CA2400929C - Antagonistic selective binding agents of osteoprotegerin binding protein - Google Patents
Antagonistic selective binding agents of osteoprotegerin binding protein Download PDFInfo
- Publication number
- CA2400929C CA2400929C CA2400929A CA2400929A CA2400929C CA 2400929 C CA2400929 C CA 2400929C CA 2400929 A CA2400929 A CA 2400929A CA 2400929 A CA2400929 A CA 2400929A CA 2400929 C CA2400929 C CA 2400929C
- Authority
- CA
- Canada
- Prior art keywords
- ser
- opgbp
- gly
- seq
- ala
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2875—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/12—Drugs for disorders of the metabolism for electrolyte homeostasis
- A61P3/14—Drugs for disorders of the metabolism for electrolyte homeostasis for calcium homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70575—NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Physical Education & Sports Medicine (AREA)
- Rheumatology (AREA)
- Immunology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Diabetes (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Pain & Pain Management (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Endocrinology (AREA)
- Oncology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Selective binding agents of osteoprotegerin binding protein (OPGbp) are provided by the invention. More particularly, the invention provides for antibodies and antigen binding domains which selectively bind to OPGbp and may be used to prevent or treat conditions relating to loss of bone mass. Nucleic acid molecules encoding said antibodies and antigen binding domains, and expression vectors and host cells for the production of same are also provided.
Description
ANTAGONISTIC SELECTIVE BINDING AGENTS OF OSTEOPROTEGERIN BINDING PROTEIN
Field of the Invention The invention relates to selective binding agents for osteoprotegerin binding protein (OPGbp).
More particularly, the invention relates to antibodies and antigen binding domains which bind selectively to OPGbp and may be used to prevent or treat conditions relating to loss of bone mass. Nucleic acid molecules;
vectors and host cells for the production of the selective binding agents of the invention are also provided.
Background of the Invention Living bone tissue exhibits a dynamic equilibrium between deposition and resorption of bone.
These processes are mediated primarily by two cell types: osteoblasts, which secrete molecules that comprise the organic matrix of bone; and osteoclasts, which promote dissolution of the bone matrix and solubilization of bone salts. In young individuals with growing bone, the rate of bone deposition exceeds the rate of bone resorption, while in older individuals the rate of resorption can exceed deposition. In the latter situation, the increased breakdown of bone leads to reduced bone mass and strength, increased risk of fractures, and slow or incomplete repair of broken bones.
Osteoclasts are large phagocytic multinucleated cells which are formed from hematopoietic precursor cells in the bone marrow.
Although the growth and formation of mature functional osteoclasts is not well understood, it is thought that osteoclasts mature along the monocyte/macrophage cell lineage in response to exposure to various growth-promoting factors. Early development of bone marrow precursor cells to preosteoclasts are believed to mediated by soluble factors such as tumor necrosis factor-a (TNF-(X), tumor necrosis factor-(3 (TNF-0), interleukin-1 (IL-1), interleukin-4 (IL-4), interleukin-6 (IL-6), and leukemia inhibitory factor (LIF). In culture, preosteoclasts are formed in the presence of added macrophage colony stimulating factor (M-CSF). These factors act primarily in early steps of osteoclast development.
A polypeptide factor, osteoprotegerin binding protein (OPGbp), has been described which stimulates osteoclast formation and bone resorption and appears to act at a late stage of development. See PCT
W098/46751. OPGbp stimulates osteoclast formation from bone marrow precursor cells without the requirement for coculturing in the presence of a stromal cell line.
Stimulation of bone resorption by OPGbp required interaction with its cognate receptor, osteoprotegerin differentiation and activation receptor (ODAR) and inhibition of the ODAR/OPGbp interaction by osteoprotegerin (OPG) also inhibited bone resorption.
Consequently, the regulation of OPGbp binding to ODAR
affects osteoclast formation and loss of bone.
It is an object of the invention to identify selective binding agents which regulate the interaction of OPGbp and ODAR, especially those agents which block the interaction of OPGbp and ODAR and/or inhibit at least one activity of OPGbp, such as bone resorption.
It is a further object of the invention to identify those selective binding agents that may be used to prevent and treat loss of bone mass. It is a further object of the invention to identify an antibody, or an antigen binding domain, or a fragment or variant thereof, which regulates the interaction of OPGbp and ODAR and neutralizes at least one activity of OPGbp.
The antibodies may be used to prevent and treat loss of bone mass.
Summary of the Invention The invention provides for a selective binding agent of osteoprotegerin binding protein (OPGbp). In one embodiment, the selective binding agent of the invention partially or completely inhibits at least one activity of OPGbp; that is, the selective binding agent is an antagonist of OPGbp. In another embodiment, the selective binding agent binds to OPGbp in a manner that partially or completely inhibits the interaction of OPGbp with its cognate receptor, osteoclast differentiation and activation receptor, or ODAR, and thereby partially or completely inhibits OPGbp activity. Selective binding agents of the invention may be protein in nature and are referred to herein as proteinaceous selective binding agents.
The invention also provides for an antibody or antigen binding domain thereof, or a fragment, variant, or derivative thereof, which binds to an epitope on OPGbp and partially or completely inhibits at least one activity of OPGbp. That is, the antibody is an antagonist antibody. Preferably, OPGbp is mammalian OPGbp. More preferably, OPGbp is human OPGbp which may be in soluble or cell surface associated forms, or fragments, derivatives and variants thereof.
Field of the Invention The invention relates to selective binding agents for osteoprotegerin binding protein (OPGbp).
More particularly, the invention relates to antibodies and antigen binding domains which bind selectively to OPGbp and may be used to prevent or treat conditions relating to loss of bone mass. Nucleic acid molecules;
vectors and host cells for the production of the selective binding agents of the invention are also provided.
Background of the Invention Living bone tissue exhibits a dynamic equilibrium between deposition and resorption of bone.
These processes are mediated primarily by two cell types: osteoblasts, which secrete molecules that comprise the organic matrix of bone; and osteoclasts, which promote dissolution of the bone matrix and solubilization of bone salts. In young individuals with growing bone, the rate of bone deposition exceeds the rate of bone resorption, while in older individuals the rate of resorption can exceed deposition. In the latter situation, the increased breakdown of bone leads to reduced bone mass and strength, increased risk of fractures, and slow or incomplete repair of broken bones.
Osteoclasts are large phagocytic multinucleated cells which are formed from hematopoietic precursor cells in the bone marrow.
Although the growth and formation of mature functional osteoclasts is not well understood, it is thought that osteoclasts mature along the monocyte/macrophage cell lineage in response to exposure to various growth-promoting factors. Early development of bone marrow precursor cells to preosteoclasts are believed to mediated by soluble factors such as tumor necrosis factor-a (TNF-(X), tumor necrosis factor-(3 (TNF-0), interleukin-1 (IL-1), interleukin-4 (IL-4), interleukin-6 (IL-6), and leukemia inhibitory factor (LIF). In culture, preosteoclasts are formed in the presence of added macrophage colony stimulating factor (M-CSF). These factors act primarily in early steps of osteoclast development.
A polypeptide factor, osteoprotegerin binding protein (OPGbp), has been described which stimulates osteoclast formation and bone resorption and appears to act at a late stage of development. See PCT
W098/46751. OPGbp stimulates osteoclast formation from bone marrow precursor cells without the requirement for coculturing in the presence of a stromal cell line.
Stimulation of bone resorption by OPGbp required interaction with its cognate receptor, osteoprotegerin differentiation and activation receptor (ODAR) and inhibition of the ODAR/OPGbp interaction by osteoprotegerin (OPG) also inhibited bone resorption.
Consequently, the regulation of OPGbp binding to ODAR
affects osteoclast formation and loss of bone.
It is an object of the invention to identify selective binding agents which regulate the interaction of OPGbp and ODAR, especially those agents which block the interaction of OPGbp and ODAR and/or inhibit at least one activity of OPGbp, such as bone resorption.
It is a further object of the invention to identify those selective binding agents that may be used to prevent and treat loss of bone mass. It is a further object of the invention to identify an antibody, or an antigen binding domain, or a fragment or variant thereof, which regulates the interaction of OPGbp and ODAR and neutralizes at least one activity of OPGbp.
The antibodies may be used to prevent and treat loss of bone mass.
Summary of the Invention The invention provides for a selective binding agent of osteoprotegerin binding protein (OPGbp). In one embodiment, the selective binding agent of the invention partially or completely inhibits at least one activity of OPGbp; that is, the selective binding agent is an antagonist of OPGbp. In another embodiment, the selective binding agent binds to OPGbp in a manner that partially or completely inhibits the interaction of OPGbp with its cognate receptor, osteoclast differentiation and activation receptor, or ODAR, and thereby partially or completely inhibits OPGbp activity. Selective binding agents of the invention may be protein in nature and are referred to herein as proteinaceous selective binding agents.
The invention also provides for an antibody or antigen binding domain thereof, or a fragment, variant, or derivative thereof, which binds to an epitope on OPGbp and partially or completely inhibits at least one activity of OPGbp. That is, the antibody is an antagonist antibody. Preferably, OPGbp is mammalian OPGbp. More preferably, OPGbp is human OPGbp which may be in soluble or cell surface associated forms, or fragments, derivatives and variants thereof.
When the selective binding agent is an antibody, such an antibody may be prepared by immunizing an animal with OPGbp such as murine or human OPGbp, preferably human OPGbp, or with an immunogenic fragment, derivative or variant thereof. In addition, an animal may be immunized with cells transfected with a vector containing a nucleic acid molecule encoding OPGbp such that OPGbp is expressed and associated with the surface of the transfected cells. Alternatively, selective binding agents which are antibodies may be obtained by screening a library comprising antibody or antigen binding domain sequences for binding to OPGbp.
Such a library is conveniently prepared in bacteriophage as protein or peptide fusions to a bacteriophage coat protein which are expressed on the surface of assembled phage particles and the encoding DNA sequences contained within the phage particles (so-called "phage displayed library"). In one example, a phage displayed library contains DNA sequences encoding human antibodies, such as variable light and heavy chains.
Selective binding agents which are antibodies or antigen binding domains may be tetrameric glycoproteins similar to native antibodies, or they may be single chain antibodies; Fv, Fab, Fab' or F(ab)' fragments, bispecific antibodies, heteroantibodies, or other fragments, variants, or derivatives thereof, which are capable of binding OPGbp and partially or completely neutralize OPGbp activity. Antibodies or antigen binding domains may be produced in hybridoma cell lines (antibody-producing cells such as spleen cells fused to mouse myeloma cells, for example) or may be produced in heterologous cell lines transfected with nucleic acid molecules encoding said antibody or antigen binding domain.
-An antibody or antigen binding domain of the invention comprises:
(a) a Fab heavy chain amino acid sequence as shown in Figure 9 (SEQ ID NO: 51)or Figure 10 (SEQ ID
Such a library is conveniently prepared in bacteriophage as protein or peptide fusions to a bacteriophage coat protein which are expressed on the surface of assembled phage particles and the encoding DNA sequences contained within the phage particles (so-called "phage displayed library"). In one example, a phage displayed library contains DNA sequences encoding human antibodies, such as variable light and heavy chains.
Selective binding agents which are antibodies or antigen binding domains may be tetrameric glycoproteins similar to native antibodies, or they may be single chain antibodies; Fv, Fab, Fab' or F(ab)' fragments, bispecific antibodies, heteroantibodies, or other fragments, variants, or derivatives thereof, which are capable of binding OPGbp and partially or completely neutralize OPGbp activity. Antibodies or antigen binding domains may be produced in hybridoma cell lines (antibody-producing cells such as spleen cells fused to mouse myeloma cells, for example) or may be produced in heterologous cell lines transfected with nucleic acid molecules encoding said antibody or antigen binding domain.
-An antibody or antigen binding domain of the invention comprises:
(a) a Fab heavy chain amino acid sequence as shown in Figure 9 (SEQ ID NO: 51)or Figure 10 (SEQ ID
5 NO: 53);
(b) a heavy chain amino acid sequence comprising conservative amino acid substitutions of the sequence in (a);
(c ) a heavy chain amino acid sequence which is at least about 80% identical to the sequence in (a);
or (d) a fragment or derivative of (a), (b) or (c) ;
wherein the antibody or antigen binding domain binds selectively to OPGbp.
In another embodiment, an antibody or antigen binding domain of the invention recognizes an epitope on human OPGbp recognized by an antibody or antigen binding domain comprising a Fab heavy chain amino acid sequence as shown in Figure 9 (SEQ ID NO: 51) or Figure 10 (SEQ ID NO: 53) and a Fab light amino acid sequence as shown in Figure 5 (SEQ ID NO: 43) or Figure 6 (SEQ
ID NO: 45). Also provided for is an anti-OPGbp antibody or antigen binding domain which recognizes a DE epitope on OPGbp.
In another embodiment, an antibody or antigen binding domain of the invention comprises a V1 and V,, chain:
wherein each V. chain comprises CDR amino acid sequences designated,CDRl(V1), CDR2(V1) and CDR3(V1) separated by framework amino acid sequences, CDR1(V1) being selected from the group consisting of:
RASQSISRYLN (SEQ ID NO: 01);
RASQSVGSYLA (SEQ ID NO: 02);
RASQSVSSSSLA(SEQ ID NO: 03); and SGDALPKQY (SEQ ID NO: 04);
(b) a heavy chain amino acid sequence comprising conservative amino acid substitutions of the sequence in (a);
(c ) a heavy chain amino acid sequence which is at least about 80% identical to the sequence in (a);
or (d) a fragment or derivative of (a), (b) or (c) ;
wherein the antibody or antigen binding domain binds selectively to OPGbp.
In another embodiment, an antibody or antigen binding domain of the invention recognizes an epitope on human OPGbp recognized by an antibody or antigen binding domain comprising a Fab heavy chain amino acid sequence as shown in Figure 9 (SEQ ID NO: 51) or Figure 10 (SEQ ID NO: 53) and a Fab light amino acid sequence as shown in Figure 5 (SEQ ID NO: 43) or Figure 6 (SEQ
ID NO: 45). Also provided for is an anti-OPGbp antibody or antigen binding domain which recognizes a DE epitope on OPGbp.
In another embodiment, an antibody or antigen binding domain of the invention comprises a V1 and V,, chain:
wherein each V. chain comprises CDR amino acid sequences designated,CDRl(V1), CDR2(V1) and CDR3(V1) separated by framework amino acid sequences, CDR1(V1) being selected from the group consisting of:
RASQSISRYLN (SEQ ID NO: 01);
RASQSVGSYLA (SEQ ID NO: 02);
RASQSVSSSSLA(SEQ ID NO: 03); and SGDALPKQY (SEQ ID NO: 04);
CDR2(V1) being selected from the group consisting of:
GASSLQS (SEQ ID NO: 05);
DATNRAT (SEQ ID NO: 06);
GASSRAT (SEQ ID NO: 07); and EDSERPS (SEQ ID NO: 08);
and CDR3(V1) being selected from the group consisting of:
QHTRA (SEQ ID NO: 09);
QHRRT (SEQ ID NO: 10);
QQYGA (SEQ ID NO: 11); and QSTDSSGTYVV (SEQ ID NO: 12);
wherein CDR1 (V1) , CDR2 (V1) and CDR3 (V1) are selected independently of each other; and wherein each V,, chain comprises CDR amino acid sequences designated CDR1 (V,,) , CDR2 (V,,) and CDR3(Vh) separated by framework amino acid sequences, CDR1(V,,) being selected from the group consisting of:
NYAIH (SEQ ID NO: 13);
NYPMH (SEQ ID NO: 14); and DYAMH (SEQ ID NO: 15) CDR2(V,,) being selected from the group consisting of:
WINAGNGNTKFSQKFQG (SEQ ID NO: 16);
VISYDGNNKYYADSVKG (SEQ ID NO: 17); and GISWNSGRIGYADSVKG (SEQ ID NO: 18) CDR3(Vh) being selected from the group consisting of:
DSSNMVRGIIIAYYFDY (SEQ ID NO: 19);
GGGGFDY (SEQ ID NO: 20); and GGSTSARYSSGWYY (SEQ ID NO: 21) wherein CDR1 (V,,) , CDR2 (V,,) and CDR3(Vh) are selected independently of each other.
In another embodiment, an antibody or antigen binding domain of the invention comprises a V1 and a V,, .chain wherein:
the V1 chain comprises CDR1 having the sequence RASQSISRYLN (SEQ ID NO: 01), CDR2 having the sequence GASSLQS (SEQ ID NO: 05), and CDR3 having the sequence QHTRA (SEQ ID NO: 09); and the V,, chain comprises CDR1 having the sequence NYAIH (SEQ ID NO: 13), CDR2 having the sequence WINAGNGNTKFSQKFQG (SEQ ID NO: 16), and CDR3 having the sequence DSSNMVRGIIIAYYFDY (SEQ ID NO: 19);
wherein CDR1, CDR2 and CDR3 on each V. and V,, chain are separated by framework amino acid sequences.
Antibodies and antigen binding domains of the invention are derived from germ line nucleic acid sequences present in genomic DNA which encode light and heavy chain amino acid sequences. Antibodies are encoded by nucleic acid sequences which are the products of germline sequence rearrangement and somatic mutation.
In one embodiment, an antibody or antigen binding domain of the invention comprises a V1 and a V,, chain wherein the V. chain is comprises a rearranged or somatic variant of a Vhf germline genes such as in Figure 19 (SEQ ID NO: 66); and the V,, chain comprises a rearranged or somatic variant of a Vhf germline genes such as in Figure 16 (SEQ ID NO: 59); and the antibody binds selectively to an OPGbp polypeptide.
In another embodiment, the V1 chain comprises or a rearranged or somatic variant of a Vk3 germline genes such as in Figure 20 (SEQ ID NO: 68); and the V,, chain comprises a rearranged or somatic variant of a Vhf germline gene such as in Figure 16 (SEQ ID NO: 59).
In another embodiment, the V1 chain comprises a rearranged or somatic variant of a Vk3 germline gene such as in Figure 21 (SEQ ID NO: 70); and the V,, chain comprises a rearranged or somatic variant of a Vh3 germline gene such as in Figure 17 (SEQ ID NO: 62).
In another embodiment, the V1 chain comprises a rearranged or somatic variant of a V13 germline gene such as in Figure 22 (SEQ ID NO: 72); and the V,, chain comprises or a rearranged or somatic variant of a Vh3 germline gene such as in Figure 18 (SEQ ID NO: 64).
The selective binding agents of the invention (antibody or antigen binding domain) partially or completely inhibit at least one activity of OPGbp, such as binding of OPGbp to ODAR, formation or activation of osteoclasts, or OPGbp-mediated bone resorption and are used to prevent and/or treat bone diseases. In one embodiment, an OPGbp antagonist, such as an antibody or antigen binding domains, is administered to an animal which has experienced loss of bone mass, or is at risk for loss of bone mass, in order to prevent and/or treat loss of bone mass. An OPGbp antagonist may be used to prevent and/or treat osteoporosis, loss of bone mass due to metastasis of cancer to bone; loss of bone mass due to rheumatoid arthritis, hypercalcemia of malignancy and steroid-induced osteoporosis.
Also provided are compositions comprising the antibodies or antigen binding domains of the invention and a pharmaceutically acceptable carrier.
Description of the Figures Figure 1 shows an ELISA of predominant Fab Patterns for reactivity to human OPGbp[143-317].
Titrations were performed using a maximum of 50 gl of phage solution per well to given a typical range 109-10 phage/well in the ELISA. Phage stocks for ELISA
were prepared as described in Example 1. Values were from single point determinations. Patterns "AB" & "X"
were superimposed on the same line.
Figure 2 shows inhibition of OPGbp binding to ODAR by Fabs "AT" and "Y". Fabs were purified as described in Example 4 and added to final well concentrations as shown in the figure. Details of the OPGbp/ODAR binding assay are set forth in Example 1.
Values were averages of duplicate determinations.
Figure 3 shows bone marrow assays of Fabs "AT" "Y" & "P". The results of one endotoxin-free preparation (0.5 EU/ml or less) each of Fabs "AT", "Y"
and "P" were shown. Fabs were purified as described in Example 4 and added to final well dilutions as shown in the figure (Fab stock solutions were 750 gg/ml to 1 mg/ml). The assay format includes a 1 hour pre-incubation of the anti-hu-OPGbp Fab with 10 ng/ml final cell well concentration of human OPGbp [143-317].
Values were averages of triplicate determinations.
Figure 4 shows Raw cell assays of Fabs "AT"
"Y" & "P". The results of one endotoxin-free preparation (0.5 EU/ml or less) each of Fabs "AT", "Y"
and "P" were shown. Fabs were purified as described in Example 4. Fabs were preincubated with human OPGbp [143-317] for 1 hour at room temperature before a 1/20 dilution to the final cell well concentration shown on the graph. The final cell well concentration of OPGbp was 20 ng/ml. The cell concentration was 1 x 105 /ml.
Values were from triplicate determinations with error bars designating 2 standard deviations (2 STD).
Figure 5 shows the nucleotide and amino acid sequence of Fab "AT" light chain.
Figure 6 shows the nucleotide and amino acid sequence of Fab "Y" light chain.
Figure 7 shows the nucleotide and amino acid sequence of Fab "P" light chain.
GASSLQS (SEQ ID NO: 05);
DATNRAT (SEQ ID NO: 06);
GASSRAT (SEQ ID NO: 07); and EDSERPS (SEQ ID NO: 08);
and CDR3(V1) being selected from the group consisting of:
QHTRA (SEQ ID NO: 09);
QHRRT (SEQ ID NO: 10);
QQYGA (SEQ ID NO: 11); and QSTDSSGTYVV (SEQ ID NO: 12);
wherein CDR1 (V1) , CDR2 (V1) and CDR3 (V1) are selected independently of each other; and wherein each V,, chain comprises CDR amino acid sequences designated CDR1 (V,,) , CDR2 (V,,) and CDR3(Vh) separated by framework amino acid sequences, CDR1(V,,) being selected from the group consisting of:
NYAIH (SEQ ID NO: 13);
NYPMH (SEQ ID NO: 14); and DYAMH (SEQ ID NO: 15) CDR2(V,,) being selected from the group consisting of:
WINAGNGNTKFSQKFQG (SEQ ID NO: 16);
VISYDGNNKYYADSVKG (SEQ ID NO: 17); and GISWNSGRIGYADSVKG (SEQ ID NO: 18) CDR3(Vh) being selected from the group consisting of:
DSSNMVRGIIIAYYFDY (SEQ ID NO: 19);
GGGGFDY (SEQ ID NO: 20); and GGSTSARYSSGWYY (SEQ ID NO: 21) wherein CDR1 (V,,) , CDR2 (V,,) and CDR3(Vh) are selected independently of each other.
In another embodiment, an antibody or antigen binding domain of the invention comprises a V1 and a V,, .chain wherein:
the V1 chain comprises CDR1 having the sequence RASQSISRYLN (SEQ ID NO: 01), CDR2 having the sequence GASSLQS (SEQ ID NO: 05), and CDR3 having the sequence QHTRA (SEQ ID NO: 09); and the V,, chain comprises CDR1 having the sequence NYAIH (SEQ ID NO: 13), CDR2 having the sequence WINAGNGNTKFSQKFQG (SEQ ID NO: 16), and CDR3 having the sequence DSSNMVRGIIIAYYFDY (SEQ ID NO: 19);
wherein CDR1, CDR2 and CDR3 on each V. and V,, chain are separated by framework amino acid sequences.
Antibodies and antigen binding domains of the invention are derived from germ line nucleic acid sequences present in genomic DNA which encode light and heavy chain amino acid sequences. Antibodies are encoded by nucleic acid sequences which are the products of germline sequence rearrangement and somatic mutation.
In one embodiment, an antibody or antigen binding domain of the invention comprises a V1 and a V,, chain wherein the V. chain is comprises a rearranged or somatic variant of a Vhf germline genes such as in Figure 19 (SEQ ID NO: 66); and the V,, chain comprises a rearranged or somatic variant of a Vhf germline genes such as in Figure 16 (SEQ ID NO: 59); and the antibody binds selectively to an OPGbp polypeptide.
In another embodiment, the V1 chain comprises or a rearranged or somatic variant of a Vk3 germline genes such as in Figure 20 (SEQ ID NO: 68); and the V,, chain comprises a rearranged or somatic variant of a Vhf germline gene such as in Figure 16 (SEQ ID NO: 59).
In another embodiment, the V1 chain comprises a rearranged or somatic variant of a Vk3 germline gene such as in Figure 21 (SEQ ID NO: 70); and the V,, chain comprises a rearranged or somatic variant of a Vh3 germline gene such as in Figure 17 (SEQ ID NO: 62).
In another embodiment, the V1 chain comprises a rearranged or somatic variant of a V13 germline gene such as in Figure 22 (SEQ ID NO: 72); and the V,, chain comprises or a rearranged or somatic variant of a Vh3 germline gene such as in Figure 18 (SEQ ID NO: 64).
The selective binding agents of the invention (antibody or antigen binding domain) partially or completely inhibit at least one activity of OPGbp, such as binding of OPGbp to ODAR, formation or activation of osteoclasts, or OPGbp-mediated bone resorption and are used to prevent and/or treat bone diseases. In one embodiment, an OPGbp antagonist, such as an antibody or antigen binding domains, is administered to an animal which has experienced loss of bone mass, or is at risk for loss of bone mass, in order to prevent and/or treat loss of bone mass. An OPGbp antagonist may be used to prevent and/or treat osteoporosis, loss of bone mass due to metastasis of cancer to bone; loss of bone mass due to rheumatoid arthritis, hypercalcemia of malignancy and steroid-induced osteoporosis.
Also provided are compositions comprising the antibodies or antigen binding domains of the invention and a pharmaceutically acceptable carrier.
Description of the Figures Figure 1 shows an ELISA of predominant Fab Patterns for reactivity to human OPGbp[143-317].
Titrations were performed using a maximum of 50 gl of phage solution per well to given a typical range 109-10 phage/well in the ELISA. Phage stocks for ELISA
were prepared as described in Example 1. Values were from single point determinations. Patterns "AB" & "X"
were superimposed on the same line.
Figure 2 shows inhibition of OPGbp binding to ODAR by Fabs "AT" and "Y". Fabs were purified as described in Example 4 and added to final well concentrations as shown in the figure. Details of the OPGbp/ODAR binding assay are set forth in Example 1.
Values were averages of duplicate determinations.
Figure 3 shows bone marrow assays of Fabs "AT" "Y" & "P". The results of one endotoxin-free preparation (0.5 EU/ml or less) each of Fabs "AT", "Y"
and "P" were shown. Fabs were purified as described in Example 4 and added to final well dilutions as shown in the figure (Fab stock solutions were 750 gg/ml to 1 mg/ml). The assay format includes a 1 hour pre-incubation of the anti-hu-OPGbp Fab with 10 ng/ml final cell well concentration of human OPGbp [143-317].
Values were averages of triplicate determinations.
Figure 4 shows Raw cell assays of Fabs "AT"
"Y" & "P". The results of one endotoxin-free preparation (0.5 EU/ml or less) each of Fabs "AT", "Y"
and "P" were shown. Fabs were purified as described in Example 4. Fabs were preincubated with human OPGbp [143-317] for 1 hour at room temperature before a 1/20 dilution to the final cell well concentration shown on the graph. The final cell well concentration of OPGbp was 20 ng/ml. The cell concentration was 1 x 105 /ml.
Values were from triplicate determinations with error bars designating 2 standard deviations (2 STD).
Figure 5 shows the nucleotide and amino acid sequence of Fab "AT" light chain.
Figure 6 shows the nucleotide and amino acid sequence of Fab "Y" light chain.
Figure 7 shows the nucleotide and amino acid sequence of Fab "P" light chain.
Figure 8 shows the nucleotide and amino acid sequence of Fab "S" light chain.
Figure 9 shows the nucleotide and amino acid sequence of Fab "AT" heavy chain.
Figure 10 shows the nucleotide and amino acid sequence of Fab "Y" heavy chain.
Figure 11 shows the nucleotide and amino acid sequence of Fab "P" heavy chain.
Figure 12 shows the nucleotide and amino acid sequence of Fab "S" heavy chain.
Figure 13 shows a comparison of Fab amino acid sequences shown in Figures 5-12. The predicted amino acid sequences of heavy and light chain Fabs "AT", "Y", "P" and "S" were compared for identity and similarity. Heavy chains "AT" and "Y" differ at only one amino acid position. As library designed, all four Fabs have identical heavy chain CH1 regions comprising the carboxy half of the heavy chain which are included in the calculations of identity and similarity. Light chains "AT", "Y" and "P" share the same or similar V
kappa families and therefore differ only at 1 to 2 amino acids in the carboxyl half of the chain, included in the calculations Figure 14 shows a comparison of the predicted heavy and light chain complementarily determining regions (CDRs) of Fabs "AT", "Y", "P" and "S". For heavy chain comparisons, CDR1 includes amino acid residues 32-36 inclusive for all Fabs; CDR2 includes amino acid residues 51-67 inclusive for all Fabs; and CDR3 includes amino acid residues 100-116 inclusive for Fabs "AT" and "Y", 100-106 inclusive for Fab "P", and 100-113 inclusive for Fab "S". For light chain comparisons, CDR1 includes amino acid residues 29-39 inclusive for Fabs "AT" and "Y", 28-39 inclusive for Fab "P", and 27-35 inclusive Fab "S"; CDR2 includes amino acid residues 55-61 inclusive for Fabs "AT", "Y", and "P", and 53-59 inclusive for Fab "S"; and CDR3 includes amino acid residues 94-98 inclusive for Fabs "AT", "Y" and "P" and 92-102 inclusive for Fab "S".
Figure 15 shows a comparison of Fab classes.
Fab class comparison was obtained from V-Base DNA PLOT
analysis. The symbol (*) indicates that the closest matching diversity (D) region, although related to known germ line sequences could not be determined. The symbol (**) indicates that the germ line variable (V) region sequence of the closest match has been identified but not formally named to date, being of the rarer lambda family.
Figure 16 shows a comparison of predicted Fab "AT" and "Y" heavy chain amino acid sequences (residues 2-127 inclusive in Figures 9 and 10, respectively) with a germline sequence from the VH1 family. The germline sequence comprises the V region sequence 1-03, D region sequence 3-10, and J region sequence JH4 (SEQ. ID NO:
44). FR1, FR2 and FR3 designate the three framework regions, CDR1, CDR2, and CDR3 designate the three complementarily determining regions, and H1, H2 and H3 designate the corresponding junction sequences between framework regions and CDRs. Differences between "AT", "Y" and germline V, D, or J sequences are in boldface.
The numbering of germline amino acid residues in Figures 16-22 is as described in Kabat et al. Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 4th ed. (1991).
Figure 9 shows the nucleotide and amino acid sequence of Fab "AT" heavy chain.
Figure 10 shows the nucleotide and amino acid sequence of Fab "Y" heavy chain.
Figure 11 shows the nucleotide and amino acid sequence of Fab "P" heavy chain.
Figure 12 shows the nucleotide and amino acid sequence of Fab "S" heavy chain.
Figure 13 shows a comparison of Fab amino acid sequences shown in Figures 5-12. The predicted amino acid sequences of heavy and light chain Fabs "AT", "Y", "P" and "S" were compared for identity and similarity. Heavy chains "AT" and "Y" differ at only one amino acid position. As library designed, all four Fabs have identical heavy chain CH1 regions comprising the carboxy half of the heavy chain which are included in the calculations of identity and similarity. Light chains "AT", "Y" and "P" share the same or similar V
kappa families and therefore differ only at 1 to 2 amino acids in the carboxyl half of the chain, included in the calculations Figure 14 shows a comparison of the predicted heavy and light chain complementarily determining regions (CDRs) of Fabs "AT", "Y", "P" and "S". For heavy chain comparisons, CDR1 includes amino acid residues 32-36 inclusive for all Fabs; CDR2 includes amino acid residues 51-67 inclusive for all Fabs; and CDR3 includes amino acid residues 100-116 inclusive for Fabs "AT" and "Y", 100-106 inclusive for Fab "P", and 100-113 inclusive for Fab "S". For light chain comparisons, CDR1 includes amino acid residues 29-39 inclusive for Fabs "AT" and "Y", 28-39 inclusive for Fab "P", and 27-35 inclusive Fab "S"; CDR2 includes amino acid residues 55-61 inclusive for Fabs "AT", "Y", and "P", and 53-59 inclusive for Fab "S"; and CDR3 includes amino acid residues 94-98 inclusive for Fabs "AT", "Y" and "P" and 92-102 inclusive for Fab "S".
Figure 15 shows a comparison of Fab classes.
Fab class comparison was obtained from V-Base DNA PLOT
analysis. The symbol (*) indicates that the closest matching diversity (D) region, although related to known germ line sequences could not be determined. The symbol (**) indicates that the germ line variable (V) region sequence of the closest match has been identified but not formally named to date, being of the rarer lambda family.
Figure 16 shows a comparison of predicted Fab "AT" and "Y" heavy chain amino acid sequences (residues 2-127 inclusive in Figures 9 and 10, respectively) with a germline sequence from the VH1 family. The germline sequence comprises the V region sequence 1-03, D region sequence 3-10, and J region sequence JH4 (SEQ. ID NO:
44). FR1, FR2 and FR3 designate the three framework regions, CDR1, CDR2, and CDR3 designate the three complementarily determining regions, and H1, H2 and H3 designate the corresponding junction sequences between framework regions and CDRs. Differences between "AT", "Y" and germline V, D, or J sequences are in boldface.
The numbering of germline amino acid residues in Figures 16-22 is as described in Kabat et al. Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 4th ed. (1991).
Figure 17 shows a comparison of predicted Fab "P" heavy chain amino acid sequences (residues 2-117 inclusive in Figure 11) with a germline sequence from the VH3 family. The sequence comprises the V region sequence 3-30 and the J region sequence JH4. The D
region sequence is unknown.
Figure 18 shows a comparison of predicted Fab "S" heavy chain amino acid sequences (residues 2-124 inclusive in Figure 12) with a germline sequence from the VH3 family. The germline sequence comprises the V
region sequence 3-09, D region sequence 6-19 and J
regions sequence JH4.
Figure 19 shows a comparison of predicted Fab "AT" light chain amino acid sequence (residues 6-108 inclusive in Figure 5) with a germline sequence from the Vkappal family. The germline sequence comprises the V region sequence 012 and J region sequence JK1.
Figure 20 shows a comparison of predicted Fab "Y" light chain amino acid sequence (residues 6-108 inclusive in Figure 6) with a germline sequence from the Vkappa3 family. The germline sequence comprises the V region sequence L6 and the J region sequence JK2.
Figure 21 shows a comparison of predicted Fab "P" light chain amino acid sequence (residues 5-108 inclusive in Figure 7) with a germline sequence from the Vkappa3 family. The germline sequence comprises the V region sequence A27 and the J region sequence JK4.
Figure 22 shows a comparison of predicted Fab "S" light chain amino acid sequence (residues 5-112 inclusive in Figure 8) with a germline sequence from the VL3 family. The germline sequence comprises the V
region sequence 3m and the J region sequence JL2.
Figure 23 shows RAW cell assays of "AT" 405, "AT" 406 and "AT" 407 isolates. cDNA encoding Fab "AT"
was fused to cDNA encoding CH1, CH2 and CH3 regions of human IgG1 as described in Example 7. Different leader sequences were used to produce the resulting isolates designated "AT" 405, "AT" 406 and "AT" 407. "AT" 405-407 were preincubated with OPGbp for 1 hour at room temperature before dilution to the final cell well concentration shown on the graph. The final cell well concentration of OPGbp was 40 ng/ml. Values were from triplicate determinations with error bars designating 2 standard deviations (2 STD).
Figure 24 shows bone marrow assays of "AT"
405 and "AT" 407. The results of one endotoxin-free preparation (0.5 EU/ml or less) of "AT" 405 and "AT"
407 were shown. Samples were pre-incubated with human OPGbp [143-317] for 1 hour at room temperature before addition to the cells. The final cell well dilution for "AT" 405 and "AT" 407 from the sample stock is indicated on the x axis. The final cell well OPGbp concentration was 20 ng/ml.
Figure 25 shows a bone marrow assay of "AT"
406. The results of one endotoxin-free preparation (0.5 EU/ml or less) of "AT" 406 is shown. Samples were pre-incubated with human OPGbp [143-317] for 1 hour at room temperature before addition to the cells. The final cell well concentration of the sample is indicated on the x axis. The final cell well concentration of OPGbp was 20 ng/ml.
region sequence is unknown.
Figure 18 shows a comparison of predicted Fab "S" heavy chain amino acid sequences (residues 2-124 inclusive in Figure 12) with a germline sequence from the VH3 family. The germline sequence comprises the V
region sequence 3-09, D region sequence 6-19 and J
regions sequence JH4.
Figure 19 shows a comparison of predicted Fab "AT" light chain amino acid sequence (residues 6-108 inclusive in Figure 5) with a germline sequence from the Vkappal family. The germline sequence comprises the V region sequence 012 and J region sequence JK1.
Figure 20 shows a comparison of predicted Fab "Y" light chain amino acid sequence (residues 6-108 inclusive in Figure 6) with a germline sequence from the Vkappa3 family. The germline sequence comprises the V region sequence L6 and the J region sequence JK2.
Figure 21 shows a comparison of predicted Fab "P" light chain amino acid sequence (residues 5-108 inclusive in Figure 7) with a germline sequence from the Vkappa3 family. The germline sequence comprises the V region sequence A27 and the J region sequence JK4.
Figure 22 shows a comparison of predicted Fab "S" light chain amino acid sequence (residues 5-112 inclusive in Figure 8) with a germline sequence from the VL3 family. The germline sequence comprises the V
region sequence 3m and the J region sequence JL2.
Figure 23 shows RAW cell assays of "AT" 405, "AT" 406 and "AT" 407 isolates. cDNA encoding Fab "AT"
was fused to cDNA encoding CH1, CH2 and CH3 regions of human IgG1 as described in Example 7. Different leader sequences were used to produce the resulting isolates designated "AT" 405, "AT" 406 and "AT" 407. "AT" 405-407 were preincubated with OPGbp for 1 hour at room temperature before dilution to the final cell well concentration shown on the graph. The final cell well concentration of OPGbp was 40 ng/ml. Values were from triplicate determinations with error bars designating 2 standard deviations (2 STD).
Figure 24 shows bone marrow assays of "AT"
405 and "AT" 407. The results of one endotoxin-free preparation (0.5 EU/ml or less) of "AT" 405 and "AT"
407 were shown. Samples were pre-incubated with human OPGbp [143-317] for 1 hour at room temperature before addition to the cells. The final cell well dilution for "AT" 405 and "AT" 407 from the sample stock is indicated on the x axis. The final cell well OPGbp concentration was 20 ng/ml.
Figure 25 shows a bone marrow assay of "AT"
406. The results of one endotoxin-free preparation (0.5 EU/ml or less) of "AT" 406 is shown. Samples were pre-incubated with human OPGbp [143-317] for 1 hour at room temperature before addition to the cells. The final cell well concentration of the sample is indicated on the x axis. The final cell well concentration of OPGbp was 20 ng/ml.
Figure 26 shows a bone marrow assay of "S"
435 and "Y" 429. Construction of "S" 435 and "Y" 429 are described in Example 7 . The results of one endotoxin-free preparation (0.5 EU/ml or less) of each of "S" 435 and "Y" 429 are shown. Samples were pre-incubated with human OPGbp [143-317] for 1 hour at room temperature before addition to the cells. The final cell well concentration of the sample is indicated on the x axis. The final cell well concentration of OPGbp was 20 ng/ml.
Figure 27 shows a bone marrow assay of "Y"
442 and "P" 444. Construction and expression of "Y"
442 and "P" 444 is described in Example 7. The results of one endotoxin-free preparation (0.5 EU/ml or less) each of "Y" 442 and "P" 444 are shown. Samples were pre-incubated with human OPGbp [143-317] for 1 hour at room temperature before addition to the cells. The final cell well concentration of the sample is shown on the x axis. The final cell well concentration of OPGbp was 20 ng/ml.
Figure 28 shows the nucleic acid and amino acid sequence of FLAG-murine [153-316] OPGbp/DE.
Figure 29 is an alignment of human OPGbp[143-317], murine OPGbp[158-316], and FLAG-murine OPGbp [158-316]/DE amino acid sequences in the region of the DE loop. Underlined are the amino acid residues of human OPGbp introduced into mouse OPGbp to generate the FLAG-mouse OPGbp/DE molecule.
