation signals can also be included in the transgene to increase the efficiency of expression of the transgene. A
tissue-specific regulatory sequences) can be operably-linked to the GPCRX
transgene to direct expression of GPCRX protein to particular cells. Methods for generating transgenic animals via embryo manipulation and microinjection, particularly animals such as mice, have become conventional in the art and are described, for example, in U.S. Patent Nos. 4,736,866;
4,870,009; and 4,873,191; and Hogan, 1986. In: MANIPULATING T~ MotlsE EMBRYO, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. Similar methods are used for production of other transgenic animals. A transgenic founder animal can be identified based upon the presence of the GPCRX transgene in its genome and/or expression of GPCRX
mRNA in tissues or cells of the animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene-encoding GPCRX protein can further be bred to other transgenic animals carrying other transgenes.
To create a homologous recombinant animal, a vector is prepared which contains at least a portion of an GPCRX gene into which a deletion, addition or substitution has been introduced to thereby alter, e.g., functionally disrupt, the GPCRX gene. The GPCRX gene can be a human gene (e.g., the cDNA of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38), but more preferably, is a non-human homologue of a human GPCRX
gene. For example, a mouse homologue of human GPCRX gene of SEQ >D NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 can be used to construct a homologous recombination vector suitable for altering an endogenous GPCRX gene in the mouse genome.
In one embodiment, the vector is designed such that, upon homologous recombination, the endogenous GPCRX gene is functionally disrupted (i. e., no longer encodes a functional protein; also referred to as a "knock out" vector).
Alternatively, the vector can be designed such that, upon homologous recombination, the endogenous GPCRX gene is mutated or otherwise altered but still encodes functional protein (e.g., the upstream regulatory region can be altered to thereby alter the expression of the endogenous GPCRX protein). In the homologous recombination vector, the altered portion of the GPCRX gene is flanked at its S'- and 3'-termini by additional nucleic acid of the GPCRX gene to allow for homologous recombination to occur between the exogenous GPCRX gene carried by the vector and an endogenous GPCRX gene in an embryonic stem cell. The additional flanking GPCRX nucleic acid is of sufficient length for successful homologous recombination with the endogenous gene. Typically, several kilobases of flanking DNA (both at the 5'- and 3'-termini) are included in the vector. See, e.g., Thomas, et al., 1987. Cell 51: 503 for a description of homologous recombination vectors.
The vector is ten introduced into an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced GPCRX gene has homologously-recombined with the endogenous GPCRX
gene are selected. See, e.g., Li, et al., 1992. Cell 69: 915.
The selected cells are then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras. See, e.g., Bradley, 1987. In: TERATOCARCINOMAS AND

EMBRYONIC STEM CELLS: A PRACTICAL APPROACH, Robertson, ed. IRL, Oxford, pp.
113-152.
A chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term. Progeny harboring the homologously-recombined DNA in their germ cells can be used to breed animals in which all cells of the animal contain the homologously-recombined DNA by germline transmission of the transgene. Methods for constructing homologous recombination vectors and homologous recombinant animals are described further in Bradley, 1991. Curr. Opin. Biotechnol. 2: 823-829; PCT
International Publication Nos.: WO 90/11354; WO 91/01140; WO 92/0968; and WO 93/04169.
In another embodiment, transgenic non-humans animals can be produced that contain selected systems that allow for regulated expression of the transgene. One example of such a system is the cre/loxP recombinase system ofbacteriophage P1. For a description of the cre/loxP recombinase system, See, e.g., Lakso, et al., 1992. Proc. Natl. Acad.
Sci. USA 89:
6232-6236. Another example of a recombinase system is the FLP recombinase system of Saccharomyces cerevisiae. See, O'Gorman, et al., 1991. Science 251:1351-1355.
If a cre/loxP
recombinase system is used to regulate expression of the transgene, animals containing transgenes encoding both the Cre recombinase and a selected protein are required. Such animals can be provided through the construction of "double" transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase.
Clones of the non-human transgenic animals described herein can also be produced according to the methods described in Wilmut, et al., 1997. Nature 385: 810-813. In brief, a cell (e.g., a somatic cell) from the transgenic animal can be isolated and induced to exit the growth cycle and enter Go phase. The quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal of the same species from which the quiescent cell is isolated. The reconstructed oocyte is then cultured such that it develops to morula or blastocyte and then transferred to pseudopregnant female foster animal. The offspring borne of this female foster animal will be a clone of the animal from which the cell (e.g., the somatic cell) is isolated.
Pharmaceutical Compositions The GPCRX nucleic acid molecules, GPCRX proteins, and anti-GPCRX antibodies (also referred to herein as "active compounds") of the invention, and derivatives, fragments, analogs and homologs thereof, can be incorporated into pharmaceutical compositions suitable for administration. Such compositions typically comprise the nucleic acid molecule, protein, or antibody and a pharmaceutically acceptable Garner. As used herein, "pharmaceutically acceptable Garner" is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Preferred examples of such carriers or diluents include, but are not limited to, water, saline, finger's solutions, dextrose solution, and S%
human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
A pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (i.e., topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components:
a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfate;
chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose.
The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
Sterile injectable solutions can be prepared by incorporating the active compound (e.g., an GPCRX protein or anti-GPCRX antibody) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
Oral compositions generally include an inert diluent or an edible carrier.
They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid Garner for use as a mouthwash, wherein the compound in the fluid Garner is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.

For administration by inhalation, the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
The compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
In one embodiment, the active compounds are prepared with Garners that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc.
Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S.
Patent No. 4,522,811.
It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated;
each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical Garner. The specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.

The nucleic acid molecules of the invention can be inserted into vectors and used as gene therapy vectors. Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see, e.g., U.S. Patent No.
5,328,470) or by stereotactic injection (see, e.g., Chen, et al., 1994. Proc. Natl. Acad. Sci.
USA 91: 3054-3057).
The pharmaceutical preparation of the gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where the complete gene delivery vector can be produced intact from recombinant cells, e.g., retroviral vectors, the pharmaceutical preparation can include one or more cells that produce the gene delivery system.
The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
Screening and Detection Methods The isolated nucleic acid molecules of the invention can be used to express GPCRX
protein (e.g., via a recombinant expression vector in a host cell in gene therapy applications), 1 S to detect GPCRX mRNA (e.g., in a biological sample) or a genetic lesion in an GPC1ZX gene, and to modulate GPCItX activity, as described further, below. In addition, the GPCRX
proteins can be used to screen drugs or compounds that modulate the GPCRX
protein activity or expression as well as to treat disorders characterized by insufficient or excessive production of GPC1RX protein or production of GPCRX protein forms that have decreased or aberrant activity compared to GPCRX wild-type protein (e.g.; diabetes (regulates insulin release);
obesity (binds and transport lipids); metabolic disturbances associated with obesity, the metabolic syndrome X as well as anorexia and wasting disorders associated with chronic diseases and various cancers, and infectious disease(possesses anti-microbial activity) and the various dyslipidemias. In addition, the anti-GPCRX antibodies of the invention can be used to detect and isolate GPCRX proteins and modulate GPCRX activity. In yet a further aspect, the invention can be used in methods to influence appetite, absorption of nutrients and the disposition of metabolic substrates in both a positive and negative fashion.
The invention further pertains to novel agents identified by the screening assays described herein and uses thereof for treatments as described, supra.
Screening Assays The invention provides a method (also referred to herein as a "screening assay") for identifying modulators, i.e., candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other drugs) that bind to GPCRX proteins or have a stimulatory or inhibitory effect on, e.g., GPCRX protein expression or GPCRX
protein activity. The invention also includes compounds identified in the screening assays described herein.
In one embodiment, the invention provides assays for screening candidate or test compounds which bind to or modulate the activity of the membrane-bound form of an GPCRX protein or polypeptide or biologically-active portion thereof. The test compounds of the invention can be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the "one-bead one-compound" library method; and synthetic library methods using affinity chromatography selection. The biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds. See, e.g., Lam, 1997. Anticancer Drug Design 12: 145.
A "small molecule" as used herein, is meant to refer to a composition that has a molecular weight of less than about S kD and most preferably less than about 4 kD. Small molecules can be, e.g., nucleic acids, peptides, polypeptides, peptidomimetics, carbohydrates, lipids or other organic or inorganic molecules. Libraries of chemical and/or biological mixtures, such as fungal, bacterial, or algal extracts, are known in the art and can be screened with any of the assays of the invention.
Examples of methods for the synthesis of molecular libraries can be found in the art, for example in: DeWitt, et al., 1993. Proc. Natl. Acad. Sci. U.S.A. 90: 6909;
Erb, et al., 1994.
Proc. Natl. Acad. Sci. U.S.A. 91: 11422; Zuckermann, et al., 1994. J. Med.
Chem. 37: 2678;
Cho, et al., 1993. Science 261: 1303; Carrell, et al., 1994. Angew. Chem. Int.
Ed. Engl. 33:
2059; Carell, et al., 1994. Angew. Chem. Int. Ed. Engl. 33: 2061; and Gallop, et al., 1994. .l.
Med. Chem. 37: 1233.
Libraries of compounds may be presented in solution (e.g., Houghten, .1992.
Biotechniques 13: 412-421), or on beads (Lam, 1991. Nature 354: 82-84), on chips (Fodor, 1993. Nature 364: S55-556), bacteria (Ladner, U.S. Patent No. 5,223,409), spores (Ladner, U.S. Patent 5,233,409), plasmids (Cull, et al., 1992. Proc. Natl. Acad. Sci.
USA 89:
1865-1869) or on phage (Scott and Smith, 1990. Science 249: 386-390; Devlin, 1990. Science 249: 404-406; Cwirla, et al., 1990. Proc. Natl. Acad. Sci. U.S.A. 87: 6378-6382; Felici, 1991.
J. Mol. Biol. 222: 301-310; Ladner, U.S. Patent No. 5,233,409.).