Figure 30 is an enzyme immunoassay examining the binding and reactivity of the AT antibody to plates coated with either human OPGbp[143-317], murine OPGbp[158-316], or FLAG-murine OPGbp [158-316]/DE.
435 and "Y" 429. Construction of "S" 435 and "Y" 429 are described in Example 7 . The results of one endotoxin-free preparation (0.5 EU/ml or less) of each of "S" 435 and "Y" 429 are shown. Samples were pre-incubated with human OPGbp [143-317] for 1 hour at room temperature before addition to the cells. The final cell well concentration of the sample is indicated on the x axis. The final cell well concentration of OPGbp was 20 ng/ml.
Figure 27 shows a bone marrow assay of "Y"
442 and "P" 444. Construction and expression of "Y"
442 and "P" 444 is described in Example 7. The results of one endotoxin-free preparation (0.5 EU/ml or less) each of "Y" 442 and "P" 444 are shown. Samples were pre-incubated with human OPGbp [143-317] for 1 hour at room temperature before addition to the cells. The final cell well concentration of the sample is shown on the x axis. The final cell well concentration of OPGbp was 20 ng/ml.
Figure 28 shows the nucleic acid and amino acid sequence of FLAG-murine [153-316] OPGbp/DE.
Figure 29 is an alignment of human OPGbp[143-317], murine OPGbp[158-316], and FLAG-murine OPGbp [158-316]/DE amino acid sequences in the region of the DE loop. Underlined are the amino acid residues of human OPGbp introduced into mouse OPGbp to generate the FLAG-mouse OPGbp/DE molecule.
Figure 30 is an enzyme immunoassay examining the binding and reactivity of the AT antibody to plates coated with either human OPGbp[143-317], murine OPGbp[158-316], or FLAG-murine OPGbp [158-316]/DE.
Detailed Description of the Invention The present invention provides for agents which selectively bind OPG binding protein (OPGbp).
Preferably, the agents are OPGbp antagonists or inhibitors which inhibit partially or completely at least one activity of OPGbp, such as binding of OPGbp to its cognate receptor, ODAR, osteoclast formation and/or activation, or bone resorption. In one embodiment, the selective binding agent is an antibody which selectively binds OPGbp such that it partially or completely blocks the binding of OPGbp to its cognate receptor and partially or completely inhibits osteoclast formation and/or bone resorption.
The term "selective binding agent" refers to a molecule which preferentially binds OPGbp. A
selective binding agent may include a protein, peptide, nucleic acid, carbohydrate, lipid, or small molecular weight compound. In a preferred embodiment, a selective binding agent is an antibody, such as polyclonal antibodies, monoclonal antibodies (mAbs), chimeric antibodies, CDR-grafted antibodies, anti-idiotypic (anti-Id) antibodies to antibodies that can be labeled in soluble or bound form, as well as fragments, regions or derivatives thereof, provided by known techniques, including, but not limited to enzymatic cleavage, peptide synthesis or recombinant techniques. The anti-OPGbp selective binding agents of the present invention are capable of binding portions of OPGbp that inhibit the binding of OPGbp to ODAR
receptors.
The antibodies and antigen binding domains of the invention bind selectively to OPGbp, that is they bind preferentially to OPGbp with a greater binding affinity than to other antigens. The antibodies may bind selectively to human OPGbp, but also bind detectably to non-human OPGbp, such as murine OPGbp.
Alternatively, the antibodies may bind selectively to non-human OPG, but also bind detectably to human OPG.
Alternatively, the antibodies may bind exclusively to human OPGbp, with no detectable binding to non-human OPGbp.
The term "monoclonal antibody" refers to an antibody obtained from a population of substantially homogeneous antibodies wherein each monoclonal antibody will typically recognize a single epitope on the antigen. The term "monoclonal" is not limited to any particular method for making the antibody. For example, monoclonal antibodies of the invention may be made by the hybridoma method as described in Kohler et al. Nature 256, 495 (1975) or may be isolated from phage libraries using the techniques as described herein, for example.
The term "antigen binding domain" or "antigen binding region" refers to that portion of the selective binding agent (such as an antibody molecule) which contains the amino acid residues that interact with an antigen and confer on the binding agent its specificity and affinity for the antigen. Preferably, the antigen binding region will be of human origin. In other embodiments, the antigen binding region can be derived from other animal species, in particular rodents such as rabbit, rat or hamster.
The term "epitope" refers to that portion of any molecule capable of being recognized by and bound by a selective binding agent (such as an antibody) at one or more of the binding agent's antigen binding regions. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and have specific three dimensional structural characteristics as well as specific charge characteristics. By "inhibiting and/or neutralizing epitope" is intended an epitope, which, when bound by a selective binding agent, results in loss of biological activity of the molecule or organism containing the epitope, in vivo, in vitro, or in situ, more preferably in vivo, including binding of OPGbp to its receptor.
The term "light chain" when used in reference to an antibody refers to two distinct types, called kappa (k) of lambda (X) based on the amino acid sequence of the constant domains.
The term "heavy chain" when used in reference to an antibody refers to five distinct types, called alpha, delta, epsilon, gamma and mu, based on the amino acid sequence of the heavy chain constant domain.
These distinct types of heavy chains give rise to five classes of antibodies, IgA, IgD, IgE, IgG and IgM, respectively, including four subclasses of IgG, namely IgG1, IgG2, IgG3 and IgG4.
The term "variable region" or "variable domain" refers to a portion of the light and heavy chains, typically about the amino-terminal 120 to 130 amino acids in the heavy chain and about 100 to 110 amino acids in the light chain, which differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. The variability in sequence is concentrated in those regions called complimentarily determining regions (CDRs) while the more highly conserved regions in the variable domain are called framework regions (FR). The CDRs of the light and heavy chains are responsible for the interaction of the antibody with antigen.
The term "constant region" or "constant domain" refers to a carboxy terminal portion of the light and heavy chain which is not directly involved in binding of the antibody to antigen but exhibits various effector function, such as interaction with the Fc receptor.
The term "OPGbp" or "OPGbp polypeptide"
refers to a polypeptide comprising the amino acid sequence as shown in Figure 4 of PCT publication and related polypeptides. Related polypeptides include allelic variants; splice variants;
fragments; derivatives; substitution, deletion, and insertion variants; fusion polypeptides; and interspecies homologs. Also encompassed are soluble forms of OPGbp, such as residues 69-317 inclusive of human OPGbp (as numbered in WO 98/46757), or a subset thereof which is sufficient to generate an immunological response. In one embodiment, soluble human OPGbp includes residues 140-317 inclusive, 143-317 inclusive, or immunogenic fragments thereof. OPGbp may be a mature polypeptide, as defined herein, and may or may not have an amino terminal methionine'residue, depending upon the method by which it is prepared.
The term "fragment" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to a peptide or polypeptide that comprises less than the full length amino acid sequence. Such a fragment may arise, for example, from a truncation at the amino terminus, a truncation at the carboxy terminus, and/or an internal deletion of a residue(s) from the amino acid sequence. Fragments may result from alternative RNA splicing or from in vivo protease activity.
The term "variant" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to a peptide or polypeptide comprising one or more amino acid sequence substitutions, deletions, and/or additions as compared to a native or unmodified sequence. For example, an OPGbp variant may result from one or more changes to an amino acid sequence of native OPGbp. Also by way of example, a variant of a selective binding agent of OPGbp may result from one or more changes to an amino acid sequence of a native or previously unmodified selective binding agent.
Variants may be naturally occurring, such as allelic or splice variants, or may be artificially constructed.
Polypeptide variants may be prepared from the corresponding nucleic acid molecules encoding said variants.
The term "derivative" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to a polypeptide or peptide, or a variant, fragment or derivative thereof, which has been chemically modified. Examples include covalent attachment of one or more polymers, such as water soluble polymers, N-linked, or 0-linked carbohydrates, sugars, phosphates, and/or other such molecules. The derivatives are modified in a manner that is different from naturally occurring or starting peptide or polypeptides, either in the type or location of the molecules attached. Derivatives further include deletion of one or more chemical groups which are naturally present on the peptide or polypeptide.
The term "fusion" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to the joining of a peptide or polypeptide, or fragment, variant and/or derivative thereof, with a heterologous peptide or polypeptide.
The term "biologically active" when used in relation to OPGbp or to a proteinaceous selective binding agent refers to a peptide or a polypeptide having at least one activity characteristic of OPGbp or a selective binding agent. A selective binding agent of OPGbp may have agonist, antagonist, or neutralizing or blocking activity with respect to at least one biological activity of OPGbp.
The term "naturally occurring" when used in connection with biological materials such as nucleic acid molecules, polypeptides, host cells, and the like, refers to those which are found in nature and not manipulated by a human being.
The term "isolated" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to a peptide or polypeptide that is free from at least one contaminating polypeptide that is found in its natural environment, and preferably substantially free from any other contaminating mammalian polypeptides which would interfere with its therapeutic or diagnostic use.
The term "mature" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to a peptide or polypeptide lacking a leader sequence. The term may also include other modifications of a peptide or polypeptide such as proteolytic processing of the amino terminus (with or without a leader sequence) and/or the carboxy terminus, cleavage of a smaller polypeptide from a larger precursor, N-linked and/or 0-linked glycosylation, and the like.
The terms "effective amount" and "therapeutically effective amount" when used in relation to a selective binding agent of OPGbp refers to an amount of a selective binding agent that is useful or necessary to support an observable change in the level of one or more biological activities of OPGbp. Said change may be either an increase or decrease in the level of OPGbp activity.
The term "conservative amino acid substitution"
refers to a substitution of a native amino acid residue with a non-native residue such that there is little or no effect on the polarity or charge of the amino acid residue at that position. For example, a conservative substitution results from the replacement of a non-polar residue in a polypeptide with any other non-polar residue. Furthermore, any native residue in a polypeptide may also be substituted with alanine, as has been previously described for alanine scanning mutagenesis (Cunningham et al. Science 244, 1081-1085 (1989). Exemplary rules for conservative amino acid substitutions are set forth in Table I.
Table I
Conservative Amino Acid Substitutions Original Exemplary Preferred Residues Substitutions Substitutions Ala Val,Leu,Ile Val Arg Lys,Gln,Asn Lys Asn G1n,His,Lys,Arg Gin Asp Glu Glu Cys Ser Ser Gln Asn Asn Glu Asp Asp Gly Pro,Ala Ala His Asn,Gln,Lys,Arg Arg Ile Leu,Val,Met,Ala, Leu Phe,Norleucine Leu Norleucine,Ile, Ile Val,Met,Ala,Phe Lys Arg,Gln,Asn Arg Met Leu,Phe,Ile Leu Phe Leu,Val,Mle,Ala, Leu Tyr Pro Ala Ala Ser Thr Thr Thr Ser Ser Trp Tyr, Phe Tyr Tyr Trp,Phe,Thr,Ser Phe Val Ile,Met,Leu,Phe, Leu Ala,Norleucine Conservative amino acid substitutions also encompass non-naturally occurring amino acid residues which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include peptidomimetics, and other reversed or inverted forms of amino acid moieties.
Conservative modifications to the amino acid sequence (and the corresponding modifications to the encoding nucleotides) are able to produce OPGbp polypeptides (and proteinaceous selective binding agents thereof) having functional and chemical characteristics similar to those of naturally occurring OPGbp or selective binding agents. In contrast, substantial modifications in the functional and/or chemical characteristics of OPGbp (and protineaceous selective binding agents thereof) may be accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the molecular backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues may be divided into groups based on common side chain properties:
1) Hydrophobic: norleucine, Met, Ala, Val, Leu, Ile;
2) Neutral hydrophilic: Cys, Ser, Thr;
Preferably, the agents are OPGbp antagonists or inhibitors which inhibit partially or completely at least one activity of OPGbp, such as binding of OPGbp to its cognate receptor, ODAR, osteoclast formation and/or activation, or bone resorption. In one embodiment, the selective binding agent is an antibody which selectively binds OPGbp such that it partially or completely blocks the binding of OPGbp to its cognate receptor and partially or completely inhibits osteoclast formation and/or bone resorption.
The term "selective binding agent" refers to a molecule which preferentially binds OPGbp. A
selective binding agent may include a protein, peptide, nucleic acid, carbohydrate, lipid, or small molecular weight compound. In a preferred embodiment, a selective binding agent is an antibody, such as polyclonal antibodies, monoclonal antibodies (mAbs), chimeric antibodies, CDR-grafted antibodies, anti-idiotypic (anti-Id) antibodies to antibodies that can be labeled in soluble or bound form, as well as fragments, regions or derivatives thereof, provided by known techniques, including, but not limited to enzymatic cleavage, peptide synthesis or recombinant techniques. The anti-OPGbp selective binding agents of the present invention are capable of binding portions of OPGbp that inhibit the binding of OPGbp to ODAR
receptors.
The antibodies and antigen binding domains of the invention bind selectively to OPGbp, that is they bind preferentially to OPGbp with a greater binding affinity than to other antigens. The antibodies may bind selectively to human OPGbp, but also bind detectably to non-human OPGbp, such as murine OPGbp.
Alternatively, the antibodies may bind selectively to non-human OPG, but also bind detectably to human OPG.
Alternatively, the antibodies may bind exclusively to human OPGbp, with no detectable binding to non-human OPGbp.
The term "monoclonal antibody" refers to an antibody obtained from a population of substantially homogeneous antibodies wherein each monoclonal antibody will typically recognize a single epitope on the antigen. The term "monoclonal" is not limited to any particular method for making the antibody. For example, monoclonal antibodies of the invention may be made by the hybridoma method as described in Kohler et al. Nature 256, 495 (1975) or may be isolated from phage libraries using the techniques as described herein, for example.
The term "antigen binding domain" or "antigen binding region" refers to that portion of the selective binding agent (such as an antibody molecule) which contains the amino acid residues that interact with an antigen and confer on the binding agent its specificity and affinity for the antigen. Preferably, the antigen binding region will be of human origin. In other embodiments, the antigen binding region can be derived from other animal species, in particular rodents such as rabbit, rat or hamster.
The term "epitope" refers to that portion of any molecule capable of being recognized by and bound by a selective binding agent (such as an antibody) at one or more of the binding agent's antigen binding regions. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and have specific three dimensional structural characteristics as well as specific charge characteristics. By "inhibiting and/or neutralizing epitope" is intended an epitope, which, when bound by a selective binding agent, results in loss of biological activity of the molecule or organism containing the epitope, in vivo, in vitro, or in situ, more preferably in vivo, including binding of OPGbp to its receptor.
The term "light chain" when used in reference to an antibody refers to two distinct types, called kappa (k) of lambda (X) based on the amino acid sequence of the constant domains.
The term "heavy chain" when used in reference to an antibody refers to five distinct types, called alpha, delta, epsilon, gamma and mu, based on the amino acid sequence of the heavy chain constant domain.
These distinct types of heavy chains give rise to five classes of antibodies, IgA, IgD, IgE, IgG and IgM, respectively, including four subclasses of IgG, namely IgG1, IgG2, IgG3 and IgG4.
The term "variable region" or "variable domain" refers to a portion of the light and heavy chains, typically about the amino-terminal 120 to 130 amino acids in the heavy chain and about 100 to 110 amino acids in the light chain, which differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. The variability in sequence is concentrated in those regions called complimentarily determining regions (CDRs) while the more highly conserved regions in the variable domain are called framework regions (FR). The CDRs of the light and heavy chains are responsible for the interaction of the antibody with antigen.
The term "constant region" or "constant domain" refers to a carboxy terminal portion of the light and heavy chain which is not directly involved in binding of the antibody to antigen but exhibits various effector function, such as interaction with the Fc receptor.
The term "OPGbp" or "OPGbp polypeptide"
refers to a polypeptide comprising the amino acid sequence as shown in Figure 4 of PCT publication and related polypeptides. Related polypeptides include allelic variants; splice variants;
fragments; derivatives; substitution, deletion, and insertion variants; fusion polypeptides; and interspecies homologs. Also encompassed are soluble forms of OPGbp, such as residues 69-317 inclusive of human OPGbp (as numbered in WO 98/46757), or a subset thereof which is sufficient to generate an immunological response. In one embodiment, soluble human OPGbp includes residues 140-317 inclusive, 143-317 inclusive, or immunogenic fragments thereof. OPGbp may be a mature polypeptide, as defined herein, and may or may not have an amino terminal methionine'residue, depending upon the method by which it is prepared.
The term "fragment" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to a peptide or polypeptide that comprises less than the full length amino acid sequence. Such a fragment may arise, for example, from a truncation at the amino terminus, a truncation at the carboxy terminus, and/or an internal deletion of a residue(s) from the amino acid sequence. Fragments may result from alternative RNA splicing or from in vivo protease activity.
The term "variant" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to a peptide or polypeptide comprising one or more amino acid sequence substitutions, deletions, and/or additions as compared to a native or unmodified sequence. For example, an OPGbp variant may result from one or more changes to an amino acid sequence of native OPGbp. Also by way of example, a variant of a selective binding agent of OPGbp may result from one or more changes to an amino acid sequence of a native or previously unmodified selective binding agent.
Variants may be naturally occurring, such as allelic or splice variants, or may be artificially constructed.
Polypeptide variants may be prepared from the corresponding nucleic acid molecules encoding said variants.
The term "derivative" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to a polypeptide or peptide, or a variant, fragment or derivative thereof, which has been chemically modified. Examples include covalent attachment of one or more polymers, such as water soluble polymers, N-linked, or 0-linked carbohydrates, sugars, phosphates, and/or other such molecules. The derivatives are modified in a manner that is different from naturally occurring or starting peptide or polypeptides, either in the type or location of the molecules attached. Derivatives further include deletion of one or more chemical groups which are naturally present on the peptide or polypeptide.
The term "fusion" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to the joining of a peptide or polypeptide, or fragment, variant and/or derivative thereof, with a heterologous peptide or polypeptide.
The term "biologically active" when used in relation to OPGbp or to a proteinaceous selective binding agent refers to a peptide or a polypeptide having at least one activity characteristic of OPGbp or a selective binding agent. A selective binding agent of OPGbp may have agonist, antagonist, or neutralizing or blocking activity with respect to at least one biological activity of OPGbp.
The term "naturally occurring" when used in connection with biological materials such as nucleic acid molecules, polypeptides, host cells, and the like, refers to those which are found in nature and not manipulated by a human being.
The term "isolated" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to a peptide or polypeptide that is free from at least one contaminating polypeptide that is found in its natural environment, and preferably substantially free from any other contaminating mammalian polypeptides which would interfere with its therapeutic or diagnostic use.
The term "mature" when used in relation to OPGbp or to a proteinaceous selective binding agent of OPGbp refers to a peptide or polypeptide lacking a leader sequence. The term may also include other modifications of a peptide or polypeptide such as proteolytic processing of the amino terminus (with or without a leader sequence) and/or the carboxy terminus, cleavage of a smaller polypeptide from a larger precursor, N-linked and/or 0-linked glycosylation, and the like.
The terms "effective amount" and "therapeutically effective amount" when used in relation to a selective binding agent of OPGbp refers to an amount of a selective binding agent that is useful or necessary to support an observable change in the level of one or more biological activities of OPGbp. Said change may be either an increase or decrease in the level of OPGbp activity.
The term "conservative amino acid substitution"
refers to a substitution of a native amino acid residue with a non-native residue such that there is little or no effect on the polarity or charge of the amino acid residue at that position. For example, a conservative substitution results from the replacement of a non-polar residue in a polypeptide with any other non-polar residue. Furthermore, any native residue in a polypeptide may also be substituted with alanine, as has been previously described for alanine scanning mutagenesis (Cunningham et al. Science 244, 1081-1085 (1989). Exemplary rules for conservative amino acid substitutions are set forth in Table I.
Table I
Conservative Amino Acid Substitutions Original Exemplary Preferred Residues Substitutions Substitutions Ala Val,Leu,Ile Val Arg Lys,Gln,Asn Lys Asn G1n,His,Lys,Arg Gin Asp Glu Glu Cys Ser Ser Gln Asn Asn Glu Asp Asp Gly Pro,Ala Ala His Asn,Gln,Lys,Arg Arg Ile Leu,Val,Met,Ala, Leu Phe,Norleucine Leu Norleucine,Ile, Ile Val,Met,Ala,Phe Lys Arg,Gln,Asn Arg Met Leu,Phe,Ile Leu Phe Leu,Val,Mle,Ala, Leu Tyr Pro Ala Ala Ser Thr Thr Thr Ser Ser Trp Tyr, Phe Tyr Tyr Trp,Phe,Thr,Ser Phe Val Ile,Met,Leu,Phe, Leu Ala,Norleucine Conservative amino acid substitutions also encompass non-naturally occurring amino acid residues which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include peptidomimetics, and other reversed or inverted forms of amino acid moieties.
Conservative modifications to the amino acid sequence (and the corresponding modifications to the encoding nucleotides) are able to produce OPGbp polypeptides (and proteinaceous selective binding agents thereof) having functional and chemical characteristics similar to those of naturally occurring OPGbp or selective binding agents. In contrast, substantial modifications in the functional and/or chemical characteristics of OPGbp (and protineaceous selective binding agents thereof) may be accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the molecular backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues may be divided into groups based on common side chain properties:
1) Hydrophobic: norleucine, Met, Ala, Val, Leu, Ile;
2) Neutral hydrophilic: Cys, Ser, Thr;
3) Acidic: Asp, Glu;
4) Basic: Asn, Gln, His, Lys, Arg;
5) Residues that influence chain orientation:
Gly, Pro; and 6) Aromatic: Trp, Tyr, Phe.
Non-conservative substitutions may involve the exchange of a member of one of these classes for a member from another class.
The "identity or similarity" of two or more nucleic acid molecules and/or polypeptides provides a measure of the relatedness of two or more distinct sequences. The term "identity" refers to amino acids which are identical at corresponding positions in two distinct amino acid sequences. The term "similarity"
refers to amino acids which are either identical or are conservative substitutions as defined above at corresponding positions in two distinct amino acid sequences.
The extent of identity or similarity can be readily calculated by known methods, including but not limited to those described in Computational Molecular Biology, Lesk, A.M., ed., oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New York, 1991; and Carillo et al., SIAM J. Applied Math., 48, 1073 (1988).
Preferred methods to determine identity and/or similarity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Exemplary computer program methods to determine identity and similarity between-two sequences include, but are not limited to, the GCG program package, including GAP (Devereux et al., Nucleic Acids Research 12, 387 (1984); Genetics Computer Group, University of Wisconsin, Madison, WI), BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol.
Biol., 215, 403-410 (1990)). The BLAST X program is publicly available from the National Center for Biotechnology information (NCBI) and other sources (BLAST Manual, Altschul et al. NCB NLM NIH Bethesda, MD). The well known Smith Waterman algorithm may also be used to determine identity.
OPGbp polypeptides OPGbp polypeptides, and fragments, variants and derivatives thereof, are used as target molecules for screening and identifying the selective binding agents of the invention. When it is desired to prepare antibodies as selective binding agents, OPGbp polypeptides are preferably immunogenic, that is they elicit an immune response when administered to an animal. Alternatively, when antibodies are prepared by in vitro techniques, OPGbp polypeptides used as target molecules are capable of detectably binding an antibody or antigen binding domain.
OPG polypeptides are prepared by biological or chemical methods. Biological methods such as expression of DNA sequences encoding recombinant OPGbp are known in the art (see for example Sambrook et al.
supra). Chemical synthesis methods such as those set forth by Merrifield et al., J. Am. Chem. Soc., 85:2149 (1963), Houghten et al., Proc Natl Acad. Sci. USA, 82:5132 (1985), and Stewart and Young, Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, IL
(1984) may also be used to prepare OPGbp polypeptides of the invention. Such polypeptides may be synthesized with or without a methionine on the amino terminus.
Chemically synthesized OPGbp polypeptides, or fragments or variants thereof, may be oxidized using methods set forth in these references to form disulfide bridges.
OPGbp polypeptides of the invention prepared by chemical synthesis will have at least one biological activity comparable to the corresponding OPGbp polypeptides produced recombinantly or purified from natural sources.
OPGbp polypeptides may be obtained by isolation from biological samples such as source tissues and/or fluids in which the OPGbp polypeptides are naturally found. Sources for OPGbp polypeptides may be human or non-human in origin. Isolation of naturally-occurring OPGbp polypeptides can be accomplished using methods known in the art, such as separation by electrophoresis followed by electroelution, various types of chromatography (affinity, immunoaffinity, molecular sieve, and/or ion exchange), and/or high pressure liquid chromatography.
The presence of the OPGbp polypeptide during purification may be monitored using, for example, an antibody prepared against recombinantly produced OPGbp polypeptide or peptide fragments thereof.
Polypeptides of the invention include isolated OPGbp polypeptides and polypeptides related thereto including fragments, variants, fusion polypeptides, and derivatives as defined hereinabove.
OPGbp fragments of the invention may result from truncations at the amino terminus (with or without a leader sequence), truncations at the carboxy terminus, and/or deletions internal to the polypeptide. Such OPGbp polypeptides fragments may optionally comprise an amino terminal methionine residue. The polypeptides of the invention will be immunogenic in that they will be capable of eliciting an antibody response.
OPGbp polypeptide variants of the invention include one or more amino acid substitutions, additions and/or deletions as compared to the native OPGbp amino acid sequence. Amino acid substitutions may be conservative, as defined above, or non-conservative or any combination thereof. The variants may have additions of amino acid residues either at the carboxy terminus or at the amino terminus (where the amino terminus may or may not comprise a leader sequence).
Embodiments of the invention include OPGbp glycosylation variants and cysteine variants. OPGbp glycosylation variants include variants wherein the number and/or type of glycosylation sites has been altered compared to native OPGbp polypeptide. In one embodiment, OPGbp glycosylation variants comprise a greater or a lesser number of N-linked glycosylation sites compared to native OPGbp. Also provided for are OPGbp glycoyslation variants comprising a rearrangement of N-linked carbohydrate chains wherein one or more N-linked glycosylation sites (typically those that are naturally occurring) are eliminated and one or more new N-linked sites are created. OPGbp cysteine variants comprise a greater number or alternatively a lesser number of cysteine residues compared to native OPGbp.
In one embodiment, one or more cysteine residues are deleted or substituted with another amino acid (e.g., serine). Cysteine variants of OPGbp can improve the recovery of biologically active OPGbp by aiding the refolding of OPGbp into a biologically active conformation after isolation from a denatured state.
Preparing OPGbp polypeptide variants is within the level of skill in the art. In one approach, one may introduce one or more amino acid substitutions, deletions and/or additions in native OPGbp wherein the OPGbp variant retains the native structure of OPGbp and/or at least one of the biological activities. One approach is to compare sequences of OPG polypeptides from a variety of different species in order to identify regions of relatively low and high identity and/or similarity. It is appreciated that those regions of an OPGbp polypeptide having relatively low identity and/or similarity, are less likely to be essential for structure and activity and therefore may be more tolerant of amino acid alterations, especially those which are non-conservative. It is also appreciated that even in relatively conserved regions, one could introduce conservative amino acid substitutions while retaining activity.
In another approach, structure-function relationships can be used to identify residues in similar polypeptides that are important for activity or structure. For example, one may compare conserved amino acid residue among OPGbp and other members of the tumor necrosis factor family for which structure-function analyses are available and, based on such a comparison, predict which amino acid residues in OPGbp are important for activity or structure. One skilled in the art may choose chemically similar amino acid substitutions for such predicted important amino acid residues of OPGbp.
In yet another approach, an analysis of a secondary or tertiary structure of OPGbp (either determined by x-ray diffraction of OPGbp crystals or by structure prediction methods) can be undertaken to determine the location of specific amino acid residues in relation to actual or predicted structures within an OPGbp polypeptide. Using this information, one can introduce amino acid changes in a manner that seeks to retain as much as possible the secondary and/or tertiary structure of an OPGbp polypeptide.
In yet another approach, the effects of altering amino acids at specific positions may be tested experimentally by introducing amino acid substitutions and testing the altered OPGbp polypeptides for biological activity using assays described herein. Techniques such as alanine scanning mutagenesis (Cunningham et al., supra) are particularly suited for this approach. Many altered sequence may be conveniently tested by introducing many substitutions at various amino acid positions in OPGbp and screening the population of altered polypeptides as part of a phage display library. Using this approach, those regions of an OPGbp polypeptide that are essential for activity may be readily determined.
The above methods are useful for generating OPGbp variants which retain the native structure.
Thus, antibodies raised against each variants are likely to recognize a native structural determinant, or epitope, of OPGbp and are also likely to bind to native OPGbp. However, in some cases is may be desirable to produce OPGbp variants which do not retain native OPGbp structure or are partially or completely unfilled.
Antibodies raised against such proteins will recognize buried epitopes on OPGbp.
The invention also provides for OPGbp fusion polypeptides which comprise OPGbp polypeptides, and fragments, variants, and derivatives thereof, fused to a heterologous peptide or protein. Heterologous peptides and proteins include, but are not limited to:
an epitope to allow for detection and/or isolation ofa OPGbp fusion polypeptide; a transmembrane receptor protein or a portion thereof, such as an extracellular domain, or a transmembrane and intracellular domain; a ligand or a portion thereof which binds to a transmembrane receptor protein; an enzyme or portion thereof which is catalytically active; a protein or peptide which promotes oligomerization, such as leucine zipper domain; and a protein or peptide which increases stability, such as an immunoglobulin constant region.
A OPGbp polypeptide may be fused to itself or to a fragment, variant, or derivative thereof. Fusions may be made either at the amino terminus or at the carboxy terminus of a OPGbp polypeptide, and may be direct with no linker or adapter molecule or may be through a linker or adapter molecule. A linker or adapter molecule may also be designed with a cleavage site for a DNA restriction endonuclease or for a protease to allow for separation of the fused moieties.
In a further embodiment of the invention, a OPGbp polypeptide, fragment, variant and/or derivative is fused to an Fc region of human IgG. In one example, a human IgG hinge, CH2 and CH3 region may be fused at either the N-terminus or C-terminus of the OPGbp polypeptides using methods known to the skilled artisan. In another example, a portion of a hinge regions and CH2 and CH3 regions may be fused. The OPGbp Fc-fusion polypeptide so produced may be purified by use of a Protein A affinity column. In addition, peptides and proteins fused to an Fc region have been found to exhibit a substantially greater half-life in vivo than the unfused counterpart. Also, a fusion to an Fc region allows for dimerization/multimerization of the fusion polypeptide. The Fc region may be a naturally occurring Fc region, or may be altered to improve certain qualities, such as therapeutic qualities, circulation time, reduce aggregation, etc.
OPGbp polypeptide derivatives are included in the scope of the present invention. Such derivatives are chemically modified OPGbp polypeptide compositions in which OPGbp polypeptide is linked to a polymer. The polymer selected is typically water soluble so that the protein to which it is attached does not precipitate in an aqueous environment, such as a physiological environment. The polymer may be of any molecular weight, and may be branched or unbranched. Included within the scope of OPGbp polypeptide polymers is a mixture of polymers. Preferably, for therapeutic use of the end-product preparation, the polymer will be pharmaceutically acceptable.
The water soluble polymer or mixture thereof may be for example, polyethylene glycol (PEG), monomethoxy-polyethylene glycol, dextran (such as low molecular weight dextran, of, for example about 6 kD), cellulose, or other carbohydrate based polymers, poly-(N-vinyl pyrrolidone) polyethylene glycol, propylene glycol homopolymers, a polypropylene oxide/ethylene oxide co-polymer, polyoxyethylated polyols (e.g., glycerol) and polyvinyl alcohol.
A preferred water soluble polymer is polyethylene glycol. As used herein, polyethylene glycol is meant to encompass any of the forms of PEG
that have been used to derivatize other proteins, such as mono- (C1-C10) alkoxy-, or aryloxy-polyethylene glycol. Also encompassed by the invention are bifunctional PEG crosslinking molecules which maybe used to prepare covalently attached OPGbp multimers.
Methods for preparing chemically derivatized OPGbp polypeptides are known in the art. By way of example, derivatization of OPGbp polypeptides with PEG
may be carried out using procedures described in Francis et al., Focus on Growth Factors, _J, 4-10 (1992); EP 0 154 316; EP 0 401 384, and U.S. Patent No.
4,179,337. In a preferred embodiment, an OPGbp polypeptide derivative will have a single PEG moiety at the amino terminus. See U.S. Patent No. 5,234,784.
4) Basic: Asn, Gln, His, Lys, Arg;
5) Residues that influence chain orientation:
Gly, Pro; and 6) Aromatic: Trp, Tyr, Phe.
Non-conservative substitutions may involve the exchange of a member of one of these classes for a member from another class.
The "identity or similarity" of two or more nucleic acid molecules and/or polypeptides provides a measure of the relatedness of two or more distinct sequences. The term "identity" refers to amino acids which are identical at corresponding positions in two distinct amino acid sequences. The term "similarity"
refers to amino acids which are either identical or are conservative substitutions as defined above at corresponding positions in two distinct amino acid sequences.
The extent of identity or similarity can be readily calculated by known methods, including but not limited to those described in Computational Molecular Biology, Lesk, A.M., ed., oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New York, 1991; and Carillo et al., SIAM J. Applied Math., 48, 1073 (1988).
Preferred methods to determine identity and/or similarity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Exemplary computer program methods to determine identity and similarity between-two sequences include, but are not limited to, the GCG program package, including GAP (Devereux et al., Nucleic Acids Research 12, 387 (1984); Genetics Computer Group, University of Wisconsin, Madison, WI), BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol.
Biol., 215, 403-410 (1990)). The BLAST X program is publicly available from the National Center for Biotechnology information (NCBI) and other sources (BLAST Manual, Altschul et al. NCB NLM NIH Bethesda, MD). The well known Smith Waterman algorithm may also be used to determine identity.
OPGbp polypeptides OPGbp polypeptides, and fragments, variants and derivatives thereof, are used as target molecules for screening and identifying the selective binding agents of the invention. When it is desired to prepare antibodies as selective binding agents, OPGbp polypeptides are preferably immunogenic, that is they elicit an immune response when administered to an animal. Alternatively, when antibodies are prepared by in vitro techniques, OPGbp polypeptides used as target molecules are capable of detectably binding an antibody or antigen binding domain.
OPG polypeptides are prepared by biological or chemical methods. Biological methods such as expression of DNA sequences encoding recombinant OPGbp are known in the art (see for example Sambrook et al.
supra). Chemical synthesis methods such as those set forth by Merrifield et al., J. Am. Chem. Soc., 85:2149 (1963), Houghten et al., Proc Natl Acad. Sci. USA, 82:5132 (1985), and Stewart and Young, Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, IL
(1984) may also be used to prepare OPGbp polypeptides of the invention. Such polypeptides may be synthesized with or without a methionine on the amino terminus.
Chemically synthesized OPGbp polypeptides, or fragments or variants thereof, may be oxidized using methods set forth in these references to form disulfide bridges.
OPGbp polypeptides of the invention prepared by chemical synthesis will have at least one biological activity comparable to the corresponding OPGbp polypeptides produced recombinantly or purified from natural sources.
OPGbp polypeptides may be obtained by isolation from biological samples such as source tissues and/or fluids in which the OPGbp polypeptides are naturally found. Sources for OPGbp polypeptides may be human or non-human in origin. Isolation of naturally-occurring OPGbp polypeptides can be accomplished using methods known in the art, such as separation by electrophoresis followed by electroelution, various types of chromatography (affinity, immunoaffinity, molecular sieve, and/or ion exchange), and/or high pressure liquid chromatography.
The presence of the OPGbp polypeptide during purification may be monitored using, for example, an antibody prepared against recombinantly produced OPGbp polypeptide or peptide fragments thereof.
Polypeptides of the invention include isolated OPGbp polypeptides and polypeptides related thereto including fragments, variants, fusion polypeptides, and derivatives as defined hereinabove.
OPGbp fragments of the invention may result from truncations at the amino terminus (with or without a leader sequence), truncations at the carboxy terminus, and/or deletions internal to the polypeptide. Such OPGbp polypeptides fragments may optionally comprise an amino terminal methionine residue. The polypeptides of the invention will be immunogenic in that they will be capable of eliciting an antibody response.
OPGbp polypeptide variants of the invention include one or more amino acid substitutions, additions and/or deletions as compared to the native OPGbp amino acid sequence. Amino acid substitutions may be conservative, as defined above, or non-conservative or any combination thereof. The variants may have additions of amino acid residues either at the carboxy terminus or at the amino terminus (where the amino terminus may or may not comprise a leader sequence).
Embodiments of the invention include OPGbp glycosylation variants and cysteine variants. OPGbp glycosylation variants include variants wherein the number and/or type of glycosylation sites has been altered compared to native OPGbp polypeptide. In one embodiment, OPGbp glycosylation variants comprise a greater or a lesser number of N-linked glycosylation sites compared to native OPGbp. Also provided for are OPGbp glycoyslation variants comprising a rearrangement of N-linked carbohydrate chains wherein one or more N-linked glycosylation sites (typically those that are naturally occurring) are eliminated and one or more new N-linked sites are created. OPGbp cysteine variants comprise a greater number or alternatively a lesser number of cysteine residues compared to native OPGbp.
In one embodiment, one or more cysteine residues are deleted or substituted with another amino acid (e.g., serine). Cysteine variants of OPGbp can improve the recovery of biologically active OPGbp by aiding the refolding of OPGbp into a biologically active conformation after isolation from a denatured state.
Preparing OPGbp polypeptide variants is within the level of skill in the art. In one approach, one may introduce one or more amino acid substitutions, deletions and/or additions in native OPGbp wherein the OPGbp variant retains the native structure of OPGbp and/or at least one of the biological activities. One approach is to compare sequences of OPG polypeptides from a variety of different species in order to identify regions of relatively low and high identity and/or similarity. It is appreciated that those regions of an OPGbp polypeptide having relatively low identity and/or similarity, are less likely to be essential for structure and activity and therefore may be more tolerant of amino acid alterations, especially those which are non-conservative. It is also appreciated that even in relatively conserved regions, one could introduce conservative amino acid substitutions while retaining activity.
In another approach, structure-function relationships can be used to identify residues in similar polypeptides that are important for activity or structure. For example, one may compare conserved amino acid residue among OPGbp and other members of the tumor necrosis factor family for which structure-function analyses are available and, based on such a comparison, predict which amino acid residues in OPGbp are important for activity or structure. One skilled in the art may choose chemically similar amino acid substitutions for such predicted important amino acid residues of OPGbp.
In yet another approach, an analysis of a secondary or tertiary structure of OPGbp (either determined by x-ray diffraction of OPGbp crystals or by structure prediction methods) can be undertaken to determine the location of specific amino acid residues in relation to actual or predicted structures within an OPGbp polypeptide. Using this information, one can introduce amino acid changes in a manner that seeks to retain as much as possible the secondary and/or tertiary structure of an OPGbp polypeptide.
In yet another approach, the effects of altering amino acids at specific positions may be tested experimentally by introducing amino acid substitutions and testing the altered OPGbp polypeptides for biological activity using assays described herein. Techniques such as alanine scanning mutagenesis (Cunningham et al., supra) are particularly suited for this approach. Many altered sequence may be conveniently tested by introducing many substitutions at various amino acid positions in OPGbp and screening the population of altered polypeptides as part of a phage display library. Using this approach, those regions of an OPGbp polypeptide that are essential for activity may be readily determined.
The above methods are useful for generating OPGbp variants which retain the native structure.
Thus, antibodies raised against each variants are likely to recognize a native structural determinant, or epitope, of OPGbp and are also likely to bind to native OPGbp. However, in some cases is may be desirable to produce OPGbp variants which do not retain native OPGbp structure or are partially or completely unfilled.
Antibodies raised against such proteins will recognize buried epitopes on OPGbp.
The invention also provides for OPGbp fusion polypeptides which comprise OPGbp polypeptides, and fragments, variants, and derivatives thereof, fused to a heterologous peptide or protein. Heterologous peptides and proteins include, but are not limited to:
an epitope to allow for detection and/or isolation ofa OPGbp fusion polypeptide; a transmembrane receptor protein or a portion thereof, such as an extracellular domain, or a transmembrane and intracellular domain; a ligand or a portion thereof which binds to a transmembrane receptor protein; an enzyme or portion thereof which is catalytically active; a protein or peptide which promotes oligomerization, such as leucine zipper domain; and a protein or peptide which increases stability, such as an immunoglobulin constant region.
A OPGbp polypeptide may be fused to itself or to a fragment, variant, or derivative thereof. Fusions may be made either at the amino terminus or at the carboxy terminus of a OPGbp polypeptide, and may be direct with no linker or adapter molecule or may be through a linker or adapter molecule. A linker or adapter molecule may also be designed with a cleavage site for a DNA restriction endonuclease or for a protease to allow for separation of the fused moieties.
In a further embodiment of the invention, a OPGbp polypeptide, fragment, variant and/or derivative is fused to an Fc region of human IgG. In one example, a human IgG hinge, CH2 and CH3 region may be fused at either the N-terminus or C-terminus of the OPGbp polypeptides using methods known to the skilled artisan. In another example, a portion of a hinge regions and CH2 and CH3 regions may be fused. The OPGbp Fc-fusion polypeptide so produced may be purified by use of a Protein A affinity column. In addition, peptides and proteins fused to an Fc region have been found to exhibit a substantially greater half-life in vivo than the unfused counterpart. Also, a fusion to an Fc region allows for dimerization/multimerization of the fusion polypeptide. The Fc region may be a naturally occurring Fc region, or may be altered to improve certain qualities, such as therapeutic qualities, circulation time, reduce aggregation, etc.
OPGbp polypeptide derivatives are included in the scope of the present invention. Such derivatives are chemically modified OPGbp polypeptide compositions in which OPGbp polypeptide is linked to a polymer. The polymer selected is typically water soluble so that the protein to which it is attached does not precipitate in an aqueous environment, such as a physiological environment. The polymer may be of any molecular weight, and may be branched or unbranched. Included within the scope of OPGbp polypeptide polymers is a mixture of polymers. Preferably, for therapeutic use of the end-product preparation, the polymer will be pharmaceutically acceptable.
The water soluble polymer or mixture thereof may be for example, polyethylene glycol (PEG), monomethoxy-polyethylene glycol, dextran (such as low molecular weight dextran, of, for example about 6 kD), cellulose, or other carbohydrate based polymers, poly-(N-vinyl pyrrolidone) polyethylene glycol, propylene glycol homopolymers, a polypropylene oxide/ethylene oxide co-polymer, polyoxyethylated polyols (e.g., glycerol) and polyvinyl alcohol.
A preferred water soluble polymer is polyethylene glycol. As used herein, polyethylene glycol is meant to encompass any of the forms of PEG
that have been used to derivatize other proteins, such as mono- (C1-C10) alkoxy-, or aryloxy-polyethylene glycol. Also encompassed by the invention are bifunctional PEG crosslinking molecules which maybe used to prepare covalently attached OPGbp multimers.
Methods for preparing chemically derivatized OPGbp polypeptides are known in the art. By way of example, derivatization of OPGbp polypeptides with PEG
may be carried out using procedures described in Francis et al., Focus on Growth Factors, _J, 4-10 (1992); EP 0 154 316; EP 0 401 384, and U.S. Patent No.
4,179,337. In a preferred embodiment, an OPGbp polypeptide derivative will have a single PEG moiety at the amino terminus. See U.S. Patent No. 5,234,784.
OPGbp polypeptide derivatives disclosed herein may exhibit an enhancement or reduction of at least one biological activity of OPGbp compared to unmodified polypeptide, or may exhibit increased or decreased half-life or stability.
OPGbp selective binding agents OPGbp polypeptides, and fragments, variants and derivatives thereof, may be used to identify selective binding agents of OPGbp. As defined above, a selective binding agent of OPGbp encompasses both proteinaceous and non-proteinaceous binding agents and, in one preferred embodiment of the invention, the selective binding agent is proteinaceous. In yet another preferred embodiment, the selective binding agent is an antibody or fragment thereof which binds OPGbp, preferably human OPGbp. The antibodies of the invention may be agonist antibodies, which enhance the level of at least one biological activity of OPGbp; or antagonist antibodies, which decrease the level of at least one biological activity of OPGbp. Antagonist antibodies of OPGbp may also be referred to as inhibitory or neutralizing antibodies of OPGbp.
Although such antibodies are preferred embodiments of the invention, it is understood that other proteinaceous selective binding agents which are agonists or antagonists of OPGbp activity are also encompassed by the invention.
As described in the examples below, anti-OPGbp antibodies and antigen binding domains which inhibit at least one activity of OPGbp have been identified. Embodiments of the invention include antibodies comprising a heavy chain Fab sequence as shown in any of Figures 9, 10, 11 or 12 and further comprising a kappa or lambda light chain sequence.
OPGbp selective binding agents OPGbp polypeptides, and fragments, variants and derivatives thereof, may be used to identify selective binding agents of OPGbp. As defined above, a selective binding agent of OPGbp encompasses both proteinaceous and non-proteinaceous binding agents and, in one preferred embodiment of the invention, the selective binding agent is proteinaceous. In yet another preferred embodiment, the selective binding agent is an antibody or fragment thereof which binds OPGbp, preferably human OPGbp. The antibodies of the invention may be agonist antibodies, which enhance the level of at least one biological activity of OPGbp; or antagonist antibodies, which decrease the level of at least one biological activity of OPGbp. Antagonist antibodies of OPGbp may also be referred to as inhibitory or neutralizing antibodies of OPGbp.
Although such antibodies are preferred embodiments of the invention, it is understood that other proteinaceous selective binding agents which are agonists or antagonists of OPGbp activity are also encompassed by the invention.
As described in the examples below, anti-OPGbp antibodies and antigen binding domains which inhibit at least one activity of OPGbp have been identified. Embodiments of the invention include antibodies comprising a heavy chain Fab sequence as shown in any of Figures 9, 10, 11 or 12 and further comprising a kappa or lambda light chain sequence.
Light chain Fab sequences may be as shown in Figures 5, 6, 7 or 8. For example, "AT" antibody has light and heavy chain sequences in Figures 5 and 9, respectively;
"Y" antibody has light and heavy chains sequences of Figures 6 and 10, respectively; "S" antibody has light and heavy chain sequences of Figures 7 and 11, respectively; and "P" antibody has light and heavy chain sequences of Figures 8 and 12, respectively. The antibodies of the invention further comprise a human Fc region from any isotype, either IgG, IgM, IgA, IgE, or IgD. Preferably, the Fc region is from human IgG, such as IgG1, IgG2, IgG3, or IgG4.
The invention also provides for antibodies or antigen binding domains which comprise fragments, variants, or derivatives of the Fab sequences disclosed herein. Fragments include variable domains of either the light or heavy chain Fab sequences which are typically joined to light or heavy constant domains.
Variants include antibodies comprising light chain Fab sequences which are at least about 80%, 85%, 90%, 95%, 98% or 99% identical or similar to the Fab sequences, or the corresponding variable domains, in any one of Figures 5-8, or antibodies comprising heavy chain Fab sequences, or the corresponding variable domains, which are at least about 80%, 85%, 90%, 95%, 98% or 99%
identical or similar to the Fab sequences in any one of Figures 9-12. The antibodies may be typically associated with constant regions of the heavy and light chains to form full-length antibodies.
Antibodies and antigen binding domains, and fragments, variants and derivatives thereof, of the invention will retain the ability to bind selectively to an OPGbp polypeptide, preferably to a human OPGbp polypeptide. In one embodiment, an antibody will bind an OPGbp polypeptide with a dissociation constant (KD) of about 1 nM or less, or alternatively 0.1 nM or less, or alternatively 10 pM or less or alternatively less than 10 pM. In Example 8, it was observed that "AT"
antibody binds to OPGbp with a KD of about 0.33 to 0.43 nM.
Antibodies of the invention include polyclonal monospecific polyclonal, monoclonal, recombinant, chimeric, humanized, fully human, single chain and/or bispecific antibodies. Antibody fragments include those portions of an anti-OPGbp antibody which bind to an epitope on an OPGbp polypeptide. Examples of such fragments include Fab F(ab'), F(ab)', Fv, and sFv fragments. The antibodies may be generated by enzymatic cleavage of full-length antibodies or by recombinant DNA techniques, such as expression of recombinant plasmids containing nucleic acid sequences encoding antibody variable regions.
Polyclonal antibodies are heterogeneous populations of antibody molecules derived from the sera of animals immunized with an antigen. An antigen is a molecule or a portion of a molecule capable of being bound by an antibody which is additionally capable of inducing an animal to produce antibody capable of binding to an epitope of that antigen. An antigen can have one or more epitope. The specific reaction referred to above is meant to indicate that the antigen will react, in a highly selective manner, with its corresponding antibody and not with the multitude of other antibodies which can be evoked by other antigens.
Polyclonal antibodies directed toward an OPGbp polypeptide generally are raised in animals (e.g., rabbits or mice) by multiple subcutaneous or intraperitoneal injections of OPGbp and an adjuvant.
In accordance with the invention, it may be useful to conjugate an OPGbp polypeptide, or a variant, fragment, or derivative thereof to a carrier protein that is immunogenic in the species to be immunized, such as keyhole limpet heocyanin, serum, albumin, bovine thyroglobulin, or soybean trypsin inhibitor. Also, aggregating agents such as alum are used to enhance the immune response. After immunization, the animals are bled and the serum is assayed for anti-OPGbp antibody titer.
Monoclonal antibodies (mAbs) contain a substantially homogeneous population of antibodies specific to antigens, which population contains substantially similar epitope binding sites. Such antibodies may be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD and any subclass thereof. A
hybridoma producing a monoclonal antibody of the present invention may be cultivated in vitro, in situ, or in vivo. Production of high titers in vivo or in situ is a preferred method of production.
Monoclonal antibodies directed toward OPGbp are produced using any method which provides for the production of antibody molecules by continuous cell lines in culture. Examples of suitable methods for preparing monoclonal antibodies include hybridoma methods of Kohler et al., Nature 256, 495-497 (1975), and the human B-cell hybridoma method, Kozbor, J.
133, 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp.
51-63 (Marcel Dekker, Inc., New York, 1987); and Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory (1988).
Preferred anti-OPGbp selective binding agents include monoclonal antibodies which will inhibit partially or completely the binding of human OPGbp to its cognate receptor, ODAR, or an antibody having substantially the same specific binding characteristics, as well as fragments and regions thereof. Preferred methods for determining monoclonal antibody specificity and affinity by competitive inhibition can be found in Harlow et al., Antibodies: A
Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1988), Colligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc. and Wiley Interscience, N.Y., (1992, 1993), and Muller, Meth. Enzymol., 92:589-601 (1983).
Also provided by the invention are hybridoma cell lines which produce monoclonal antibodies reactive with OPGbp polypeptides.
Chimeric antibodies are molecules in which different portions are derived from different animal species, such as those having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region. Chimeric antibodies are primarily used to reduce immunogenicity in application and to increase yields in production, for example, where murine monoclonal antibodies have higher yields from hybridomas but higher immunogenicity in humans, such that human/marine chimeric monoclonal antibodies are used.
Chimeric antibodies and methods for their production are known in the art. Cabilly et al., Proc.
Natl. Acad. Sci. USA, 81:3273-3277 (1984); Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984);
Boulianne et al., Nature, 312:643-646 (1984); Neuberger at al., Nature, 314:268-270 (1985); Liu et al., Proc.
Natl. Acad. Sci. USA, 84:3439-3443 (1987); and Harlow and Lane Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory (1988).
For example, chimeric monoclonal antibodies of the invention may be used as a therapeutic. In such a chimeric antibody, a portion of the heavy and/or light chain is identical with or homologous to corresponding sequence in antibodies derived from a particular species or belonging to one particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequence in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see U.S. Patent No.
4,816,567; Morrison et al., Proc. Natl. Acad. Sci., 81, 6851-6855 (1985).
As used herein, the term "chimeric antibody"
includes monovalent, divalent or polyvalent immunoglobulins. A monovalent chimeric antibody is a dimer (HL) formed by a chimeric H chain associated through disulfide bridges with a chimeric L chain. A
divalent chimeric antibody is tetramer (H2L2) formed by two HL dimers associated through at least one disulfide bridge. A polyvalent chimeric antibody can also be produced, for example, by employing a C. region that aggregates (e.g., from an IgM H chain, or chain).
Murine and chimeric antibodies, fragments and regions of the present invention may comprise individual heavy (H) and/or light (L) immunoglobulin chains. A chimeric H chain comprises an antigen binding region derived from the H chain of a non-human antibody specific for OPGbp, which is linked to at least a portion of a human H chain C region (CH), such as CH1 or CH2.
A chimeric L chain according to the present invention comprises an antigen binding region derived from the L chain of a non-human antibody specific for OPGbp, linked to at least a portion of a human L chain C region (CL) .
"Y" antibody has light and heavy chains sequences of Figures 6 and 10, respectively; "S" antibody has light and heavy chain sequences of Figures 7 and 11, respectively; and "P" antibody has light and heavy chain sequences of Figures 8 and 12, respectively. The antibodies of the invention further comprise a human Fc region from any isotype, either IgG, IgM, IgA, IgE, or IgD. Preferably, the Fc region is from human IgG, such as IgG1, IgG2, IgG3, or IgG4.
The invention also provides for antibodies or antigen binding domains which comprise fragments, variants, or derivatives of the Fab sequences disclosed herein. Fragments include variable domains of either the light or heavy chain Fab sequences which are typically joined to light or heavy constant domains.
Variants include antibodies comprising light chain Fab sequences which are at least about 80%, 85%, 90%, 95%, 98% or 99% identical or similar to the Fab sequences, or the corresponding variable domains, in any one of Figures 5-8, or antibodies comprising heavy chain Fab sequences, or the corresponding variable domains, which are at least about 80%, 85%, 90%, 95%, 98% or 99%
identical or similar to the Fab sequences in any one of Figures 9-12. The antibodies may be typically associated with constant regions of the heavy and light chains to form full-length antibodies.
Antibodies and antigen binding domains, and fragments, variants and derivatives thereof, of the invention will retain the ability to bind selectively to an OPGbp polypeptide, preferably to a human OPGbp polypeptide. In one embodiment, an antibody will bind an OPGbp polypeptide with a dissociation constant (KD) of about 1 nM or less, or alternatively 0.1 nM or less, or alternatively 10 pM or less or alternatively less than 10 pM. In Example 8, it was observed that "AT"
antibody binds to OPGbp with a KD of about 0.33 to 0.43 nM.
Antibodies of the invention include polyclonal monospecific polyclonal, monoclonal, recombinant, chimeric, humanized, fully human, single chain and/or bispecific antibodies. Antibody fragments include those portions of an anti-OPGbp antibody which bind to an epitope on an OPGbp polypeptide. Examples of such fragments include Fab F(ab'), F(ab)', Fv, and sFv fragments. The antibodies may be generated by enzymatic cleavage of full-length antibodies or by recombinant DNA techniques, such as expression of recombinant plasmids containing nucleic acid sequences encoding antibody variable regions.
Polyclonal antibodies are heterogeneous populations of antibody molecules derived from the sera of animals immunized with an antigen. An antigen is a molecule or a portion of a molecule capable of being bound by an antibody which is additionally capable of inducing an animal to produce antibody capable of binding to an epitope of that antigen. An antigen can have one or more epitope. The specific reaction referred to above is meant to indicate that the antigen will react, in a highly selective manner, with its corresponding antibody and not with the multitude of other antibodies which can be evoked by other antigens.
Polyclonal antibodies directed toward an OPGbp polypeptide generally are raised in animals (e.g., rabbits or mice) by multiple subcutaneous or intraperitoneal injections of OPGbp and an adjuvant.
In accordance with the invention, it may be useful to conjugate an OPGbp polypeptide, or a variant, fragment, or derivative thereof to a carrier protein that is immunogenic in the species to be immunized, such as keyhole limpet heocyanin, serum, albumin, bovine thyroglobulin, or soybean trypsin inhibitor. Also, aggregating agents such as alum are used to enhance the immune response. After immunization, the animals are bled and the serum is assayed for anti-OPGbp antibody titer.
Monoclonal antibodies (mAbs) contain a substantially homogeneous population of antibodies specific to antigens, which population contains substantially similar epitope binding sites. Such antibodies may be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD and any subclass thereof. A
hybridoma producing a monoclonal antibody of the present invention may be cultivated in vitro, in situ, or in vivo. Production of high titers in vivo or in situ is a preferred method of production.
Monoclonal antibodies directed toward OPGbp are produced using any method which provides for the production of antibody molecules by continuous cell lines in culture. Examples of suitable methods for preparing monoclonal antibodies include hybridoma methods of Kohler et al., Nature 256, 495-497 (1975), and the human B-cell hybridoma method, Kozbor, J.
133, 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp.
51-63 (Marcel Dekker, Inc., New York, 1987); and Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory (1988).
Preferred anti-OPGbp selective binding agents include monoclonal antibodies which will inhibit partially or completely the binding of human OPGbp to its cognate receptor, ODAR, or an antibody having substantially the same specific binding characteristics, as well as fragments and regions thereof. Preferred methods for determining monoclonal antibody specificity and affinity by competitive inhibition can be found in Harlow et al., Antibodies: A
Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1988), Colligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc. and Wiley Interscience, N.Y., (1992, 1993), and Muller, Meth. Enzymol., 92:589-601 (1983).
Also provided by the invention are hybridoma cell lines which produce monoclonal antibodies reactive with OPGbp polypeptides.
Chimeric antibodies are molecules in which different portions are derived from different animal species, such as those having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region. Chimeric antibodies are primarily used to reduce immunogenicity in application and to increase yields in production, for example, where murine monoclonal antibodies have higher yields from hybridomas but higher immunogenicity in humans, such that human/marine chimeric monoclonal antibodies are used.
Chimeric antibodies and methods for their production are known in the art. Cabilly et al., Proc.
Natl. Acad. Sci. USA, 81:3273-3277 (1984); Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984);
Boulianne et al., Nature, 312:643-646 (1984); Neuberger at al., Nature, 314:268-270 (1985); Liu et al., Proc.
Natl. Acad. Sci. USA, 84:3439-3443 (1987); and Harlow and Lane Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory (1988).
For example, chimeric monoclonal antibodies of the invention may be used as a therapeutic. In such a chimeric antibody, a portion of the heavy and/or light chain is identical with or homologous to corresponding sequence in antibodies derived from a particular species or belonging to one particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequence in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see U.S. Patent No.
4,816,567; Morrison et al., Proc. Natl. Acad. Sci., 81, 6851-6855 (1985).
As used herein, the term "chimeric antibody"
includes monovalent, divalent or polyvalent immunoglobulins. A monovalent chimeric antibody is a dimer (HL) formed by a chimeric H chain associated through disulfide bridges with a chimeric L chain. A
divalent chimeric antibody is tetramer (H2L2) formed by two HL dimers associated through at least one disulfide bridge. A polyvalent chimeric antibody can also be produced, for example, by employing a C. region that aggregates (e.g., from an IgM H chain, or chain).
Murine and chimeric antibodies, fragments and regions of the present invention may comprise individual heavy (H) and/or light (L) immunoglobulin chains. A chimeric H chain comprises an antigen binding region derived from the H chain of a non-human antibody specific for OPGbp, which is linked to at least a portion of a human H chain C region (CH), such as CH1 or CH2.
A chimeric L chain according to the present invention comprises an antigen binding region derived from the L chain of a non-human antibody specific for OPGbp, linked to at least a portion of a human L chain C region (CL) .
Selective binding agents, such as antibodies, fragments, or derivatives, having chimeric H chains and L chains of the same or different variable region binding specificity, can also be prepared by appropriate association of the individual polypeptide chains, according to known method steps, e.g., according to Ausubel et al., eds. Current Protocols in Molecular Biology, Wiley Interscience, N.Y. (1993), and Harlow et al., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1988).
With this approach, hosts expressing chimeric H chains (or their derivatives) are separately cultured from hosts expressing chimeric L chains (or their derivatives), and the immunoglobulin chains are separately recovered and then associated. Alternatively, the hosts can be co-cultured and the chains allowed to associate spontaneously in the culture medium, followed by recovery of the assembled immunoglobulin, fragment or derivative.
As an example, the antigen binding region of the selective binding agent (such as a chimeric antibody) of the present invention is preferably derived from a non-human antibody specific for human OPGbp. Preferred sources for the DNA encoding such a non-human antibody include cell lines which produce antibodies, such as hybrid cell lines commonly known as hybridomas.
-30 The invention also provides for fragments, variants and derivatives, and fusions of anti-OPGbp antibodies, wherein the terms "fragments", "variants", "derivatives" and "fusions" are defined herein. The invention encompasses fragments, variants, derivatives, and fusions of anti-OPGbp antibodies which are functionally similar to the unmodified anti-OPGbp antibody, that is, they retain at least one of the activities of the unmodified antibody. In addition to the modifications set forth above, also included is the addition of genetic sequences coding for cytotoxic proteins such as plant and bacterial toxins. The fragments, variants, derivatives and fusions of anti-OPGbp antibodies can be produced from any of the hosts of this invention.
Suitable fragments include, for example, Fab, Fab', F(ab')2, Fv and scFv. These fragments lack the Fc fragment of an intact antibody, clear more rapidly from the circulation, and can have less non-specific tissue binding than an intact antibody. See Wahl et al., J. Nucl. Med., 24:316-325 (1983). These fragments are produced from intact antibodies using methods well known in the art, for example by proteolytic cleavage with enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab')2 fragments). The identification of these antigen binding regions and/or epitopes recognized by monoclonal antibodies of the present invention provides the information necessary to generate additional monoclonal antibodies with similar binding characteristics and therapeutic or diagnostic utility that parallel the embodiments of this application.
The invention provides for anti-OPGbp antibodies, or antigen binding domains, which recognize and bind to inhibiting and/or neutralizing epitopes on OPGbp. As a result of this binding, an anti-OPGbp antibody may partially or completely inhibit binding of OPGbp to its receptor, or may partially or completely inhibit osteoclast formation, bone resoprtion and/or bone loss. More particularly, the invention provides for anti-OPGbp antibodies which recognize and bind to an epitope comprising a portion of the amino acid sequence of a DE region of OPGbp (a "DE epitope"). A
With this approach, hosts expressing chimeric H chains (or their derivatives) are separately cultured from hosts expressing chimeric L chains (or their derivatives), and the immunoglobulin chains are separately recovered and then associated. Alternatively, the hosts can be co-cultured and the chains allowed to associate spontaneously in the culture medium, followed by recovery of the assembled immunoglobulin, fragment or derivative.
As an example, the antigen binding region of the selective binding agent (such as a chimeric antibody) of the present invention is preferably derived from a non-human antibody specific for human OPGbp. Preferred sources for the DNA encoding such a non-human antibody include cell lines which produce antibodies, such as hybrid cell lines commonly known as hybridomas.
-30 The invention also provides for fragments, variants and derivatives, and fusions of anti-OPGbp antibodies, wherein the terms "fragments", "variants", "derivatives" and "fusions" are defined herein. The invention encompasses fragments, variants, derivatives, and fusions of anti-OPGbp antibodies which are functionally similar to the unmodified anti-OPGbp antibody, that is, they retain at least one of the activities of the unmodified antibody. In addition to the modifications set forth above, also included is the addition of genetic sequences coding for cytotoxic proteins such as plant and bacterial toxins. The fragments, variants, derivatives and fusions of anti-OPGbp antibodies can be produced from any of the hosts of this invention.
Suitable fragments include, for example, Fab, Fab', F(ab')2, Fv and scFv. These fragments lack the Fc fragment of an intact antibody, clear more rapidly from the circulation, and can have less non-specific tissue binding than an intact antibody. See Wahl et al., J. Nucl. Med., 24:316-325 (1983). These fragments are produced from intact antibodies using methods well known in the art, for example by proteolytic cleavage with enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab')2 fragments). The identification of these antigen binding regions and/or epitopes recognized by monoclonal antibodies of the present invention provides the information necessary to generate additional monoclonal antibodies with similar binding characteristics and therapeutic or diagnostic utility that parallel the embodiments of this application.
The invention provides for anti-OPGbp antibodies, or antigen binding domains, which recognize and bind to inhibiting and/or neutralizing epitopes on OPGbp. As a result of this binding, an anti-OPGbp antibody may partially or completely inhibit binding of OPGbp to its receptor, or may partially or completely inhibit osteoclast formation, bone resoprtion and/or bone loss. More particularly, the invention provides for anti-OPGbp antibodies which recognize and bind to an epitope comprising a portion of the amino acid sequence of a DE region of OPGbp (a "DE epitope"). A
DE region of OPGbp spans approximately the D and E beta sheet regions and intervening loop sequence (a "DE
loop"). The DE region in human OPGbp comprises from about amino acid residue 212 to about amino acid residue 250 inclusive (see Figure 29). However, the amino acid sequence and endpoints of the DE region of human OPGbp are merely exemplary, and it is understood that DE regions may have sequences and endpoints which vary from those in human OPGbp. The invention encompasses antibodies which bind to such variable DE
regions.
While it is contemplated that an anti-OPGbp antibody, or an antigen binding domain, may bind at any location within a DE region, a preferred embodiment is an anti-OPGbp antibody which binds to at least part of a DE loop. The DE loop in human OPGbp spans approximately five amino acids and is located at about residues 230-234 inclusive. The DE loop in human OPGbp has the sequence DLATE. However, the amino acid sequence and endpoints of the DE loop of human OPGbp are merely exemplary and it is understood that DE loops could have sequences and endpoints which vary from those in human OPGbp. The invention encompass antibodies which bind to such variable DE loops.
As shown in Example 10, introduction of the sequence DLATE into the corresponding DE loop of murine OPGbp resulted in binding of "AT" antibody whereas the antibody had no detectable affinity for murine OPGbp with the native DE loop sequence up to an antibody concentration of about 2 g/ml. In another embodiment, an anti-OPGbp antibody binds to the amino acid sequence DLATE in human OPGbp, or to a portion of said sequence.
In another embodiment, an anti-OPGbp antibody, or antigen binding domain, binds to murine OPGbp comprising the amino acid substitutions S229D, V230L, P231A and D233E, but does not bind to murine OPGbp lacking said substitutions under similar conditions.
While the antibodies of the invention are characterized in part by the amino acid sequences on OPGbp to which they bind, it is understood and appreciated by one skilled in the art that a DE epitope on OPGbp recognized by an antibody typically comprises a three dimensional structure which may involve amino acids outside the DE region. In a linear representation of an OPGbp sequence, amino acids comprising the DE epitope may be distant from the DE
region, but in a three dimensional structure of OPGbp, amino acids of the DE epitope will likely be in proximity to the DE region. Thus, it is understood that binding of an anti-OPGbp antibody to a DE epitope may involve amino acids other than those in the DE
region. Nonetheless, it has been shown that amino acid residues in the DE loop, especially some or all of the residues in the sequence DLATE, are involved in antibody binding to OPGbp and inhibition of OPGbp activity.
Variants of selective binding agents are also provided. In one embodiment, variants of antibodies and antigen binding domains comprise changes in light and/or heavy chain amino acid sequences that are naturally occurring or are introduced by in vitro engineering of native sequences using recombinant DNA
techniques. Naturally occurring variants include "somatic" variants which are generated in vivo in the corresponding germ line nucleotide sequences during the generation of an antibody response to a foreign antigen. Variants encoded by somatic mutations in germline variable light and heavy chain sequences which generate the exemplary Fabs of the present invention in sequences are shown in Figures 16 and 19 for Fab "AT", Figures 16 and 20 for Fab "Y", Figures 17 and 21 for Fab "P" and Figures 18 and 22 for Fab "S".
Variants of anti-OPGbp antibodies and antigen binding domains are also prepared by mutagenesis techniques known in the art. In one example, amino acid changes may be introduced at random throughout an antibody coding region and the resulting variants may be screened for a desired activity, such as binding affinity for OPGbp. Alternatively, amino acid changes may be introduced in selected regions of an OPGbp antibody, such as in the light and/or heavy chain CDRs, and framework regions, and the resulting antibodies may be screened for binding to OPGbp or some other activity. Amino acid changes encompass one or more amino acid substitutions in a CDR, ranging from a single amino acid difference to the introduction of all possible permutations of amino acids within a given CDR, such as CDR3. In another method, the contribution of each residue within a CDR to OPGbp binding may be assessed by substituting at least one residue within the CDR with alanine (Lewis et al., Mol. Immunol. 32, 1065-1072 (1995)). Residues which are not optimal for binding to OPGbp may then be changed in order to determine a more optimum sequence. Also encompassed are variants generated by insertion of amino acids to increase the size of a CDR, such as CDR3. For example, most light chain CDR3 sequences are nine amino acids in length. Light chain CDR3 sequences in an antibody which are shorter than nine residues may be optimized for binding to OPGbp by insertion of appropriate amino acids to increase the length of the CDR.
In one embodiment, antibody or antigen binding domain variants comprise one or more amino acid changes in one or more of the heavy or light chain CDR1, CDR2 or CDR3 and optionally one or more of the heavy or light chain framework regions FR1, FR2 or FR3.
loop"). The DE region in human OPGbp comprises from about amino acid residue 212 to about amino acid residue 250 inclusive (see Figure 29). However, the amino acid sequence and endpoints of the DE region of human OPGbp are merely exemplary, and it is understood that DE regions may have sequences and endpoints which vary from those in human OPGbp. The invention encompasses antibodies which bind to such variable DE
regions.
While it is contemplated that an anti-OPGbp antibody, or an antigen binding domain, may bind at any location within a DE region, a preferred embodiment is an anti-OPGbp antibody which binds to at least part of a DE loop. The DE loop in human OPGbp spans approximately five amino acids and is located at about residues 230-234 inclusive. The DE loop in human OPGbp has the sequence DLATE. However, the amino acid sequence and endpoints of the DE loop of human OPGbp are merely exemplary and it is understood that DE loops could have sequences and endpoints which vary from those in human OPGbp. The invention encompass antibodies which bind to such variable DE loops.
As shown in Example 10, introduction of the sequence DLATE into the corresponding DE loop of murine OPGbp resulted in binding of "AT" antibody whereas the antibody had no detectable affinity for murine OPGbp with the native DE loop sequence up to an antibody concentration of about 2 g/ml. In another embodiment, an anti-OPGbp antibody binds to the amino acid sequence DLATE in human OPGbp, or to a portion of said sequence.
In another embodiment, an anti-OPGbp antibody, or antigen binding domain, binds to murine OPGbp comprising the amino acid substitutions S229D, V230L, P231A and D233E, but does not bind to murine OPGbp lacking said substitutions under similar conditions.
While the antibodies of the invention are characterized in part by the amino acid sequences on OPGbp to which they bind, it is understood and appreciated by one skilled in the art that a DE epitope on OPGbp recognized by an antibody typically comprises a three dimensional structure which may involve amino acids outside the DE region. In a linear representation of an OPGbp sequence, amino acids comprising the DE epitope may be distant from the DE
region, but in a three dimensional structure of OPGbp, amino acids of the DE epitope will likely be in proximity to the DE region. Thus, it is understood that binding of an anti-OPGbp antibody to a DE epitope may involve amino acids other than those in the DE
region. Nonetheless, it has been shown that amino acid residues in the DE loop, especially some or all of the residues in the sequence DLATE, are involved in antibody binding to OPGbp and inhibition of OPGbp activity.
Variants of selective binding agents are also provided. In one embodiment, variants of antibodies and antigen binding domains comprise changes in light and/or heavy chain amino acid sequences that are naturally occurring or are introduced by in vitro engineering of native sequences using recombinant DNA
techniques. Naturally occurring variants include "somatic" variants which are generated in vivo in the corresponding germ line nucleotide sequences during the generation of an antibody response to a foreign antigen. Variants encoded by somatic mutations in germline variable light and heavy chain sequences which generate the exemplary Fabs of the present invention in sequences are shown in Figures 16 and 19 for Fab "AT", Figures 16 and 20 for Fab "Y", Figures 17 and 21 for Fab "P" and Figures 18 and 22 for Fab "S".
Variants of anti-OPGbp antibodies and antigen binding domains are also prepared by mutagenesis techniques known in the art. In one example, amino acid changes may be introduced at random throughout an antibody coding region and the resulting variants may be screened for a desired activity, such as binding affinity for OPGbp. Alternatively, amino acid changes may be introduced in selected regions of an OPGbp antibody, such as in the light and/or heavy chain CDRs, and framework regions, and the resulting antibodies may be screened for binding to OPGbp or some other activity. Amino acid changes encompass one or more amino acid substitutions in a CDR, ranging from a single amino acid difference to the introduction of all possible permutations of amino acids within a given CDR, such as CDR3. In another method, the contribution of each residue within a CDR to OPGbp binding may be assessed by substituting at least one residue within the CDR with alanine (Lewis et al., Mol. Immunol. 32, 1065-1072 (1995)). Residues which are not optimal for binding to OPGbp may then be changed in order to determine a more optimum sequence. Also encompassed are variants generated by insertion of amino acids to increase the size of a CDR, such as CDR3. For example, most light chain CDR3 sequences are nine amino acids in length. Light chain CDR3 sequences in an antibody which are shorter than nine residues may be optimized for binding to OPGbp by insertion of appropriate amino acids to increase the length of the CDR.
In one embodiment, antibody or antigen binding domain variants comprise one or more amino acid changes in one or more of the heavy or light chain CDR1, CDR2 or CDR3 and optionally one or more of the heavy or light chain framework regions FR1, FR2 or FR3.
Amino acid changes comprise substitutions, deletions and/or insertions of amino acid residues. Exemplary variants include an "AT" heavy chain variable region variant with one or more amino acid changes in the sequences NYAIH (SEQ ID NO: 13); WINAGNGNTIKFSQKFQF
(SEQ ID NO: 16); or DSSNMVRGIIIAYYFDY (SEQ ID NO: 19), or an "AT" light chain variable region variant with one or more amino acid changes in the sequences RASQSISRYLN
(SEQ ID NO: 01); GASSLQS (SEQ ID NO: 05); or QHTRA (SEQ
ID NO: 09). The aforementioned "AT" heavy and light chain variable region variants may further comprise one or more amino acid changes in the framework regions.
In one example, one or more amino acid changes may be introduced to substitute a somatically mutated framework residue with the germline residue at that position. When the aforementioned amino acid changes are substitutions, the changes may be conservative or non-conservative substitutions.
Examples 11 and 12 provide variants in light and heavy chain CDR3 region of AT antibody. In one embodiment, the invention provides for variants in either SEQ ID NO:19 (heavy chain CDR3) or SEQ ID NO:9 (light chain CDR3) such that the resulting antibodies or antigen binding domains bind selectively to an OPG
binding protein. In one embodiment, the OPGbp is human OPGbp.
The invention provides for anti-OPG bp antibodies comprising variable light and variable heavy chains and further comprising a heavy chain CDR3 region having the sequence selected from the group consisting of:
XSSNMVRGIIIAYYFDY (SEQ ID NO: 80);
DXSNMVRGIIIAYYFDY (SEQ ID NO: 81);
DSXNMVRGIIIAYYFDY (SEQ ID NO: 82);
DSSXMVRGIIIAYYFDY (SEQ ID NO: 83);
(SEQ ID NO: 16); or DSSNMVRGIIIAYYFDY (SEQ ID NO: 19), or an "AT" light chain variable region variant with one or more amino acid changes in the sequences RASQSISRYLN
(SEQ ID NO: 01); GASSLQS (SEQ ID NO: 05); or QHTRA (SEQ
ID NO: 09). The aforementioned "AT" heavy and light chain variable region variants may further comprise one or more amino acid changes in the framework regions.
In one example, one or more amino acid changes may be introduced to substitute a somatically mutated framework residue with the germline residue at that position. When the aforementioned amino acid changes are substitutions, the changes may be conservative or non-conservative substitutions.
Examples 11 and 12 provide variants in light and heavy chain CDR3 region of AT antibody. In one embodiment, the invention provides for variants in either SEQ ID NO:19 (heavy chain CDR3) or SEQ ID NO:9 (light chain CDR3) such that the resulting antibodies or antigen binding domains bind selectively to an OPG
binding protein. In one embodiment, the OPGbp is human OPGbp.
The invention provides for anti-OPG bp antibodies comprising variable light and variable heavy chains and further comprising a heavy chain CDR3 region having the sequence selected from the group consisting of:
XSSNMVRGIIIAYYFDY (SEQ ID NO: 80);
DXSNMVRGIIIAYYFDY (SEQ ID NO: 81);
DSXNMVRGIIIAYYFDY (SEQ ID NO: 82);
DSSXMVRGIIIAYYFDY (SEQ ID NO: 83);
DSSNXVRGIIIAYYFDY (SEQ ID NO: 84);
DSSNMXRGIIIAYYFDY (SEQ ID NO: 85);
DSSNMVXGIIIAYYFDY (SEQ ID NO: 86);
DSSNMVRXIIIAYYFDY (SEQ ID NO: 87);
DSSNMVRGXIIAYYFDY (SEQ ID NO: 88);
DSSNMVRGIXIAYYFDY (SEQ ID NO: 89);
DSSNMVRGIIXAYYFDY (SEQ ID NO: 90);
DSSNMVRGIIIXYYFDY (SEQ ID NO: 91);
DSSNMVRGIIIAXYFDY (SEQ ID NO: 92);
DSSNMVRGIIIAYXFDY (SEQ ID NO: 93);
DSSNMVRGIIIAYYXDY (SEQ ID NO: 94);
DSSNMVRGIIIAYYFXY (SEQ ID NO: 95); and DSSNMVRGIIIAYYFDX (SEQ ID NO: 96);
wherein X can be any amino acid residue which is different from the amino acid residue normally resident at that position, and wherein the resulting antibody binds selectively to an OPGbp.
The invention also provides for anti-OPGbp antibodies comprising variable light and variable heavy chains and further comprising a light chain CDR3 sequence which is increased from five amino acids to up to nine amino acids. More particularly, the light chain CDR3 sequence is selected from the group consisting of:
QHTXXXXRA (SEQ ID NO: 97) wherein the first occurrence of X from left to right denotes any amino acid residue other than arginine, the second, third and fourth occurrences of X denote any amino acid residue, but preferably alanine, and wherein the resulting antibody binds selectively to an OPGbp.
In another embodiment of the invention, a light chain CDR3 sequence is selected from the group consisting of:
DSSNMXRGIIIAYYFDY (SEQ ID NO: 85);
DSSNMVXGIIIAYYFDY (SEQ ID NO: 86);
DSSNMVRXIIIAYYFDY (SEQ ID NO: 87);
DSSNMVRGXIIAYYFDY (SEQ ID NO: 88);
DSSNMVRGIXIAYYFDY (SEQ ID NO: 89);
DSSNMVRGIIXAYYFDY (SEQ ID NO: 90);
DSSNMVRGIIIXYYFDY (SEQ ID NO: 91);
DSSNMVRGIIIAXYFDY (SEQ ID NO: 92);
DSSNMVRGIIIAYXFDY (SEQ ID NO: 93);
DSSNMVRGIIIAYYXDY (SEQ ID NO: 94);
DSSNMVRGIIIAYYFXY (SEQ ID NO: 95); and DSSNMVRGIIIAYYFDX (SEQ ID NO: 96);
wherein X can be any amino acid residue which is different from the amino acid residue normally resident at that position, and wherein the resulting antibody binds selectively to an OPGbp.
The invention also provides for anti-OPGbp antibodies comprising variable light and variable heavy chains and further comprising a light chain CDR3 sequence which is increased from five amino acids to up to nine amino acids. More particularly, the light chain CDR3 sequence is selected from the group consisting of:
QHTXXXXRA (SEQ ID NO: 97) wherein the first occurrence of X from left to right denotes any amino acid residue other than arginine, the second, third and fourth occurrences of X denote any amino acid residue, but preferably alanine, and wherein the resulting antibody binds selectively to an OPGbp.
In another embodiment of the invention, a light chain CDR3 sequence is selected from the group consisting of:
QHTXAAARA (SEQ ID NO: 98) wherein X is any amino acid residue other than arginine.
In another embodiment, the antibody variants of the invention comprise V1 chains having a CDR1 sequence as in SEQ ID NO:1 and a CDR2 sequence as in SEQ ID NO:5, and comprise Vh chains having Vh chains having a CDR1 sequence as in SEQ ID NO:13 and a CDR2 sequence as in SEQ ID NO:16. In another embodiment, the antibody variants comprise a V1 chain from "AT"
antibody with the aforementioned light chain CDR3 variants and a Vh chain from "AT" antibody with the aforementioned heavy chain CDR3 variants.Variants may also be prepared by "chain shuffling" of either light or heavy chains (Marks et al. Biotechnology 10, 779-783 (1992)). Typically, a single light (or heavy) chain is combined with a library having a repertoire of heavy (or light) chains and the resulting population is screened for a desired activity, such as binding to OPGbp. This technique permits screening of a greater sample of different heavy (or light) chains in combination with a single light (or heavy) chain than is possible with libraries comprising repertoires of both heavy and light chains.