In one embodiment, an assay is a cell-based assay in which a cell which expresses a membrane-bound form of GPCRX protein, or a biologically-active portion thereof, on the cell surface is contacted with a test compound and the ability of the test compound to bind to an GPCRX protein determined. The cell, for example, can of mammalian origin or a yeast cell.
Determining the ability of the test compound to bind to the GPCRX protein can be accomplished, for example, by coupling the test compound with a radioisotope or enzymatic label such that binding of the test compound to the GPCRX protein or biologically-active portion thereof can be determined by detecting the labeled compound in a complex. For example, test compounds can be labeled with lzsh 3sS, laC, or 3H, either directly or indirectly, and the radioisotope detected by direct counting of radioemission or by scintillation counting.
Alternatively, test compounds can be enzymatically-labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product. In one embodiment, the assay comprises contacting a cell which expresses a membrane-bound form of GPCRX
protein, or a biologically-active portion thereof, on the cell surface with a known compound which binds GPCRX to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with an GPCRX
protein, wherein determining the ability of the test compound to interact with an GPCRX
protein comprises determining the ability of the test compound to preferentially bind to GPCRX protein or a biologically-active portion thereof as compared to the known compound.
In another embodiment, an assay is a cell-based assay comprising contacting a cell expressing a membrane-bound form of GPCRX protein, or a biologically-active portion thereof, on the cell surface with a test compound and determining the ability of the test compound to modulate (e.g., stimulate or inhibit) the activity of the GPCRX
protein or biologically-active portion thereof. Determining the ability of the test compound to modulate the activity of GPCRX or a biologically-active portion thereof can be accomplished, for example, by determining the ability of the GPCRX protein to bind to or interact with an GPCRX target molecule. As used herein, a "target molecule" is a molecule with which an GPCRX protein binds or interacts in nature, for example, a molecule on the surface of a cell which expresses an GPCRX interacting protein, a molecule on the surface of a second cell, a molecule in the extracellular milieu, a molecule associated with the internal surface of a cell membrane or a cytoplasmic molecule. An GPCRX target molecule can be a non-GPCRX
molecule or an GPCRX protein or polypeptide of the invention. In one embodiment, an GPCRX target molecule is a component of a signal transduction pathway that facilitates transduction of an extracellular signal (e.g. a signal generated by binding of a compound to a membrane-bound GPCRX molecule) through the cell membrane and into the cell.
The target, for example, can be a second intercellular protein that has catalytic activity or a protein that facilitates the association of downstream signaling molecules with GPCRX.
S Determining the ability of the GPCRX protein to bind to or interact with an GPCRX
target molecule can be accomplished by one of the methods described above for determining direct binding. In one embodiment, determining the ability of the GPCRX
protein to bind to or interact with an GPCRX target molecule can be accomplished by determining the activity of the target molecule. For example, the activity of the target molecule can be determined by detecting induction of a cellular second messenger of the target (i.e.
intracellular Ca2+, diacylglycerol, IP3, etc.), detecting catalytic/enzymatic activity of the target an appropriate substrate, detecting the induction of a reporter gene (comprising an GPCRX-responsive regulatory element operatively linked to a nucleic acid encoding a detectable marker, e.g., luciferase), or detecting a cellular response, for example, cell survival, cellular differentiation, or cell proliferation.
In yet another embodiment, an assay of the invention is a cell-free assay comprising contacting an GPCRX protein or biologically-active portion thereof with a test compound and determining the ability of the test compound to bind to the GPCRX protein or biologically-active portion thereof. Binding of the test compound to the GPCRX protein can be determined either directly or indirectly as described above. In one such embodiment, the assay comprises contacting the GPCRX protein or biologically-active portion thereof with a known compound which binds GPCRX to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with an GPCRX
protein, wherein determining the ability of the test compound to interact with an GPCRX
protein comprises determining the ability of the test compound to preferentially bind to GPCRX or biologically-active portion thereof as compared to the known compound.
In still another embodiment, an assay is a cell-free assay comprising contacting GPCRX protein or biologically-active portion thereof with a test compound and determining the ability of the test compound to modulate (e.g. stimulate or inhibit) the activity of the GPCRX protein or biologically-active portion thereof. Determining the ability of the test compound to modulate the activity of GPCRX can be accomplished, for example, by determining the ability of the GPCRX protein to bind to an GPCRX target molecule by one of the methods described above for determining direct binding. In an alternative embodiment, determining the ability of the test compound to modulate the activity of GPCRX
protein can be accomplished by determining the ability of the GPCRX protein further modulate an GPCRX target molecule. For example, the catalytic/enzymatic activity of the target molecule on an appropriate substrate can be determined as described, supra.
In yet another embodiment, the cell-free assay comprises contacting the GPCRX
protein or biologically-active portion thereof with a known compound which binds GPCRX
protein to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with an GPCRX
protein, wherein determining the ability of the test compound to interact with an GPCRX protein comprises determining the ability of the GPCRX protein to preferentially bind to or modulate the activity of an GPCRX target molecule.
The cell-free assays of the invention are amenable to use of both the soluble form or the membrane-bound form of GPCRX protein. In the case of cell-free assays comprising the membrane-bound form of GPCRX protein, it may be desirable to utilize a solubilizing agent such that the membrane-bound form of GPCRX protein is maintained in solution.
Examples of such solubilizing agents include non-ionic detergents such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside, octanoyl-N-methylglucamide, decanoyl-N-methylglucamide, Triton~ X-100, Triton~ X-114, Thesit~, Isotridecypoly(ethylene glycol ether)", N-dodecyl--N,N-dimethyl-3-ammonio-1-propane sulfonate, 3-(3-cholamidopropyl) dimethylamminiol-1-propane sulfonate (CHAPS), or 3-(3-cholamidopropyl)dimethylamminiol-2-hydroxy-1-propane sulfonate (CHAPSO).
In more than one embodiment of the above assay methods of the invention, it may be desirable to immobilize either GPCRX protein or its target molecule to facilitate separation of complexed from uncomplexed forms of one or both of the proteins, as well as to accommodate automation of the assay. Binding of a test compound to GPCRX protein, or interaction of GPCRX protein with a target molecule in the presence and absence of a candidate compound, can be accomplished in any vessel suitable for containing the reactants.
Examples of such vessels include microtiter plates, test tubes, and micro-centrifuge tubes. In one embodiment, a fusion protein can be provided that adds a domain that allows one or both of the proteins to be bound to a matrix. For example, GST-GPCRX fusion proteins or GST-target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, MO) or glutathione derivatized microtiter plates, that are then combined with the test compound or the test compound and either the non-adsorbed target protein or GPCRX protein, and the mixture is incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described, supra.
Alternatively, the complexes can be dissociated from the matrix, and the level of GPCRX
protein binding or activity determined using standard techniques.
S Other techniques for immobilizing proteins on matrices can also be used in the screening assays of the invention. For example, either the GPCRX protein or its target molecule can be immobilized utilizing conjugation of biotin and streptavidin.
Biotinylated GPCRX protein or target molecules can be prepared from biotin-NHS
(N-hydroxy-succinimide) using techniques well-known within the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, Ill.), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical). Alternatively, antibodies reactive with GPCRX
protein or target molecules, but which do not interfere with binding of the GPCRX protein to its target molecule, can be derivatized to the wells of the plate, and unbound target or GPCRX protein trapped in the wells by antibody conjugation. Methods for detecting such complexes, in addition to those described above for the GST-immobilized complexes, include immunodetection of complexes using antibodies reactive with the GPCRX protein or target molecule, as well as enzyme-linked assays that rely on detecting an enzymatic activity associated with the GPCRX protein or target molecule.
In another embodiment, modulators of GPCRX protein expression are identified in a method wherein a cell is contacted with a candidate compound and the expression of GPCRX
mRNA or protein in the cell is determined. The level of expression of GPCRX
mRNA or protein in the presence of the candidate compound is compared to the level of expression of GPCRX mRNA or protein in the absence of the candidate compound. The candidate compound can then be identified as a modulator of GPCRX mRNA or protein expression based upon this comparison. For example, when expression of GPCRX mRNA or protein is greater (i.e., statistically significantly greater) in the presence of the candidate compound than in its absence, the candidate compound is identified as a stimulator of GPCRX
mRNA or protein expression. Alternatively, when expression of GPCRX mRNA or protein is less (statistically significantly less) in the presence of the candidate compound than in its absence, the candidate compound is identified as an inhibitor of GPCRX mRNA or protein expression.
The level of GPCRX mRNA or protein expression in the cells can be determined by methods described herein for detecting GPCRX mRNA or protein.
In yet another aspect of the invention, the GPCRX proteins can be used as "bait proteins" in a two-hybrid assay or three hybrid assay (see, e.g., U.S. Patent No. 5,283,317;