The selective binding agents of the invention can be bispecific. Bispecific selective binding agents of this invention can be of several configurations. For example, bispecific antibodies resemble single antibodies (or antibody fragments) but have two different antigen binding sites (variable regions).
Bispecific antibodies can be produced by chemical techniques (see e.g., Kranz et al., Proc. Natl. Acad.
Sci. USA, 78:5807 (1981)), by "polydoma" techniques (see U.S. Pat. No. 4,474,893 to Reading) or by recombinant DNA techniques.
In another embodiment, the antibody variants of the invention comprise V1 chains having a CDR1 sequence as in SEQ ID NO:1 and a CDR2 sequence as in SEQ ID NO:5, and comprise Vh chains having Vh chains having a CDR1 sequence as in SEQ ID NO:13 and a CDR2 sequence as in SEQ ID NO:16. In another embodiment, the antibody variants comprise a V1 chain from "AT"
antibody with the aforementioned light chain CDR3 variants and a Vh chain from "AT" antibody with the aforementioned heavy chain CDR3 variants.Variants may also be prepared by "chain shuffling" of either light or heavy chains (Marks et al. Biotechnology 10, 779-783 (1992)). Typically, a single light (or heavy) chain is combined with a library having a repertoire of heavy (or light) chains and the resulting population is screened for a desired activity, such as binding to OPGbp. This technique permits screening of a greater sample of different heavy (or light) chains in combination with a single light (or heavy) chain than is possible with libraries comprising repertoires of both heavy and light chains.
The selective binding agents of the invention can be bispecific. Bispecific selective binding agents of this invention can be of several configurations. For example, bispecific antibodies resemble single antibodies (or antibody fragments) but have two different antigen binding sites (variable regions).
Bispecific antibodies can be produced by chemical techniques (see e.g., Kranz et al., Proc. Natl. Acad.
Sci. USA, 78:5807 (1981)), by "polydoma" techniques (see U.S. Pat. No. 4,474,893 to Reading) or by recombinant DNA techniques.
The selective binding agents of the invention may also be heteroantibodies. Heteroantibodies are two or more antibodies, or antibody binding fragments (Fab) linked together, each antibody or fragment having a different specificity.
The invention also relates to "humanized"
antibodies. Methods for humanizing non-human antibodies are well known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into a human antibody from a source which is non-human. In general, non-human residues will be present in CDRs. Humanization can be performed following methods known in the art (Jones et al., Nature 321, 522-525 (1986); Riechmann et al., Nature, 332, 323-327 (1988); Verhoeyen et al., Science 239, 1534-1536 (1988)), by substituting rodent complementarily-determining regions (CDRs) for the corresponding regions of a human antibody.
The selective binding agents of the invention, including chimeric, CDR-grafted, and humanized antibodies can be produced by recombinant methods known in the art. Nucleic acids encoding the antibodies are introduced into host cells and expressed using materials and procedures described herein and known in the art. In a preferred embodiment, the antibodies are produced in mammalian host cells, such as CHO cells. Fully human antibodies may be produced by expression of recombinant DNA transfected into host cells or by expression in hybridoma cells as described above.
Techniques for creating recombinant DNA
versions of the antigen-binding regions of antibody molecules which bypass the generation of monoclonal antibodies are encompassed within the practice of this invention. To do so, antibody-specific messenger RNA
molecules are extracted from immune system cells taken from an immunized animal, and transcribed into complementary DNA (cDNA). The cDNA is then cloned into a bacterial expression system. One example of such a technique suitable for the practice of this invention uses a bacteriophage lambda vector system having a leader sequence that causes the expressed Fab protein to migrate to the periplasmic space (between the bacterial cell membrane and the cell wall) or to be secreted. One can rapidly generate and screen great numbers of functional Fab fragments for those which bind the antigen. Such OPGbp selective binding agents (Fab fragments with specificity for an OPGbp polypeptide) are specifically encompassed within the term "antibody" as it is defined, discussed, and claimed herein.
Also within the scope of the invention are techniques developed for the production of chimeric antibodies by splicing the genes from a mouse antibody molecule of appropriate antigen-specificity together with genes from a human antibody molecule of appropriate biological activity, such as the ability to activate human complement and mediate ADCC. (Morrison et al., Proc. Natl. Acad. Sci., 81:6851 (1984);
Neuberger et al., Nature, 312:604 (1984)). One example is the replacement of a Fc region with that of a different isotype. Selective binding agents such as antibodies produced by this technique are within the scope of the invention.
In a preferred embodiment of the invention, the anti-OPGbp antibodies are fully human antibodies.
Thus encompassed by the invention are antibodies which bind OPGbp polypeptides and are encoded by nucleic acid sequences which are naturally occurring somatic variants of human germline immunoglobulin nucleic acid sequence, and fragments, synthetic variants, derivatives and fusions thereof. Such antibodies may be produced by any method known in the art. Exemplary methods include immunization with a OPGbp antigen (any OPGbp polypeptide capable of elicing an immune response, and optionally conjugated to a carrier) of transgenic animals (e.g., mice) that are capable of producing a repertoire of human antibodies in the absence of endogenous immunoglobulin production. See, for example, Jakobovits et al., Proc. Natl. Acad. Sci., 2Q, 2551-2555 (1993); Jakobovits et al., Nature, 362, 255-258 (1993); Bruggermann et al., Year in Immunol., 7, 33 (1993).
Alternatively, human antibodies may be generated through the in vitro screening of phage display antibody libraries. See Hoogenboom et al., J.
Mol. Biol., 227, 381 (1991); Marks et al., J. Mol.
Biol., 222, 581 (1991), Various antibody-containing phage display libraries have been described and may be readily prepared by one skilled in the art. Libraries may contain a diversity of human antibody sequences, such as human Fab, Fv, and scFv fragments, that may be screened against an appropriate target. Example 1 describes the screening of a Fab phage library against OPGbp to identify those molecules which selectively bind OPGbp. It will be appreciated that phage display libraries may comprise peptides or proteins other than antibodies which may be screened to identify selective binding agents of OPGbp.
An anti-idiotypic (anti-Id) antibody is an antibody which recognizes unique determinants generally associated with the antigen-binding site of an antibody. An Id antibody can be prepared by immunizing an animal of the same species and genetic type (e.g., mouse strain) as the source of the monoclonal antibody with the monoclonal antibody to which an anti-Id is being prepared. The immunized animal will recognize and respond to the idiotypic determinants of the immunizing antibody by producing an antibody to these idiotypic determinants (the anti-Id antibody). See, for example, U.S. Pat. No. 4,699,880.
The anti-Id antibody may also be used as an "immunogen" to induce an immune response in yet another animal, producing a so-called anti-anti-Id antibody. The anti-anti-Id may be epitopically identical to the original monoclonal antibody which induced the anti-Id. Thus, by using antibodies to the idiotypic determinants of a mAb, it is possible to identify other clones expressing antibodies of identical specificity.
Production of selective binding agents of OPGbg When the selective binding agent of OPGbp to be prepared is a proteinaceous selective binding agent, such as an antibody or an antigen binding domain, various biological or chemical methods for producing said agent are available.
Biological methods are preferable for producing sufficient quantities of a selective binding agent for therapeutic use. Standard recombinant DNA
techniques are particularly useful for the production of antibodies and antigen binding domains of the invention. Exemplary expression vectors, host cells and methods for recovery of the expressed product are described below.
A nucleic acid molecule encoding an OPGbp antibody or antigen binding domain is inserted into an appropriate expression vector using standard ligation techniques. The vector is typically selected to be functional in the particular host cell employed (i.e., the vector is compatible with the host cell machinery 35, such that amplification of the gene and/or expression of the gene can occur). A nucleic acid molecule encoding an anti-OPGbp antibody may be amplified/expressed in prokaryotic, yeast, insect (baculovirus systems) and/or eukaryotic host cells.
Selection of the host cell will depend in part on whether an anti-OPGbp antibody is to be post-transitionally modified (e.g., glycosylated and/or phosphorylated). If so, yeast, insect, or mammalian host cells are preferable. For a review of expression vectors, see Meth. Enz. v. 185, D.V. Goeddel, ed.
Academic Press Inc., San Diego, CA (1990) Typically, expression vectors used in any host cells will contain one or more of the following components: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a leader sequence for secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element. Each of these sequences is discussed in more detail below.
The vector components may be homologous (i.e., from the same species and/or strain as the host cell), heterologous (i.e., from a species other than the host cell species or strain), hybrid (i.e., a combination of different sequences from more than one source), synthetic, or native sequences which normally function to regulate immunoglobulin expression. As such, a source of vector components may be any prokaryotic or eukaryotic organism, any vertebrate or invertebrate organism, or any plant, provided that the components are functional in, and can be activated by, the host cell machinery.
An origin of replication is selected based upon the type of host cell being used for expression.
For example, the origin of replication from the plasmid pBR322 (Product No. 303-3s, New England Biolabs, Beverly, MA) is suitable for most Gram-negative bacteria while various origins from SV40, polyoma, adenovirus, vesicular stomatitus virus (VSV) or papillomaviruses (such as HPV or BPV) are useful for cloning vectors in mammalian cells. Generally, the origin of replication component is not needed for mammalian expression vectors (for example, the SV40 origin is often used only because it contains the early promoter).
A transcription termination sequence is typically located 3' of the end of a polypeptide coding regions and serves to terminate transcription.
Usually, a transcription termination sequence in prokaryotic cells is a G-C rich fragment followed by a poly T sequence. While the sequence is easily cloned from a library or even purchased commercially as part of a vector, it can also be readily synthesized using methods for nucleic acid synthesis such as those described above.
A selectable marker gene element encodes a protein necessary for the survival and growth of a host cell grown in a selective culture medium. Typical selection marker genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, tetracycline, or kanamycin for prokaryotic host cells, (b) complement auxotrophic deficiencies of the cell; or (c) supply critical nutrients not available from complex media. Preferred selectable markers are the kanamycin resistance gene, the ampicillin resistance gene, and the tetracycline resistance gene. A neomycin resistance gene may also be used for selection in prokaryotic and eukaryotic host cells.
Other selection genes may be used to amplify the gene which will be expressed. Amplification is the process wherein genes which are in greater demand for the production of a protein critical for growth are reiterated in tandem within the chromosomes of successive generations of recombinant cells. Examples of suitable selectable markers for mammalian cells include dihydrofolate reductase (DHFR) and thymidine kinase. The mammalian cell transformants are placed under selection pressure which only the transformants are uniquely adapted to survive by virtue of the marker present in the vector. Selection pressure is imposed by culturing the transformed cells under conditions in which the concentration of selection agent in the medium is successively changed, thereby leading to amplification of both the selection gene and the DNA
that encodes an anti-OPGbp antibody. As a result, increased quantities of an antibody are synthesized from the amplified DNA.
A ribosome binding site is usually necessary for translation initiation of mRNA and is characterized by a Shine-Dalgarno sequence (prokaryotes) or a Kozak sequence (eukaryotes). The element is typically located 3' to the promoter and 5' to the coding sequence of the polypeptide to be expressed. The Shine-Dalgarno sequence is varied but is typically a polypurine (i.e., having a high A-G content). Many Shine-Dalgarno sequences have been identified, each of which can be readily synthesized using methods set forth above and used in a prokaryotic vector.
A leader, or signal, sequence is used to direct secretion of a polypeptide. A signal sequence may be positioned within or directly at the 5' end of a polypeptide coding region. Many signal sequences have been identified and may be selected based upon the host cell used for expression. In the present invention, a signal sequence may be homologous (naturally occurring) or heterologous to a nucleic acid sequence encoding an anti-OPGbp antibody or antigen binding domain. A
heterologous signal sequence selected should be one that is recognized and processed, i.e., cleaved, by a signal peptidase, by the host cell. For prokaryotic host cells that do not recognize and process a native immunoglobulin signal sequence, the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, or heat-stable enterotoxin II leaders. For yeast secretion, a native immunoglobulin signal sequence may be substituted by the yeast invertase, alpha factor, or acid phosphatase leaders. In mammalian cell expression the native signal sequence is satisfactory, although other mammalian signal sequences may be suitable.
In most cases, secretion of an anti-OPGbp antibody or antigen binding domain from a host cell will result in the removal of the signal peptide from the antibody. Thus the mature antibody will lack any leader or signal sequence.
In some cases, such as where glycosylation is desired in a eukaryotic host cell expression system, one may manipulate the various presequences to improve glycosylation or yield. For example, one may alter the peptidase cleavage site of a particular signal peptide, or add prosequences, which also may affect glycosylation. The final protein product may have, in the -1 position (relative to the first amino acid of the mature protein) one or more additional amino acids incident to expression, which may not have been totally removed. For example, the final protein product may have one or two amino acid found in the peptidase cleavage site, attached to the N-terminus.
Alternatively, use of some enzyme cleavage sites may result in a slightly truncated form of the desired OPGbp polypeptide, if the enzyme cuts at such area within the mature polypeptide.
The expression vectors of the present invention will typically contain a promoter that is recognized by the host organism and operably linked to a nucleic acid molecule encoding an anti-OPGbp antibody or antigen binding domain. Either a native or heterologous promoter may be used depending the host cell used for expression and the yield of protein desired.
Promoters suitable for use with prokaryotic hosts include the beta-lactamase and lactose promoter systems; alkaline phosphatase, a tryptophan (trp) promoter system; and hybrid promoters such as the tac promoter. Other known bacterial promoters are also suitable. Their sequences have been published, thereby enabling one skilled in the art to ligate them to the desired DNA sequence(s), using linkers or adapters as needed to supply any required restriction sites.
Suitable promoters for use with yeast hosts are also well known in the art. Yeast enhancers are advantageously used with yeast promoters. Suitable promoters for use with mammalian host cells are well known and include those obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and most preferably Simian Virus 40 (SV40). Other suitable mammalian promoters include heterologous mammalian promoters, e.g., heat-shock promoters and the actin promoter.
Additional promoters which may be used for expressing the selective binding agents of the invention include, but are not limited to: the SV40 early promoter region (Bernoist and Chambon, Nature, 290:304-310, 1981); the CMV promoter; the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto, et al., Cell, 22; 787-797, 1980); the herpes thymidine kinase promoter (Wagner et al., Proc. Natl. Acad. Sci. U.S.A., 78; 144-1445, 1981); the regulatory sequences of the metallothionine gene (Brinster et al., Nature, 296; 39-42, 1982);
prokaryotic expression vectors such as the beta -lactamase promoter (Villa-Kamaroff, et al., Proc. Natl.
Acad. Sci. U.S.A., 75; 3727-3731, 1978); or the tac promoter (DeBoer, et al., Proc. Natl. Acad. Sci.
U.S.A., 80; 21-25, 1983). Also of interest are the following animal transcriptional control regions, which exhibit tissue specificity and have been utilized in transgenic animals: the elastase I gene control region which is active in pancreatic acinar cells (Swift et al., Cell, 38; :639-646, 1984; Ornitz et al., Cold Spring Harbor Symp. Quant. Biol. 50; 399-409, 1986;
MacDonald, Hepatology, 7; :425-515, 1987); the insulin gene control region which is active in pancreatic beta cells (Hanahan, Nature, 315; 115-122, 1985); the immunoglobulin gene control region which is active in lymphoid cells (Grosschedl et al., Cell, 38; 647-658, 1984; Adames et al., Nature, 318; 533-538, 1985;
Alexander et al., Mol. Cell. Biol., 7; 1436-1444, 1987); the mouse mammary tumor virus control region which is active in testicular, breast, lymphoid and mast cells (Leder et al., Cell, 45; 485-495, 1986), albumin gene control region which is active in liver (Pinkert et al., Genes and Devel., 1; 268-276, 1987);
the alphafetoprotein gene control region which is active in liver (Krumlauf et al., Mol. Cell. Biol., 5;
1639-1648, 1985; Hammer et al,, Science, 235; 53-58, 1987); the alpha 1-antitrypsin gene control region which is active in the liver (Kelsey et al., Genes and Devel., 1; 161-171, 1987); the beta-globin gene control region which is active in myeloid cells (Mogram et al., Nature, 315; 338-340, 1985; Kollias et al., Cell, 46;
89-94, 1986); the myelin basic protein gene control region which is active in oligodendrocyte cells in the brain (Readhead et al., Cell, 48; 703-712, 1987); the myosin light chain-2 gene control region which is active in skeletal muscle (Sani, Nature, 314; 283-286, 1985); and the gonadotropic releasing hormone gene control region which is active in the hypothalamus (Mason et al., Science, 234; 1372-1378, 1986).
An enhancer sequence may be inserted into the vector to increase transcription in eucaryotic host cells. Several enhancer sequences available from mammalian genes are known (e.g., globin, elastase, albumin, alpha-feto-protein and insulin). Typically, however, an enhancer from a virus will be used. The SV40 enhancer, the cytomegalovirus early promoter enhancer, the polyoma enhancer, and adenovirus enhancers are exemplary enhancing elements for the activation of eukaryotic promoters. While an enhancer may be spliced into the vector at a position 5' or 3' to the polypeptide coding region, it is typically located at a site 5' from the promoter.
Preferred vectors for practicing this invention are those which are compatible with bacterial, insect, and mammalian host cells. Such vectors include, inter alia, pCRII, pCR3, and pcDNA3.1 (Invitrogen Company, San Diego, CA), pBSII (Stratagene Company, La Jolla, CA), pET15 (Novagen, Madison, WI), pGEX (Pharmacia Biotech, Piscataway, NJ), pEGFP-N2 (Clontech, Palo Alto, CA), pETL (BlueBacli;
Invitrogen), pDSR-alpha (PCT Publication No.
W090/14363) and pFastBacDual (Gibco/BRL, Grand Island, NY).
Additional possible vectors include, but are not limited to, cosmids, plasmids or modified viruses, but the vector system must be compatible with the selected host cell. Such vectors include, but are not limited to plasmids such as Bluescript plasmid derivatives (a high copy number ColEl-based phagemid, Stratagene Cloning Systems Inc., La Jolla CA), PCR
cloning plasmids designed for cloning Taq-amplified PCR
products (e.g., TOPOTM TA Cloning Kit, PCR2.1 plasmid derivatives, Invitrogen, Carlsbad, CA), and mammalian yeast or virus vectors such as a baculovirus expression system (pBacPAK plasmid derivatives, Clontech, Palo Alto, CA). The recombinant molecules can be introduced into host cells via transformation, transfection, infection, electroporation, or other known techniques.
Host cells of the invention may be prokaryotic host cells (such as E. coli) or eukaryotic host cells (such as a yeast cell, an insect cell, or a vertebrate cell). The host cell, when cultured under appropriate conditions, expresses an antibody or antigen binding domain of the invention which can subsequently be collected from the culture medium (if the host cell secretes it into the medium) or directly from the host cell producing it (if it is not secreted). Selection of an appropriate host cell will depend upon various factors, such as desired expression levels, polypeptide modifications that are desirable or necessary for activity, such as glycosylation or phosphorylation, and ease of folding into a biologically active molecule.
A number of suitable host cells are known in the art and many are available from the American Type Culture Collection (ATCC), Manassas, VA. Examples include mammalian cells, such as Chinese hamster ovary cells (CHO) (ATCC No. CCL61) CHO DHFR- cells (Urlaub et al. Proc. Natl. Acad. Sci. USA 97, 4216-4220 (1980)), human embryonic kidney (HEK) 293 or 293T cells (ATCC
No. CRL1573), or 3T3 cells (ATCC No. CCL92). The selection of suitable mammalian host cells and methods for transformation, culture, amplification, screening and product production and purification are known in the art. Other suitable mammalian cell lines, are the monkey COS-1 (ATCC No. CRL1650) and COS-7 cell lines (ATCC No. CRL1651), and the CV-1 cell line (ATCC No.
CCL70). Further exemplary mammalian host cells include primate cell lines and rodent cell lines, including transformed cell lines. Normal diploid cells, cell strains derived from in vitro culture of primary tissue, as well as primary explants, are also suitable.
Candidate cells may be genotypically deficient in the selection gene, or may contain a dominantly acting selection gene. Other suitable mammalian cell lines include but are not limited to, mouse neuroblastoma N2A
cells', HeLa, mouse L-929 cells, 3T3 lines derived from Swiss, Balb-c or NIH mice, BHK or HaK hamster cell lines, which are available from the American Type Culture Collection, Manassas, VA). Each of these cell lines is known by and available to those skilled in the art of protein expression.' Similarly useful as host cells suitable for the present invention are bacterial cells. For example, the various strains of E. coli (e.g., HB101, (ATCC No. 33694) DH5(x, DH10, and MC1061 (ATCC No.
53338)) are well-known as host cells in the field of biotechnology. Various strains of B. subtilis, Pseudomonas spp., other Bacillus spp., Streptomyces spp., and the like may also be employed in this method.
Many strains of yeast cells known to those skilled in the art are also available as host cells for expression of the polypeptides of the present invention. Preferred yeast cells include, for example, Saccharomvices cerivisae.
The invention also relates to "humanized"
antibodies. Methods for humanizing non-human antibodies are well known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into a human antibody from a source which is non-human. In general, non-human residues will be present in CDRs. Humanization can be performed following methods known in the art (Jones et al., Nature 321, 522-525 (1986); Riechmann et al., Nature, 332, 323-327 (1988); Verhoeyen et al., Science 239, 1534-1536 (1988)), by substituting rodent complementarily-determining regions (CDRs) for the corresponding regions of a human antibody.
The selective binding agents of the invention, including chimeric, CDR-grafted, and humanized antibodies can be produced by recombinant methods known in the art. Nucleic acids encoding the antibodies are introduced into host cells and expressed using materials and procedures described herein and known in the art. In a preferred embodiment, the antibodies are produced in mammalian host cells, such as CHO cells. Fully human antibodies may be produced by expression of recombinant DNA transfected into host cells or by expression in hybridoma cells as described above.
Techniques for creating recombinant DNA
versions of the antigen-binding regions of antibody molecules which bypass the generation of monoclonal antibodies are encompassed within the practice of this invention. To do so, antibody-specific messenger RNA
molecules are extracted from immune system cells taken from an immunized animal, and transcribed into complementary DNA (cDNA). The cDNA is then cloned into a bacterial expression system. One example of such a technique suitable for the practice of this invention uses a bacteriophage lambda vector system having a leader sequence that causes the expressed Fab protein to migrate to the periplasmic space (between the bacterial cell membrane and the cell wall) or to be secreted. One can rapidly generate and screen great numbers of functional Fab fragments for those which bind the antigen. Such OPGbp selective binding agents (Fab fragments with specificity for an OPGbp polypeptide) are specifically encompassed within the term "antibody" as it is defined, discussed, and claimed herein.
Also within the scope of the invention are techniques developed for the production of chimeric antibodies by splicing the genes from a mouse antibody molecule of appropriate antigen-specificity together with genes from a human antibody molecule of appropriate biological activity, such as the ability to activate human complement and mediate ADCC. (Morrison et al., Proc. Natl. Acad. Sci., 81:6851 (1984);
Neuberger et al., Nature, 312:604 (1984)). One example is the replacement of a Fc region with that of a different isotype. Selective binding agents such as antibodies produced by this technique are within the scope of the invention.
In a preferred embodiment of the invention, the anti-OPGbp antibodies are fully human antibodies.
Thus encompassed by the invention are antibodies which bind OPGbp polypeptides and are encoded by nucleic acid sequences which are naturally occurring somatic variants of human germline immunoglobulin nucleic acid sequence, and fragments, synthetic variants, derivatives and fusions thereof. Such antibodies may be produced by any method known in the art. Exemplary methods include immunization with a OPGbp antigen (any OPGbp polypeptide capable of elicing an immune response, and optionally conjugated to a carrier) of transgenic animals (e.g., mice) that are capable of producing a repertoire of human antibodies in the absence of endogenous immunoglobulin production. See, for example, Jakobovits et al., Proc. Natl. Acad. Sci., 2Q, 2551-2555 (1993); Jakobovits et al., Nature, 362, 255-258 (1993); Bruggermann et al., Year in Immunol., 7, 33 (1993).
Alternatively, human antibodies may be generated through the in vitro screening of phage display antibody libraries. See Hoogenboom et al., J.
Mol. Biol., 227, 381 (1991); Marks et al., J. Mol.
Biol., 222, 581 (1991), Various antibody-containing phage display libraries have been described and may be readily prepared by one skilled in the art. Libraries may contain a diversity of human antibody sequences, such as human Fab, Fv, and scFv fragments, that may be screened against an appropriate target. Example 1 describes the screening of a Fab phage library against OPGbp to identify those molecules which selectively bind OPGbp. It will be appreciated that phage display libraries may comprise peptides or proteins other than antibodies which may be screened to identify selective binding agents of OPGbp.
An anti-idiotypic (anti-Id) antibody is an antibody which recognizes unique determinants generally associated with the antigen-binding site of an antibody. An Id antibody can be prepared by immunizing an animal of the same species and genetic type (e.g., mouse strain) as the source of the monoclonal antibody with the monoclonal antibody to which an anti-Id is being prepared. The immunized animal will recognize and respond to the idiotypic determinants of the immunizing antibody by producing an antibody to these idiotypic determinants (the anti-Id antibody). See, for example, U.S. Pat. No. 4,699,880.
The anti-Id antibody may also be used as an "immunogen" to induce an immune response in yet another animal, producing a so-called anti-anti-Id antibody. The anti-anti-Id may be epitopically identical to the original monoclonal antibody which induced the anti-Id. Thus, by using antibodies to the idiotypic determinants of a mAb, it is possible to identify other clones expressing antibodies of identical specificity.
Production of selective binding agents of OPGbg When the selective binding agent of OPGbp to be prepared is a proteinaceous selective binding agent, such as an antibody or an antigen binding domain, various biological or chemical methods for producing said agent are available.
Biological methods are preferable for producing sufficient quantities of a selective binding agent for therapeutic use. Standard recombinant DNA
techniques are particularly useful for the production of antibodies and antigen binding domains of the invention. Exemplary expression vectors, host cells and methods for recovery of the expressed product are described below.
A nucleic acid molecule encoding an OPGbp antibody or antigen binding domain is inserted into an appropriate expression vector using standard ligation techniques. The vector is typically selected to be functional in the particular host cell employed (i.e., the vector is compatible with the host cell machinery 35, such that amplification of the gene and/or expression of the gene can occur). A nucleic acid molecule encoding an anti-OPGbp antibody may be amplified/expressed in prokaryotic, yeast, insect (baculovirus systems) and/or eukaryotic host cells.
Selection of the host cell will depend in part on whether an anti-OPGbp antibody is to be post-transitionally modified (e.g., glycosylated and/or phosphorylated). If so, yeast, insect, or mammalian host cells are preferable. For a review of expression vectors, see Meth. Enz. v. 185, D.V. Goeddel, ed.
Academic Press Inc., San Diego, CA (1990) Typically, expression vectors used in any host cells will contain one or more of the following components: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a leader sequence for secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element. Each of these sequences is discussed in more detail below.
The vector components may be homologous (i.e., from the same species and/or strain as the host cell), heterologous (i.e., from a species other than the host cell species or strain), hybrid (i.e., a combination of different sequences from more than one source), synthetic, or native sequences which normally function to regulate immunoglobulin expression. As such, a source of vector components may be any prokaryotic or eukaryotic organism, any vertebrate or invertebrate organism, or any plant, provided that the components are functional in, and can be activated by, the host cell machinery.
An origin of replication is selected based upon the type of host cell being used for expression.
For example, the origin of replication from the plasmid pBR322 (Product No. 303-3s, New England Biolabs, Beverly, MA) is suitable for most Gram-negative bacteria while various origins from SV40, polyoma, adenovirus, vesicular stomatitus virus (VSV) or papillomaviruses (such as HPV or BPV) are useful for cloning vectors in mammalian cells. Generally, the origin of replication component is not needed for mammalian expression vectors (for example, the SV40 origin is often used only because it contains the early promoter).
A transcription termination sequence is typically located 3' of the end of a polypeptide coding regions and serves to terminate transcription.
Usually, a transcription termination sequence in prokaryotic cells is a G-C rich fragment followed by a poly T sequence. While the sequence is easily cloned from a library or even purchased commercially as part of a vector, it can also be readily synthesized using methods for nucleic acid synthesis such as those described above.
A selectable marker gene element encodes a protein necessary for the survival and growth of a host cell grown in a selective culture medium. Typical selection marker genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, tetracycline, or kanamycin for prokaryotic host cells, (b) complement auxotrophic deficiencies of the cell; or (c) supply critical nutrients not available from complex media. Preferred selectable markers are the kanamycin resistance gene, the ampicillin resistance gene, and the tetracycline resistance gene. A neomycin resistance gene may also be used for selection in prokaryotic and eukaryotic host cells.
Other selection genes may be used to amplify the gene which will be expressed. Amplification is the process wherein genes which are in greater demand for the production of a protein critical for growth are reiterated in tandem within the chromosomes of successive generations of recombinant cells. Examples of suitable selectable markers for mammalian cells include dihydrofolate reductase (DHFR) and thymidine kinase. The mammalian cell transformants are placed under selection pressure which only the transformants are uniquely adapted to survive by virtue of the marker present in the vector. Selection pressure is imposed by culturing the transformed cells under conditions in which the concentration of selection agent in the medium is successively changed, thereby leading to amplification of both the selection gene and the DNA
that encodes an anti-OPGbp antibody. As a result, increased quantities of an antibody are synthesized from the amplified DNA.
A ribosome binding site is usually necessary for translation initiation of mRNA and is characterized by a Shine-Dalgarno sequence (prokaryotes) or a Kozak sequence (eukaryotes). The element is typically located 3' to the promoter and 5' to the coding sequence of the polypeptide to be expressed. The Shine-Dalgarno sequence is varied but is typically a polypurine (i.e., having a high A-G content). Many Shine-Dalgarno sequences have been identified, each of which can be readily synthesized using methods set forth above and used in a prokaryotic vector.
A leader, or signal, sequence is used to direct secretion of a polypeptide. A signal sequence may be positioned within or directly at the 5' end of a polypeptide coding region. Many signal sequences have been identified and may be selected based upon the host cell used for expression. In the present invention, a signal sequence may be homologous (naturally occurring) or heterologous to a nucleic acid sequence encoding an anti-OPGbp antibody or antigen binding domain. A
heterologous signal sequence selected should be one that is recognized and processed, i.e., cleaved, by a signal peptidase, by the host cell. For prokaryotic host cells that do not recognize and process a native immunoglobulin signal sequence, the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, or heat-stable enterotoxin II leaders. For yeast secretion, a native immunoglobulin signal sequence may be substituted by the yeast invertase, alpha factor, or acid phosphatase leaders. In mammalian cell expression the native signal sequence is satisfactory, although other mammalian signal sequences may be suitable.
In most cases, secretion of an anti-OPGbp antibody or antigen binding domain from a host cell will result in the removal of the signal peptide from the antibody. Thus the mature antibody will lack any leader or signal sequence.
In some cases, such as where glycosylation is desired in a eukaryotic host cell expression system, one may manipulate the various presequences to improve glycosylation or yield. For example, one may alter the peptidase cleavage site of a particular signal peptide, or add prosequences, which also may affect glycosylation. The final protein product may have, in the -1 position (relative to the first amino acid of the mature protein) one or more additional amino acids incident to expression, which may not have been totally removed. For example, the final protein product may have one or two amino acid found in the peptidase cleavage site, attached to the N-terminus.
Alternatively, use of some enzyme cleavage sites may result in a slightly truncated form of the desired OPGbp polypeptide, if the enzyme cuts at such area within the mature polypeptide.
The expression vectors of the present invention will typically contain a promoter that is recognized by the host organism and operably linked to a nucleic acid molecule encoding an anti-OPGbp antibody or antigen binding domain. Either a native or heterologous promoter may be used depending the host cell used for expression and the yield of protein desired.
Promoters suitable for use with prokaryotic hosts include the beta-lactamase and lactose promoter systems; alkaline phosphatase, a tryptophan (trp) promoter system; and hybrid promoters such as the tac promoter. Other known bacterial promoters are also suitable. Their sequences have been published, thereby enabling one skilled in the art to ligate them to the desired DNA sequence(s), using linkers or adapters as needed to supply any required restriction sites.
Suitable promoters for use with yeast hosts are also well known in the art. Yeast enhancers are advantageously used with yeast promoters. Suitable promoters for use with mammalian host cells are well known and include those obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and most preferably Simian Virus 40 (SV40). Other suitable mammalian promoters include heterologous mammalian promoters, e.g., heat-shock promoters and the actin promoter.
Additional promoters which may be used for expressing the selective binding agents of the invention include, but are not limited to: the SV40 early promoter region (Bernoist and Chambon, Nature, 290:304-310, 1981); the CMV promoter; the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto, et al., Cell, 22; 787-797, 1980); the herpes thymidine kinase promoter (Wagner et al., Proc. Natl. Acad. Sci. U.S.A., 78; 144-1445, 1981); the regulatory sequences of the metallothionine gene (Brinster et al., Nature, 296; 39-42, 1982);
prokaryotic expression vectors such as the beta -lactamase promoter (Villa-Kamaroff, et al., Proc. Natl.
Acad. Sci. U.S.A., 75; 3727-3731, 1978); or the tac promoter (DeBoer, et al., Proc. Natl. Acad. Sci.
U.S.A., 80; 21-25, 1983). Also of interest are the following animal transcriptional control regions, which exhibit tissue specificity and have been utilized in transgenic animals: the elastase I gene control region which is active in pancreatic acinar cells (Swift et al., Cell, 38; :639-646, 1984; Ornitz et al., Cold Spring Harbor Symp. Quant. Biol. 50; 399-409, 1986;
MacDonald, Hepatology, 7; :425-515, 1987); the insulin gene control region which is active in pancreatic beta cells (Hanahan, Nature, 315; 115-122, 1985); the immunoglobulin gene control region which is active in lymphoid cells (Grosschedl et al., Cell, 38; 647-658, 1984; Adames et al., Nature, 318; 533-538, 1985;
Alexander et al., Mol. Cell. Biol., 7; 1436-1444, 1987); the mouse mammary tumor virus control region which is active in testicular, breast, lymphoid and mast cells (Leder et al., Cell, 45; 485-495, 1986), albumin gene control region which is active in liver (Pinkert et al., Genes and Devel., 1; 268-276, 1987);
the alphafetoprotein gene control region which is active in liver (Krumlauf et al., Mol. Cell. Biol., 5;
1639-1648, 1985; Hammer et al,, Science, 235; 53-58, 1987); the alpha 1-antitrypsin gene control region which is active in the liver (Kelsey et al., Genes and Devel., 1; 161-171, 1987); the beta-globin gene control region which is active in myeloid cells (Mogram et al., Nature, 315; 338-340, 1985; Kollias et al., Cell, 46;
89-94, 1986); the myelin basic protein gene control region which is active in oligodendrocyte cells in the brain (Readhead et al., Cell, 48; 703-712, 1987); the myosin light chain-2 gene control region which is active in skeletal muscle (Sani, Nature, 314; 283-286, 1985); and the gonadotropic releasing hormone gene control region which is active in the hypothalamus (Mason et al., Science, 234; 1372-1378, 1986).
An enhancer sequence may be inserted into the vector to increase transcription in eucaryotic host cells. Several enhancer sequences available from mammalian genes are known (e.g., globin, elastase, albumin, alpha-feto-protein and insulin). Typically, however, an enhancer from a virus will be used. The SV40 enhancer, the cytomegalovirus early promoter enhancer, the polyoma enhancer, and adenovirus enhancers are exemplary enhancing elements for the activation of eukaryotic promoters. While an enhancer may be spliced into the vector at a position 5' or 3' to the polypeptide coding region, it is typically located at a site 5' from the promoter.
Preferred vectors for practicing this invention are those which are compatible with bacterial, insect, and mammalian host cells. Such vectors include, inter alia, pCRII, pCR3, and pcDNA3.1 (Invitrogen Company, San Diego, CA), pBSII (Stratagene Company, La Jolla, CA), pET15 (Novagen, Madison, WI), pGEX (Pharmacia Biotech, Piscataway, NJ), pEGFP-N2 (Clontech, Palo Alto, CA), pETL (BlueBacli;
Invitrogen), pDSR-alpha (PCT Publication No.
W090/14363) and pFastBacDual (Gibco/BRL, Grand Island, NY).
Additional possible vectors include, but are not limited to, cosmids, plasmids or modified viruses, but the vector system must be compatible with the selected host cell. Such vectors include, but are not limited to plasmids such as Bluescript plasmid derivatives (a high copy number ColEl-based phagemid, Stratagene Cloning Systems Inc., La Jolla CA), PCR
cloning plasmids designed for cloning Taq-amplified PCR
products (e.g., TOPOTM TA Cloning Kit, PCR2.1 plasmid derivatives, Invitrogen, Carlsbad, CA), and mammalian yeast or virus vectors such as a baculovirus expression system (pBacPAK plasmid derivatives, Clontech, Palo Alto, CA). The recombinant molecules can be introduced into host cells via transformation, transfection, infection, electroporation, or other known techniques.
Host cells of the invention may be prokaryotic host cells (such as E. coli) or eukaryotic host cells (such as a yeast cell, an insect cell, or a vertebrate cell). The host cell, when cultured under appropriate conditions, expresses an antibody or antigen binding domain of the invention which can subsequently be collected from the culture medium (if the host cell secretes it into the medium) or directly from the host cell producing it (if it is not secreted). Selection of an appropriate host cell will depend upon various factors, such as desired expression levels, polypeptide modifications that are desirable or necessary for activity, such as glycosylation or phosphorylation, and ease of folding into a biologically active molecule.
A number of suitable host cells are known in the art and many are available from the American Type Culture Collection (ATCC), Manassas, VA. Examples include mammalian cells, such as Chinese hamster ovary cells (CHO) (ATCC No. CCL61) CHO DHFR- cells (Urlaub et al. Proc. Natl. Acad. Sci. USA 97, 4216-4220 (1980)), human embryonic kidney (HEK) 293 or 293T cells (ATCC
No. CRL1573), or 3T3 cells (ATCC No. CCL92). The selection of suitable mammalian host cells and methods for transformation, culture, amplification, screening and product production and purification are known in the art. Other suitable mammalian cell lines, are the monkey COS-1 (ATCC No. CRL1650) and COS-7 cell lines (ATCC No. CRL1651), and the CV-1 cell line (ATCC No.
CCL70). Further exemplary mammalian host cells include primate cell lines and rodent cell lines, including transformed cell lines. Normal diploid cells, cell strains derived from in vitro culture of primary tissue, as well as primary explants, are also suitable.
Candidate cells may be genotypically deficient in the selection gene, or may contain a dominantly acting selection gene. Other suitable mammalian cell lines include but are not limited to, mouse neuroblastoma N2A
cells', HeLa, mouse L-929 cells, 3T3 lines derived from Swiss, Balb-c or NIH mice, BHK or HaK hamster cell lines, which are available from the American Type Culture Collection, Manassas, VA). Each of these cell lines is known by and available to those skilled in the art of protein expression.' Similarly useful as host cells suitable for the present invention are bacterial cells. For example, the various strains of E. coli (e.g., HB101, (ATCC No. 33694) DH5(x, DH10, and MC1061 (ATCC No.
53338)) are well-known as host cells in the field of biotechnology. Various strains of B. subtilis, Pseudomonas spp., other Bacillus spp., Streptomyces spp., and the like may also be employed in this method.
Many strains of yeast cells known to those skilled in the art are also available as host cells for expression of the polypeptides of the present invention. Preferred yeast cells include, for example, Saccharomvices cerivisae.
Additionally, where desired, insect cell systems may be utilized in the methods of the present invention. Such systems are described for example in Kitts et al. (Biotechniques, 14, 810-817 (1993)), Lucklow (Curr. Opin. Biotechnol., 4, 564-572 (1993) and Lucklow et al. (J. Virol., 67, 4566-4579 (1993)).
Preferred insect cells are Sf-9 and Hi5 (Invitrogen, Carlsbad, CA).
Transformation or transfection of a nucleic acid molecule encoding an anti-OPGbp antibody or antigen binding domain into a selected host cell may be accomplished by well known methods including methods such as calcium chloride, electroporation, microinjection, lipofection or the DEAE-dextran method.