Zervos, et al., 1993. Cell 72: 223-232; Madura, et al., 1993. J. Biol. Chem.
268: 12046-12054;
Bartel, et al., 1993. Biotechniques 14: 920-924; Iwabuchi, et al., 1993.
Oncogene 8:
1693-1696; and Brent WO 94/10300), to identify other proteins that bind to or interact with GPC1RX ("GPCRX-binding proteins" or "GPCItX-by") and modulate GPCRX activity.
Such GPCItX-binding proteins are also likely to be involved in the propagation of signals by the GPC1RX proteins as, for example, upstream or downstream elements of the GPCRX
pathway.
The two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains. Briefly, the assay utilizes two different DNA constructs. In one construct, the gene that codes for GPCRX
is fused to a gene encoding the DNA binding domain of a known transcription factor (e.g., GAL-4). In the other construct, a DNA sequence, from a library of DNA sequences, that encodes an unidentified protein ("prey" or "sample") is fused to a gene that codes for the activation domain of the known transcription factor. If the "bait" and the "prey"
proteins are able to interact, in vivo, forming an GPCRX-dependent complex, the DNA-binding and activation domains of the transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ) that is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression of the reporter gene can be detected and cell colonies containing the functional transcription factor can be isolated and used to obtain the cloned gene that encodes the protein which interacts with GPCRX.
The invention further pertains to novel agents identified by the aforementioned screening assays and uses thereof for treatments as described herein.
Detection Assays Portions or fragments of the cDNA sequences identified herein (and the corresponding complete gene sequences) can be used in numerous ways as polynucleotide reagents. By way of example, and not of limitation, these sequences can be used to: (i) map their respective genes on a chromosome; and, thus, locate gene regions associated with genetic disease; (ii) identify an individual from a minute biological sample (tissue typing); and (iii) aid in forensic identification of a biological sample. Some of these applications are described in the subsections, below.
Chromosome Mapping Once the sequence (or a portion of the sequence) of a gene has been isolated, this sequence can be used to map the location of the gene on a chromosome. This process is called chromosome mapping. Accordingly, portions or fragments of the GPCRX sequences, SEQ ID
NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, or fragments or derivatives thereof, can be used to map the location of the GPCRX genes, respectively, on a chromosome. The mapping of the GPCRX sequences to chromosomes is an important first step in correlating these sequences with genes associated with disease.
Briefly, GPCRX genes can be mapped to chromosomes by preparing PCR primers (preferably 15-25 by in length) from the GPCRX sequences. Computer analysis of the GPCRX, sequences can be used to rapidly select primers that do not span more than one exon in the genomic DNA, thus complicating the amplification process. These primers can then be used for PCR screening of somatic cell hybrids containing individual human chromosomes.
Only those hybrids containing the human gene corresponding to the GPCRX
sequences will yield an amplified fragment.
Somatic cell hybrids are prepared by fusing somatic cells from different mammals (e.g., human and mouse cells). As hybrids of human and mouse cells grow and divide, they gradually lose human chromosomes in random order, but retain the mouse chromosomes. By using media in which mouse cells cannot grow, because they lack a particular enzyme, but in which human cells can, the one human chromosome that contains the gene encoding the needed enzyme will be retained. By using various media, panels of hybrid cell lines can be established. Each cell line in a panel contains either a single human chromosome or a small number of human chromosomes, and a full set of mouse chromosomes, allowing easy mapping of individual genes to specific human chromosomes. See, e.g., D'Eustachio, et al., 1983. Science 220: 919-924. Somatic cell hybrids containing only fragments of human chromosomes can also be produced by using human chromosomes with translocations and deletions.
PCR mapping of somatic cell hybrids is a rapid procedure for assigning a particular sequence to a particular chromosome. Three or more sequences can be assigned per day using a single thermal cycler. Using the GPCRX sequences to design oligonucleotide primers, sub-localization can be achieved with panels of fragments from specific chromosomes.
Fluorescence in situ hybridization (FISH) of a DNA sequence to a metaphase chromosomal spread can further be used to provide a precise chromosomal location in one step. Chromosome spreads can be made using cells whose division has been blocked in metaphase by a chemical like colcemid that disrupts the mitotic spindle. The chromosomes can be treated briefly with trypsin, and then stained with Giemsa. A pattern of light and dark bands develops on each chromosome, so that the chromosomes can be identified individually.

The FISH technique can be used with a DNA sequence as short as S00 or 600 bases.
However, clones larger than 1,000 bases have a higher likelihood of binding to a unique chromosomal location with sufficient signal intensity for simple detection.
Preferably 1,000 bases, and more preferably 2,000 bases, will suffice to get good results at a reasonable amount of time. For a review of this technique, see, Verma, et al., HUMAN
CIIROI~tosolvlES: A
MANUAL OF BASIC TECHNIQUES (Pergamon Press, New York 1988).
Reagents for chromosome mapping can be used individually to mark a single chromosome or a single site on that chromosome, or panels of reagents can be used for marking multiple sites and/or multiple chromosomes. Reagents corresponding to noncoding regions of the genes actually are preferred for mapping purposes. Coding sequences are more likely to be conserved within gene families, thus increasing the chance of cross hybridizations during chromosomal mapping.
Once a sequence has been mapped to a precise chromosomal location, the physical position of the sequence on the chromosome can be correlated with genetic map data. Such data are found, e.g., in McKusick, MENDELIAN INHERITANCE IN MAN, available on-line through Johns Hopkins University Welch Medical Library). The relationship between genes and disease, mapped to the same chromosomal region, can then be identified through linkage analysis (co-inheritance of physically adjacent genes), described in, e.g., Egeland, et al., 1987.
Nature, 325: 783-787.
Moreover, differences in the DNA sequences between individuals affected and unaffected with a disease associated with the GPCRX gene, can be determined.
If a mutation is observed in some or all of the affected individuals but not in any unaffected individuals, then the mutation is likely to be the causative agent of the particular disease. Comparison of affected and unaffected individuals generally involves first looking for structural alterations in the chromosomes, such as deletions or translocations that are visible from chromosome spreads or detectable using PCR based on that DNA sequence. Ultimately, complete sequencing of genes from several individuals can be performed to confirm the presence of a mutation and to distinguish mutations from polymorphisms.
Tissue Typing The GPCRX sequences of the invention can also be used to identify individuals from minute biological samples. In this technique, an individual's genomic DNA is digested with one or more restriction enzymes, and probed on a Southern blot to yield unique bands for identification. The sequences of the invention are useful as additional DNA
markers for RFLP
("restriction fragment length polyrnorphisms," described in U.S. Patent No.
5,272,057).
Furthermore, the sequences of the invention can be used to provide an alternative technique that determines the actual base-by-base DNA sequence of selected portions of an individual's genome. Thus, the GPCRX sequences described herein can be used to prepare two PCR primers from the 5'- and 3'-termini of the sequences. These primers can then be used to amplify an individual's DNA and subsequently sequence it.
Panels of corresponding DNA sequences from individuals, prepared in this manner, can provide unique individual identifications, as each individual will have a unique set of such DNA sequences due to allelic differences. The sequences of the invention can be used to obtain such identification sequences from individuals and from tissue. The GPCRX sequences of the invention uniquely represent portions of the human genome. Allelic variation occurs to some degree in the coding regions of these sequences, and to a greater degree in the noncoding regions. It is estimated that allelic variation between individual humans occurs with a frequency of about once per each 500 bases. Much of the allelic variation is due to single nucleotide polymorphisms (SNPs), which include restriction fragment length polymorphisms (RFLPs).
Each of the sequences described herein can, to some degree, be used as a standard against which DNA from an individual can be compared for identification purposes. Because greater numbers of polymorphisms occur in the noncoding regions, fewer sequences are necessary to differentiate individuals. The noncoding sequences can comfortably provide positive individual identification with a panel of perhaps 10 to 1,000 primers that each yield a noncoding amplified sequence of 100 bases. If predicted coding sequences, such as those in SEQ ID NOS:l, 3, S, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38 are used, a more appropriate number of primers for positive individual identification would be 500-2,000.
Predictive Medicine The invention also pertains to the field of predictive medicine in which diagnostic assays, prognostic assays, pharmacogenomics, and monitoring clinical trials are used for prognostic (predictive) purposes to thereby treat an individual prophylactically. Accordingly, one aspect of the invention relates to diagnostic assays for determining GPCRX
protein and/or nucleic acid expression as well as GPCRX activity, in the context of a biological sample (e.g., blood, serum, cells, tissue) to thereby determine whether an individual is afflicted with a disease or. disorder, or is at risk of developing a disorder, associated with aberrant GPCRX