The method selected will in part be a function of the type of host cell to be used. These methods and other suitable methods are well known to the skilled artisan, and are set forth, for example, in Sambrook et al., supra.
One may also use transgenic animals to express glycosylated selective binding agents, such as antibodies and antigen binding domain. For example, one may use a transgenic milk-producing animal (a cow or goat, for example) and obtain glycosylated binding agents in the animal milk. Alternatively, one may use plants to produce glycosylated selective binding agents.
Host cells comprising (i.e., transformed or transfected) an expression vector encoding a selective binding agent of OPGbp may be cultured using standard media well known to the skilled artisan. The media will usually contain all nutrients necessary for the growth and survival of the cells. Suitable media for culturing E. coli cells are for example, Luria Broth (LB) and/or Terrific Broth (TB). Suitable media for culturing eukaryotic cells are RPMI 1640, MEM, DMEM, all of which may be supplemented with serum and/or growth factors as required by the particular cell line being cultured. A suitable medium for insect cultures is Grace's medium supplemented with yeastolate, lactalbumin hydrolysate, and/or fetal calf serum as necessary.
Typically, an antibiotic or other compound useful for selective growth of transfected or transformed cells is added as a supplement to the media. The compound to be used will be dictated by the selectable marker element present on the plasmid with which the host cell was transformed. For example, where the selectable marker element is kanamycin resistance, the compound added to the culture medium will be kanamycin. Other compounds for selective growth include ampicillin, tetracycline and neomycin The amount of an anti-OPGbp antibody or antigen binding domain produced by a host cell can be evaluated using standard methods known in the art.
Such methods include, without limitation, Western blot analysis, SDS-pol-yacrylamide gel electrophoresis, non-denaturing gel electrophoresis, HPLC separation, immunoprecipitation, and/or activity assays.
Purification of an anti-OPG antibody or antigen binding domain which has been secreted into the cell media can be accomplished using a variety of techniques including affinity, immunoaffinity or ion exchange chromatography, molecular sieve chromatography, preparative gel electrophoresis or isoelectric focusing, chromatofocusing, and high pressure liquid chromatography. For example, antibodies comprising a Fc region may be conveniently purified by affinity chromatography with Protein A, which selectively binds the Fc region. Modified forms of an antibody or antigen binding domain may be prepared with affinity tags, such as hexahistidine or other small peptide such as FLAG (Eastman Kodak Co., New Haven, CT) or myc (Invitrogen) at either its carboxyl or amino terminus and purified by a one-step affinity column. For example, polyhistidine binds with great affinity and specificity to nickel, thus an affinity column of nickel (such as the Qiagen nickel columns) can be used for purification of polyhistidine-tagged selective binding agents. (See for example, Ausubel et al., eds., Current Protocols in Molecular Biology, Section 10.11.8, John Wiley & Sons, New York (1993)). In some instances, more than one purification step may be required.
Selective binding agents of the invention which are expressed in procaryotic host cells may be present in soluble form either in the periplasmic space or in the cytoplasm or in an insoluble form as part of intracellular inclusion bodies. Selective binding agents can be extracted from the host cell using any standard technique known to the skilled artisan. For example, the host cells can be lysed to release the contents of the periplasm/cytoplasm by French press, homogenization, and/or sonication followed by centrifugation.
Soluble forms of an anti-OPGbp antibody or antigen binding domain present either in the cytoplasm or released from the periplasmic space may be further purified using methods known in the art, for example Fab fragments are released from the bacterial periplasmic space by osmotic shock techniques.
If an antibody or antigen binding domain has formed inclusion bodies, they can often bind to the inner and/or outer cellular membranes and thus will be found primarily in the pellet material after centrifugation. The pellet material can then be treated at pH extremes or with chaotropic agent such as a detergent, guanidine, guanidine derivatives, urea, or urea derivatives in the presence of a reducing agent such as dithiothreitol at alkaline pH or tris carboxyethyl phosphine at acid pH to release, break apart, and solubilize the inclusion bodies. The soluble selective binding agent can then be analyzed using gel electrophoresis, immunoprecipitation or the like. If it is desired to isolate a solublized antibody or antigen binding domain, isolation may be accomplished using standard methods such as those set forth below and in Marston et al. (Meth. Enz., 182:264-275 (1990)).
In some cases, an antibody or antigen binding domain may not be biologically active upon isolation.
Various methods for "refolding" or converting the polypeptide to its tertiary structure and generating disulfide linkages, can be used to restore biological activity. Such methods include exposing the solubilized polypeptide to a pH usually above 7 and in the presence of a particular concentration of a chaotrope. The selection of chaotrope is very similar to the choices used for inclusion body solubilization, but usually the chaotrope is used at a lower concentration and is not necessarily the same as chaotropes used for the solubilization. In most cases the refolding/oxidation solution will also contain a reducing agent or the reducing agent plus its oxidized form in a specific ratio to generate a particular redox potential allowing for disulfide shuffling to occur in the formation of the protein's cysteine bridge(s).
Some of the commonly used redox couples include cysteine/cystamine, glutathione (GSH)/dithiobis GSH, cupric chloride, dithiothreitol(DTT)/dithiane DTT, and 2-mercaptoethanol(bME)/dithio-b(ME). In many instances, a cosolvent may be used or may be needed to increase the efficiency of the refolding and the more common reagents used for this purpose include glycerol, polyethylene glycol of various molecular weights, arginine and the like.
Antibodies and antigen binding domains of the invention may also be prepared by chemical synthesis methods (such as solid phase peptide synthesis) using techniques known in the art such as those set forth by Merrifield et al., (J. Am. Chem. Soc., 85:2149 [1963]), Houghten et al. (Proc Natl Acad. Sci. USA, 82:5132 [1985]), and Stewart and Young (Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, IL [1984]).
Such polypeptides may be synthesized with or without a methionine on the amino terminus. Chemically synthesized antibodies and antigen binding domains may be oxidized using methods set forth in these references to form disulfide bridges. Antibodies so prepared will retain at least one biological activity associated with a native or recombinantly produced anti-OPGbp antibody or antigen binding domain.
Assays for selective binding agents of OPGbp Screening methods for identifying selective binding agents which partially or completely inhibits at least one biological activity of OPGbp are provided by the invention. Inhibiting the biological activity of OPGbp includes, but is not limited to, inhibiting binding of OPGbp to its cognate receptor, ODAR, inhibiting stimulation of osteoclast formation in vitro or in vivo by OPGbp, and/or inhibiting bone turnover or bone resorption mediated by OPGbp. Selective binding agents of the invention include anti-OPGbp antibodies, and fragments, variants, derivatives and fusion thereof, peptides, peptidomimetic compounds or organo-mimetic compounds.
Screening methods for identifying selective binding agents which can partially or completely inhibit a biological activity of OPGbp can include in vitro or in vivo assays. In vitro assays include those that detect binding of OPGbp to ODAR and may be used to screen selective binding agents of OPGbp for their ability to increase or decrease the rate or extent of OPGbp binding to ODAR. In one type of assay, an OPGbp polypeptide, preferably a soluble form of OPGbp such as an extracellular domain, is immobilized on a solid support (e.g., agarose or acrylic beads) and an ODAR
polypetpide is the added either in the presence or absence of a selective binding agent of OPGbp. The extent of binding of OPGbp and ODAR with or without a selective binding agent present is measured. Binding can be detected by for example radioactive labeling, fluorescent labeling or enzymatic reaction.
Alternatively, the binding reaction may be carried out using a surface plasmon resonance detector system such as the BlAcore assay system (Pharmacia, Piscataway, NJ). Binding reactions may be carried out according to the manufacturer's protocol.
In vitro assays such as those described above may be used advantageously to screen rapidly large numbers of selective binding agents for effects on binding of OPGbp to ODAR. The assays may be automated to screen compounds generated in phage display, synthetic peptide and chemical synthesis libraries.
Selective binding agents increase or decrease binding of OPGbp to ODAR may also be screened in cell culture using cells and cell lines expressing either polypeptide. Cells and cell lines may be obtained from any mammal, but preferably will be from human or other primate, canine, or rodent sources. As an example, the binding of OPGbp to cells expressing ODAR on the surface is evaluated in the presence or absence of selective binding agents and the extent of binding may be determined by, for example, flow cytometry using a biotinylated antibody to OPGbp.
Preferred insect cells are Sf-9 and Hi5 (Invitrogen, Carlsbad, CA).
Transformation or transfection of a nucleic acid molecule encoding an anti-OPGbp antibody or antigen binding domain into a selected host cell may be accomplished by well known methods including methods such as calcium chloride, electroporation, microinjection, lipofection or the DEAE-dextran method.
The method selected will in part be a function of the type of host cell to be used. These methods and other suitable methods are well known to the skilled artisan, and are set forth, for example, in Sambrook et al., supra.
One may also use transgenic animals to express glycosylated selective binding agents, such as antibodies and antigen binding domain. For example, one may use a transgenic milk-producing animal (a cow or goat, for example) and obtain glycosylated binding agents in the animal milk. Alternatively, one may use plants to produce glycosylated selective binding agents.
Host cells comprising (i.e., transformed or transfected) an expression vector encoding a selective binding agent of OPGbp may be cultured using standard media well known to the skilled artisan. The media will usually contain all nutrients necessary for the growth and survival of the cells. Suitable media for culturing E. coli cells are for example, Luria Broth (LB) and/or Terrific Broth (TB). Suitable media for culturing eukaryotic cells are RPMI 1640, MEM, DMEM, all of which may be supplemented with serum and/or growth factors as required by the particular cell line being cultured. A suitable medium for insect cultures is Grace's medium supplemented with yeastolate, lactalbumin hydrolysate, and/or fetal calf serum as necessary.
Typically, an antibiotic or other compound useful for selective growth of transfected or transformed cells is added as a supplement to the media. The compound to be used will be dictated by the selectable marker element present on the plasmid with which the host cell was transformed. For example, where the selectable marker element is kanamycin resistance, the compound added to the culture medium will be kanamycin. Other compounds for selective growth include ampicillin, tetracycline and neomycin The amount of an anti-OPGbp antibody or antigen binding domain produced by a host cell can be evaluated using standard methods known in the art.
Such methods include, without limitation, Western blot analysis, SDS-pol-yacrylamide gel electrophoresis, non-denaturing gel electrophoresis, HPLC separation, immunoprecipitation, and/or activity assays.
Purification of an anti-OPG antibody or antigen binding domain which has been secreted into the cell media can be accomplished using a variety of techniques including affinity, immunoaffinity or ion exchange chromatography, molecular sieve chromatography, preparative gel electrophoresis or isoelectric focusing, chromatofocusing, and high pressure liquid chromatography. For example, antibodies comprising a Fc region may be conveniently purified by affinity chromatography with Protein A, which selectively binds the Fc region. Modified forms of an antibody or antigen binding domain may be prepared with affinity tags, such as hexahistidine or other small peptide such as FLAG (Eastman Kodak Co., New Haven, CT) or myc (Invitrogen) at either its carboxyl or amino terminus and purified by a one-step affinity column. For example, polyhistidine binds with great affinity and specificity to nickel, thus an affinity column of nickel (such as the Qiagen nickel columns) can be used for purification of polyhistidine-tagged selective binding agents. (See for example, Ausubel et al., eds., Current Protocols in Molecular Biology, Section 10.11.8, John Wiley & Sons, New York (1993)). In some instances, more than one purification step may be required.
Selective binding agents of the invention which are expressed in procaryotic host cells may be present in soluble form either in the periplasmic space or in the cytoplasm or in an insoluble form as part of intracellular inclusion bodies. Selective binding agents can be extracted from the host cell using any standard technique known to the skilled artisan. For example, the host cells can be lysed to release the contents of the periplasm/cytoplasm by French press, homogenization, and/or sonication followed by centrifugation.
Soluble forms of an anti-OPGbp antibody or antigen binding domain present either in the cytoplasm or released from the periplasmic space may be further purified using methods known in the art, for example Fab fragments are released from the bacterial periplasmic space by osmotic shock techniques.
If an antibody or antigen binding domain has formed inclusion bodies, they can often bind to the inner and/or outer cellular membranes and thus will be found primarily in the pellet material after centrifugation. The pellet material can then be treated at pH extremes or with chaotropic agent such as a detergent, guanidine, guanidine derivatives, urea, or urea derivatives in the presence of a reducing agent such as dithiothreitol at alkaline pH or tris carboxyethyl phosphine at acid pH to release, break apart, and solubilize the inclusion bodies. The soluble selective binding agent can then be analyzed using gel electrophoresis, immunoprecipitation or the like. If it is desired to isolate a solublized antibody or antigen binding domain, isolation may be accomplished using standard methods such as those set forth below and in Marston et al. (Meth. Enz., 182:264-275 (1990)).
In some cases, an antibody or antigen binding domain may not be biologically active upon isolation.
Various methods for "refolding" or converting the polypeptide to its tertiary structure and generating disulfide linkages, can be used to restore biological activity. Such methods include exposing the solubilized polypeptide to a pH usually above 7 and in the presence of a particular concentration of a chaotrope. The selection of chaotrope is very similar to the choices used for inclusion body solubilization, but usually the chaotrope is used at a lower concentration and is not necessarily the same as chaotropes used for the solubilization. In most cases the refolding/oxidation solution will also contain a reducing agent or the reducing agent plus its oxidized form in a specific ratio to generate a particular redox potential allowing for disulfide shuffling to occur in the formation of the protein's cysteine bridge(s).
Some of the commonly used redox couples include cysteine/cystamine, glutathione (GSH)/dithiobis GSH, cupric chloride, dithiothreitol(DTT)/dithiane DTT, and 2-mercaptoethanol(bME)/dithio-b(ME). In many instances, a cosolvent may be used or may be needed to increase the efficiency of the refolding and the more common reagents used for this purpose include glycerol, polyethylene glycol of various molecular weights, arginine and the like.
Antibodies and antigen binding domains of the invention may also be prepared by chemical synthesis methods (such as solid phase peptide synthesis) using techniques known in the art such as those set forth by Merrifield et al., (J. Am. Chem. Soc., 85:2149 [1963]), Houghten et al. (Proc Natl Acad. Sci. USA, 82:5132 [1985]), and Stewart and Young (Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, IL [1984]).
Such polypeptides may be synthesized with or without a methionine on the amino terminus. Chemically synthesized antibodies and antigen binding domains may be oxidized using methods set forth in these references to form disulfide bridges. Antibodies so prepared will retain at least one biological activity associated with a native or recombinantly produced anti-OPGbp antibody or antigen binding domain.
Assays for selective binding agents of OPGbp Screening methods for identifying selective binding agents which partially or completely inhibits at least one biological activity of OPGbp are provided by the invention. Inhibiting the biological activity of OPGbp includes, but is not limited to, inhibiting binding of OPGbp to its cognate receptor, ODAR, inhibiting stimulation of osteoclast formation in vitro or in vivo by OPGbp, and/or inhibiting bone turnover or bone resorption mediated by OPGbp. Selective binding agents of the invention include anti-OPGbp antibodies, and fragments, variants, derivatives and fusion thereof, peptides, peptidomimetic compounds or organo-mimetic compounds.
Screening methods for identifying selective binding agents which can partially or completely inhibit a biological activity of OPGbp can include in vitro or in vivo assays. In vitro assays include those that detect binding of OPGbp to ODAR and may be used to screen selective binding agents of OPGbp for their ability to increase or decrease the rate or extent of OPGbp binding to ODAR. In one type of assay, an OPGbp polypeptide, preferably a soluble form of OPGbp such as an extracellular domain, is immobilized on a solid support (e.g., agarose or acrylic beads) and an ODAR
polypetpide is the added either in the presence or absence of a selective binding agent of OPGbp. The extent of binding of OPGbp and ODAR with or without a selective binding agent present is measured. Binding can be detected by for example radioactive labeling, fluorescent labeling or enzymatic reaction.
Alternatively, the binding reaction may be carried out using a surface plasmon resonance detector system such as the BlAcore assay system (Pharmacia, Piscataway, NJ). Binding reactions may be carried out according to the manufacturer's protocol.
In vitro assays such as those described above may be used advantageously to screen rapidly large numbers of selective binding agents for effects on binding of OPGbp to ODAR. The assays may be automated to screen compounds generated in phage display, synthetic peptide and chemical synthesis libraries.
Selective binding agents increase or decrease binding of OPGbp to ODAR may also be screened in cell culture using cells and cell lines expressing either polypeptide. Cells and cell lines may be obtained from any mammal, but preferably will be from human or other primate, canine, or rodent sources. As an example, the binding of OPGbp to cells expressing ODAR on the surface is evaluated in the presence or absence of selective binding agents and the extent of binding may be determined by, for example, flow cytometry using a biotinylated antibody to OPGbp.
In vitro activity assays may also be used to identify selective binding agents which inhibit OPGbp activity. Examples of assays include stimulation of cell growth and proliferation which are dependent on OPGbp and OPGbp mediated osteoclast formation from bone marrow cells, the latter of which is described in Example 1 of the present application.
In vivo assays are also available to determine whether a selective binding agent is capable of decreasing or inhibiting bone turnover and/or bone resorption. Bone resorption can be increased in animals by a variety of methods, including ovariectomy and administration of pro--resorptive agents such as OPGbp or IL-1. See WO 97/23614 and WO 98/46751. The effects of OPG inhibitors on bone resorption in human patients may be measured by a variety of known methods such as single photon absorptiometry (SPA), dual photon absorptiometry (DPA), dual energy X-ray absorptiometry (DEXA), quantitative computed tomography (QCT), and ultrasonography (See Johnston et al. in Primer on the Metabolic Bone Disease and Disorders of Mineral Metabolism, 2nd ed., M.J. Favus, ed. Raven Press pp.
137-146). Bone turnover and resorption may also be determined by measuring changes in certain biochemical markers, such as serum osteocalcin, serum alkaline phosphatase, serum procollagen I extension peptides, urinary or serum C-terminal or N-terminal telopeptide of collagen, urinary calcium, hydroxyproline and urinary pyridinoline and deoxypyridinoline. It is generally recognized that a decrease in the levels of the aforementioned biochemical markers indicates that bone resorption is decreased and loss of bone mass is being reduced. Alternatively, effects on bone resorption may also be determined by measuring a change in the mechanical strength of bone, in particular an increase in torsional (twisting) strength of bone.
In vivo assays are also available to determine whether a selective binding agent is capable of decreasing or inhibiting bone turnover and/or bone resorption. Bone resorption can be increased in animals by a variety of methods, including ovariectomy and administration of pro--resorptive agents such as OPGbp or IL-1. See WO 97/23614 and WO 98/46751. The effects of OPG inhibitors on bone resorption in human patients may be measured by a variety of known methods such as single photon absorptiometry (SPA), dual photon absorptiometry (DPA), dual energy X-ray absorptiometry (DEXA), quantitative computed tomography (QCT), and ultrasonography (See Johnston et al. in Primer on the Metabolic Bone Disease and Disorders of Mineral Metabolism, 2nd ed., M.J. Favus, ed. Raven Press pp.
137-146). Bone turnover and resorption may also be determined by measuring changes in certain biochemical markers, such as serum osteocalcin, serum alkaline phosphatase, serum procollagen I extension peptides, urinary or serum C-terminal or N-terminal telopeptide of collagen, urinary calcium, hydroxyproline and urinary pyridinoline and deoxypyridinoline. It is generally recognized that a decrease in the levels of the aforementioned biochemical markers indicates that bone resorption is decreased and loss of bone mass is being reduced. Alternatively, effects on bone resorption may also be determined by measuring a change in the mechanical strength of bone, in particular an increase in torsional (twisting) strength of bone.
For diagnostic applications, in certain embodiments, selective binding agents of OPGbp, such as antibodies and antigen binding domains thereof, typically will be labeled with a detectable moiety.
The detectable moiety can be any one which is capable of producing, either directly or indirectly, a detectable signal. For example, the detectable moiety may be a radioisotope, such as 3H, 14C, 32P, 35 S, or 125 I, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin; or an enzyme, such as alkaline phosphatase, /3-galactosidase or horseradish peroxidase. Bayer et al., Meth. Enz., 184: 138-163 (1990).
The selective binding agents of the invention may be employed in any known assay method, such as radioimmunoassays, competitive binding assays, direct and indirect sandwich assays (ELISAs), and immunoprecipitation assays (Sola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC
Press, 1987)) for detection and quantitation of OPGbp polypeptides. The antibodies will bind OPGbp polypeptides with an affinity which is appropriate for the assay method being employed.
The selective binding agents of the invention also are useful for in vivo imaging, wherein for example a selective binding agent labeled with a detectable moiety is administered to an animal, preferably into the bloodstream, and the presence and location of the labeled antibody in the host is assayed. The agent may be labeled with any moiety that is detectable in an animal, whether by nuclear magnetic resonance, radiology, or other detection means known in the art.
The invention also relates to a kit comprising a selective binding agent of OPGbp, such as an antibody or antigen binding domain, and other reagents useful for detecting OPGbp levels in biological samples. Such reagents may include a secondary activity, a detectable label, blocking serum, positive and negative control samples, and detection reagents.
Therapeutic Uses of OPGbp selective binding agents Selective binding agents of the invention may be used as therapeutics. Therapeutic selective binding agents may be OPGbp agonists or antagonists and, in one embodiment, are anti-OPGbp antagonist antibodies which inhibit at least one of the biological activities of a OPGbp polypeptide in vitro or in vivo. For example, an antagonist of OPGbp will inhibit the binding of OPGbp to ODAR by at least about 100-fold, or about 1000-fold, or greater than 1000-fold. Alternatively, an OPGbp antagonist will inhibit osteoclast formation in vitro as indicated by a measurable IC50 (a concentration giving 50% inhibition) in a bone marrow assay such as that described in Example 1. Alternatively, an OPGbp antagonist will decrease bone turnover markers by at least 20%, or at lease 50% compared to baseline levels.
Antagonist OPGbp selective binding agents (such as antibodies) are identified by screening assays described herein.
OPGbp antagonists, such as anti-OPGbp antagonist antibodies and antigen binding domains, may, be used to prevent or treat bone diseases characterized by loss of bone mass or by replacement of structurally normal bone with structurally abnormal bone. OPGbp antagonists may be administered to an animal having loss of bone mass or susceptible to having loss of bone mass resulting from any of the following disorders:
Osteoporosis, such as primary osteoporosis, endocrine osteoporosis (hyperthyroidism, hyperparathryoidism, Cushing's syndrome, and acromegaly), hereditary and congenital forms of osteoporosis (osteogenesis imperfecta, homocystinuria, Menkes' syndrome, and Riley-Day syndrome) and osteoporosis due to immobilization of extremities; Osteomyelitis, or an infectious lesion in bone, leading to loss of bone mass; Hypercalcemia resulting from solid tumors (breast, lung and kidney) and hematologic malignacies (multiple myeloma, lymphoma and leukemia), idiopathic hypercalcemia, and hypercalcemia associated with hyperthryoidism and renal function disorders;
Osteopenia following surgery, induced by steroid administration, and associated with disorders of the small and large intestine and with chronic hepatic and renal diseases; Osteonecrosis, or bone cell death, associated with traumatic injury or nontraumatic necrosis associated with Gaucher's disease, sickle cell anemia, systemic lupus erythematosus and other conditions; Loss of bone mass due to rheumatoid arthritis; Periodontal loss of bone mass;
Osteoarthritis; Prosthetic loosening; and Osteolytic metastasis. OPGbp antagonists may also be used to prevent or treat certain bone disorders are characterized by the replacement of structurally sound bone with disorganized structurally incompetent bone, such as Paget's disease of bone (osteitis deformans) in adults and juveniles; hyperparathryoidism, in congenital bone disorders such as fibrous dysplasia, and in osteosclerotic bone metastases.
In an embodiment of the invention, OPGbp antagonists are advantageously used to treat loss of bone mass resulting from osteolytic destruction of bone caused by malignant or metastatic tumors. OPG
polypeptides of the invention may be used to treat loss of bone mass associated with breast, prostate, thyroid, kidney, lung, esophogeal, rectal, bladder, cervical, ovarian and liver cancers as well as cancer of the gastrointestional tract. Also included is loss of bone mass associated with certain hematological malignancies such as multiple myeloma and lymphomas such as Hodgkin's Disease.
OPGbp antagonists of the invention, including antagonist antibodies and antigen binding domains, are administered alone or in combination with other therapeutic agents, in particular, in combination with other cancer therapy agents. Such agents generally include radiation therapy or chemotherapy.
Chemotherapy may involve treatment with one or more of the following: anthracyclines, taxol, tamoxifene, doxorubicin, 5-fluorouracil, and other drugs known to the skilled worker. In one embodiment, the cancer therapy agent is a luteinizing hormone-releasing hormone (LHRH) antagonist, preferably a peptide antagonist. More preferably, an LHRH antagonist is a decapeptide comprising the following structure:
A-B-C-D-E-F-G-H-I-J
wherein A is pyro-glu, Ac-D-Nal, Ac-D-Qal; Ac-Sar, or Ac-D-Pal;
B is His or 4-Cl-D-Phe;
C is Trp, D-Pal, D-Nal, L-Nal-D-Pal(N-O), or D-Trp;
D is Ser;
E is N-Me-Ala, Tyr, N-Me-Tyr, Ser, Lys(iPr), 4-Cl-Phe, His, Asn, Met, Ala, Arg or Ile;
F is x Y
N
I
The detectable moiety can be any one which is capable of producing, either directly or indirectly, a detectable signal. For example, the detectable moiety may be a radioisotope, such as 3H, 14C, 32P, 35 S, or 125 I, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin; or an enzyme, such as alkaline phosphatase, /3-galactosidase or horseradish peroxidase. Bayer et al., Meth. Enz., 184: 138-163 (1990).
The selective binding agents of the invention may be employed in any known assay method, such as radioimmunoassays, competitive binding assays, direct and indirect sandwich assays (ELISAs), and immunoprecipitation assays (Sola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC
Press, 1987)) for detection and quantitation of OPGbp polypeptides. The antibodies will bind OPGbp polypeptides with an affinity which is appropriate for the assay method being employed.
The selective binding agents of the invention also are useful for in vivo imaging, wherein for example a selective binding agent labeled with a detectable moiety is administered to an animal, preferably into the bloodstream, and the presence and location of the labeled antibody in the host is assayed. The agent may be labeled with any moiety that is detectable in an animal, whether by nuclear magnetic resonance, radiology, or other detection means known in the art.
The invention also relates to a kit comprising a selective binding agent of OPGbp, such as an antibody or antigen binding domain, and other reagents useful for detecting OPGbp levels in biological samples. Such reagents may include a secondary activity, a detectable label, blocking serum, positive and negative control samples, and detection reagents.
Therapeutic Uses of OPGbp selective binding agents Selective binding agents of the invention may be used as therapeutics. Therapeutic selective binding agents may be OPGbp agonists or antagonists and, in one embodiment, are anti-OPGbp antagonist antibodies which inhibit at least one of the biological activities of a OPGbp polypeptide in vitro or in vivo. For example, an antagonist of OPGbp will inhibit the binding of OPGbp to ODAR by at least about 100-fold, or about 1000-fold, or greater than 1000-fold. Alternatively, an OPGbp antagonist will inhibit osteoclast formation in vitro as indicated by a measurable IC50 (a concentration giving 50% inhibition) in a bone marrow assay such as that described in Example 1. Alternatively, an OPGbp antagonist will decrease bone turnover markers by at least 20%, or at lease 50% compared to baseline levels.
Antagonist OPGbp selective binding agents (such as antibodies) are identified by screening assays described herein.
OPGbp antagonists, such as anti-OPGbp antagonist antibodies and antigen binding domains, may, be used to prevent or treat bone diseases characterized by loss of bone mass or by replacement of structurally normal bone with structurally abnormal bone. OPGbp antagonists may be administered to an animal having loss of bone mass or susceptible to having loss of bone mass resulting from any of the following disorders:
Osteoporosis, such as primary osteoporosis, endocrine osteoporosis (hyperthyroidism, hyperparathryoidism, Cushing's syndrome, and acromegaly), hereditary and congenital forms of osteoporosis (osteogenesis imperfecta, homocystinuria, Menkes' syndrome, and Riley-Day syndrome) and osteoporosis due to immobilization of extremities; Osteomyelitis, or an infectious lesion in bone, leading to loss of bone mass; Hypercalcemia resulting from solid tumors (breast, lung and kidney) and hematologic malignacies (multiple myeloma, lymphoma and leukemia), idiopathic hypercalcemia, and hypercalcemia associated with hyperthryoidism and renal function disorders;
Osteopenia following surgery, induced by steroid administration, and associated with disorders of the small and large intestine and with chronic hepatic and renal diseases; Osteonecrosis, or bone cell death, associated with traumatic injury or nontraumatic necrosis associated with Gaucher's disease, sickle cell anemia, systemic lupus erythematosus and other conditions; Loss of bone mass due to rheumatoid arthritis; Periodontal loss of bone mass;
Osteoarthritis; Prosthetic loosening; and Osteolytic metastasis. OPGbp antagonists may also be used to prevent or treat certain bone disorders are characterized by the replacement of structurally sound bone with disorganized structurally incompetent bone, such as Paget's disease of bone (osteitis deformans) in adults and juveniles; hyperparathryoidism, in congenital bone disorders such as fibrous dysplasia, and in osteosclerotic bone metastases.
In an embodiment of the invention, OPGbp antagonists are advantageously used to treat loss of bone mass resulting from osteolytic destruction of bone caused by malignant or metastatic tumors. OPG
polypeptides of the invention may be used to treat loss of bone mass associated with breast, prostate, thyroid, kidney, lung, esophogeal, rectal, bladder, cervical, ovarian and liver cancers as well as cancer of the gastrointestional tract. Also included is loss of bone mass associated with certain hematological malignancies such as multiple myeloma and lymphomas such as Hodgkin's Disease.
OPGbp antagonists of the invention, including antagonist antibodies and antigen binding domains, are administered alone or in combination with other therapeutic agents, in particular, in combination with other cancer therapy agents. Such agents generally include radiation therapy or chemotherapy.
Chemotherapy may involve treatment with one or more of the following: anthracyclines, taxol, tamoxifene, doxorubicin, 5-fluorouracil, and other drugs known to the skilled worker. In one embodiment, the cancer therapy agent is a luteinizing hormone-releasing hormone (LHRH) antagonist, preferably a peptide antagonist. More preferably, an LHRH antagonist is a decapeptide comprising the following structure:
A-B-C-D-E-F-G-H-I-J
wherein A is pyro-glu, Ac-D-Nal, Ac-D-Qal; Ac-Sar, or Ac-D-Pal;
B is His or 4-Cl-D-Phe;
C is Trp, D-Pal, D-Nal, L-Nal-D-Pal(N-O), or D-Trp;
D is Ser;
E is N-Me-Ala, Tyr, N-Me-Tyr, Ser, Lys(iPr), 4-Cl-Phe, His, Asn, Met, Ala, Arg or Ile;
F is x Y
N
I
wherein R and X are independently, H and alkyl;
and Y comprises a small polar entity.
G is Leu or Trp;
H is Lys(iPr), Gln, Met, or Arg;
I is Pro; and J is Gly-NH2 or D-Ala-NH2;
or a pharmaceutically acceptable salt thereof.
In another embodiment, an LHRH antagonist comprises the peptide:
N-Ac-D-Nal-4-Cl-Phe-D-Pal-Ser-N-Me-Tyr-D-Asn-Leu-Lys(iPr)-Pro-D-Ala-NH2.
Standard abbreviations and conventions are used herein and the following non-standard residues and moieties are abbreviated as follows:
Nal 3- (2 -napthyl) alaninyl 4-C1-Phe (4'-chlorophenyl)alaninyl Pal 3-(3'-pyridyl)alaninyl Pal(N-O) 3-(3'-pyridine-N-oxide)alaninyl iPr-Lys N-epsilon-2-propyl-lysinyl Qal 3-(2'-quinolinyl)alaninyl Alternative forms of LHRH antagonist decapeptides are also encompassed by the invention.
Such decapeptides are described in U.S. Patent No.
5,843,901, Also included are combinations of OPGbp antagonists with antibodies which bind to tumor cells and induce a cytotoxic and/or cytostatic effect on tumor growth. Examples of such antibodies include those which bind to cell surface proteins Her2, CDC20, CDC33, mucin-like glycoprotein and epidermal growth factor receptor (EGFR) present on tumor cells and induce a cytostatic and/or cytotoxic effect on tumor cells displaying these proteins. Examples of such antibodies include HERCEPTIN for treatment of breast cancer and RITUXAN for the treatment of non-Hodgkin's lymphoma. Also included as cancer therapy agents are polypeptides which selectively induce apoptosis in tumor cells, such as the TNF-related polypeptide TRAIL.
OPGbp antagonists may be administered prior to, concurrent with, or subsequent to treatment with a cancer therapy agent. OPGbp antagonists may be administered prophylactically to prevent or mitigate the onset of loss of bone mass by metastatic cancer or may be given for the treatment of an existing condition of loss of bone mass due to metastasis.
OPGbp antagonists of the invention may be used to prevent and/or treat the growth of tumor cells in bone. Cancer which metastasizes to bone can spread readily as tumor cells stimulate osteoclasts to resorb the internal bone matrix. Treatment with an OPGbp antagonist will maintain bone density by inhibiting resorption and decrease the likelihood of tumor cells spreading throughout the skeleton. Any cancer which metastasizes to bone may be prevented and/or treated with an OPGbp antagonist.
In one embodiment, multiple myeloma may be prevented and/or treated with an OPGbp antagonist, such as an antibody. Multiple myeloma is localized to bone and affected patients typically exhibit a loss of bone mass due to increased osteoclast activation in localized regions. Myeloma cells either directly or indirectly produce OPGbp, which in turn activates osteoclasts resulting in local bone lysis surrounding the myeloma cells embedded in bone marrow spaces. The normal osteoclasts adjacent to the myeloma cell in turn produce IL-6, leading to growth and proliferation of myeloma cells. Myeloma cells expand in a clonal fashion and occupy bone spaces that are being created by inappropriate bone resorption. Treatment of an animal with an OPGbp antagonist blocks activation of osteoclasts which in turn leads to a decrease in IL-6 production by osteoclasts, and a suppression of mycloma all growth and/or proliferation.
OPGbp antagonists may be used alone for the treatment of the above referenced conditions resulting in loss of bone mass or in combination with a therapeutically effective amount of a bone growth promoting (anabolic) agent or a bone anti-resorptive agent including bone morphogenic factors designated BMP-1 to BMP-12, transforming growth factor-(3 and TGF-0 family members, fibroblast growth factors FGF-1 to FGF-10, interleukin-1 inhibitors, TNFQG inhibitors, parathyroid hormone, E series prostaglandins, bisphosphonates and bone-enhancing minerals such as fluoride and calcium. Anabolic agents include parathyroid hormone and insulin-like growth factor (IGF), wherein the latter agent is preferably complexed with an IGF binding protein. Preferred embodiments also include the combination of an OPGbp antagonist with a interluekin-1 (IL-1) receptor antagonist or an OPGbp antagonist with a soluble TNF receptor, such as soluble TNF receptor-1 or soluble TNF receptor-2. An exemplary IL-1 receptor antagonist is described in W089/11540 and an exemplary soluble TNF receptor-1 is described in W098/01555.
A decrease in the rate of bone resorption can lead to osteopetrosis, a condition marked by excessive bone density. Agonists of OPGbp may increase osteoclast formation and bone resorption and be administered to an animal which has or is susceptible to decreased bone resorption and an abnormal increase in bone mass.
Pharmaceutical Compositions Pharmaceutical compositions of OPGbp selective binding agents are within the scope of the present invention. Such compositions comprise a therapeutically or prophylactically effective amount of an OPGbp selective binding agent such as an antibody, or a fragment, variant, derivative or fusion thereof, in admixture with a pharmaceutically acceptable agent.
In a preferred embodiment, pharmaceutical compositions comprise anti-OPGbp antagonist antibodies which inhibit partially or completely at least one biological activity of OPGbp in admixture with a pharmaceutically acceptable agent. Typically, the antibodies will be sufficiently purified for administration to an animal.
Pharmaceutically acceptable agents for use in the compositions of the invention include carriers, excipients, diluents, antioxidants, preservatives, coloring, flavoring and diluting agents, emulsifying agents, suspending agents, solvents, fillers, bulking agents, buffers, delivery vehicles, tonicity agents, cosolvents, wetting agents, complexing agents, buffering agents, antimicrobials and surfactants, as are well known in the art.
Neutral buffered saline or saline mixed with serum albumin are exemplary appropriate carriers. Also included in the compositions are antioxidants such as ascorbic acid; low molecular weight polypeptides;
proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine;
monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium;
and/or nonionic surfactants such as Tween, pluronics or polyethylene glycol. Also by way of example, suitable tonicity enhancing agents include alkali metal halides (preferably sodium or potassium chloride), mannitol, sorbitol and the like. Suitable preservatives include, but are not limited to, benzalkonium chloride, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid and the like.
Hydrogen peroxide may also be used as preservative.
Suitable cosolvents are for example glycerin, propylene glycol, and polyethylene glycol. Suitable complexing agents are for example caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxy-propyl-beta-cyclodextrinn.
Suitable surfactants or wetting agents include sorbitan esters, polysorbates such as polysorbate 80, tromethamine, lecithin, cholesterol, tyloxapal and the like. The buffers can be conventional buffers 'such as acetate, borate, citrate, phosphate, bicarbonate, or Tris-HC1. Acetate buffer may be around pH 4.0-5.5 and Tris buffer may be around pH 7.0-8.5. Additional pharmaceutical agents are set forth in Remington's Pharmaceutical Sciences, 18th Edition, A.R. Gennaro, ed., Mack Publishing Company 1990.
The compositions may be in liquid form or in a lyophilized or freeze-dried form. Lypophilized forms may include excipients such as sucrose.
The compositions of the invention are suitable for parenteral administration. In preferred embodiments, the compositions are suitable for injection or infusion into an animal by any route available to the skilled worker, such as subcutaneous, intravenous, intramuscular, intraperitoneal, intracerebral (intraparenchymal), intracerebroventricular, intramuscular, intraocular, intraarterial, or intralesional routes. A parenteral formulation will typically be a sterile, pyrogen-free, isotonic aqueous solution, optionally containing pharmaceutically acceptable preservatives.
The optimal pharmaceutical formulation may be readily determined by one skilled in the art depending upon the intended route of administration, delivery format and desired dosage.
Other formulations are also contemplated by the invention. The pharmaceutical compositions also may include particulate preparations of polymeric compounds such as polylactic acid, polyglycolic acid, etc. or the introduction of an OPGbp selective binding agent (such as an antibody) into liposomes. Hyaluronic acid may also be used, and this may have the effect of promoting sustained duration in the circulation.
Pharmaceutical compositions also include the formulation of OPGbp selective binding agents (such as antibodies) with an agent, such as injectable microspheres, bio-erodible particles or beads, or liposomes, that provides for the controlled or sustained release of a selective binding agent which may then be delivered as a depot injection. Other suitable means for delivery include implantable delivery devices.
A pharmaceutical composition comprising and OPGbp selective binding agent (such as an antibody) may be formulated as a dry powder for inhalation. Such inhalation solutions may also be formulated in a liquefied propellant for aerosol delivery. In yet another formulation, solutions may be nebulized.
It is also contemplated that certain formulations containing OPGbp selective binding agents may be administered orally. Formulations administered in this fashion may be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules. For example, a capsule may be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized.
Additional agents may be included to facilitate absorption of a selective binding agent. Diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders may also be employed.
Another preparation may involve an effective quantity of an OPGbp selective binding agent in a mixture with non-toxic excipients which are suitable for the manufacture of tablets. By dissolving the tablets in sterile water, or another appropriate vehicle, solutions can be prepared in unit dose form.
Suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
Additional formulations will be evident to those skilled in the art, including formulations involving OPGbp selective binding agents in combination with one or more other therapeutic agents. Techniques for formulating a variety of other sustained- or controlled-delivery means, such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art.
See, for example, the Supersaxo et al. description of controlled release porous polymeric microparticles for the delivery of pharmaceutical compositions (See WO
93/15722 (PCT/US93/00829).
Regardless of the manner of administration, the specific dose may be calculated according to body weight, body surface area or organ size. Further refinement of the calculations necessary to determine the appropriate dosage for treatment involving each of the above mentioned formulations is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them.
Appropriate dosages may be ascertained through use of appropriate dose-response data.