expression or activity. The disorders include metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers. The invention also provides for prognostic (or predictive) assays for determining whether an individual is at risk of developing a disorder associated with GPCRX protein, nucleic acid expression or activity. For example, mutations in an GPC1ZX gene can be assayed in a biological sample. Such assays can be used for prognostic or predictive purpose to thereby prophylactically treat an individual prior to the onset of a disorder characterized by or associated with GPC1RX protein, nucleic acid expression, or biological activity.
Another aspect of the invention provides methods for determining GPC1RX
protein, nucleic acid expression or activity in an individual to thereby select appropriate therapeutic or prophylactic agents for that individual (referred to herein as "pharmacogenomics").
Pharmacogenomics allows for the selection of agents (e.g., drugs) for therapeutic or prophylactic treatment of an individual based on the genotype of the individual (e.g., the genotype of the individual examined to determine the ability of the individual to respond to a particular agent.) Yet another aspect of the invention pertains to monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of GPC1RX in clinical trials.
These and other agents are described in further detail in the following sections.
Diagnostic Assays An exemplary method for detecting the presence or absence of GPCRX in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with a compound or an agent capable of detecting GPC1RX protein or nucleic acid (e.g., mIRNA, genomic DNA) that encodes GPCRX protein such that the presence of GPCRX
is detected in the biological sample. An agent for detecting GPC1ZX mltNA or genomic DNA
is a labeled nucleic acid probe capable of hybridizing to GPC1R.X mRNA or genomic DNA.
The nucleic acid probe can be, for example, a full-length GPC1RX nucleic acid, such as the nucleic acid of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, or a portion thereof, such as an oligonucleotide of at least 1 S, 30, 50, 100, 250 or 500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to GPCRX mRNA or genomic DNA. Other suitable probes for use in the diagnostic assays of the invention are described herein.
An agent for detecting GPCRX protein is an antibody capable of binding to GPCRX
protein, preferably an antibody with a detectable label. Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g., Fab or F(ab')2) can be used. The term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled. Examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin. The term "biological sample" is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. That is, the detection method of the invention can be used to detect GPCRX mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo.
For example, in vitro techniques for detection of GPCRX mRNA include Northern hybridizations and in situ hybridizations. In vitro techniques for detection of GPCRX protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence. In vitro techniques for detection of GPCRX genomic DNA
include Southern hybridizations. Furthermore, in vivo techniques for detection of GPCRX protein include introducing into a subject a labeled anti-GPCRX antibody. For example, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
In one embodiment, the biological sample contains protein molecules from the test subject. Alternatively, the biological sample can contain mRNA molecules from the test subject or genomic DNA molecules from the test subject. A preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject.
In another embodiment, the methods further involve obtaining a control biological sample from a control subject, contacting the control sample with a compound or agent capable of detecting GPCRX protein, mRNA, or genomic DNA, such that the presence of GPCRX protein, mRNA or genomic DNA is detected in the biological sample, and comparing the presence of GPCRX protein, mRNA or genomic DNA in the control sample with the presence of GPCRX protein, mRNA or genomic DNA in the test sample.

The invention also encompasses kits for detecting the presence of GPC1RX in a biological sample. For example, the kit can comprise: a labeled compound or agent capable of detecting GPCIRX protein or mRNA in a biological sample; means for determining the amount of GPCRX in the sample; and means for comparing the amount of GPCRX in the sample with a standard. The compound or agent can be packaged in a suitable container. The kit can further comprise instructions for using the kit to detect GPCItX protein or nucleic acid.
Prognostic Assays The diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant GPCRX
expression or activity. For example, the assays described herein, such as the preceding diagnostic assays or the following assays, can be utilized to identify a subject having or at risk of developing a disorder associated with GPCItX protein, nucleic acid expression or activity.
Alternatively, the prognostic assays can be utilized to identify a subject having or at risk for developing a disease or disorder. Thus, the invention provides a method for identifying a disease or disorder associated with aberrant GPCRX expression or activity in which a test sample is obtained from a subject and GPCRX protein or nucleic acid (e.g., mRNA, genomic DNA) is detected, wherein the presence of GPC1RX protein or nucleic acid is diagnostic for a subject having or at risk of developing a disease or disorder associated with aberrant GPCRX
expression or activity. As used herein, a "test sample" refers to a biological sample obtained from a subject of interest. For example, a test sample can be a biological fluid (e.g., serum), cell sample, or tissue.
Furthermore, the prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disease or disorder associated with aberrant GPCRX expression or activity. For example, such methods can be used to determine whether a subject can be effectively treated with an agent for a disorder.
Thus, the invention provides methods for determining whether a subject can be effectively treated with an agent for a disorder associated with aberrant GPCItX
expression or activity in which a test sample is obtained and GPCItX protein or nucleic acid is detected (e.g., wherein the presence of GPC1RX protein or nucleic acid is diagnostic for a subject that can be administered the agent to treat a disorder associated with aberrant GPC1RX
expression or activity).

The methods of the invention can also be used to detect genetic lesions in an GPCRX
gene, thereby determining if a subject with the lesioned gene is at risk for a disorder characterized by aberrant cell proliferation and/or differentiation. In various embodiments, the methods include detecting, in a sample of cells from the subject, the presence or absence of a genetic lesion characterized by at least one of an alteration affecting the integrity of a gene encoding an GPCRX-protein, or the misexpression of the GPCRX gene. For example, such genetic lesions can be detected by ascertaining the existence of at least one of: (i) a deletion of one or more nucleotides from an GPCRX gene; (ii) an addition of one or more nucleotides to an GPCRX gene; (iii) a substitution of one or more nucleotides of an GPCRX
gene, (iv) a chromosomal rearrangement of an GPCRX gene; (v) an alteration in the level of a messenger RNA transcript of an GPCRX gene, (vi) aberrant modification of an GPCRX gene, such as of the methylation pattern of the genomic DNA, (vii) the presence of a non-wild-type splicing pattern of a messenger RNA transcript of an GPCRX gene, (viii) a non-wild-type level of an GPCRX protein, (ix) allelic loss of an GPCRX gene, and (x) inappropriate post-translational modification of an GPCRX protein. As described herein, there are a large number of assay techniques known in the art which can be used for detecting lesions in an GPCRX gene. A
preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject. However, any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.
In certain embodiments, detection of the lesion involves the use of a probe/primer in a polymerise chain reaction (PCR) (see, e.g., U.S. Patent Nos. 4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligation chain reaction (LCR) (see, e.g., Landegran, et al., 1988. Science 241: 1077-1080; and Nakazawa, et al., 1994.
Proc. Natl.
Acid. Sci. USA 91: 360-364), the latter of which can be particularly useful for detecting point mutations in the GPCRX-gene (see, Abravaya, et al., 1995. Nucl. Acids Res. 23:
675-682).
This method can include the steps of collecting a sample of cells from a patient, isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, contacting the nucleic acid sample with one or more primers that specifically hybridize to an GPCRX gene under conditions such that hybridization and amplification of the GPCRX gene (if present) occurs, and detecting the presence or absence of an amplification product, or detecting the size of the amplification product and comparing the length to a control sample. It is anticipated that PCR and/or LCR may be desirable to use as a preliminary amplification step in conjunction with any of the techniques used for detecting mutations described herein.