One may further administer the present pharmaceutical compositions by pulmonary administration, see, e.g., PCT W094/20069, which discloses pulmonary delivery of chemically modified proteinsõ For pulmonary delivery, the particle size should be suitable for delivery to the distal lung. For example, the particle size may be from 1 m to 5 m, however, larger particles may be used, for example, if each particle is fairly porous.
Alternatively or additionally, the compositions may be administered locally via implantation into the affected area of a membrane, sponge, or other appropriate material on to which an OP
an OPGbp selective binding agent has been absorbed or encapsulated. Where an implantation device is used, the device may be implanted into any suitable tissue or organ, and delivery of an OPGbp selective binding agent may be directly through the device via bolus, or via continuous administration, or via catheter using continuous infusion.
Pharmaceutical compositions of the invention may also be administered in a sustained release formulation or preparation. Suitable examples of sustained-,release preparations include semipermeable polymer matrices in the form of shaped articles, e.g.
films, or microcapsules. Sustained release matrices include polyesters, hydrogels, polylactides (See e.g., U.S. Patent No. 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al, Biopolymers, 22: 547-556 [1983]), poly (2-hydroxyethyl-methacrylate) (Langer et al., J. Biomed.
Mater. Res., 15: 167-277 [1981] and Langer, Chem.
Tech., 12: 98-105 [1982]), ethylene vinyl acetate, or poly-D(-)-3-hydroxybutyric acid. Sustained-release .compositions also may include liposomes, which can be prepared by any of several methods known in the art.
See e.g., Eppstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688-3692 (1985); EP 36,676; EP 88,046; and EP
143,949.
OPGbp selective binding agents, such as antibodies and fragments, variants, derivatives and fusions thereof, may be employed alone or in combination with other pharmaceutical compositions.
For example, pharmaceutical compositions comprising separately or together an OPGbp antagonist and an interleukin-1 receptor antagonist, or an OPGbp antagonist and a soluble TNF receptor-1, or an OPGbp antagonist and a soluble TNF receptor-2 may be used for the treatment of rheumatoid arthritis. Further, compositions comprising separately or together an OPGbp antagonist and a cancer therapy agent may be used for the treatment of cancer and associated loss of bone mass. Other combinations with an OPGbp antagonist or agonist are possible depending upon the condition being treated.
It may be desirable in some instances to use a pharmaceutical composition comprising an OPGbp selective binding agent compositions in an ex vivo manner. Here, cells, tissues, or organs that have been removed from the patient are exposed to pharmaceutical compositons comprising OPGbp selective binding agents after which the cells, tissues and/or organs are subsequently implanted back into the patient.
and Y comprises a small polar entity.
G is Leu or Trp;
H is Lys(iPr), Gln, Met, or Arg;
I is Pro; and J is Gly-NH2 or D-Ala-NH2;
or a pharmaceutically acceptable salt thereof.
In another embodiment, an LHRH antagonist comprises the peptide:
N-Ac-D-Nal-4-Cl-Phe-D-Pal-Ser-N-Me-Tyr-D-Asn-Leu-Lys(iPr)-Pro-D-Ala-NH2.
Standard abbreviations and conventions are used herein and the following non-standard residues and moieties are abbreviated as follows:
Nal 3- (2 -napthyl) alaninyl 4-C1-Phe (4'-chlorophenyl)alaninyl Pal 3-(3'-pyridyl)alaninyl Pal(N-O) 3-(3'-pyridine-N-oxide)alaninyl iPr-Lys N-epsilon-2-propyl-lysinyl Qal 3-(2'-quinolinyl)alaninyl Alternative forms of LHRH antagonist decapeptides are also encompassed by the invention.
Such decapeptides are described in U.S. Patent No.
5,843,901, Also included are combinations of OPGbp antagonists with antibodies which bind to tumor cells and induce a cytotoxic and/or cytostatic effect on tumor growth. Examples of such antibodies include those which bind to cell surface proteins Her2, CDC20, CDC33, mucin-like glycoprotein and epidermal growth factor receptor (EGFR) present on tumor cells and induce a cytostatic and/or cytotoxic effect on tumor cells displaying these proteins. Examples of such antibodies include HERCEPTIN for treatment of breast cancer and RITUXAN for the treatment of non-Hodgkin's lymphoma. Also included as cancer therapy agents are polypeptides which selectively induce apoptosis in tumor cells, such as the TNF-related polypeptide TRAIL.
OPGbp antagonists may be administered prior to, concurrent with, or subsequent to treatment with a cancer therapy agent. OPGbp antagonists may be administered prophylactically to prevent or mitigate the onset of loss of bone mass by metastatic cancer or may be given for the treatment of an existing condition of loss of bone mass due to metastasis.
OPGbp antagonists of the invention may be used to prevent and/or treat the growth of tumor cells in bone. Cancer which metastasizes to bone can spread readily as tumor cells stimulate osteoclasts to resorb the internal bone matrix. Treatment with an OPGbp antagonist will maintain bone density by inhibiting resorption and decrease the likelihood of tumor cells spreading throughout the skeleton. Any cancer which metastasizes to bone may be prevented and/or treated with an OPGbp antagonist.
In one embodiment, multiple myeloma may be prevented and/or treated with an OPGbp antagonist, such as an antibody. Multiple myeloma is localized to bone and affected patients typically exhibit a loss of bone mass due to increased osteoclast activation in localized regions. Myeloma cells either directly or indirectly produce OPGbp, which in turn activates osteoclasts resulting in local bone lysis surrounding the myeloma cells embedded in bone marrow spaces. The normal osteoclasts adjacent to the myeloma cell in turn produce IL-6, leading to growth and proliferation of myeloma cells. Myeloma cells expand in a clonal fashion and occupy bone spaces that are being created by inappropriate bone resorption. Treatment of an animal with an OPGbp antagonist blocks activation of osteoclasts which in turn leads to a decrease in IL-6 production by osteoclasts, and a suppression of mycloma all growth and/or proliferation.
OPGbp antagonists may be used alone for the treatment of the above referenced conditions resulting in loss of bone mass or in combination with a therapeutically effective amount of a bone growth promoting (anabolic) agent or a bone anti-resorptive agent including bone morphogenic factors designated BMP-1 to BMP-12, transforming growth factor-(3 and TGF-0 family members, fibroblast growth factors FGF-1 to FGF-10, interleukin-1 inhibitors, TNFQG inhibitors, parathyroid hormone, E series prostaglandins, bisphosphonates and bone-enhancing minerals such as fluoride and calcium. Anabolic agents include parathyroid hormone and insulin-like growth factor (IGF), wherein the latter agent is preferably complexed with an IGF binding protein. Preferred embodiments also include the combination of an OPGbp antagonist with a interluekin-1 (IL-1) receptor antagonist or an OPGbp antagonist with a soluble TNF receptor, such as soluble TNF receptor-1 or soluble TNF receptor-2. An exemplary IL-1 receptor antagonist is described in W089/11540 and an exemplary soluble TNF receptor-1 is described in W098/01555.
A decrease in the rate of bone resorption can lead to osteopetrosis, a condition marked by excessive bone density. Agonists of OPGbp may increase osteoclast formation and bone resorption and be administered to an animal which has or is susceptible to decreased bone resorption and an abnormal increase in bone mass.
Pharmaceutical Compositions Pharmaceutical compositions of OPGbp selective binding agents are within the scope of the present invention. Such compositions comprise a therapeutically or prophylactically effective amount of an OPGbp selective binding agent such as an antibody, or a fragment, variant, derivative or fusion thereof, in admixture with a pharmaceutically acceptable agent.
In a preferred embodiment, pharmaceutical compositions comprise anti-OPGbp antagonist antibodies which inhibit partially or completely at least one biological activity of OPGbp in admixture with a pharmaceutically acceptable agent. Typically, the antibodies will be sufficiently purified for administration to an animal.
Pharmaceutically acceptable agents for use in the compositions of the invention include carriers, excipients, diluents, antioxidants, preservatives, coloring, flavoring and diluting agents, emulsifying agents, suspending agents, solvents, fillers, bulking agents, buffers, delivery vehicles, tonicity agents, cosolvents, wetting agents, complexing agents, buffering agents, antimicrobials and surfactants, as are well known in the art.
Neutral buffered saline or saline mixed with serum albumin are exemplary appropriate carriers. Also included in the compositions are antioxidants such as ascorbic acid; low molecular weight polypeptides;
proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine;
monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium;
and/or nonionic surfactants such as Tween, pluronics or polyethylene glycol. Also by way of example, suitable tonicity enhancing agents include alkali metal halides (preferably sodium or potassium chloride), mannitol, sorbitol and the like. Suitable preservatives include, but are not limited to, benzalkonium chloride, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid and the like.
Hydrogen peroxide may also be used as preservative.
Suitable cosolvents are for example glycerin, propylene glycol, and polyethylene glycol. Suitable complexing agents are for example caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxy-propyl-beta-cyclodextrinn.
Suitable surfactants or wetting agents include sorbitan esters, polysorbates such as polysorbate 80, tromethamine, lecithin, cholesterol, tyloxapal and the like. The buffers can be conventional buffers 'such as acetate, borate, citrate, phosphate, bicarbonate, or Tris-HC1. Acetate buffer may be around pH 4.0-5.5 and Tris buffer may be around pH 7.0-8.5. Additional pharmaceutical agents are set forth in Remington's Pharmaceutical Sciences, 18th Edition, A.R. Gennaro, ed., Mack Publishing Company 1990.
The compositions may be in liquid form or in a lyophilized or freeze-dried form. Lypophilized forms may include excipients such as sucrose.
The compositions of the invention are suitable for parenteral administration. In preferred embodiments, the compositions are suitable for injection or infusion into an animal by any route available to the skilled worker, such as subcutaneous, intravenous, intramuscular, intraperitoneal, intracerebral (intraparenchymal), intracerebroventricular, intramuscular, intraocular, intraarterial, or intralesional routes. A parenteral formulation will typically be a sterile, pyrogen-free, isotonic aqueous solution, optionally containing pharmaceutically acceptable preservatives.
The optimal pharmaceutical formulation may be readily determined by one skilled in the art depending upon the intended route of administration, delivery format and desired dosage.
Other formulations are also contemplated by the invention. The pharmaceutical compositions also may include particulate preparations of polymeric compounds such as polylactic acid, polyglycolic acid, etc. or the introduction of an OPGbp selective binding agent (such as an antibody) into liposomes. Hyaluronic acid may also be used, and this may have the effect of promoting sustained duration in the circulation.
Pharmaceutical compositions also include the formulation of OPGbp selective binding agents (such as antibodies) with an agent, such as injectable microspheres, bio-erodible particles or beads, or liposomes, that provides for the controlled or sustained release of a selective binding agent which may then be delivered as a depot injection. Other suitable means for delivery include implantable delivery devices.
A pharmaceutical composition comprising and OPGbp selective binding agent (such as an antibody) may be formulated as a dry powder for inhalation. Such inhalation solutions may also be formulated in a liquefied propellant for aerosol delivery. In yet another formulation, solutions may be nebulized.
It is also contemplated that certain formulations containing OPGbp selective binding agents may be administered orally. Formulations administered in this fashion may be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules. For example, a capsule may be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized.
Additional agents may be included to facilitate absorption of a selective binding agent. Diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders may also be employed.
Another preparation may involve an effective quantity of an OPGbp selective binding agent in a mixture with non-toxic excipients which are suitable for the manufacture of tablets. By dissolving the tablets in sterile water, or another appropriate vehicle, solutions can be prepared in unit dose form.
Suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
Additional formulations will be evident to those skilled in the art, including formulations involving OPGbp selective binding agents in combination with one or more other therapeutic agents. Techniques for formulating a variety of other sustained- or controlled-delivery means, such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art.
See, for example, the Supersaxo et al. description of controlled release porous polymeric microparticles for the delivery of pharmaceutical compositions (See WO
93/15722 (PCT/US93/00829).
Regardless of the manner of administration, the specific dose may be calculated according to body weight, body surface area or organ size. Further refinement of the calculations necessary to determine the appropriate dosage for treatment involving each of the above mentioned formulations is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them.
Appropriate dosages may be ascertained through use of appropriate dose-response data.
One may further administer the present pharmaceutical compositions by pulmonary administration, see, e.g., PCT W094/20069, which discloses pulmonary delivery of chemically modified proteinsõ For pulmonary delivery, the particle size should be suitable for delivery to the distal lung. For example, the particle size may be from 1 m to 5 m, however, larger particles may be used, for example, if each particle is fairly porous.
Alternatively or additionally, the compositions may be administered locally via implantation into the affected area of a membrane, sponge, or other appropriate material on to which an OP
an OPGbp selective binding agent has been absorbed or encapsulated. Where an implantation device is used, the device may be implanted into any suitable tissue or organ, and delivery of an OPGbp selective binding agent may be directly through the device via bolus, or via continuous administration, or via catheter using continuous infusion.
Pharmaceutical compositions of the invention may also be administered in a sustained release formulation or preparation. Suitable examples of sustained-,release preparations include semipermeable polymer matrices in the form of shaped articles, e.g.
films, or microcapsules. Sustained release matrices include polyesters, hydrogels, polylactides (See e.g., U.S. Patent No. 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al, Biopolymers, 22: 547-556 [1983]), poly (2-hydroxyethyl-methacrylate) (Langer et al., J. Biomed.
Mater. Res., 15: 167-277 [1981] and Langer, Chem.
Tech., 12: 98-105 [1982]), ethylene vinyl acetate, or poly-D(-)-3-hydroxybutyric acid. Sustained-release .compositions also may include liposomes, which can be prepared by any of several methods known in the art.
See e.g., Eppstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688-3692 (1985); EP 36,676; EP 88,046; and EP
143,949.
OPGbp selective binding agents, such as antibodies and fragments, variants, derivatives and fusions thereof, may be employed alone or in combination with other pharmaceutical compositions.
For example, pharmaceutical compositions comprising separately or together an OPGbp antagonist and an interleukin-1 receptor antagonist, or an OPGbp antagonist and a soluble TNF receptor-1, or an OPGbp antagonist and a soluble TNF receptor-2 may be used for the treatment of rheumatoid arthritis. Further, compositions comprising separately or together an OPGbp antagonist and a cancer therapy agent may be used for the treatment of cancer and associated loss of bone mass. Other combinations with an OPGbp antagonist or agonist are possible depending upon the condition being treated.
It may be desirable in some instances to use a pharmaceutical composition comprising an OPGbp selective binding agent compositions in an ex vivo manner. Here, cells, tissues, or organs that have been removed from the patient are exposed to pharmaceutical compositons comprising OPGbp selective binding agents after which the cells, tissues and/or organs are subsequently implanted back into the patient.
In other cases, a composition comprising an OPGbp selective binding agent may be delivered through implanting into patients certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptides, selective binding agents, fragments, variants, or derivatives. Such cells may be animal or human cells, and may be derived from the patient's own tissue or from another source, either human or non-human. Optionally, the cells may be immortalized.
However, in order to decrease the chance of an immunological response, it is preferred that the cells be encapsulated to avoid infiltration of surrounding tissues. The encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow release of the protein product(s) but prevent destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.
Methods used for membrane encapsulation of cells are familiar to the skilled artisan, and preparation of encapsulated cells and their implantation in patients may be accomplished without undue experimentation. See, e.g., U.S. Patent Nos.
4,892,538; 5,011,472; and 5,106,627. A system for encapsulating living cells is described in PCT WO
91/10425 (Aebischer et al.). Techniques for formulating a variety of other sustained or controlled delivery means, such as liposome carriers, bio-erodible particles or beads, are also known to those in the art, and are described. The cells, with or without encapsulation, may be implanted into suitable body tissues or organs of the patient.
A therapeutically or prophylactically effective amount of a pharmaceutical composition comprising an OPGbp selective binding agent (such as an.
However, in order to decrease the chance of an immunological response, it is preferred that the cells be encapsulated to avoid infiltration of surrounding tissues. The encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow release of the protein product(s) but prevent destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.
Methods used for membrane encapsulation of cells are familiar to the skilled artisan, and preparation of encapsulated cells and their implantation in patients may be accomplished without undue experimentation. See, e.g., U.S. Patent Nos.
4,892,538; 5,011,472; and 5,106,627. A system for encapsulating living cells is described in PCT WO
91/10425 (Aebischer et al.). Techniques for formulating a variety of other sustained or controlled delivery means, such as liposome carriers, bio-erodible particles or beads, are also known to those in the art, and are described. The cells, with or without encapsulation, may be implanted into suitable body tissues or organs of the patient.
A therapeutically or prophylactically effective amount of a pharmaceutical composition comprising an OPGbp selective binding agent (such as an.
anti-OPGbp antibody, or fragment, variant, derivative, and fusion thereof) will depend, for example, upon the therapeutic objectives such as the indication for which the composition is being used, the route of administration, and the condition of the subject.
OPGbp antagonist antibodies or antigen binding domains of the invention are administered in a therapeutically or prophylactically effective amount to prevent and/or treat loss of bone associated with metastatic bone disease. A "therapeutically or prophylactically effective amount" of an OPGbp antagonist antibody is that amount which reduces the rate and/or extent of loss of bone mass or prevents the loss of bone mass in a subject having normal bone mass. Changes in bone mass are detected by a variety of known methods such as single photon absorptiometry (SPA), dual photon absorptiomerty (DPA), dual energy X-ray absorptiometry (DEXA), quantitative computed tomography (QCT), and ultrasonography (See Johnston et al. in Primer on the Metabolic Bone Disease and Disorders of Mineral Metabolism, 2d ed., M.J. Favus, ed. Raven Press pp.
137-146). One skilled in the art can use these methods to determine a therapeutically effective amount of an OPG fusion polypeptide. A therapeutically effective amount may also be determined by measuring changes in biochemical markers for bone turnover, such as serum osteocalcin, serum alkaline phosphatase, serum procollagen I extension peptides, urinary or serum C-terminal or N-terminal telopeptide of collagen, urinary calcium, hydroxyproline and urinary pyridinoline and deoxypyridinoline. It is generally recognized that a decrease in the levels of the aforementioned biochemical markers indicates that bone resorption is decreased and loss of bone mass is being reduced.
Alternatively, a therapeutically effective amount of an OPG fusion polypeptide may also be determined by measuring a change in the mechanical strength of bone, in particular an increase in torsional (twisting) strength of bone.
Accordingly, it may be necessary for the caretaker to titer the dosage and modify the route of administration as required to obtain the optimal therapeutic effect. A typical dosage may range from about 0.1 g/kg to up to about 100 mg/kg or more, depending on the factors mentioned above. In other embodiments, the dosage may range from 1 g/kg up to about 100 mg/kg; or 5 g/kg up to about 100 mg/kg; or 0.1 g/kg up to about 100 mg/kg; or 1 g/kg up to about 100 mg/kg Typically, a clinician will administer the composition until a dosage is reached that achieves the desired effect. The composition may therefore be administered as a single dose, or as two or more doses (which may or may not contain the same amount of an OPGbp selective binding agent) over time, or as a continuous infusion via implantation device or catheter.
The following examples are offered to more fully illustrate the invention but are not construed as limiting the scope thereof.
Example 1 Reagents and Assays The screening target used in these studies was prepared from expression of a cDNA encoding human OPGbp of amino acids 140 through 317 inclusive as shown in Figure 4 of PCT W098/46751 in a CHO host cell and purified as follows. A Q Sepharose*column (Pharmacia) was., equilibrated with 20mM tris pH 8.5. Conditioned media which had also been titrated to pH 8.5 was applied, the column washed with the Tris buffer, and proteins were eluted with a 100-600mM NaCl'gradient, over 20 column volumes. Fractions containing OPGL were identified through SDS-PAGE and Western blot analysis.
OPGbp containing fractions were then titrated to pH 4.8 and applied to a Sp column (Pharmacia) which had been equilibrated with 20mM sodium acetate pH 4.8. After washing, proteins were eluted with a 0-0.3M NaCl gradient followed by 0.5M and 1M NaCl steps. OPGbp eluted with all buffers however only the 0-0.3M NaCl gradient fractions were found to be active in vitro osteoclast stimulating bioassays. The yield was 40mg/1.
Amino-terminal sequencing revealed that about 80% of the purified protein started with amino acid 143 of human OPGbp while the remaining about 20% started with amino acid 147. The final product used for screening phage libraries is referred to as OPGbp[143-317], the predominant purified form.
Anti-OPGbp polyclonal antibodies were prepared as follows. Three white New Zealand rabbits (Western Oregon Rabbit Co., Philomath, OR) were initially injected with equal amounts of Hunter Titer Max (CytRx Corp., Atlanta, GA) and OPGbp[143-317]. 0.2 mgs per rabbit was injected. This was repeated four and six weeks later. A 50 ml bleed was performed at seven weeks and once per week thereafter for a total of six bleeds. The antibodies were affinity purified from sera of immunized rabbits on an OPGbp resin as follows.
Three mis of Actigel*Ald resin (Sterogene) were added to a 10m1 column (Kontes Flex Colum) and washed with 50 mis of PBS. Three mgs of OPGbp[143-317] diluted into 3 mis of PBS was added to the Actigel column and shaken gently to mix. 0.6mls of 1M Na Cyanoborohydride was Trademark then added and the mixture shaken overnight at 4 C.
The column was washed with 50mis of Pierce Gentle Elution Buffer (Pierce) followed by 150mis of PBS.
50mis of sera from immunized rabbits was sterile filtered through a 0.45 m filter, added to the column and the mixture was shaken overnight at 4 C. The following day the column contents were allowed to settle and the liquid phase was drained. The column was then washed with 150mis of PBS to an OD280 of 0.002.
Pierce Gentle Elution Buffer with 1% Glacial Acetic Acid was then added to the column and 1 ml fractions were collected at 10 min intervals and analyzed by OD240. Fractions containing the highest amount of OD280 absorbing material were pooled and dialyzed against two liters of PBS for 48 hours. There was one buffer change during this time.
ELISA assays were performed on eluted phage pools by plating OPGbp[143-317] at 1.5 gg/ml in PBS pH
8.0 for 2 h at room temperature in Nunc Maxisorp*
Immunoplates on a rocker. A rinse solution of 2% MPBS' (Block Buffer ) was added to the immunoplates, incubated for 3 min at room temperature and discarded.
Blocking was performed for 1 hour at room temperature with 2% MPBS.- Washes were performed 5X using TBS-Tween 20 (0.1%) (TBS; Tris Buffered Saline; 10 mM Tris-HC1 (pH 7.5), 1 mM EDTA, 150 mM NaCl). A titration of phage were added using a minimum of 1010 phage/well in Conjugate Dilution Buffer (0.4% Nonfat Dry Milk in TBS
or, 0.4% M-TBS) for 1 hour at room temperature. Washes were performed using TBS-Tween-20 (0.1%). Anti-M13-horse radish peroxidase (HRP) Monoclonal Antibody Conjugate (Pharmacia Piscataway, NJ) was used at a 1/2000 dilution in 0.4% MTBS for 1.5 h at room temperature. Washes were performed 5 times with TBS-Tween-20 (0.1%). 2,2'-Azinobis(3-ethylbenzthiazoline-* Trademark sulfonic acid) (ARTS) (Pierce, Rockford, IL) a colorimetric substrate for detection at OD405 was added. Positive controls for the detection of plated huOPG bp [143-317] was performed by addition of OPG[22-194]-Fc, followed by anti-Fc-alkaline phosphatase and para-nitrophenylphenol (pNPP) substrate for detection.
PCR conditions and 2xTY-AG culture A typical polymerase chain reaction (PCR) was performed in a 96-well Thermowell plate. Each well contains 20 Al of PCR reaction mix [2 Al 10X PCR
buffer (Gibco BRL Products, Grand Island, NY), 17.3 Al water, 0.2 gl dNTPs (25 mM), 0.2 gl Primer 870-02, 0.2 Al Primer 2182-83 (primer stocks 10 pmol/ l for insert amplification), 0.1 gl Taq polymerase]. Individual colonies were picked and resuspended in a well and overlayed with 20 Al of mineral oil, sealed, then placed in PCR machine.
870-02 5'-CCG ACT TTG CAC CTA GTT (SEQ ID NO: 22) 2182-83 5'-TTT GTC GTC TTT CCA GAC GTT AGT (SEQ ID
NO: 23) A duplicate plate for preparing cultures was generated by transferring the same picked colony to the corresponding well position in a second 96-deep well block. Cultures were grown in 0.3 to 1.0 ml 2xTY-AG
(2xTY broth: (16 g bacto-tryptone / liter water, 10 g Yeast extract / liter water, 5 g NaCl/ liter water), containing 100 g/ml ampicillin and 2% glucose). The block was sealed with air-permeable tape, centrifuged at 1000 rpm for 2 minutes to bring down the liquid, and 37 C incubator at 300 to 350 rpm overnight for culturing. The overnight cultures received 150 l/well of 50% glycerol, were mixed, and frozen at -80 C.
OPGbp antagonist antibodies or antigen binding domains of the invention are administered in a therapeutically or prophylactically effective amount to prevent and/or treat loss of bone associated with metastatic bone disease. A "therapeutically or prophylactically effective amount" of an OPGbp antagonist antibody is that amount which reduces the rate and/or extent of loss of bone mass or prevents the loss of bone mass in a subject having normal bone mass. Changes in bone mass are detected by a variety of known methods such as single photon absorptiometry (SPA), dual photon absorptiomerty (DPA), dual energy X-ray absorptiometry (DEXA), quantitative computed tomography (QCT), and ultrasonography (See Johnston et al. in Primer on the Metabolic Bone Disease and Disorders of Mineral Metabolism, 2d ed., M.J. Favus, ed. Raven Press pp.
137-146). One skilled in the art can use these methods to determine a therapeutically effective amount of an OPG fusion polypeptide. A therapeutically effective amount may also be determined by measuring changes in biochemical markers for bone turnover, such as serum osteocalcin, serum alkaline phosphatase, serum procollagen I extension peptides, urinary or serum C-terminal or N-terminal telopeptide of collagen, urinary calcium, hydroxyproline and urinary pyridinoline and deoxypyridinoline. It is generally recognized that a decrease in the levels of the aforementioned biochemical markers indicates that bone resorption is decreased and loss of bone mass is being reduced.
Alternatively, a therapeutically effective amount of an OPG fusion polypeptide may also be determined by measuring a change in the mechanical strength of bone, in particular an increase in torsional (twisting) strength of bone.
Accordingly, it may be necessary for the caretaker to titer the dosage and modify the route of administration as required to obtain the optimal therapeutic effect. A typical dosage may range from about 0.1 g/kg to up to about 100 mg/kg or more, depending on the factors mentioned above. In other embodiments, the dosage may range from 1 g/kg up to about 100 mg/kg; or 5 g/kg up to about 100 mg/kg; or 0.1 g/kg up to about 100 mg/kg; or 1 g/kg up to about 100 mg/kg Typically, a clinician will administer the composition until a dosage is reached that achieves the desired effect. The composition may therefore be administered as a single dose, or as two or more doses (which may or may not contain the same amount of an OPGbp selective binding agent) over time, or as a continuous infusion via implantation device or catheter.
The following examples are offered to more fully illustrate the invention but are not construed as limiting the scope thereof.
Example 1 Reagents and Assays The screening target used in these studies was prepared from expression of a cDNA encoding human OPGbp of amino acids 140 through 317 inclusive as shown in Figure 4 of PCT W098/46751 in a CHO host cell and purified as follows. A Q Sepharose*column (Pharmacia) was., equilibrated with 20mM tris pH 8.5. Conditioned media which had also been titrated to pH 8.5 was applied, the column washed with the Tris buffer, and proteins were eluted with a 100-600mM NaCl'gradient, over 20 column volumes. Fractions containing OPGL were identified through SDS-PAGE and Western blot analysis.
OPGbp containing fractions were then titrated to pH 4.8 and applied to a Sp column (Pharmacia) which had been equilibrated with 20mM sodium acetate pH 4.8. After washing, proteins were eluted with a 0-0.3M NaCl gradient followed by 0.5M and 1M NaCl steps. OPGbp eluted with all buffers however only the 0-0.3M NaCl gradient fractions were found to be active in vitro osteoclast stimulating bioassays. The yield was 40mg/1.
Amino-terminal sequencing revealed that about 80% of the purified protein started with amino acid 143 of human OPGbp while the remaining about 20% started with amino acid 147. The final product used for screening phage libraries is referred to as OPGbp[143-317], the predominant purified form.
Anti-OPGbp polyclonal antibodies were prepared as follows. Three white New Zealand rabbits (Western Oregon Rabbit Co., Philomath, OR) were initially injected with equal amounts of Hunter Titer Max (CytRx Corp., Atlanta, GA) and OPGbp[143-317]. 0.2 mgs per rabbit was injected. This was repeated four and six weeks later. A 50 ml bleed was performed at seven weeks and once per week thereafter for a total of six bleeds. The antibodies were affinity purified from sera of immunized rabbits on an OPGbp resin as follows.
Three mis of Actigel*Ald resin (Sterogene) were added to a 10m1 column (Kontes Flex Colum) and washed with 50 mis of PBS. Three mgs of OPGbp[143-317] diluted into 3 mis of PBS was added to the Actigel column and shaken gently to mix. 0.6mls of 1M Na Cyanoborohydride was Trademark then added and the mixture shaken overnight at 4 C.
The column was washed with 50mis of Pierce Gentle Elution Buffer (Pierce) followed by 150mis of PBS.
50mis of sera from immunized rabbits was sterile filtered through a 0.45 m filter, added to the column and the mixture was shaken overnight at 4 C. The following day the column contents were allowed to settle and the liquid phase was drained. The column was then washed with 150mis of PBS to an OD280 of 0.002.
Pierce Gentle Elution Buffer with 1% Glacial Acetic Acid was then added to the column and 1 ml fractions were collected at 10 min intervals and analyzed by OD240. Fractions containing the highest amount of OD280 absorbing material were pooled and dialyzed against two liters of PBS for 48 hours. There was one buffer change during this time.
ELISA assays were performed on eluted phage pools by plating OPGbp[143-317] at 1.5 gg/ml in PBS pH
8.0 for 2 h at room temperature in Nunc Maxisorp*
Immunoplates on a rocker. A rinse solution of 2% MPBS' (Block Buffer ) was added to the immunoplates, incubated for 3 min at room temperature and discarded.
Blocking was performed for 1 hour at room temperature with 2% MPBS.- Washes were performed 5X using TBS-Tween 20 (0.1%) (TBS; Tris Buffered Saline; 10 mM Tris-HC1 (pH 7.5), 1 mM EDTA, 150 mM NaCl). A titration of phage were added using a minimum of 1010 phage/well in Conjugate Dilution Buffer (0.4% Nonfat Dry Milk in TBS
or, 0.4% M-TBS) for 1 hour at room temperature. Washes were performed using TBS-Tween-20 (0.1%). Anti-M13-horse radish peroxidase (HRP) Monoclonal Antibody Conjugate (Pharmacia Piscataway, NJ) was used at a 1/2000 dilution in 0.4% MTBS for 1.5 h at room temperature. Washes were performed 5 times with TBS-Tween-20 (0.1%). 2,2'-Azinobis(3-ethylbenzthiazoline-* Trademark sulfonic acid) (ARTS) (Pierce, Rockford, IL) a colorimetric substrate for detection at OD405 was added. Positive controls for the detection of plated huOPG bp [143-317] was performed by addition of OPG[22-194]-Fc, followed by anti-Fc-alkaline phosphatase and para-nitrophenylphenol (pNPP) substrate for detection.
PCR conditions and 2xTY-AG culture A typical polymerase chain reaction (PCR) was performed in a 96-well Thermowell plate. Each well contains 20 Al of PCR reaction mix [2 Al 10X PCR
buffer (Gibco BRL Products, Grand Island, NY), 17.3 Al water, 0.2 gl dNTPs (25 mM), 0.2 gl Primer 870-02, 0.2 Al Primer 2182-83 (primer stocks 10 pmol/ l for insert amplification), 0.1 gl Taq polymerase]. Individual colonies were picked and resuspended in a well and overlayed with 20 Al of mineral oil, sealed, then placed in PCR machine.
870-02 5'-CCG ACT TTG CAC CTA GTT (SEQ ID NO: 22) 2182-83 5'-TTT GTC GTC TTT CCA GAC GTT AGT (SEQ ID
NO: 23) A duplicate plate for preparing cultures was generated by transferring the same picked colony to the corresponding well position in a second 96-deep well block. Cultures were grown in 0.3 to 1.0 ml 2xTY-AG
(2xTY broth: (16 g bacto-tryptone / liter water, 10 g Yeast extract / liter water, 5 g NaCl/ liter water), containing 100 g/ml ampicillin and 2% glucose). The block was sealed with air-permeable tape, centrifuged at 1000 rpm for 2 minutes to bring down the liquid, and 37 C incubator at 300 to 350 rpm overnight for culturing. The overnight cultures received 150 l/well of 50% glycerol, were mixed, and frozen at -80 C.
The PCR reaction conditions were 40 cycles of 45 sec. at 90 C, 45 sec at 55 C, 1.5 min at 72C, followed by a 72 C extension for 10 min. After the PCR
reaction was complete, 2.5 to 4.0 gl were run on 25-well 1% agarose gels with 0.5 Al/ml ethidium bromide, using DNA molecular weight standards (Gibco BRL
Products, Grand Island, NY, or Stratagene, La Jolla, CA) for 90 min at 90 volts. Only full-length inserts of greater than 1.6 kb were considered.
A 16 gl aliquot of the PCR reactions was BstNI digested 3 hours at 60 C with a 30 /tl total digestion mixture containing 10 gl water, 3 gl of lOX
REact*Buffer 2 (GIBCO BRL Products), 0.3 gl BSA (10 mg/ml), 0.7 Al BstNI (GIBCO; 10,000 units/ml).
Digested samples were run on a 25-well 3% agarose gels for 3.5 hours at 80 volts.
RAW cell assay Varying concentrations of Fab test samples were mixed with a constant amount of human OPGbp[143-317]
and incubated for at least one hour at room temperature in DMEM, 10% fetal bovine serum and lx glutamine-penicillin-streptomycin mixture. The concentrations of Fab samples and OPGbp are indicated for each experiment. After incubation, the mixture was added to 2 x 104 RAW 264.7 cells/well (American Type Culture Collection, Manassas, VA, Accession No. TIB-71) in a 96 well flat bottom tissue culture plate. RAW cells were cultured in DMEM with 10% fetal bovine serum and lx glutamine-penicillin-streptomycin. After three days at 37 C and 5%C02, the media was aspirated from the wells and the cells were stained for Tartrate Resistant Acid Phosphatase (TRAP), an osteoclast differentiation marker, by addition of 100 gl per well of 0.1M citrate buffer with 0.1% Triton* X-100, incubation for five minutes at room temperature, addition of para-* Trademark nitrophenylphosphate (pNPP) substrate and tartrate in citrate buffer containing Triton X-100 (substrate concentration was 20 mM pNPP and 335 mM tartrate) and incubation for an additional five minutes at room temperature. The reaction was stopped by addition of NaOH to a concentration of 0.05M. Acid phosphatase converts the pNPP substrate to para-nitrophenol which is detected by absorbance at 405 nm. The change in absorbance at 405 nm was plotted as a function log dose for both controls and test samples. An analysis of Variance (ANOVA) and relative potency with 95%
confidence limits was calculated. Positive controls included varying concentrations of OPG[22-194]-Fc fusion protein or an anti-OPGbp polyclonal antibody preparation preincubated with OPGbp[143-317] and incubated with RAW264.7 cells as described above.
Bone Marrow Assay A murine bone marrow assay for osteoclast formation was carried out essentially as described in Lacey et al. (Cell 93, 165-176 (1998)) and Kong et al.
(Nature 397, 315-323 (1999)). Briefly, the assay is a modification of the murine bone marrow coculture assay described in PCT W097/23614 in which non-adherent murine bone marrow cells were cultured in media for about seven days in the presence of human OPGbp (143-317) but without addition of the stromal cell line ST2, 1,25(OH)2 vitamin D3 and dexamethsone. Cells having an osteoclast phenotype were detected by the appearance of TRAP-positive cells. TRAP activity was measured in solution or by histochemical staining.
For detection of TRAP activity in solution, adult bone marrow cells were lysed in 100 mM Citrate Buffer (Sigma, Cat # 91-5) + 0.1% Triton X-100, pH 5.0, 3-5 min. 20 mM pNPP, 80 mM Tartrate, and 100 mM
Citrate + 0.1% Triton X-100, pH 5.0 were added and incubated at RT, 3-5 min, and measured at 405 nm after stopping the reaction with 50 gl of 500 mM NaOH /well.
A positive response was a concentration dependent decrease in absorbance at 405 nm from -2.0 OD to -0.6 OD.
For histochemical staining, cells were fixed in a formaldehyde-based fixative solution, then stained with Fast Garnet GBC (2-methyl-4-[(2-methylphenyl)-azo]benzenediazonium) solution + Naphthol AS-BI
(C18H15BrNO6P) phosphate solution + Acetate Solution +
Tartrate Solution, incubated 1 hour at 37oC, then rinsed, dried, and evaluated microscopically. A cell that was TRAP positive and contained three or more nuclei (TRAP-positive MITC) was considered an osteoclastic cell.
Example 2 Screening of a Human Fab library A library of about 4 x1010 unique human Fab fragments prepared in bacteriophage M13 was obtained from Target Quest, NV (Amsterdam, Netherlands).
General procedures for construction and screening human Fab libraries were described in de Haard et al.
(Advanced Drug Delivery Reviews 31, 5-31 (1998); J.
Biol. Chem. 274, 18218-18230 (1999)). The library was screened for Fab fragments which bind to OPGbp[143-317]
by the following procedures.
Solid phase direct plating OPGbp [143-317] prepared as described above was immobilized on a solid phase using Nunc Maxisorb immunotubes (12 x 75mm, 5ml capacity) by directly plating on the solid phase at a protein concentration of 1.5 g/ml in TBS, pH 8.0 (TBS was Tris buffered saline: 10 MM Tris (pH 7.5), 150 mM NaCl) at room temperature for 2 hours. These conditions permitted 80% of maximum plating of the solid phase at 2 hours (maximum at 2 hours was still nonsaturating) while retaining binding capabilities to OPG [22-194]-Fc.
After the 2 hour incubation, the tube was washed three times with PBS. The plated target was blocked by filling the immunotube with 2% nonfat dry milk, (Marvel or Carnation) in PBS (MPBS) for 1 to 4 hours at room temperature, washed two times each in PBS-Tween 20 (0.1%) and PBS. The PEG-concentrated phage (approximately 1013) were pre-blocked in 2% MPBS to adsorb milk binding phage prior to exposure of the phage to the solid phase target. The pre-blocked phage were incubated in 4 ml with the plated target at room temperature for 2 h, (30 min rotating end-over-end and 90 min standing). The contents bound to the tube were washed 20 times with PBS-Tween 20 (0.1%) and 20 times with PBS to remove unbound phage and to reduce nonspecific binding. Phage were eluted from the solid phase by a ten minute total phage elution with 1 ml of 100 mM triethylamine (TEA) pH 12, rotating the tube end-to-end, followed by neutralization with 0.5 ml of 1 M Tris-HC1 pH 7.4. Alternatively, specific phage binders were recovered by elution with 1 ml of either 1 uM OPGbp[143-317] or 1 uM OPG[22-194]-Fc in 0.4%
MPBS, pH 8.0 or pH 7.4, respectively.
Eluted phage (binders) were titered on E. coli strain TG1 (Pharmacia, Piscataway, NJ.). Titering was performed in duplicate by a modification of the "Track-Dilution" method (Huycke et al. BioTechniques 23, 648-650 (1997)) by 10 l phage dilution in 2xTY broth into 90 ul log phase (A600 0.2 to 1.0 ODs)TG1 cells, mixed and incubated 20-30 minutes at room temperature. Ten gl were streaked horizontally in a lane, 6 lanes per 2xTY-AG square petri dish (2xTY broth, containing 2%
glucose, 100 gl /ml ampicillin and 15 g/liter agar), and incubated overnight at 37 C.
The eluted phage (binders) were amplified through bacterial infection in TG1 cells. Twenty-five ml of 2xTY broth were inoculated with E. coli TG1 cells and grown at 30 C for more than 12 h, 270 rpm. The overnight culture was inoculated 1:100 in 50 ml of 2xTY
broth, and grown -1.5 hr, 270 rpm to an OD600 of 0.5.