Alternative amplification methods include: self sustained sequence replication (see, Guatelli, et al., 1990. Proc. Natl. Acad. Sci. USA 87: 1874-1878), transcriptional amplification system (see, Kwoh, et al., 1989. Proc. Natl. Acad. Sci. USA 86: 1173-1177);
Q[3 Replicase (see, Lizardi, et al, 1988. BioTechnology 6: 1197), or any other nucleic acid amplification method, followed by the detection of the amplified molecules using techniques well known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers.
In an alternative embodiment, mutations in an GPCRX gene from a sample cell can be identified by alterations in restriction enzyme cleavage patterns. For example, sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis and compared.
Differences in fragment length sizes between sample and control DNA indicates mutations in the sample DNA. Moreover, the use of sequence specific ribozymes (see, e.g., U.S. Patent No. 5,493,531) can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.
In other embodiments, genetic mutations in GPCRX can be identified by hybridizing a sample and control nucleic acids, e.g., DNA or RNA, to high-density arrays containing hundreds or thousands of oligonucleotides probes. See, e.g., Cronin, et al., 1996. Human Mutation 7: 244-255; Kozal, et al., 1996. Nat. Med. 2: 753-759. For example, genetic mutations in GPCRX can be identified in two dimensional arrays containing light-generated DNA probes as described in Cronin, et al., supra. Briefly, a first hybridization array of probes can be used to scan through long stretches of DNA in a sample and control to identify base changes between the sequences by making linear arrays of sequential overlapping probes.
This step allows the identification of point mutations. This is followed by a second hybridization array that allows the characterization of specific mutations by using smaller, specialized probe arrays complementary to all variants or mutations detected.
Each mutation array is composed of parallel probe sets, one complementary to the wild-type gene and the other complementary to the mutant gene.
In yet another embodiment, any of a variety of sequencing reactions known in the art can be used to directly sequence the GPCRX gene and detect mutations by comparing the sequence of the sample GPCRX with the corresponding wild-type (control) sequence.
Examples of sequencing reactions include those based on techniques developed by Maxim and Gilbert, 1977. Proc. Natl. Acad. Sci. USA 74: 560 or Sanger, 1977. Proc. Natl.
Acad. Sci. USA
74: 5463. It is also contemplated that any of a variety of automated sequencing procedures can be utilized when performing the diagnostic assays (see, e.g., Naeve, et al., 1995.
Biotechniques 19: 448), including sequencing by mass spectrometry (see, e.g., PCT
International Publication No. WO 94/16101; Cohen, et al., 1996. Adv.
Chromatography 36:
127-162; and Griffin, et al., 1993. Appl. Biochem. Biotechnol. 38: 147-159).
Other methods for detecting mutations in the GPCRX gene include methods in which protection from cleavage agents is used to detect mismatched bases in RNA/RNA
or RNAlDNA heteroduplexes. See, e.g., Myers, et al., 1985. Science 230: 1242. In general, the art technique of "mismatch cleavage" starts by providing heteroduplexes of formed by hybridizing (labeled) RNA or DNA containing the wild-type GPCRX sequence with potentially mutant RNA or DNA obtained from a tissue sample. The double-stranded duplexes are treated with an agent that cleaves single-stranded regions of the duplex such as which will exist due to basepair mismatches between the control and sample strands. For instance, RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with S ~ nuclease to enzymatically digesting the mismatched regions. In other embodiments, either DNA/DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of the mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, e.g., Cotton, et al., 1988. Proc. Natl.
Acad. Sci. USA 85:
4397; Saleeba, et al., 1992. Methods Enzymol. 217: 286-295. In an embodiment, the control DNA or RNA can be labeled for detection.
In still another embodiment, the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA
mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in GPCRX cDNAs obtained from samples of cells. For example, the mutt enzyme of E, coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T
at G/T mismatches. See, e.g., Hsu, et al., 1994. Carcinogenesis 15: 1657-1662.
According to an exemplary embodiment, a probe based on an GPCRX sequence, e.g., a wild-type GPCRX
sequence, is hybridized to a cDNA or other DNA product from a test cell(s).
The duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, e.g., U.S. Patent No. 5,459,039.
In other embodiments, alterations in electrophoretic mobility will be used to identify mutations in GPCRX genes. For example, single strand conformation polymorphism (SSCP) may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids. See, e.g., Orita, et al., 1989. Proc. Natl. Acad. Sci. USA: 86:
2766; Cotton, 1993. Mutat. Res. 285: 125-144; Hayashi, 1992. Genet. Anal. Tech. Appl. 9: 73-79.
Single-stranded DNA fragments of sample and control GPCRX nucleic acids will be denatured and allowed to renature. The secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change. The DNA fragments may be labeled or detected with labeled probes. The sensitivity of the assay may be enhanced by using RNA
(rather than DNA), in which the secondary structure is more sensitive to a change in sequence. In one embodiment, the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility.
See, e.g., Keen, et al., 1991. Trends Genet. 7: 5.
In yet another embodiment, the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE). See, e.g., Myers, et al., 1985. Nature 313: 495.
When DGGE is used as the method of analysis, DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 by of high-melting GC-rich DNA by PCR. In a further embodiment, a temperature gradient is used in place of a denaturing gradient to identify differences in the mobility of control and sample DNA. See, e.g., Rosenbaum and Reissner, 1987. Biophys. Chem. 265: 12753.
Examples of other techniques for detecting point mutations include, but are not limited to, selective oligonucleotide hybridization, selective amplification, or selective primer extension. For example, oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions that permit hybridization only if a perfect match is found. See, e.g., Saiki, et al., 1986. Nature 324: 163;
Saiki, et al., 1989. Proc. Natl. Acid. Sci. USA 86: 6230. Such allele specific oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations when the oligonucleotides are attached to the hybridizing membrane and hybridized with labeled target DNA.
Alternatively, allele specific amplification technology that depends on selective PCR
amplification may be used in conjunction with the instant invention.
Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center of the molecule (so that amplification depends on differential hybridization; see, e.g., Gibbs, et al., 1989. Nucl. Acids Res. 17: 2437-2448) or at the extreme 3'-terminus of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerise extension (see, e.g., Prossner, 1993. Tibtech. 11: 238). In addition it may be desirable to introduce a novel restriction site in the region of the mutation to create cleavage-based detection. See, e.g., Gasparini, et al., 1992. Mol. Cell Probes 6: 1. It is anticipated that in certain embodiments amplification may also be performed using Taq ligase for amplification. See, e.g., Barany, 1991. Proc. Natl. Acad. Sci. USA 88: 189. In such cases, ligation will occur only if there is a perfect match at the 3'-terminus of the 5' sequence, making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
The methods described herein may be performed, for example, by utilizing pre-packaged diagnostic kits comprising at least one probe nucleic acid or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving an GPCRX
gene.
Furthermore, any cell type or tissue, preferably peripheral blood leukocytes, in which GPCRX is expressed may be utilized in the prognostic assays described herein.
However, any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.
Pharmacogenomics Agents, or modulators that have a stimulatory or inhibitory effect on GPCRX
activity (e.g., GPCRX gene expression), as identified by a screening assay described herein can be administered to individuals to treat (prophylactically or therapeutically) disorders (The disorders include metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers.) In conjunction with such treatment, the pharmacogenomics (i.e., the study of the relationship between an individual's genotype and that individual's response to a foreign compound or drug) of the individual may be considered. Differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration of the pharmacologically active drug. Thus, the pharmacogenomics of the individual permits the selection of effective agents (e.g., drugs) for prophylactic or therapeutic treatments based on a consideration of the individual's genotype. Such pharmacogenomics can further be used to determine appropriate dosages and therapeutic regimens. Accordingly, the activity of GPCRX
protein, expression of GPCRX nucleic acid, or mutation content of GPCRX genes in an individual can be determined to thereby select appropriate agents) for therapeutic or prophylactic treatment of the individual.
Pharmacogenomics deals with clinically significant hereditary variations in the response to drugs due to altered drug disposition and abnormal action in affected persons. See e.g., Eichelbaum, 1996. Clin. Exp. Pharmacol. Physiol., 23: 983-985; Linder, 1997. Clin.
Chem., 43: 254-266. In general, two types of pharmacogenetic conditions can be differentiated. Genetic conditions transmitted as a single factor altering the way drugs act on the body (altered drug action) or genetic conditions transmitted as single factors altering the way the body acts on drugs (altered drug metabolism). These pharmacogenetic conditions can occur either as rare defects or as polymorphisms. For example, glucose-6-phosphate dehydrogenase (G6PD) deficiency is a common inherited enzymopathy in which the main clinical complication is hemolysis after ingestion of oxidant drugs (anti-malarials, sulfonamides, analgesics, nitrofurans) and consumption of fava beans.
As an illustrative embodiment, the activity of drug metabolizing enzymes is a major 1 S determinant of both the intensity and duration of drug action. The discovery of genetic polymorphisms of drug metabolizing enzymes (e.g., N-acetyltransferase 2 (NAT
2) and cytochrome P450 enzymes CYP2D6 and CYP2C19) has provided an explanation as to why some patients do not obtain the expected drug effects or show exaggerated drug response and serious toxicity after taking the standard and safe dose of a drug. These polymorphisms are expressed in two phenotypes in the population, the extensive metabolizer (EM) and poor metabolizer (PM). The prevalence of PM is different among different populations. For example, the gene coding for CYP2D6 is highly polymorphic and several mutations have been identified in PM, which all lead to the absence of functional CYP2D6. Poor metabolizers of CYP2D6 and CYP2C19 quite frequently experience exaggerated drug response and side effects when they receive standard doses. If a metabolite is the active therapeutic moiety, PM
show no therapeutic response, as demonstrated for the analgesic effect of codeine mediated by its CYP2D6-formed metabolite morphine. At the other extreme are the so called ultra-rapid metabolizers who do not respond to standard doses. Recently, the molecular basis of ultra-rapid metabolism has been identified to be due to CYP2D6 gene amplification.
Thus, the activity of GPCRX protein, expression of GPCRX nucleic acid, or mutation content of GPCRX genes in an individual can be determined to thereby select appropriate agents) for therapeutic or prophylactic treatment of the individual. In addition, pharmacogenetic studies can be used to apply genotyping of polymorphic alleles encoding drug-metabolizing enzymes to the identification of an individual's drug responsiveness phenotype. This knowledge, when applied to dosing or drug selection, can avoid adverse reactions or therapeutic failure and thus enhance therapeutic or prophylactic efficiency when treating a subject with an GPCRX modulator, such as a modulator identified by one of the exemplary screening assays described herein.
Monitoring of Effects During Clinical Trials Monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of GPCRX (e.g., the ability to modulate aberrant cell proliferation and/or differentiation) can be applied not only in basic drug screening, but also in clinical trials. For example, the effectiveness of an agent determined by a screening assay as described herein to increase GPCRX gene expression, protein levels, or upregulate GPCRX activity, can be monitored in clinical trails of subjects exhibiting decreased GPCRX gene expression, protein levels, or downregulated GPCRX activity. Alternatively, the effectiveness of an agent determined by a screening assay to decrease GPCRX gene expression, protein levels, or downregulate GPCRX activity, can be monitored in clinical trails of subjects exhibiting increased GPCRX gene expression, protein levels, or upregulated GPCRX
activity. In such clinical trials, the expression or activity of GPCRX and, preferably, other genes that have been implicated in, for example, a cellular proliferation or immune disorder can be used as a "read out" or markers of the immune responsiveness of a particular cell.
By way of example, and not of limitation, genes, including GPCRX, that are modulated in cells by treatment with an agent (e.g., compound, drug or small molecule) that modulates GPCRX activity (e.g., identified in a screening assay as described herein) can be identified. Thus, to study the effect of agents on cellular proliferation disorders, for example, in a clinical trial, cells can be isolated and RNA prepared and analyzed for the levels of expression of GPCRX and other genes implicated in the disorder. The levels of gene expression (i. e., a gene expression pattern) can be quantified by Northern blot analysis or RT-PCR, as described herein, or alternatively by measuring the amount of protein produced, by one of the methods as described herein, or by measuring the levels of activity of GPCRX or other genes. In this manner, the gene expression pattern can serve as a marker, indicative of the physiological response of the cells to the agent. Accordingly, this response state may be determined before, and at various points during, treatment of the individual with the agent.
In one embodiment, the invention provides a method for monitoring the effectiveness of treatment of a subject with an agent (e.g., an agonist, antagonist, protein, peptide, peptidomimetic, nucleic acid, small molecule, or other drug candidate identified by the screening assays described herein) comprising the steps of (i) obtaining a pre-administration sample from a subject prior to administration of the agent; (ii) detecting the level of expression of an GPCRX protein, mIRNA, or genomic DNA in the preadministration sample;
(iii) obtaining one or more post-administration samples from the subject; (iv) detecting the level of expression or activity of the GPCRX protein, mRNA, or genomic DNA in the post-administration samples; (v) comparing the level of expression or activity of the GPCRX
protein, mRNA, or genomic DNA in the pre-administration sample with the GPC1RX
protein, mRNA, or genomic DNA in the post administration sample or samples; and (vi) altering the administration of the agent to the subject accordingly. For example, increased administration of the agent may be desirable to increase the expression or activity of GPCRX
to higher levels than detected, i.e., to increase the effectiveness of the agent.
Alternatively, decreased administration of the agent may be desirable to decrease expression or activity of GPCIRX to lower levels than detected, i.e., to decrease the effectiveness of the agent.
Methods of Treatment The invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant GPCRX expression or activity. The disorders include cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus, pulmonary stenosis, subaortic stenosis, ventricular septal defect (VSD), valve diseases, tuberous sclerosis, scleroderma, obesity, transplantation, adrenoleukodystrophy, congenital adrenal hyperplasia, prostate cancer, neoplasm; adenocarcinoma, lymphoma, uterus cancer, fertility, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease, AIDS, bronchial asthma, Crohn's disease; multiple sclerosis, treatment of Albright Hereditary Ostoeodystrophy, and other diseases, disorders and conditions of the like.
These methods of treatment will be discussed more fully, below.
Disease and Disorders Diseases and disorders that are characterized by increased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with Therapeutics that antagonize (i.e., reduce or inhibit) activity. Therapeutics that antagonize activity may be administered in a therapeutic or prophylactic manner.
Therapeutics that may be utilized include, but are not limited to: (i) an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; (ii) antibodies to an aforementioned peptide; (iii) nucleic acids encoding an aforementioned peptide; (iv) administration of antisense nucleic acid and nucleic acids that are "dysfunctional" (i.e., due to a heterologous insertion within the coding sequences of coding sequences to an aforementioned peptide) that are utilized to "knockout" endoggenous function of an aforementioned peptide by homologous recombination (see, e.g., Capecchi, 1989. Science 244: 1288-1292); or (v) modulators ( i.e., inhibitors, agonists and antagonists, including additional peptide mimetic of the invention or antibodies specific to a peptide of the invention) that alter the interaction between an aforementioned peptide and its binding partner.
Diseases and disorders that are characterized by decreased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with Therapeutics that increase (i.e., are agonists to) activity. Therapeutics that upregulate activity may be administered in a therapeutic or prophylactic manner. Therapeutics that may be utilized include, but are not limited to, an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; or an agonist that increases bioavailability.
Increased or decreased levels can be readily detected by quantifying peptide and/or RNA, by obtaining a patient tissue sample (e.g., from biopsy tissue) and assaying it in vitro for RNA or peptide levels, structure and/or activity of the expressed peptides (or mRNAs of an aforementioned peptide). Methods that are well-known within the art include, but are not limited to, immunoassays (e.g., by Western blot analysis, immunoprecipitation followed by sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis, immunocytochemistry, etc.) and/or hybridization assays to detect expression of mRNAs (e.g., Northern assays, dot blots, in situ hybridization, and the like).
Prophylactic Methods In one aspect, the invention provides a method for preventing, in a subject, a disease or condition associated with an aberrant GPCRX expression or activity, by administering to the subject an agent that modulates GPCRX expression or at least one GPCRX
activity. Subjects at risk for a disease that is caused or contributed to by aberrant GPCRX
expression or activity can be identified by, for example, any or a combination of diagnostic or prognostic assays as described herein. Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic of the GPCRX aberrancy, such that a disease or disorder is prevented or, alternatively, delayed in its progression. Depending upon the type of GPCRX
aberrancy, for example, an GPCRX agonist or GPCRX antagonist agent can be used for treating the subject. The appropriate agent can be determined based on screening assays described herein. The prophylactic methods of the invention are further discussed in the following subsections.
Therapeutic Methods Another aspect of the invention pertains to methods of modulating GPCRX
expression or activity for therapeutic purposes. The modulatory method of the invention involves contacting a cell with an agent that modulates one or more of the activities of GPCRX protein activity associated with the cell. An agent that modulates GPCRX protein activity can be an agent as described herein, such as a nucleic acid or a protein, a naturally-occurnng cognate ligand of an GPCRX protein, a peptide, an GPCRX peptidomimetic, or other small molecule.
In one embodiment, the agent stimulates one or more GPCRX protein activity.
Examples of such stimulatory agents include active GPCRX protein and a nucleic acid molecule encoding GPCRX that has been introduced into the cell. In another embodiment, the agent inhibits one or more GPCRX protein activity. Examples of such inhibitory agents include antisense GPCRX nucleic acid molecules and anti-GPCRX antibodies. These modulatory methods can be performed in vitro (e.g., by culturing the cell with the agent) or, alternatively, in vivo (e.g., by administering the agent to a subject). As such, the invention provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant expression or activity of an GPCRX protein or nucleic acid molecule. In one embodiment, the method involves administering an agent (e.g., an agent identified by a screening assay described herein), or combination of agents that modulates (e.g., up-regulates or down-regulates) GPCRX expression or activity. In another embodiment, the method involves administering an GPCRX protein or nucleic acid molecule as therapy to compensate for reduced or aberrant GPCRX expression or activity.
Stimulation of GPCRX activity is desirable in situations in which GPCRX is abnormally downregulated and/or in which increased GPCRX activity is likely to have a beneficial effect. One example of such a situation is where a subj ect has a disorder characterized by aberrant cell proliferation and/or differentiation (e.g., cancer or immune associated disorders). Another example of such a situation is where the subject has a gestational disease (e.g., preclampsia).

Determination of the Biological Effect of the Therapeutic In various embodiments of the invention, suitable in vitro or in vivo assays are performed to determine the effect of a specific Therapeutic and whether its administration is indicated for treatment of the affected tissue.
In various specific embodiments, in vitro assays may be performed with representative cells of the types) involved in the patient's disorder, to determine if a given Therapeutic exerts the desired effect upon the cell type(s). Compounds for use in therapy may be tested in suitable animal model systems including, but not limited to rats, mice, chicken, cows, monkeys, rabbits, and the like, prior to testing in human subjects. Similarly, for in vivo testing, any of the animal model system known in the art may be used prior to administration to human subjects.
Prophylactic and Therapeutic Uses of the Compositions of the Invention The GPCRX nucleic acids and proteins of the invention are useful in potential prophylactic and therapeutic applications implicated in a variety of disorders including, but not limited to: metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers.
As an example, a cDNA encoding the GPCRX protein of the invention may be useful in gene therapy, and the protein may be useful when administered to a subject in need thereof.
By way of non-limiting example, the compositions of the invention will have efficacy for treatment of patients suffering from: metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, hematopoietic disorders, and the various dyslipidemias.
Both the novel nucleic acid encoding the GPCRX protein, and the GPCItX protein of the invention, or fragments thereof, may also be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed. A
further use could be as an anti-bacterial molecule (i.e., some peptides have been found to possess anti-bacterial properties). These materials are further useful in the generation of antibodies which immunospecifically-bind to the novel substances of the invention for use in therapeutic or diagnostic methods.