For amplification of selected phage, 5 volumes of exponential E. coli TG1 cells were added, 4 volumes of 2xTY broth and 1 volume of eluted (neutralized) phage together and incubated in a waterbath at 37 C for 30 min. To reduce the volume for plating the cells were centrifuged at 4,000 rpm and the pellet was resuspended in 2x TY-AG broth (100 ug/ml ampicillin, 2% glucose).
In the first round of selection, the sample was plated onto two to four 16 cmz 2x TY-AG plates (2xTY broth, containing 2% glucose, 100 ug/ml ampicillin and 15 g agar) to maintain diversity. For later rounds of selection, one plate was sufficient. The plates were incubated overnight at 30 C. After overnight growth, 5 mis of 2xTY-AG was added to each large plate, and bacteria were scraped loose with a sterile spreader.
After complete resuspension and concentration by spinning down at 4,000 rpm, 10 min, a concentrated sample was transferred to a Nunc Cryotube. Sterile glycerol was added to 15% final concentration and immediately stored at -70 C.
Amplified cells were resuspended in 2x TY-AG
broth to -0.1 OD and grown for 1.5-2.5 h at 37 C, 270 rpm, to an OD600 of 0.5 and transferred (5 ml) to a 50-ml Falcon tube containing an appropriate amount of M13KO7 helper phage (Gibco BRL Products, Grand Island, NY), with a 20 to 1 ratio of phage to bacteria. The mixture of phage and bacteria were incubated at 37 C
for 30 min without agitation followed by centrifugation for 15 min, 3,700 rpm. The supernatant was removed and the bacterial pellet was resuspended in 25 ml of 2xTY-AK (100 ug/ml ampicillin, 25 ug/ml kanamycin) and transferred to a 250 ml flask for overnight incubation at 30 C with shaking at 270 rpm. Next day, the culture was centrifuged in a 50-ml Falcon tube for 20 min at 3,700 rpm to pellet the bacteria. To the supernatant, 1/5th of the volume of a polyethylene glycol (PEG) solution (20% PEG 8000, 2.5M NaCl) was added and kept on ice for at least 1 hr. Phage were pelleted 20 min, 3,700 rpm at 4 C. Supernatant was discarded and the pellet was resuspend in -1.0 ml sterile PBS and transferred to a 1.5 ml eppendorf tube. The sample was microcentrifuged 2 min. -14,000 rpm to remove the remaining bacteria and the supernatant was transferred to a new tube. The PEG precipitation was repeated. The concentrated PEG precipitated phage were used in selection or screening assays. The standard yield was about 1-5 x 1013 phage from a 25 ml culture. For longer storage, glycerol was added to the phage (15% final concentration) and the phage were stored at -70 C.
This procedure describes one round of screening, comprising the steps of binding, elution and amplification. Typically, three to five rounds of screening were performed in order to obtain an eluted phage pool which bound OPGbp [143-317] in an ELISA
assay at a level at least four fold over background.
After screening was completed, the final eluted phage were plated for individual colonies and the inserted DNA analyzed by colony PCR and BstNI digestion as described below.
reaction was complete, 2.5 to 4.0 gl were run on 25-well 1% agarose gels with 0.5 Al/ml ethidium bromide, using DNA molecular weight standards (Gibco BRL
Products, Grand Island, NY, or Stratagene, La Jolla, CA) for 90 min at 90 volts. Only full-length inserts of greater than 1.6 kb were considered.
A 16 gl aliquot of the PCR reactions was BstNI digested 3 hours at 60 C with a 30 /tl total digestion mixture containing 10 gl water, 3 gl of lOX
REact*Buffer 2 (GIBCO BRL Products), 0.3 gl BSA (10 mg/ml), 0.7 Al BstNI (GIBCO; 10,000 units/ml).
Digested samples were run on a 25-well 3% agarose gels for 3.5 hours at 80 volts.
RAW cell assay Varying concentrations of Fab test samples were mixed with a constant amount of human OPGbp[143-317]
and incubated for at least one hour at room temperature in DMEM, 10% fetal bovine serum and lx glutamine-penicillin-streptomycin mixture. The concentrations of Fab samples and OPGbp are indicated for each experiment. After incubation, the mixture was added to 2 x 104 RAW 264.7 cells/well (American Type Culture Collection, Manassas, VA, Accession No. TIB-71) in a 96 well flat bottom tissue culture plate. RAW cells were cultured in DMEM with 10% fetal bovine serum and lx glutamine-penicillin-streptomycin. After three days at 37 C and 5%C02, the media was aspirated from the wells and the cells were stained for Tartrate Resistant Acid Phosphatase (TRAP), an osteoclast differentiation marker, by addition of 100 gl per well of 0.1M citrate buffer with 0.1% Triton* X-100, incubation for five minutes at room temperature, addition of para-* Trademark nitrophenylphosphate (pNPP) substrate and tartrate in citrate buffer containing Triton X-100 (substrate concentration was 20 mM pNPP and 335 mM tartrate) and incubation for an additional five minutes at room temperature. The reaction was stopped by addition of NaOH to a concentration of 0.05M. Acid phosphatase converts the pNPP substrate to para-nitrophenol which is detected by absorbance at 405 nm. The change in absorbance at 405 nm was plotted as a function log dose for both controls and test samples. An analysis of Variance (ANOVA) and relative potency with 95%
confidence limits was calculated. Positive controls included varying concentrations of OPG[22-194]-Fc fusion protein or an anti-OPGbp polyclonal antibody preparation preincubated with OPGbp[143-317] and incubated with RAW264.7 cells as described above.
Bone Marrow Assay A murine bone marrow assay for osteoclast formation was carried out essentially as described in Lacey et al. (Cell 93, 165-176 (1998)) and Kong et al.
(Nature 397, 315-323 (1999)). Briefly, the assay is a modification of the murine bone marrow coculture assay described in PCT W097/23614 in which non-adherent murine bone marrow cells were cultured in media for about seven days in the presence of human OPGbp (143-317) but without addition of the stromal cell line ST2, 1,25(OH)2 vitamin D3 and dexamethsone. Cells having an osteoclast phenotype were detected by the appearance of TRAP-positive cells. TRAP activity was measured in solution or by histochemical staining.
For detection of TRAP activity in solution, adult bone marrow cells were lysed in 100 mM Citrate Buffer (Sigma, Cat # 91-5) + 0.1% Triton X-100, pH 5.0, 3-5 min. 20 mM pNPP, 80 mM Tartrate, and 100 mM
Citrate + 0.1% Triton X-100, pH 5.0 were added and incubated at RT, 3-5 min, and measured at 405 nm after stopping the reaction with 50 gl of 500 mM NaOH /well.
A positive response was a concentration dependent decrease in absorbance at 405 nm from -2.0 OD to -0.6 OD.
For histochemical staining, cells were fixed in a formaldehyde-based fixative solution, then stained with Fast Garnet GBC (2-methyl-4-[(2-methylphenyl)-azo]benzenediazonium) solution + Naphthol AS-BI
(C18H15BrNO6P) phosphate solution + Acetate Solution +
Tartrate Solution, incubated 1 hour at 37oC, then rinsed, dried, and evaluated microscopically. A cell that was TRAP positive and contained three or more nuclei (TRAP-positive MITC) was considered an osteoclastic cell.
Example 2 Screening of a Human Fab library A library of about 4 x1010 unique human Fab fragments prepared in bacteriophage M13 was obtained from Target Quest, NV (Amsterdam, Netherlands).
General procedures for construction and screening human Fab libraries were described in de Haard et al.
(Advanced Drug Delivery Reviews 31, 5-31 (1998); J.
Biol. Chem. 274, 18218-18230 (1999)). The library was screened for Fab fragments which bind to OPGbp[143-317]
by the following procedures.
Solid phase direct plating OPGbp [143-317] prepared as described above was immobilized on a solid phase using Nunc Maxisorb immunotubes (12 x 75mm, 5ml capacity) by directly plating on the solid phase at a protein concentration of 1.5 g/ml in TBS, pH 8.0 (TBS was Tris buffered saline: 10 MM Tris (pH 7.5), 150 mM NaCl) at room temperature for 2 hours. These conditions permitted 80% of maximum plating of the solid phase at 2 hours (maximum at 2 hours was still nonsaturating) while retaining binding capabilities to OPG [22-194]-Fc.
After the 2 hour incubation, the tube was washed three times with PBS. The plated target was blocked by filling the immunotube with 2% nonfat dry milk, (Marvel or Carnation) in PBS (MPBS) for 1 to 4 hours at room temperature, washed two times each in PBS-Tween 20 (0.1%) and PBS. The PEG-concentrated phage (approximately 1013) were pre-blocked in 2% MPBS to adsorb milk binding phage prior to exposure of the phage to the solid phase target. The pre-blocked phage were incubated in 4 ml with the plated target at room temperature for 2 h, (30 min rotating end-over-end and 90 min standing). The contents bound to the tube were washed 20 times with PBS-Tween 20 (0.1%) and 20 times with PBS to remove unbound phage and to reduce nonspecific binding. Phage were eluted from the solid phase by a ten minute total phage elution with 1 ml of 100 mM triethylamine (TEA) pH 12, rotating the tube end-to-end, followed by neutralization with 0.5 ml of 1 M Tris-HC1 pH 7.4. Alternatively, specific phage binders were recovered by elution with 1 ml of either 1 uM OPGbp[143-317] or 1 uM OPG[22-194]-Fc in 0.4%
MPBS, pH 8.0 or pH 7.4, respectively.
Eluted phage (binders) were titered on E. coli strain TG1 (Pharmacia, Piscataway, NJ.). Titering was performed in duplicate by a modification of the "Track-Dilution" method (Huycke et al. BioTechniques 23, 648-650 (1997)) by 10 l phage dilution in 2xTY broth into 90 ul log phase (A600 0.2 to 1.0 ODs)TG1 cells, mixed and incubated 20-30 minutes at room temperature. Ten gl were streaked horizontally in a lane, 6 lanes per 2xTY-AG square petri dish (2xTY broth, containing 2%
glucose, 100 gl /ml ampicillin and 15 g/liter agar), and incubated overnight at 37 C.
The eluted phage (binders) were amplified through bacterial infection in TG1 cells. Twenty-five ml of 2xTY broth were inoculated with E. coli TG1 cells and grown at 30 C for more than 12 h, 270 rpm. The overnight culture was inoculated 1:100 in 50 ml of 2xTY
broth, and grown -1.5 hr, 270 rpm to an OD600 of 0.5.
For amplification of selected phage, 5 volumes of exponential E. coli TG1 cells were added, 4 volumes of 2xTY broth and 1 volume of eluted (neutralized) phage together and incubated in a waterbath at 37 C for 30 min. To reduce the volume for plating the cells were centrifuged at 4,000 rpm and the pellet was resuspended in 2x TY-AG broth (100 ug/ml ampicillin, 2% glucose).
In the first round of selection, the sample was plated onto two to four 16 cmz 2x TY-AG plates (2xTY broth, containing 2% glucose, 100 ug/ml ampicillin and 15 g agar) to maintain diversity. For later rounds of selection, one plate was sufficient. The plates were incubated overnight at 30 C. After overnight growth, 5 mis of 2xTY-AG was added to each large plate, and bacteria were scraped loose with a sterile spreader.
After complete resuspension and concentration by spinning down at 4,000 rpm, 10 min, a concentrated sample was transferred to a Nunc Cryotube. Sterile glycerol was added to 15% final concentration and immediately stored at -70 C.
Amplified cells were resuspended in 2x TY-AG
broth to -0.1 OD and grown for 1.5-2.5 h at 37 C, 270 rpm, to an OD600 of 0.5 and transferred (5 ml) to a 50-ml Falcon tube containing an appropriate amount of M13KO7 helper phage (Gibco BRL Products, Grand Island, NY), with a 20 to 1 ratio of phage to bacteria. The mixture of phage and bacteria were incubated at 37 C
for 30 min without agitation followed by centrifugation for 15 min, 3,700 rpm. The supernatant was removed and the bacterial pellet was resuspended in 25 ml of 2xTY-AK (100 ug/ml ampicillin, 25 ug/ml kanamycin) and transferred to a 250 ml flask for overnight incubation at 30 C with shaking at 270 rpm. Next day, the culture was centrifuged in a 50-ml Falcon tube for 20 min at 3,700 rpm to pellet the bacteria. To the supernatant, 1/5th of the volume of a polyethylene glycol (PEG) solution (20% PEG 8000, 2.5M NaCl) was added and kept on ice for at least 1 hr. Phage were pelleted 20 min, 3,700 rpm at 4 C. Supernatant was discarded and the pellet was resuspend in -1.0 ml sterile PBS and transferred to a 1.5 ml eppendorf tube. The sample was microcentrifuged 2 min. -14,000 rpm to remove the remaining bacteria and the supernatant was transferred to a new tube. The PEG precipitation was repeated. The concentrated PEG precipitated phage were used in selection or screening assays. The standard yield was about 1-5 x 1013 phage from a 25 ml culture. For longer storage, glycerol was added to the phage (15% final concentration) and the phage were stored at -70 C.
This procedure describes one round of screening, comprising the steps of binding, elution and amplification. Typically, three to five rounds of screening were performed in order to obtain an eluted phage pool which bound OPGbp [143-317] in an ELISA
assay at a level at least four fold over background.
After screening was completed, the final eluted phage were plated for individual colonies and the inserted DNA analyzed by colony PCR and BstNI digestion as described below.
Solution Iohase Phage were preblocked for 60 min on a rotator at room temperature in 2% MPBS. Biotinylated OPGbp b-b' loop peptide (500 nM) was added directly into the equilibrated phage mix and incubated for 30 min to 1 hour on a rotator (end-over-end) at room temperature.
The loop peptide had the sequence [biotin(LC)-TDIPSGSHKVSLSSWYHDRG] (SEQ ID NO: 24) where the LC
(linear chain i . e . , (CH2) 5-NH2) ) was used to link the OPGbp b-b' loop sequence to biotin. Streptavidin-coated Dynabeads (100 Al per selection in 1.5 ml eppendorf tubes) were used for solution phase capture of biotinylated antigen-phage complexes (3X for negative and 1X for target antigen selection). Streptavidin-coated beads were pre-equilibrated by being drawn to the side of the tube using a Dynal magnet, buffer was removed and beads resuspended in 1 ml of 2% MPBS.
Equilibration at room temperature was for 1-2 h on an end-over-end rotator.
Three negative selections were performed in rounds 2 and 3. For negative selection preblocked phage were added to a tube of streptavidin coated Dynabeads pre-equilibrated in 2% MPBS and incubated for min on an end-over-end rotator at room temperature 25 (repeated two times). Beads were drawn to the side and unbound phage transferred into a fresh eppendorf tube to be used for antigen selection. Biotinylated huOPGbp b-b' loop peptide (500 nM) was added directly into the equilibrated phage mix and incubated for 30 min to 1 30 hour on an end-over-end rotator at RT. Equilibrated beads were drawn to the side of the tube, buffer was removed and resuspended with the phage-biotinylated peptide mix followed by incubation for 15 min on an end-over-end rotator at RT. Tubes were placed in a magnetic rack for 1 min, aspirated and beads were washed 6x with 1 ml of 2% MPBS-Tween-20 (0.1%), 6x with 1 ml of PBS-Tween-20 (0.1%), and 2x with 1 ml of PBS.
Phage were eluted with 1 ml of 100 MM TEA pH 12 for 5-min on a rotator at room temperature followed by neutralization with 0.5 ml of 1M Tris-HC1, pH 7.4.
Example 3 Identification of Fab clones which bind OPGbp 10 E. coli TG1 cells were infected with the phage pool from an ELISA responsive round and individual colonies were picked for PCR analysis.
Typically one to four plates of 96 colonies were picked for each selection. Fab cDNAs were amplified by PCR by a specific set of primers and analyzed on an agarose gel for Fab insert length. Fab insert lengths > 1.6 kb were full length. cDNAs were also digested with BstNI
restriction enzyme and the banding pattern analyzed by electorphoresis on agarose gels. Clones which exhibited identical size PCR full-length inserts and identical BstNI banding patterns in two or more isolates were candidates for further analysis. Using the above criteria, the following Fabs were identified.
Fab pattern "P" was identified after solution phase screening using three rounds of elution with triethylamine, pH 12, followed by solid phase screening as described above using one round of elution with 1 um OPGbp[143-317].
Fab pattern "S" was identified by solution phase screening using three rounds of elution with triethylamine, pH 12, followed by solid phase screening as described above using two rounds of elution with 1 uM OPG[22-194]-Fc.
Fab pattern "AT" was identified by solid phase screening as described above using four rounds of elution with 1 uM OPG[22-194]-Fc .
The loop peptide had the sequence [biotin(LC)-TDIPSGSHKVSLSSWYHDRG] (SEQ ID NO: 24) where the LC
(linear chain i . e . , (CH2) 5-NH2) ) was used to link the OPGbp b-b' loop sequence to biotin. Streptavidin-coated Dynabeads (100 Al per selection in 1.5 ml eppendorf tubes) were used for solution phase capture of biotinylated antigen-phage complexes (3X for negative and 1X for target antigen selection). Streptavidin-coated beads were pre-equilibrated by being drawn to the side of the tube using a Dynal magnet, buffer was removed and beads resuspended in 1 ml of 2% MPBS.
Equilibration at room temperature was for 1-2 h on an end-over-end rotator.
Three negative selections were performed in rounds 2 and 3. For negative selection preblocked phage were added to a tube of streptavidin coated Dynabeads pre-equilibrated in 2% MPBS and incubated for min on an end-over-end rotator at room temperature 25 (repeated two times). Beads were drawn to the side and unbound phage transferred into a fresh eppendorf tube to be used for antigen selection. Biotinylated huOPGbp b-b' loop peptide (500 nM) was added directly into the equilibrated phage mix and incubated for 30 min to 1 30 hour on an end-over-end rotator at RT. Equilibrated beads were drawn to the side of the tube, buffer was removed and resuspended with the phage-biotinylated peptide mix followed by incubation for 15 min on an end-over-end rotator at RT. Tubes were placed in a magnetic rack for 1 min, aspirated and beads were washed 6x with 1 ml of 2% MPBS-Tween-20 (0.1%), 6x with 1 ml of PBS-Tween-20 (0.1%), and 2x with 1 ml of PBS.
Phage were eluted with 1 ml of 100 MM TEA pH 12 for 5-min on a rotator at room temperature followed by neutralization with 0.5 ml of 1M Tris-HC1, pH 7.4.
Example 3 Identification of Fab clones which bind OPGbp 10 E. coli TG1 cells were infected with the phage pool from an ELISA responsive round and individual colonies were picked for PCR analysis.
Typically one to four plates of 96 colonies were picked for each selection. Fab cDNAs were amplified by PCR by a specific set of primers and analyzed on an agarose gel for Fab insert length. Fab insert lengths > 1.6 kb were full length. cDNAs were also digested with BstNI
restriction enzyme and the banding pattern analyzed by electorphoresis on agarose gels. Clones which exhibited identical size PCR full-length inserts and identical BstNI banding patterns in two or more isolates were candidates for further analysis. Using the above criteria, the following Fabs were identified.
Fab pattern "P" was identified after solution phase screening using three rounds of elution with triethylamine, pH 12, followed by solid phase screening as described above using one round of elution with 1 um OPGbp[143-317].
Fab pattern "S" was identified by solution phase screening using three rounds of elution with triethylamine, pH 12, followed by solid phase screening as described above using two rounds of elution with 1 uM OPG[22-194]-Fc.
Fab pattern "AT" was identified by solid phase screening as described above using four rounds of elution with 1 uM OPG[22-194]-Fc .
Fab pattern "Y" was identified by solid phase screening as described above using three rounds of elution with OPGbp[143-317].
Phage were prepared from individual colonies exhibiting Fab AT, Y, P and S patterns by the following procedure. Plasmid preparations were made and transformed into TG1 cells. PCR analysis confirmed the transformation of a full length insert. The cells were grown in either a deep well block (0.5 ml volume) or as a 10 ml culture. Phage were rescued by a 20:1 ratio of M13KO7 helper phage/cells infection, PEG precipitated 1 time (as in the solid phase direct plating protocol) and resuspended in - 200 ul from a 2-ml well sized deep well block or -500 ul from the 10 ml culture in PBS.
Phage titers were in the range of 1011-1014 phage/ml into the ELISA. Titrations based on volume using a maximum of 50 l/well additions were performed giving a typical range 109-1011 phage/well in an ELISA.
Phage ELISA was performed as previously described. The ELISA uses anti-M13-HRP conjugate for detection of bound phage with ABTS, a colorimetric substrate at 405 nm. Anti-M13 HRP conjugate was specific for the major coat protein VIII on the phage. Values were from single point determinations.
Results of an ELISA of a representative clone from each of the major patterns "AT", "Y", "P" and "S"
was shown in Figure 1. All four Fab clones demonstrated significant reactivity with OPGbp[143-317]. All clone members from patterns "AT" and "Y" (27 members from 672 clones and 9 members from 96 clones, respectively) were sequenced found identical within their patterns. Therefore any pattern member will be representative of the entire pattern for patterns "AT"
and "Y".
Phage were prepared from individual colonies exhibiting Fab AT, Y, P and S patterns by the following procedure. Plasmid preparations were made and transformed into TG1 cells. PCR analysis confirmed the transformation of a full length insert. The cells were grown in either a deep well block (0.5 ml volume) or as a 10 ml culture. Phage were rescued by a 20:1 ratio of M13KO7 helper phage/cells infection, PEG precipitated 1 time (as in the solid phase direct plating protocol) and resuspended in - 200 ul from a 2-ml well sized deep well block or -500 ul from the 10 ml culture in PBS.
Phage titers were in the range of 1011-1014 phage/ml into the ELISA. Titrations based on volume using a maximum of 50 l/well additions were performed giving a typical range 109-1011 phage/well in an ELISA.
Phage ELISA was performed as previously described. The ELISA uses anti-M13-HRP conjugate for detection of bound phage with ABTS, a colorimetric substrate at 405 nm. Anti-M13 HRP conjugate was specific for the major coat protein VIII on the phage. Values were from single point determinations.
Results of an ELISA of a representative clone from each of the major patterns "AT", "Y", "P" and "S"
was shown in Figure 1. All four Fab clones demonstrated significant reactivity with OPGbp[143-317]. All clone members from patterns "AT" and "Y" (27 members from 672 clones and 9 members from 96 clones, respectively) were sequenced found identical within their patterns. Therefore any pattern member will be representative of the entire pattern for patterns "AT"
and "Y".
Patterns "Q" (3 members from 96 clones), "X" (3 members from 96 clones) and "AB" (2 members from 96 clones) were also ELISA positive to plated OPGbp[143-317] as determined by a representative clone (Figure 1). Since the ELISA signals were considerably lower than patterns "AT", "Y", "P", and "S", and represented by only two to three members in 96 clones, they were assumed to have Kds in the AM range and were not analyzed further. Pattern "X" was only ELISA positive when the concentration of Tween-20 in the washes was reduced from 0.1% to 0.01%.
Example 4 Purification of soluble Fabs Phage containing Fabs "AT", "Y", "P" and "S"
were infected into E. coli HB2151 (Pharmacia, Piscataway, NJ) and expression of Fab fragments was induced by addition of IPTG to 1 mM generally for at least 5 h, except that for pattern Y the IPTG levels were reduced to 0.25 mM. After induction, the cells (750 ml) were harvested by centrifugation and Fabs were released from the periplasmic space by osmotic shock.
The total pellet was resuspended in 8 ml of ice cold TES (0.2 M Tris , 0.5 mM EDTA, 17.1 % sucrose, pH 8.0), transferred to a 50 ml tube and incubated for 5 to 10 min on ice with occasional gentle shaking.
Meanwhile, the empty tubes were washed with 8.8 ml TES/H20 (1:3) to recover the remaining cell pellet and added to the other cells and incubated another 20 min on ice. Cells were centrifuged at 14,000 rpm for 3 min and supernatant transferred from the slightly sloppy cell pellet to another 50-ml tube. The supernatant was again centrifuged at 14,000 rpm for 10 min at 4 C to remove residual cell contamination. The supernatant was referred to as the TES-released periplasmic fraction. The bacterial pellet was resuspended in 10 ml TES plus 15 mm MgSO4, incubated on ice for 15 min and centrifuged twice as above. The supernatant was referred to as the Mg-released periplasmic fraction. Bovine serum albumin (BSA; RIA
grade, Sigma) was added as a carrier and stabilizer to each periplasmic fraction to a final concentration of 1 mg/ml and dialyzed overnight at 4 C in 2 L with 1 exchange of Talon columm buffer (20 mM Tris-HC1/0.1 M
NaCl, pH 8.5) plus protease inhibitors at the final concentrations, Pefabloc*0.05 mg/ml, leupeptin 50 nM, aprotinin 0.06 g/ml and pepstatin A 0.9 g/ml.
The Fab-containing periplasmic extracts (TES
and Mg-released) were subjected separately to batch method binding 1 h rocking at 4C with 0.8 ml to 1.5 ml (1/20 th the extract volume) preequilibrated Talon* resin (Clontech), then batch method washing in at least 2Xs column volumes of column buffer. The Talon resin was 20 column packed, washed with 10 column volumes of column.
buffer, and 2 column volumes of column buffer plus 50 mM imidazole to release nonspecifically bound proteins.
Purified Fabs were eluted with 2 to 3 column volumes of 200 mM imidazole, 4% glycerol. Purified extracts were then concentrated/exchanged in a Centricon*l0 (Amicon, Inc. Beverly, MA) into PBS, pH 7.4 to a final concentration of 0.5 to 5 mg/ml. Purity of soluble Fab "AT' was determined on a Novex (San Diego, CA) 10% Bis Tris NuPAGE*Gel with NuPAGE*MOPS SDS Running Buffer (Nonreducing) and 4X LDS Sample Buffer (pH 8.45).
Purified Fab samples containing the LDS Sample Buffer were heated at 70 C for 10 min and loaded 40 ul/lane.
The gel was run at 200 volts, 20 min, then reduced to 50 volts -1.5 h, stained with Novex Colloidal Coomassie * Trademark Blue Stain -14 h, and destained. Soluble Fab "AT" was determined to have greater than 98% purity.
Example 5 Activity of purified anti-OPGbp Fabs The activity of purified soluble Fabs "AT" and "Y" was analyzed by the following assays.
OPGbp/ODAR interaction inhibition assay The interaction of human OPGbp [143-317] and its receptor ODAR was measured in a fluorescence energy transfer (FRET) assay. A 1 hour preincubation with OPGbp was added for increased sensitivity. A soluble extracellular domain of human ODAR was constructed as a fusion polypeptide with an amino terminal FLAG tag and a carboxy terminal human Fc region. The Fc region is recognized and bound by a polyclonal goat anti-human Fc specific allophycocyanin (APC) which is detected by absorbance at 665 nm. OPGbp [143-317] was labeled with Eu2+ which is detected by absorbance at 620 nm.
Binding of OPGbp to ODAR in this assay triggers a fluorescent energy transfer and is highly sensitive for competition curves. A decrease in the A665/A620 absorbance ratio indicates inhibition of OPGbp binding to ODAR.
A concentration dependent inhibition of OPGbp-Eu binding to sODAR-Fc was observed for duplicate preparations of soluble Fabs "AT" and "Y". Soluble Fab "AT" (preparation A) inhibited OPGbp binding to soluble ODAR-Fc fusion with an IC50 of 550 nM. Soluble Fab "Y"
inhibited with an IC50 of 6 M. The Fab "AT" clone 1B5 was from the predominant 27 member pattern from seven 96-well plates (all with same amino acid sequence) obtained by elution from OPGbp target using a solution of 1 M OPG[22-194]-Fc for 90 min. The Fab 'Y' clone 1B4. was from the predominant 9 member pattern from one .96-well plate (all with same amino acid sequence) from the optimized plated OPGbp screen using a 1 M OPGbp elution for 90min. A second purification of Fab"AT', clone 6F11, (designated preparation B) yielded a similar IC50 of 440nM for PBS and IC50 of 354nM for TBS. A second purification of Fab "Y' (preparation B) yielded a similar IC50 of 4.1 gM for TBS. The positive control was OPGbp[143-317] in TBS or PBS with corresponding IC50s of 0.89 and 0.93 nM, respectively.
Similar IC50's were obtained with the duplicate preparations "A" and W. Results of preparation "B"
of Fabs "AT" and "Y" in TBS are shown in figure 2.
Bone Marrow assay Soluble Fabs "AT' "Y' and "P' were purified as in Example 4 followed by two sequential endotoxin removal steps using a Polymyxin*affinity column (-1 ml; BioRad, Hercules, CA) in PBS at room temperature according to the manufacturers instructions except as follows. To increase the probability of removing endotoxin bound to the Fab, after sample addition, a 100 gl to 150 Al aliquot was recycled from the bottom to the top of the column every 5 min for 2 to 2.5 hours. Fab was eluted with 3 column volumes of PBS
with 4% glycerol.
-The samples were tested for endotoxin using E-Toxate*(Limulus Amebocyte Lysate) detection system (Sigma, St. Louis, MO) according to manufacturer's instructions. The samples were then filter sterilized (0.2 m). Fab "P' was denatured after purification and bound poorly to OPGbp [143-317] in an ELISA. It was used as a negative control in these experiments.
* Trademark The assay format includes a 1 hour pre-incubation of the anti-OPGbp Fab with 10 ng/ml of human OPGbp [143-317] (final cell well concentration). TRAP
assays were carried out in solution using pNPP
chromogenic substrate. The results are shown in Figure 3. Fab "AT" gave a 50% decrease (IC50) at 57.8 nM; Fab "Y" gave a 50% decrease at 212 nM; Fab "P" gave a 50%
decrease at 1.5 AM. An estimated Fab molecular weight of 50,000 was used in these calculations to give a conversion factor of 1 g/ml = 20 nM.
The IC50's as determined by TRAP histochemical staining were similar to those above as determined in the pNPP assay.
RAW Cell Assay The effects of adding soluble Fabs "AT", "Y"
and "P" to the RAW cell assay are shown in Figure 4.
The 50% point for the graph was taken as 1.65 OD405 nm.
Fab "AT" has an IC50 of 15 gg/ml, 300 nM (assuming a Fab molecular weight of 50,000). Fab "Y" has a decrease in signal to 2.15 OD405 from 2.5 OD405, an 80% point. By extrapolation, a 50% point OD405 of 1.65 for Fab "Y"
would be reached at - 400 g/ml x 20 = -8 AM. "P" does not show any detectable reactivity in the assay.
Example 6 Sequencing and Analysis of Fab clones The DNA and predicted amino acid sequences for the light chains of Fabs "AT", "Y", "P" and "S" were shown in Figures 5, 6, 7, and 8 respectively. The DNA
and predicted amino acid sequences for the heavy chains of Fabs "AT", "Y", "P" and "S" were shown in Figures 9, 10, 11, and 12, respectively. Figure 13 shows an amino acid sequence comparison matrix of the heavy and light chains respectively of the four predominant Fab pattern clones based on identity and similarity. Identity and similarity were obtained by either the GCG program or calculated by hand. The heavy chain sequences of Fabs "AT" and "Y" has the closest match as they differed by a single amino acid (conservative change) and thus had an identity of 99.6% and a similarity of 100%. The light chain amino acid sequences were compared among the top four patterns for both identity and similarity to each other. Fabs "AT", "Y" and "P" showed an identity of at least 85% and a'similarity of at least 89%. Pattern "S" was the most dissimilar being of the rarer V lambda family.
A comparison of the amino acid sequences of the complementary determining regions (CDRs) was shown in Figure 14. Fabs "AT" and "Y" had identical heavy chain amino acid sequences in CDR1, CDR2 and CDR3. The heavy chain CDR1 of Fabs "P" and "S" each had 3 amino acid residues identical to the "AT" and "Y" CDR1 sequence.
The CDR2 sequence of "P" and "S" showed greater identity to each other than to the "AT" and "Y" CDR2 sequence. The light chains of Fabs "AT" and "Y" were showed identical lengths of CDR1, CDR2 and CDR3.
Patterns "AT" and "Y" light chain CDRs 1 and 3 showed identity in 7 of 11 residues (64%) and 3 of 5 residues (60%), respectively. Although patterns "AT" and "Y"
light chain CDR2 show no identity to each other, each contain part of the consensus sequence for light chain CDR2. When the first 4 residues of pattern "AT" were combined with the last 3 residues of pattern "Y", the light chain CDR2 of pattern "P" was obtained. The light chain CDR3 can vary in length from 5 to 25 residues.
Therefore, the light chain CDR3s obtained in patterns "AT", "Y" and "P" were very short. The most unique of the four predominant pattern clones was Fab "S."
Example 4 Purification of soluble Fabs Phage containing Fabs "AT", "Y", "P" and "S"
were infected into E. coli HB2151 (Pharmacia, Piscataway, NJ) and expression of Fab fragments was induced by addition of IPTG to 1 mM generally for at least 5 h, except that for pattern Y the IPTG levels were reduced to 0.25 mM. After induction, the cells (750 ml) were harvested by centrifugation and Fabs were released from the periplasmic space by osmotic shock.
The total pellet was resuspended in 8 ml of ice cold TES (0.2 M Tris , 0.5 mM EDTA, 17.1 % sucrose, pH 8.0), transferred to a 50 ml tube and incubated for 5 to 10 min on ice with occasional gentle shaking.
Meanwhile, the empty tubes were washed with 8.8 ml TES/H20 (1:3) to recover the remaining cell pellet and added to the other cells and incubated another 20 min on ice. Cells were centrifuged at 14,000 rpm for 3 min and supernatant transferred from the slightly sloppy cell pellet to another 50-ml tube. The supernatant was again centrifuged at 14,000 rpm for 10 min at 4 C to remove residual cell contamination. The supernatant was referred to as the TES-released periplasmic fraction. The bacterial pellet was resuspended in 10 ml TES plus 15 mm MgSO4, incubated on ice for 15 min and centrifuged twice as above. The supernatant was referred to as the Mg-released periplasmic fraction. Bovine serum albumin (BSA; RIA
grade, Sigma) was added as a carrier and stabilizer to each periplasmic fraction to a final concentration of 1 mg/ml and dialyzed overnight at 4 C in 2 L with 1 exchange of Talon columm buffer (20 mM Tris-HC1/0.1 M
NaCl, pH 8.5) plus protease inhibitors at the final concentrations, Pefabloc*0.05 mg/ml, leupeptin 50 nM, aprotinin 0.06 g/ml and pepstatin A 0.9 g/ml.
The Fab-containing periplasmic extracts (TES
and Mg-released) were subjected separately to batch method binding 1 h rocking at 4C with 0.8 ml to 1.5 ml (1/20 th the extract volume) preequilibrated Talon* resin (Clontech), then batch method washing in at least 2Xs column volumes of column buffer. The Talon resin was 20 column packed, washed with 10 column volumes of column.
buffer, and 2 column volumes of column buffer plus 50 mM imidazole to release nonspecifically bound proteins.
Purified Fabs were eluted with 2 to 3 column volumes of 200 mM imidazole, 4% glycerol. Purified extracts were then concentrated/exchanged in a Centricon*l0 (Amicon, Inc. Beverly, MA) into PBS, pH 7.4 to a final concentration of 0.5 to 5 mg/ml. Purity of soluble Fab "AT' was determined on a Novex (San Diego, CA) 10% Bis Tris NuPAGE*Gel with NuPAGE*MOPS SDS Running Buffer (Nonreducing) and 4X LDS Sample Buffer (pH 8.45).
Purified Fab samples containing the LDS Sample Buffer were heated at 70 C for 10 min and loaded 40 ul/lane.
The gel was run at 200 volts, 20 min, then reduced to 50 volts -1.5 h, stained with Novex Colloidal Coomassie * Trademark Blue Stain -14 h, and destained. Soluble Fab "AT" was determined to have greater than 98% purity.
Example 5 Activity of purified anti-OPGbp Fabs The activity of purified soluble Fabs "AT" and "Y" was analyzed by the following assays.
OPGbp/ODAR interaction inhibition assay The interaction of human OPGbp [143-317] and its receptor ODAR was measured in a fluorescence energy transfer (FRET) assay. A 1 hour preincubation with OPGbp was added for increased sensitivity. A soluble extracellular domain of human ODAR was constructed as a fusion polypeptide with an amino terminal FLAG tag and a carboxy terminal human Fc region. The Fc region is recognized and bound by a polyclonal goat anti-human Fc specific allophycocyanin (APC) which is detected by absorbance at 665 nm. OPGbp [143-317] was labeled with Eu2+ which is detected by absorbance at 620 nm.
Binding of OPGbp to ODAR in this assay triggers a fluorescent energy transfer and is highly sensitive for competition curves. A decrease in the A665/A620 absorbance ratio indicates inhibition of OPGbp binding to ODAR.
A concentration dependent inhibition of OPGbp-Eu binding to sODAR-Fc was observed for duplicate preparations of soluble Fabs "AT" and "Y". Soluble Fab "AT" (preparation A) inhibited OPGbp binding to soluble ODAR-Fc fusion with an IC50 of 550 nM. Soluble Fab "Y"
inhibited with an IC50 of 6 M. The Fab "AT" clone 1B5 was from the predominant 27 member pattern from seven 96-well plates (all with same amino acid sequence) obtained by elution from OPGbp target using a solution of 1 M OPG[22-194]-Fc for 90 min. The Fab 'Y' clone 1B4. was from the predominant 9 member pattern from one .96-well plate (all with same amino acid sequence) from the optimized plated OPGbp screen using a 1 M OPGbp elution for 90min. A second purification of Fab"AT', clone 6F11, (designated preparation B) yielded a similar IC50 of 440nM for PBS and IC50 of 354nM for TBS. A second purification of Fab "Y' (preparation B) yielded a similar IC50 of 4.1 gM for TBS. The positive control was OPGbp[143-317] in TBS or PBS with corresponding IC50s of 0.89 and 0.93 nM, respectively.
Similar IC50's were obtained with the duplicate preparations "A" and W. Results of preparation "B"
of Fabs "AT" and "Y" in TBS are shown in figure 2.
Bone Marrow assay Soluble Fabs "AT' "Y' and "P' were purified as in Example 4 followed by two sequential endotoxin removal steps using a Polymyxin*affinity column (-1 ml; BioRad, Hercules, CA) in PBS at room temperature according to the manufacturers instructions except as follows. To increase the probability of removing endotoxin bound to the Fab, after sample addition, a 100 gl to 150 Al aliquot was recycled from the bottom to the top of the column every 5 min for 2 to 2.5 hours. Fab was eluted with 3 column volumes of PBS
with 4% glycerol.
-The samples were tested for endotoxin using E-Toxate*(Limulus Amebocyte Lysate) detection system (Sigma, St. Louis, MO) according to manufacturer's instructions. The samples were then filter sterilized (0.2 m). Fab "P' was denatured after purification and bound poorly to OPGbp [143-317] in an ELISA. It was used as a negative control in these experiments.
* Trademark The assay format includes a 1 hour pre-incubation of the anti-OPGbp Fab with 10 ng/ml of human OPGbp [143-317] (final cell well concentration). TRAP
assays were carried out in solution using pNPP
chromogenic substrate. The results are shown in Figure 3. Fab "AT" gave a 50% decrease (IC50) at 57.8 nM; Fab "Y" gave a 50% decrease at 212 nM; Fab "P" gave a 50%
decrease at 1.5 AM. An estimated Fab molecular weight of 50,000 was used in these calculations to give a conversion factor of 1 g/ml = 20 nM.
The IC50's as determined by TRAP histochemical staining were similar to those above as determined in the pNPP assay.
RAW Cell Assay The effects of adding soluble Fabs "AT", "Y"
and "P" to the RAW cell assay are shown in Figure 4.
The 50% point for the graph was taken as 1.65 OD405 nm.
Fab "AT" has an IC50 of 15 gg/ml, 300 nM (assuming a Fab molecular weight of 50,000). Fab "Y" has a decrease in signal to 2.15 OD405 from 2.5 OD405, an 80% point. By extrapolation, a 50% point OD405 of 1.65 for Fab "Y"
would be reached at - 400 g/ml x 20 = -8 AM. "P" does not show any detectable reactivity in the assay.