EQUIVALENTS
Although particular embodiments have been disclosed herein in detail, this has been done by way of example for purposes of illustration only, and is not intended to be limiting with respect to the scope of the appended claims, which follow. In particular, it is contemplated by the inventors that various substitutions, alterations, and modifications may be made to the invention without departing from the spirit and scope of the invention as defined by the claims. The choice of nucleic acid starting material, clone of interest, or library type is believed to be a matter of routine for a person of ordinary skill in the art with knowledge of the embodiments described herein. Other aspects, advantages, and modifications considered to be within the scope of the following claims.

Claims (52)

WHAT IS CLAIMED IS:
1. An isolated polypeptide comprising an amino acid sequence selected from the group consisting of:
(a) a mature form of an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83;
(b) a variant of a mature form of an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, wherein one or more amino acid residues in said variant differs from the amino acid sequence of said mature form, provided that said variant differs in no more than 15% of the amino acid residues from the amino acid sequence of said mature form;
(c) an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83; and (d) a variant of an amino acid sequence selected from the group consisting of SEQ
ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, wherein one or more amino acid residues in said variant differs from the amino acid sequence of said mature form, provided that said variant differs in no more than 15% of amino acid residues from said amino acid sequence.
2 The polypeptide of claim 1, wherein said polypeptide comprises the amino acid sequence of a naturally-occurring allelic variant of an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83.
3. The polypeptide of claim 2, wherein said allelic variant comprises an amino acid sequence that is the translation of a nucleic acid sequence differing by a single nucleotide from a nucleic acid sequence selected from the group consisting of SEQ ID
NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38.
4. The polypeptide of claim 1, wherein the amino acid sequence of said variant comprises a conservative amino acid substitution.
5. An isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of:
(a) a mature form of an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83;
(b) a variant of a mature form of an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, wherein one or more amino acid residues in said variant differs from the amino acid sequence of said mature form, provided that said variant differs in no more than 15% of the amino acid residues from the amino acid sequence of said mature form;
(c) an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83;
(d) a variant of an amino acid sequence selected from the group consisting SEQ
ID
NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, wherein one or more amino acid residues in said variant differs from the amino acid sequence of said mature form, provided that said variant differs in no more than 15% of amino acid residues from said amino acid sequence;
(e) a nucleic acid fragment encoding at least a portion of a polypeptide comprising an amino acid sequence chosen from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, or a variant of said polypeptide, wherein one or more amino acid residues in said variant differs from the amino acid sequence of said mature form, provided that said variant differs in no more than 15% of amino acid residues from said amino acid sequence; and (f) a nucleic acid molecule comprising the complement of (a), (b), (c), (d) or (e).
6. The nucleic acid molecule of claim S, wherein the nucleic acid molecule comprises the nucleotide sequence of a naturally-occurring allelic nucleic acid variant.
7. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule encodes a polypeptide comprising the amino acid sequence of a naturally-occurring polypeptide variant.
8. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule differs by a single nucleotide from a nucleic acid sequence selected from the group consisting of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38.
9. The nucleic acid molecule of claim 5, wherein said nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of:
(a) a nucleotide sequence selected from the group consisting of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38;
(b) a nucleotide sequence differing by one or more nucleotides from a nucleotide sequence selected from the group consisting of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, provided that no more than 20% of the nucleotides differ from said nucleotide sequence;
(c) a nucleic acid fragment of (a); and (d) a nucleic acid fragment of (b).
10. The nucleic acid molecule of claim 5, wherein said nucleic acid molecule hybridizes under stringent conditions to a nucleotide sequence chosen from the group consisting of SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 38, or a complement of said nucleotide sequence.
11. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of:
(a) a first nucleotide sequence comprising a coding sequence differing by one or more nucleotide sequences from a coding sequence encoding said amino acid sequence, provided that no more than 20% of the nucleotides in the coding sequence in said first nucleotide sequence differ from said coding sequence;
(b) an isolated second polynucleotide that is a complement of the first polynucleotide; and (c) a nucleic acid fragment of (a) or (b).
12. A vector comprising the nucleic acid molecule of claim 11.
13. The vector of claim 12, further comprising a promoter operably-linked to said nucleic acid molecule.
14. A cell comprising the vector of claim 12.
15. An antibody that binds immunospecifically to the polypeptide of claim 1.
16. The antibody of claim 15, wherein said antibody is a monoclonal antibody.
17. The antibody of claim 15, wherein the antibody is a humanized antibody.
18. A method for determining the presence or amount of the polypeptide of claim 1 in a sample, the method comprising:
(a) providing the sample;
(b) contacting the sample with an antibody that binds immunospecifically to the polypeptide; and (c) determining the presence or amount of antibody bound to said polypeptide, thereby determining the presence or amount of polypeptide in said sample.
19. A method for determining the presence or amount of the nucleic acid molecule of claim 5 in a sample, the method comprising:
(a) providing the sample;
(b) contacting the sample with a probe that binds to said nucleic acid molecule; and (c) determining the presence or amount of the probe bound to said nucleic acid molecule, thereby determining the presence or amount of the nucleic acid molecule in said sample.
20. The method of claim 19 wherein presence or amount of the nucleic acid molecule is used as a marker for cell or tissue type.
21. The method of claim 20 wherein the cell or tissue type is cancerous.
22. A method of identifying an agent that binds to a polypeptide of claim 1, the method comprising:
(a) contacting said polypeptide with said agent; and (b) determining whether said agent binds to said polypeptide.
23. The method of claim 22 wherein the agent is a cellular receptor or a downstream effector.
24. A method for identifying an agent that modulates the expression or activity of the polypeptide of claim 1, the method comprising:
(a) providing a cell expressing said polypeptide;
(b) contacting the cell with said agent, and (c) determining whether the agent modulates expression or activity of said polypeptide, whereby an alteration in expression or activity of said peptide indicates said agent modulates expression or activity of said polypeptide.
25. A method for modulating the activity of the polypeptide of claim 1, the method comprising contacting a cell sample expressing the polypeptide of said claim with a compound that binds to said polypeptide in an amount sufficient to modulate the activity of the polypeptide.
26. A method of treating or preventing a GPCRX-associated disorder, said method comprising administering to a subject in which such treatment or prevention is desired the polypeptide of claim 1 in an amount sufficient to treat or prevent said GPCRX-associated disorder in said subject.
27. The method of claim 26 wherein the disorder is selected from the group consisting of cardiomyopathy and atherosclerosis.
28. The method of claim 26 wherein the disorder is related to cell signal processing and metabolic pathway modulation.
29. The method of claim 26, wherein said subject is a human.
30. A method of treating or preventing a GPCRX-associated disorder, said method comprising administering to a subject in which such treatment or prevention is desired the nucleic acid of claim 5 in an amount sufficient to treat or prevent said GPCRX-associated disorder in said subject.
31. The method of claim 30 wherein the disorder is selected from the group consisting of cardiomyopathy and atherosclerosis.
32. The method of claim 30 wherein the disorder is related to cell signal processing and metabolic pathway modulation.
33. The method of claim 30, wherein said subject is a human.
34. A method of treating or preventing a GPCRX-associated disorder, said method comprising administering to a subject in which such treatment or prevention is desired the antibody of claim 15 in an amount sufficient to treat or prevent said GPCRX-associated disorder in said subject.
35. The method of claim 34 wherein the disorder is diabetes.
36. The method of claim 34 wherein the disorder is related to cell signal processing and metabolic pathway modulation.
37. The method of claim 34, wherein the subject is a human.
38. A pharmaceutical composition comprising the polypeptide of claim 1 and a pharmaceutically-acceptable carrier.
39. A pharmaceutical composition comprising the nucleic acid molecule of claim 5 and a pharmaceutically-acceptable carrier.
40. A pharmaceutical composition comprising the antibody of claim 15 and a pharmaceutically-acceptable Garner.
41. A kit comprising in one or more containers, the pharmaceutical composition of claim 38.
42. A kit comprising in one or more containers, the pharmaceutical composition of claim 39.
43. A kit comprising in one or more containers, the pharmaceutical composition of claim 40.
44. A method for determining the presence of or predisposition to a disease associated with altered levels of the polypeptide of claim 1 in a first mammalian subject, the method comprising:
(a) measuring the level of expression of the polypeptide in a sample from the first mammalian subject; and (b) comparing the amount of said polypeptide in the sample of step (a) to the amount of the polypeptide present in a control sample from a second mammalian subject known not to have, or not to be predisposed to, said disease;
wherein an alteration in the expression level of the polypeptide in the first subject as compared to the control sample indicates the presence of or predisposition to said disease.
45. The method of claim 44 wherein the predisposition is to cancers.
46. A method for determining the presence of or predisposition to a disease associated with altered levels of the nucleic acid molecule of claim 5 in a first mammalian subject, the method comprising:
(a) measuring the amount of the nucleic acid in a sample from the first mammalian subject; and (b) comparing the amount of said nucleic acid in the sample of step (a) to the amount of the nucleic acid present in a control sample from a second mammalian subject known not to have or not be predisposed to, the disease;
wherein an alteration in the level of the nucleic acid in the first subject as compared to the control sample indicates the presence of or predisposition to the disease.
47. The method of claim 46 wherein the predisposition is to a cancer.
48. A method of treating a pathological state in a mammal, the method comprising administering to the mammal a polypeptide in an amount that is sufficient to alleviate the pathological state, wherein the polypeptide is a polypeptide having an amino acid sequence at least 95% identical to a polypeptide comprising an amino acid sequence of at least one of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, or a biologically active fragment thereof.
49. A method of treating a pathological state in a mammal, the method comprising administering to the mammal the antibody of claim 15 in an amount sufficient to alleviate the pathological state.
50. A method for the screening of a candidate substance interacting with an olfactory receptor polypeptide selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, or fragments or variants thereof, comprises the following steps:
a) providing a polypeptide selected from the group consisting of the sequences of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, or a peptide fragment or a variant thereof;
b) obtaining a candidate substance;
c) bringing into contact said polypeptide with said candidate substance;
and d) detecting the complexes formed between said polypeptide and said candidate substance.
51. A method for the screening of ligand molecules interacting with an olfactory receptor polypeptide selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, wherein said method comprises:

a) providing a recombinant eukaryotic host cell containing a nucleic acid encoding a polypeptide selected from the group consisting of the polypeptides comprising the amino acid sequences SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83;
b) preparing membrane extracts of said recombinant eukaryotic host cell;
c) bringing into contact the membrane extracts prepared at step b) with a selected ligand molecule; and d) detecting the production level of second messengers metabolites.
52. A method for the screening of ligand molecules interacting with an olfactory receptor polypeptide selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83, wherein said method comprises:
a) providing an adenovirus containing a nucleic acid encoding a polypeptide selected from the group consisting of polypeptides comprising the amino acid sequences SEQ ID NOS:2, 4, 6, 8, 10, 12, 17, 19, 21, 23, 25, 29, 31, 33, 35, 37, and 83;
b) infecting an olfactory epithelium with said adenovirus;
c) bringing into contact the olfactory epithelium b) with a selected ligand molecule; and d) detecting the increase of the response to said ligand molecule.
CA002401453A 2000-02-28 2001-02-28 G-proteins coupled receptor related polypeptides Abandoned CA2401453A1 (en)

Applications Claiming Priority (35)

Application Number Priority Date Filing Date Title
US18553500P 2000-02-28 2000-02-28
US18567400P 2000-02-28 2000-02-28
US60/185,674 2000-02-28
US60/185,535 2000-02-28
US18671600P 2000-03-03 2000-03-03
US18671700P 2000-03-03 2000-03-03
US18660600P 2000-03-03 2000-03-03
US18671500P 2000-03-03 2000-03-03
US18682700P 2000-03-03 2000-03-03
US18660400P 2000-03-03 2000-03-03
US18671900P 2000-03-03 2000-03-03
US18658500P 2000-03-03 2000-03-03
US60/186,585 2000-03-03
US60/186,717 2000-03-03
US60/186,715 2000-03-03
US60/186,827 2000-03-03
US60/186,604 2000-03-03
US60/186,606 2000-03-03
US60/186,716 2000-03-03
US60/186,719 2000-03-03
US21832300P 2000-07-14 2000-07-14
US21843500P 2000-07-14 2000-07-14
US60/218,323 2000-07-14
US60/218,435 2000-07-14
US22051700P 2000-07-24 2000-07-24
US60/220,517 2000-07-24
US22389700P 2000-08-09 2000-08-09
US60/223,897 2000-08-09
US26002001P 2001-01-05 2001-01-05
US60/260,020 2001-01-05
US26484901P 2001-01-26 2001-01-26
US60/264,849 2001-01-26
US09/795,271 US20030165829A1 (en) 2000-02-28 2001-02-27 Novel proteins and nucleic acids encoding same
US09/795,271 2001-02-27
PCT/US2001/006474 WO2001064879A2 (en) 2000-02-28 2001-02-28 G-proteins coupled receptor related polypeptides

Publications (1)

Publication Number Publication Date
CA2401453A1 true CA2401453A1 (en) 2001-09-07

Family

ID=27586032

Family Applications (1)

Application Number Title Priority Date Filing Date
CA002401453A Abandoned CA2401453A1 (en) 2000-02-28 2001-02-28 G-proteins coupled receptor related polypeptides

Country Status (5)

Country Link
EP (1) EP1263952A2 (en)
JP (1) JP2004500098A (en)
AU (1) AU2001241859A1 (en)
CA (1) CA2401453A1 (en)
WO (1) WO2001064879A2 (en)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2250369T3 (en) * 2000-03-14 2006-04-16 Amgen Inc. RECEPTOR COUPLED TO PROTEIN G.
US20030017457A1 (en) * 2000-04-06 2003-01-23 Fernandes, Elma R. Novel polynucleotides and polypeptides encoded thereby
WO2002050276A2 (en) * 2000-12-18 2002-06-27 Curagen Corporation Proteins and nucleic acids encoding same

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5874243A (en) * 1997-03-28 1999-02-23 Smithkline Beecham Corporation OLRCC15 receptor
WO2001027158A2 (en) * 1999-10-08 2001-04-19 Digiscents Olfactory receptor sequences

Also Published As

Publication number Publication date
JP2004500098A (en) 2004-01-08
WO2001064879A2 (en) 2001-09-07
WO2001064879A3 (en) 2002-05-10
AU2001241859A1 (en) 2001-09-12
EP1263952A2 (en) 2002-12-11

Similar Documents

Publication Publication Date Title
US20040014081A1 (en) Novel proteins and nucleic acids encoding same
WO2001010902A2 (en) Nucleoc acids and secreted polypeptides encoded thereby
EP1274844A2 (en) G-protein coupled receptors and nucleic acids encoding same
US20020137202A1 (en) Novel proteins and nucleic acids encoding same
WO2001059113A2 (en) G-protein coupled receptor proteins and nucleic acids encoding same
US20030082174A1 (en) Novel proteins and nucleic acids encoding same
CA2401453A1 (en) G-proteins coupled receptor related polypeptides
US20040048248A1 (en) Endozepine-like polypeptides and polynucleotides encoding same
CA2386199A1 (en) Endozepine-like polypeptides and polynucleotides encoding same
WO2002008289A2 (en) Novel proteins and nucleic acids encoding same
US20030109692A1 (en) Novel proteins and nucleic acids encoding same
US20030082757A1 (en) Novel proteins and nucleic acids encoding same
US20030216304A1 (en) Novel proteins and nucleic acids encoding same
US20030165829A1 (en) Novel proteins and nucleic acids encoding same
WO2001088135A2 (en) G-protein coupled receptor proteins and nucleic acids encoding same
US20030068618A1 (en) Novel proteins and nucleic acids encoding same
US20030068671A1 (en) Novel proteins and nucleic acids encoding same
US20030211985A1 (en) Novel proteins and nucleic acids encoding same
WO2001079294A2 (en) Human proteins, polynucleotides encoding them and methods of using the same
US20030207394A1 (en) Novel proteins and nucleic acids encoding same
US20030211485A1 (en) Novel proteins and nucleic acids encoding same
US20030050232A1 (en) Novel human proteins, polynucleotides encoding them and methods of using the same
AU2001256969A1 (en) Novel proteins and nucleic acids encoding same
WO2001060865A2 (en) Novel proteins and nucleic acids encoding same
US20030195335A1 (en) Novel proteins and nucleic acids encoding same

Legal Events

Date Code Title Description
FZDE Discontinued