Example 6 Sequencing and Analysis of Fab clones The DNA and predicted amino acid sequences for the light chains of Fabs "AT", "Y", "P" and "S" were shown in Figures 5, 6, 7, and 8 respectively. The DNA
and predicted amino acid sequences for the heavy chains of Fabs "AT", "Y", "P" and "S" were shown in Figures 9, 10, 11, and 12, respectively. Figure 13 shows an amino acid sequence comparison matrix of the heavy and light chains respectively of the four predominant Fab pattern clones based on identity and similarity. Identity and similarity were obtained by either the GCG program or calculated by hand. The heavy chain sequences of Fabs "AT" and "Y" has the closest match as they differed by a single amino acid (conservative change) and thus had an identity of 99.6% and a similarity of 100%. The light chain amino acid sequences were compared among the top four patterns for both identity and similarity to each other. Fabs "AT", "Y" and "P" showed an identity of at least 85% and a'similarity of at least 89%. Pattern "S" was the most dissimilar being of the rarer V lambda family.
A comparison of the amino acid sequences of the complementary determining regions (CDRs) was shown in Figure 14. Fabs "AT" and "Y" had identical heavy chain amino acid sequences in CDR1, CDR2 and CDR3. The heavy chain CDR1 of Fabs "P" and "S" each had 3 amino acid residues identical to the "AT" and "Y" CDR1 sequence.
The CDR2 sequence of "P" and "S" showed greater identity to each other than to the "AT" and "Y" CDR2 sequence. The light chains of Fabs "AT" and "Y" were showed identical lengths of CDR1, CDR2 and CDR3.
Patterns "AT" and "Y" light chain CDRs 1 and 3 showed identity in 7 of 11 residues (64%) and 3 of 5 residues (60%), respectively. Although patterns "AT" and "Y"
light chain CDR2 show no identity to each other, each contain part of the consensus sequence for light chain CDR2. When the first 4 residues of pattern "AT" were combined with the last 3 residues of pattern "Y", the light chain CDR2 of pattern "P" was obtained. The light chain CDR3 can vary in length from 5 to 25 residues.
Therefore, the light chain CDR3s obtained in patterns "AT", "Y" and "P" were very short. The most unique of the four predominant pattern clones was Fab "S."
A comparison of the Fab classes represented in the four predominant patterns was shown in Figure 15. These results were obtained from V-Base DNA PLOT
Analysis. As expected Fabs "AT" and "Y" were of the same VH1 family (Variable Heavy 1 family) with the same VDJ regions (Variable, Diversity and Joining). Fabs "AT" and "Y" belong to different light chain families.
Fabs "P" and "S" belong to the same VH3 heavy chain family but different light chain families. All heavy chains have the same JH4b joining regions.
An alignment of the Fab sequences and the corresponding germ line sequences is shown in Figures 16-18 for the heavy chains and Figure 19-22 for the light chains. Changes in the heavy and light chains of "AT", "Y", "P" and "S" result from naturally occurring sometic matastis that arise in antibody germline sequences during an antibody response. Variable regions of the "AT" and "Y" heavy chains (the amino terminal 127 amino acids in Figures 9 and 10, respectively) had 17 and 18 amino acid changes, respectively, compared to the corresponding VDJ
germline sequences. The variable region of the "P"
heavy chain (the amino terminal 117 amino acids in Figure 11) has 16 amino acid changes compared to corresponding VDJ germline sequence. The variable region of the "S" heavy chain (the amino terminal 124 amino acids in Figure 12) had 14 amino acid changes compared to germline sequences. The variable region of the "AT" light chain (residues 6-108 in Figure 5) had 16 amino acid changes compared the corresponding Vi germline sequence,; the "Y" light chain (residues 6-108 in Figure 6) had 14 amino acid changes; the "P" light chain (residues 5-108 in Figure 7) had 14 amino acid changes; and the "S" light chain (residues 5-112 in Figure 8) had 12 amino acid changes. In general, amino acid differences in the occurred with the most frequency in the CDR3 regions of both heavy and light chains.
ale 7 Cloning and Expression of full-length human OPGbp antibodies Fab clones were converted to full-length antibodies by the following procedures.
Construction of iDSRa19:hCH
The plasmid pDSRa19:EPO was digested with HindIII and Sall to remove the coding region for erythropoietin. Plasmid pCRBluntCH1-3 containing the..
human IgG1 Cal, hinge, Cat and Ca3 domains inserted into the vector pCRBlunt*(Invitrogen) was used to obtain a 1.4 kb human IgG1 constant domain. pCRBluntCH1-3 was digested with Hindlll and Sal I and the constant domain sequences were inserted into pDRSa19 to generate pDSRal9:hCH.
Construction of gDSRa19:AT-VH21 Four anti-huOPGbp Fab heavy chain cDNAs were cloned into pDSRa19:hCH to convert the Fabs into full length IgGs. The construction of a plasmid encoding NATR heavy chain is described here. The other Fab heavy chains were cloned using similar procedures. To generate the Fab with a signal sequence, a three-step PCR was performed. First, primers 2249-25 and 2248-22 were used with the Fab cDNA template Conditions were: 94 C for 1 min, (95 C for 30 sec., 50 C for 1 min., 68 C for 1 min) for 20 cycles, 68 C for 10 min.
with Pfu polymerase and the appropriate buffer and * Trademark nucleotides. The PCR product was then amplified with primers 2209-21 and 2248-22 followed by amplification with primers 2209-20 and 2248-22. The final PCR
product was cleaned, cut with Hindlll and BsmBI, and gel purified. This fragment contains the Fab with a 5' Kozak (translational initiation) site and the following signal sequence for mammalian expression of Fab "AT"
heavy chain:
MEWSWVFLFFLSVTTGVHS (SEQ ID NO: 25) This signal sequence is designated the VH21 signal sequence.
The plasmid pDSRa19:hCH was digested with Hindlll and BamBI to remove the polylinker before the IgG CH1-3 domains and the Fab PCR product was inserted to generate pDSR(X19:AT-VH21.
Primers:
HindiII Kozak 2209-20 5'-CAGAAGCTTAGACCACC ATG GAA TGG AGC TGG GTC TTT CTC TTC T-3' (SEQ ID NOS: 26 & 27) M E W S W V F L F
2209-21 5'-G AGC TGG GTC TTT CTC TTC TTC CTG TCA GTA ACG ACT GGT GTC CA-3'(SEQ ID NOS: 28 & 29) S W V F L F F L S V T T G V
2249-25 5'-TCA GTA ACG ACT GGT GTC CAC TCA CAG GTC CAG CTG GTG CAG-3' (SEQ ID NOS: 30 & 31) S V T T G V H S Q V
Q L V Q
BsmBI
2248-22 5'-GTG GAG GCA CTA GAG ACG GTGACC AGG GTG-3' (SEQ ID NO: 32) Construction of pDSRa19:AT-L
Fabs "AT", "Y", "P" and "S" light chain cDNAs were cloned into pDSRa19 to convert the Fabs into full length antibodies. The construction of a plasmid encoding the "AT" light chain is described here. The other Fabs were cloned using similar procedures. To generate Fab "AT" with a signal sequence, a three-step PCR was performed. First, primers 2233-50 and 2233-51 were used with the Fab cDNA template. The PCR
Analysis. As expected Fabs "AT" and "Y" were of the same VH1 family (Variable Heavy 1 family) with the same VDJ regions (Variable, Diversity and Joining). Fabs "AT" and "Y" belong to different light chain families.
Fabs "P" and "S" belong to the same VH3 heavy chain family but different light chain families. All heavy chains have the same JH4b joining regions.
An alignment of the Fab sequences and the corresponding germ line sequences is shown in Figures 16-18 for the heavy chains and Figure 19-22 for the light chains. Changes in the heavy and light chains of "AT", "Y", "P" and "S" result from naturally occurring sometic matastis that arise in antibody germline sequences during an antibody response. Variable regions of the "AT" and "Y" heavy chains (the amino terminal 127 amino acids in Figures 9 and 10, respectively) had 17 and 18 amino acid changes, respectively, compared to the corresponding VDJ
germline sequences. The variable region of the "P"
heavy chain (the amino terminal 117 amino acids in Figure 11) has 16 amino acid changes compared to corresponding VDJ germline sequence. The variable region of the "S" heavy chain (the amino terminal 124 amino acids in Figure 12) had 14 amino acid changes compared to germline sequences. The variable region of the "AT" light chain (residues 6-108 in Figure 5) had 16 amino acid changes compared the corresponding Vi germline sequence,; the "Y" light chain (residues 6-108 in Figure 6) had 14 amino acid changes; the "P" light chain (residues 5-108 in Figure 7) had 14 amino acid changes; and the "S" light chain (residues 5-112 in Figure 8) had 12 amino acid changes. In general, amino acid differences in the occurred with the most frequency in the CDR3 regions of both heavy and light chains.
ale 7 Cloning and Expression of full-length human OPGbp antibodies Fab clones were converted to full-length antibodies by the following procedures.
Construction of iDSRa19:hCH
The plasmid pDSRa19:EPO was digested with HindIII and Sall to remove the coding region for erythropoietin. Plasmid pCRBluntCH1-3 containing the..
human IgG1 Cal, hinge, Cat and Ca3 domains inserted into the vector pCRBlunt*(Invitrogen) was used to obtain a 1.4 kb human IgG1 constant domain. pCRBluntCH1-3 was digested with Hindlll and Sal I and the constant domain sequences were inserted into pDRSa19 to generate pDSRal9:hCH.
Construction of gDSRa19:AT-VH21 Four anti-huOPGbp Fab heavy chain cDNAs were cloned into pDSRa19:hCH to convert the Fabs into full length IgGs. The construction of a plasmid encoding NATR heavy chain is described here. The other Fab heavy chains were cloned using similar procedures. To generate the Fab with a signal sequence, a three-step PCR was performed. First, primers 2249-25 and 2248-22 were used with the Fab cDNA template Conditions were: 94 C for 1 min, (95 C for 30 sec., 50 C for 1 min., 68 C for 1 min) for 20 cycles, 68 C for 10 min.
with Pfu polymerase and the appropriate buffer and * Trademark nucleotides. The PCR product was then amplified with primers 2209-21 and 2248-22 followed by amplification with primers 2209-20 and 2248-22. The final PCR
product was cleaned, cut with Hindlll and BsmBI, and gel purified. This fragment contains the Fab with a 5' Kozak (translational initiation) site and the following signal sequence for mammalian expression of Fab "AT"
heavy chain:
MEWSWVFLFFLSVTTGVHS (SEQ ID NO: 25) This signal sequence is designated the VH21 signal sequence.
The plasmid pDSRa19:hCH was digested with Hindlll and BamBI to remove the polylinker before the IgG CH1-3 domains and the Fab PCR product was inserted to generate pDSR(X19:AT-VH21.
Primers:
HindiII Kozak 2209-20 5'-CAGAAGCTTAGACCACC ATG GAA TGG AGC TGG GTC TTT CTC TTC T-3' (SEQ ID NOS: 26 & 27) M E W S W V F L F
2209-21 5'-G AGC TGG GTC TTT CTC TTC TTC CTG TCA GTA ACG ACT GGT GTC CA-3'(SEQ ID NOS: 28 & 29) S W V F L F F L S V T T G V
2249-25 5'-TCA GTA ACG ACT GGT GTC CAC TCA CAG GTC CAG CTG GTG CAG-3' (SEQ ID NOS: 30 & 31) S V T T G V H S Q V
Q L V Q
BsmBI
2248-22 5'-GTG GAG GCA CTA GAG ACG GTGACC AGG GTG-3' (SEQ ID NO: 32) Construction of pDSRa19:AT-L
Fabs "AT", "Y", "P" and "S" light chain cDNAs were cloned into pDSRa19 to convert the Fabs into full length antibodies. The construction of a plasmid encoding the "AT" light chain is described here. The other Fabs were cloned using similar procedures. To generate Fab "AT" with a signal sequence, a three-step PCR was performed. First, primers 2233-50 and 2233-51 were used with the Fab cDNA template. The PCR
conditions were: 94 C for 1 min., (95 C for 30 sec. , 50 C for 1 min., 68 C for 2 min.) for 20 cycles, 68 C
for 10 min. with Pfu polymerase and the appropriate buffer and nucleotides. The PCR product was then amplified with primers 2148-98 and 2233-51 followed by amplification with primers 2148-97 and 2233-51. The final PCR product was cleaned, cut with Hindlll and Sall, and gel purified. This fragment contains the Fab with a 5' Kozak (translational initiation) site and the following signal sequence for mammalian expression of the "AT" light chain:
MDMRVPAQLLGLLLLWLRGARC (SEQ ID NO: 33) This signal sequence is designated the "light" signal sequence.
The plasmid pDSRa19:EPO was digested with Hindlll and SalI to remove the EPO gene before the IgG
light chain PCR product was inserted to generate of pDSRal9:AT-L.
Primers:
Hindlil Kozak 2148-97 5'-CAGAAGCTTGP.QC_ACC_ ATG GAC ATG AGG GTC CCC GCT CAG CTC CTG GG-3'(SEQ ID NO: 34 & 35) M D M R V P A Q L L
2148-98 5'-CC GCT CAG CTC CTG GGG CTC CTG CTA TTG TGG TTG AGA GGT GCC AGA
T-3'(SEQ ID NO: 36 & 37) A Q L L G L L L L
W L R G A R
2233-50 5'-G TGG TTG AGA GGT GCC AGA TGT GAA ATT GTG ATG ACA CAG TCT C-3'(SEQ ID NO: 38 & 39) W L R G A R C E I V M T Q S
Sall 2233-51 5'- TTTGGACGTCGAC TTA TTA ACA CTC TCC CCT G-3' (SEQ ID NO: 40 &
41) * * C E G R
Construction of pDSRal9:AT-tPA , Expression vectors for production of "AT", "Y", "P" and "S" full-length heavy chains were constructed as described above except that primers were modified to introduce the following signal sequence:
for 10 min. with Pfu polymerase and the appropriate buffer and nucleotides. The PCR product was then amplified with primers 2148-98 and 2233-51 followed by amplification with primers 2148-97 and 2233-51. The final PCR product was cleaned, cut with Hindlll and Sall, and gel purified. This fragment contains the Fab with a 5' Kozak (translational initiation) site and the following signal sequence for mammalian expression of the "AT" light chain:
MDMRVPAQLLGLLLLWLRGARC (SEQ ID NO: 33) This signal sequence is designated the "light" signal sequence.
The plasmid pDSRa19:EPO was digested with Hindlll and SalI to remove the EPO gene before the IgG
light chain PCR product was inserted to generate of pDSRal9:AT-L.
Primers:
Hindlil Kozak 2148-97 5'-CAGAAGCTTGP.QC_ACC_ ATG GAC ATG AGG GTC CCC GCT CAG CTC CTG GG-3'(SEQ ID NO: 34 & 35) M D M R V P A Q L L
2148-98 5'-CC GCT CAG CTC CTG GGG CTC CTG CTA TTG TGG TTG AGA GGT GCC AGA
T-3'(SEQ ID NO: 36 & 37) A Q L L G L L L L
W L R G A R
2233-50 5'-G TGG TTG AGA GGT GCC AGA TGT GAA ATT GTG ATG ACA CAG TCT C-3'(SEQ ID NO: 38 & 39) W L R G A R C E I V M T Q S
Sall 2233-51 5'- TTTGGACGTCGAC TTA TTA ACA CTC TCC CCT G-3' (SEQ ID NO: 40 &
41) * * C E G R
Construction of pDSRal9:AT-tPA , Expression vectors for production of "AT", "Y", "P" and "S" full-length heavy chains were constructed as described above except that primers were modified to introduce the following signal sequence:
MDAMKRGLCCVLLLCGAVFVFSPSRGRFRR (SEQ ID NO:
42) This signal sequence is designated the "tPA-RGR" signal sequence.
Construction of pLDH-AT
An expression vector was constructed that included both "AT" heavy and light chains. The plasmid pDSRa19:AT-Vh21 was digested with AatII and NdeI and the ends filled by T4 DNA polymerase. The fragment containing the "AT" heavy chain expression cassette ("AT" heavy chain coding sequence flanked by the promoter and polyadenylation site from pDSRa19) was gel purified and ligated to of pDSRal9:AT-L which had been linearized with NheI, filled with T4 DNA polymerase and dephosphorylated with alkaline phosphatase. The heavy chain expression cassette was in the same transcriptional orientation as the light chain and DHFR
genes.
Antibody Preparation Expression vectors containing cDNA encoding heavy and light chain "AT", "Y", "S" and "P" full-length antibodies (either in separate vectors or in a single vector) were transfected into CHO cells and cultured under conditions to allow expression of heavy and light chains and secretion into the cell media.
The conditioned media was filtered through a 0.45 m cellulose acetate filter (Corning, Acton, MA) and applied to a Protein G sepharose (Amersham Pharmacia Biotech, Piscataway, NJ) column which had been equilibrated with PBS.- Dulbecco's Phosphate Buffered Saline without calcium chloride and without magnesium chloride (Gibco BRL Products, Grand Island, NY). After sample application the column was washed with PBS until absorbency at 280 nm reached baseline. Elution of protein was achieved using 100 mM Glycine, pH 2.5.
Fractions were collected and immediately neutralized by addition of 1M Tris-HC1, pH 9.2. Antibodies were detected by SDS-polyacrylamide gels visualized by Commassie staining.
Fractions containing antibody were pooled, concentrated and diafiltered into PBS using either Centricon 10 (Amicon) or for larger volumes Centriprep 10 (Amicon).
The isolated antibody was characterized by gel filtration on Superose*6 (Amersham Pharmacia Biotech, Piscataway, NJ) and was shown to run as a monomeric IgG.
ale 8 BlAcore*Analysis of Fab and antibody binding to OPGbp The binding constant (Rd), on rate constant:
(ka) and off rate constant (kd) for Fabs "AT" and "Y"
and "AT" antibody were determined by surface plasmon resonance techniques (BlAcore, Pharmacia, Piscataway, New Jersey) and the results are shown in Table II.
Fabs were prepared as described in Example 4 and "AT"
antibody prepared as described in Example 7. OPGbp was immobilized on a CM5-chip by standard amine coupling.
The Kd and rate constants were determined by BIAEVALUATION 3.0 software (Pharmacia).
* Trademark TABLE II
BlAcore Analysis of Fabs "AT" and "Y" and "AT" antibody Ka (M 's-1) Kd (s 1) nM
Fab "Y" 9.44 x 103 5.91 x 10-3 594 Fab "AT" 2.2 x 106 0.31 140 "AT" Ab (147 RU) 5.7 x 106 2.4 x 10-3 0.42 "AT" Ab (80 RU) 8.1 x 106 2.7 x 10-3 0.33 "AT" Ab (47 RU) 7.3 x 106 3.1 x 10-3 0.43 The binding affinity of Fab "AT" increased from about 140 nM to about 0.33 to 0.43 nM, or about 350 to 400-fold, when an Fc IgG1 constant region was added as described in Example 7.
Example 9 Activity of anti-OPGbp antibodies RAW Cell Assay "AT" antibody preparations designated 405, 406 and 407 were tested in a RAW cell assay as described in Example 1. "AT"405, "AT"406 and "AT"407 differ only in the leader sequences used for expression ("AT"405 was expressed using the "light" signal sequence, "AT"406 used the tPA-RGR signal sequence, and "AT"407 used the VH21 signal sequence). The purified mature antibodies were identical in each preparation. The results are shown in Figure 23.
IC50's for "AT"405, "AT"406 and "AT"407 were 20.1 nM, 60.3 nM & 21.4 nM, respectively corresponding to 3.0 ug/ml, 9.0 ug/ml and 3.2 ug/ml, respectively (assuming a molecular weight of 150,000).
The positive controls of OPG[22-194]-Fc and anti-OPGbp polyclonal antibody were at 33 ng/ml and 150 ng/ml, respectively.
The difference in IC50 in the Raw cell assay of the "AT" Fab fragment was 300 nM as compared to about 20 nM for the "AT" full-length, or about a 15-fold increase for the "AT" full-length antibody.
Taking into account the differences in OPGbp concentrations in the two experiments (150 ng/ml / 60 ng/ml = 2.5 fold), the increase in cell function avidity for the "AT" full-length antibody was about 15 x 2.5 = 37.5 fold.
Bone Marrow Assay The effects of adding "AT"405 or "AT"407 preparations to the murine bone marrow assay were shown in Figure 24. IC50's for "AT"405 and "AT"407 were 2.15 ug/ml (14.4 nM), and 1.85 ug/ml (12.5 nM), respectively, (MW = 150,000). A rat anti-OPGbp polyclonal antibody inhibited TRAP formation with an IC50 at -50 ng/ml.
In a separate experiment, "AT"406 was tested in the bone marrow coculture assay and inhibited TRAP
formation with an IC50 of 2.35 gg/ml (14.4 nM) assuming an antibody molecular weight of 150,000 (see Figure 25).
The difference in IC50 in the bone marrow assay for "AT" Fab fragment was about 50 nM as compared to about 13 nM for "AT" full-length antibody, or about a 3.85 fold increase. Taking into account the differences in OPGbp concentrations in the two experiments (50 nM / 9 nM = 5.55 fold), the approximate gain in cell function avidity from "AT" full-length antibody was about 3.85 x 5.55 = 21.4 fold.
cDNAs encoding Fabs "Y", "P" and "S" were also fused to human IgGl CH1, CH2, and CH3 sequences as described in Example 7 and transfected into CHO cells.
42) This signal sequence is designated the "tPA-RGR" signal sequence.
Construction of pLDH-AT
An expression vector was constructed that included both "AT" heavy and light chains. The plasmid pDSRa19:AT-Vh21 was digested with AatII and NdeI and the ends filled by T4 DNA polymerase. The fragment containing the "AT" heavy chain expression cassette ("AT" heavy chain coding sequence flanked by the promoter and polyadenylation site from pDSRa19) was gel purified and ligated to of pDSRal9:AT-L which had been linearized with NheI, filled with T4 DNA polymerase and dephosphorylated with alkaline phosphatase. The heavy chain expression cassette was in the same transcriptional orientation as the light chain and DHFR
genes.
Antibody Preparation Expression vectors containing cDNA encoding heavy and light chain "AT", "Y", "S" and "P" full-length antibodies (either in separate vectors or in a single vector) were transfected into CHO cells and cultured under conditions to allow expression of heavy and light chains and secretion into the cell media.
The conditioned media was filtered through a 0.45 m cellulose acetate filter (Corning, Acton, MA) and applied to a Protein G sepharose (Amersham Pharmacia Biotech, Piscataway, NJ) column which had been equilibrated with PBS.- Dulbecco's Phosphate Buffered Saline without calcium chloride and without magnesium chloride (Gibco BRL Products, Grand Island, NY). After sample application the column was washed with PBS until absorbency at 280 nm reached baseline. Elution of protein was achieved using 100 mM Glycine, pH 2.5.
Fractions were collected and immediately neutralized by addition of 1M Tris-HC1, pH 9.2. Antibodies were detected by SDS-polyacrylamide gels visualized by Commassie staining.
Fractions containing antibody were pooled, concentrated and diafiltered into PBS using either Centricon 10 (Amicon) or for larger volumes Centriprep 10 (Amicon).
The isolated antibody was characterized by gel filtration on Superose*6 (Amersham Pharmacia Biotech, Piscataway, NJ) and was shown to run as a monomeric IgG.
ale 8 BlAcore*Analysis of Fab and antibody binding to OPGbp The binding constant (Rd), on rate constant:
(ka) and off rate constant (kd) for Fabs "AT" and "Y"
and "AT" antibody were determined by surface plasmon resonance techniques (BlAcore, Pharmacia, Piscataway, New Jersey) and the results are shown in Table II.
Fabs were prepared as described in Example 4 and "AT"
antibody prepared as described in Example 7. OPGbp was immobilized on a CM5-chip by standard amine coupling.
The Kd and rate constants were determined by BIAEVALUATION 3.0 software (Pharmacia).
* Trademark TABLE II
BlAcore Analysis of Fabs "AT" and "Y" and "AT" antibody Ka (M 's-1) Kd (s 1) nM
Fab "Y" 9.44 x 103 5.91 x 10-3 594 Fab "AT" 2.2 x 106 0.31 140 "AT" Ab (147 RU) 5.7 x 106 2.4 x 10-3 0.42 "AT" Ab (80 RU) 8.1 x 106 2.7 x 10-3 0.33 "AT" Ab (47 RU) 7.3 x 106 3.1 x 10-3 0.43 The binding affinity of Fab "AT" increased from about 140 nM to about 0.33 to 0.43 nM, or about 350 to 400-fold, when an Fc IgG1 constant region was added as described in Example 7.
Example 9 Activity of anti-OPGbp antibodies RAW Cell Assay "AT" antibody preparations designated 405, 406 and 407 were tested in a RAW cell assay as described in Example 1. "AT"405, "AT"406 and "AT"407 differ only in the leader sequences used for expression ("AT"405 was expressed using the "light" signal sequence, "AT"406 used the tPA-RGR signal sequence, and "AT"407 used the VH21 signal sequence). The purified mature antibodies were identical in each preparation. The results are shown in Figure 23.
IC50's for "AT"405, "AT"406 and "AT"407 were 20.1 nM, 60.3 nM & 21.4 nM, respectively corresponding to 3.0 ug/ml, 9.0 ug/ml and 3.2 ug/ml, respectively (assuming a molecular weight of 150,000).
The positive controls of OPG[22-194]-Fc and anti-OPGbp polyclonal antibody were at 33 ng/ml and 150 ng/ml, respectively.
The difference in IC50 in the Raw cell assay of the "AT" Fab fragment was 300 nM as compared to about 20 nM for the "AT" full-length, or about a 15-fold increase for the "AT" full-length antibody.
Taking into account the differences in OPGbp concentrations in the two experiments (150 ng/ml / 60 ng/ml = 2.5 fold), the increase in cell function avidity for the "AT" full-length antibody was about 15 x 2.5 = 37.5 fold.
Bone Marrow Assay The effects of adding "AT"405 or "AT"407 preparations to the murine bone marrow assay were shown in Figure 24. IC50's for "AT"405 and "AT"407 were 2.15 ug/ml (14.4 nM), and 1.85 ug/ml (12.5 nM), respectively, (MW = 150,000). A rat anti-OPGbp polyclonal antibody inhibited TRAP formation with an IC50 at -50 ng/ml.
In a separate experiment, "AT"406 was tested in the bone marrow coculture assay and inhibited TRAP
formation with an IC50 of 2.35 gg/ml (14.4 nM) assuming an antibody molecular weight of 150,000 (see Figure 25).
The difference in IC50 in the bone marrow assay for "AT" Fab fragment was about 50 nM as compared to about 13 nM for "AT" full-length antibody, or about a 3.85 fold increase. Taking into account the differences in OPGbp concentrations in the two experiments (50 nM / 9 nM = 5.55 fold), the approximate gain in cell function avidity from "AT" full-length antibody was about 3.85 x 5.55 = 21.4 fold.
cDNAs encoding Fabs "Y", "P" and "S" were also fused to human IgGl CH1, CH2, and CH3 sequences as described in Example 7 and transfected into CHO cells.
The resulting antibodies were expressed and purified from conditioned medium and exdotoxin removed as before. "S" and "Y" light chain antibodies (referred to as "S Light" and "Y Light") were tested in the bone marrow assay and the results shown in Figure 26. "S
light" and "Y light" antibodies were expressed using the corresponding light chain leader sequences and were designated "S" 435 and "Y" 429, respectively. The "Y"
429 ("Y Light") had an IC50 of 23 ug/ml or 154 nM. "S"
435 ("S Light") did not exhibit sufficient activity for a determination of an IC50.
The "Y Campath" and "P Light" were Hu-IgG1 sequence "Y" and "P", respectively with the leader sequence from the "Campath" and "Light" Chain, and were designated "Y" 442 and "P" 444, respectively. The "Y"
442 ("Y Campath") had an IC50 of 20 gg/ml or 134 nM.
"P" 444 ("P Light") did not show detectable activity (see Figure 27).
The difference in IC50 in the bone marrow assay of "Y" Fab fragment was 212 nM compared to 134-154 nM
for "Y" full -length antibody or about a 1.38 to 1.58 fold increase. Taking into account the differences in OPGbp concentrations in the two experiment (50 nM / 9 nM = 5.55 fold), the approximate gain in cell function avidity from "Y" Fab to "Y" full-length antibody was therefore about (1.38 to 1.58) x 5.55 = 7.7 to 8.8 fold or about 8-fold.
Example 10 Identification of an Epitope for "AT" Antibody on OPGbp Production of variant murine OPGbp Human OPGbp[143-317] was produced as described in Example 1. Murine OPGbp[158-316]
light" and "Y light" antibodies were expressed using the corresponding light chain leader sequences and were designated "S" 435 and "Y" 429, respectively. The "Y"
429 ("Y Light") had an IC50 of 23 ug/ml or 154 nM. "S"
435 ("S Light") did not exhibit sufficient activity for a determination of an IC50.
The "Y Campath" and "P Light" were Hu-IgG1 sequence "Y" and "P", respectively with the leader sequence from the "Campath" and "Light" Chain, and were designated "Y" 442 and "P" 444, respectively. The "Y"
442 ("Y Campath") had an IC50 of 20 gg/ml or 134 nM.
"P" 444 ("P Light") did not show detectable activity (see Figure 27).
The difference in IC50 in the bone marrow assay of "Y" Fab fragment was 212 nM compared to 134-154 nM
for "Y" full -length antibody or about a 1.38 to 1.58 fold increase. Taking into account the differences in OPGbp concentrations in the two experiment (50 nM / 9 nM = 5.55 fold), the approximate gain in cell function avidity from "Y" Fab to "Y" full-length antibody was therefore about (1.38 to 1.58) x 5.55 = 7.7 to 8.8 fold or about 8-fold.
Example 10 Identification of an Epitope for "AT" Antibody on OPGbp Production of variant murine OPGbp Human OPGbp[143-317] was produced as described in Example 1. Murine OPGbp[158-316]
containing amino acid residues 158 through 316 of as shown in Figure 1 of PCT W098/46751 preceded by an introduced N-terminal methionine residue was produced in E.coli and purified from the soluble fraction of bacteria as described previously (Lacey et al. Cell 93, 165-176 (1998)). FLAG-murine OPGbp[158-316] was generated by introduction of nucleic acid residues encoding an N-terminal methionine followed by a FLAG-tag sequence (DYKDDDDKKL (SEQ ID NO: 99)) fused to the N-terminus of residues 158-316 as shown in Figure 1 of PCT W098/46751 using methods known to one skilled in the art. The FLAG-OPGbp[158-316] molecule was cloned into bacterial expression vector pAMG21 (deposited with the American Type Culture Collection and having accession no. 98113).
A FLAG-murine OPGbp[158-316] polypeptide variant was constructed in which amino acid residues SVPTD at positions 229-233 inclusive as shown in Figure 1 (SEQ ID NO: 1) of W098/46751 were substituted with corresponding amino acid residues DLATE at positions 230-234 inclusive as shown in Figure 4 (SEQ ID NO: 3) of W098/46751. The resulting construct referred to as "FLAG-murine OPGbp[158-316]/DE" has the nucleic acid and protein sequence as shown in Figure 28. The amino acid sequence changes are located in a region of OPGbp between the D and E regions. Figure 29 shows a comparison of murine, human, and murine DE variant amino acid sequences in this region. The sequence changes in the murine variant are S229D, V230L, P231A
and D233E with the T at position 234 unchanged.
Flanking sequences in this region are virtually identical between murine and human OPGbp.
This molecule was constructed using a two step PCR reaction where the first step contained two separate PCR reactions, designated reaction A and reaction B. For both reaction A and reaction B, pAMG21-FLAG-murine OPGbp[158-316] DNA was used as a template for PCR. Reaction A employed oligonucleotides #2640-90 and #2640-91 for PCR, whereas reaction B
employed oligonucleotides #2640-92 and 2640-93.
Thermocycling was performed and PCR products from reactions A and B were purified from an agarose gel using methods available to one skilled in the art. The second step PCR reaction, designated reaction C, utilized purified reaction A and reaction B PCR
products as a template and oligonucleotides #2640-90 and #2640-93 as primers. Following thermocycling, the product from reaction C was cloned into the pCRII-TOPO
cloning vector (Invitrogen) & electroporated into DH10b (Gibco) cells using methods provided by the manufacturer. Clones were selected and sequence confirmed verifying that the introduced mutations resulted in changing the amino acid sequence SVPTD in murine OPGbp[158-316] to DLATE. The sequence verified DNA was then digested with NdeI and XhoI, purified, and subcloned into bacterial expression vector pAMG21 giving rise to plasmid pAMG21-FLAG-murine OPGbp[158-316] /DE.
2640-90: CCTCTCATATGGACTACAAGGAC (SEQ ID NO: 100) 2640-91: AGTAGCCAGGTCTCCCGATGTTTCATGATG (SEQ ID NO:
101) 2640-92: CTGGCTACTGAATATCTTCAGCTGATGGTG (SEQ ID NO:
102) 2640-93: CCTCTCCTCGAGTTAGTCTATGTCC (SEQ ID NO: 103) E.coli host GM94 (deposited with the American Type Culture Collection under accession number 202173) containing plasmid pAMG21-FLAG-murine OPGbp[158-316]/DE
was grown in 2XYT media to an exponential growth phase and induced to express the FLAG-murine OPGbp[158-316]/DE protein by addition of V. fischeri synthetic autoinducer to 100 ng/ml. Approximately 3-6 hours following induction, the cells were pelleted and recombinant FLAG-murine OPGbp[158-316]/DE protein was purified from the soluble fraction of E.coli using methods described in Lacey et al. ibid.
Binding of "AT" Antibody to human OPGbpfl43-3171 murine OPGbprl58-3161 and FLAG-murine OPGbp[l58-Costar E.I.A./R.I.A. Plates (Flat Bottom High Binding, Cat.#3590) were coated with 100 l/well of either human OPGbp[143-317]protein, murine OPGbp[158-316] protein, or FLAG-murine OPGbp[158-316]/DE protein at 3 g/ml in PBS, overnight at 4 C with agitation.
After overnight incubation, the protein solutions were removed from the plate and 200 l of 5% Chicken Serum (Gibco/BRL Cat# 16110-082) in PBST (PBS plus 0.05%
Tween 20) was added to each well of the plate and plates were incubated at room temperature (RT) for 90 min with agitation. After incubation and blocking, plates were washed 4 times with IX K-P wash solution in dH2O (Cat#50-63-00, Kirkegaard & Perry Laboratories) and dried. Purified "AT" antibody or human OPG [22-194]-Fc protein was serially diluted 1:1 from 2 ug/ml down to 1.953 ng/ml in PBST and 100 ul/well was added to appropriate wells of the microtiter plate coated with either human OPGbp[143-317], murine OPGbp[158-316], or FLAG-murine OPGbp[158-316]/DE protein.
Plates were incubated for three hours at room temperature with agitation, washed four times with lX
K-P wash solution and dried. Goat anti-human IgG (Fc) (Jackson ImmunoResearch, Cat# 109-036-098) was diluted 1:5000 in 5% Chicken Serum in PEST and 100 l was added to each well. Plates were incubated for 1.25 hours at room temperature with agitation, washed six times with 1X K-P wash solution, and dried. 100 l of undiluted ABTS substrate (Kirkegaard & Perry; Cat# 50-66-00) was added to each well and the dish was incubated at room temperature until sufficient blue-green color developed. Color development was stopped by addition of 100 l 1% SDS. Quantitation of color development was performed using a microtiter plate reader with detection at 405 nm.
The results of the EIA are shown in Figure 30. The "AT" antibody binds to human OPGbp[143-317]
but does not show detectable binding to murine OPGbp[158-316] over the antibody concentration range tested. However, the "AT" antibody binds to both FLAG-murine OPGbp[158-316]/DE and to human OPGbp[143-317]
under the assay conditions above. It was concluded that the amino acid changes in murine OPGbp[158-316]/DE
compared to murine OPGbp[158-316] were involved in binding of "AT" antibody.
The FLAG-murine OPGbp[158-316]/DE was assayed for activity in a RAW cell assay as described in Example 1 and observed to have a similar ED50 for osteoclast formation as human OPGbp[143-317], indicating that the DE variant is active in promoting osteoclast activity in vitro. Therefore, the binding of "AT" antibody to murine OPGbp[158-316]/DE is likely to inhibit osteoclast formation.
The epitope of the "AT" antibody is located to a region of human OPGbp which includes at least amino acids residues DLATE (residues 230 through 234 of human OPGbp as shown in Figure 4 of PCT W098/46751).
Example 11 Construction of "AT" Fab and Antibody Variants Three approaches were used to generate CDR
variants of "AT" antibody: alanine scanning mutagenesis of heavy chain CDR3 region, substitution mutagenesis of selected sites in heavy chain CDR3 region, and insertion mutagenesis of the light chain CDR3 region.
Alanine variants of heavy chain CDR3 Alanine scanning mutagenesis was done on the CDR3 region of the AT heavy chain. The amino acid sequence used for alanine scanning was:
DSSNMVRGIIIAYYFDY (SEQ ID NO:_104) Primers 12 and 15 were annealed to each other and extended by polymerase chain reaction (PCR) under the following conditions: 25 pmol of each primer, 6 cycles of 30 sec at 94 , 2 min at 55 , 20 sec at 74 .
12) 5' AGA GAT TCC TCA AAT ATG GTT CGG GGA ATT ATT ATA
GCG (SEQ ID NO: 105) 15) 5' GTA GTC AAA ATA GTA CGC TAT AAT AAT TCC CCG AAC
(SEQ ID NO: 106) The PCR product of this reaction is termed Template A.
Template A was extended by PCR using primers 11 and 14 under the following conditions: 0.5 microliters of template A, 10 pmol each primer, 15 cycles of 30 sec at 94 , 2 min at 43 , 20 sec at 74 .
11) 5' GTG TAT TAC TGT GCG AGA GAT TCC TCA AAT ATG
(SEQ ID NO: 107) 14) 5' CAG GGT GCC CTG GCC CCA GTA GTC AAA ATA GTA CGC
(SEQ ID NO: 108) The PCR product of this reaction is termed Template B.
Alanine variants of CDR3 were then generated using either template A or B. Two rounds of PCR were done (20 cycles of 94 C for 20 sec and 74 C for 40 sec) using a primer containing the desired alanine codon. The primer containing the alanine codon was in the forward orientation for CDR3 residues (numbering follows Kabat system, see Kabat et al. Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 4th edition (1991)) D95, S96, V100, R100a. The primer containing the alanine codon was in the reverse orientation for residues S97, N98, M99, G100b, I100c, I100d, I100e, Y100g, Y100h, F100i, D101, Y102.
The mutagenesis reactions were then followed by up to three extension reactions using six common primers.
These reactions extended the product to encompass the entire CDR3 region up to and including unique flanking restriction sites BglII and BstEII.
Primers for alanine substitution are shown below in the 5' to 3' orientation. The alanine codon is shown in bold type.
60) 5' GTG TAT TAC TGT GCG AGA GCT TCC TCA AAT ATG GTT
CGG (SEQ ID NO: 109) 59) 5' GTG TAT TAC TGT GCG AGA GAT GCC TCA AAT ATG GTT
CGG (SEQ ID NO: 110) 58) 5' AAT AAT TCC CCG AAC CAT ATT TGC GGA ATC TCT CGC
ACA GTA (SEQ ID NO: 111) 57) 5' AAT AAT TCC CCG AAC CAT AGC TGA GGA ATC TCT CGC
ACA (SEQ ID NO: 112) 56) 5' AAT AAT TCC CCG AAC GGC ATT TGA GGA ATC TCT CGC
(SEQ ID NO: 113) 55) 5' GAT TCC TCA AAT ATG GCT CGG GGA ATT ATT ATA GCG
(SEQ ID NO: 114) 54) 5' GAT TCC TCA AAT ATG GTT GCC GGA ATT ATT ATA GCG
TA (SEQ ID NO: 115) 53) 5' GTA GTC AAA ATA GTA CGC TAT AAT AAT TGC CCG AAC
CAT ATT TGA (SEQ ID NO: 116) 52) 5' GTA GTC AAA ATA GTA CGC TAT AAT GGC TCC CCG AAC
CAT ATT (SEQ ID NO: 117) 51) 5' GTA GTC AAA ATA GTA CGC TAT GGC AAT TCC CCG AAC
CAT (SEQ ID NO: 118) 50) 5' GTA GTC AAA ATA GTA CGC TGC AAT AAT TCC CCG AAC
(SEQ ID NO: 119) 20) 5' GGT GCC CTG GCC CCA GTA GTC AAA ATA GGC CGC TAT
AAT AAT TCC (SEQ ID NO: 120) 19) 5' GGT GCC CTG GCC CCA GTA GTC AAA AGC GTA CGC TAT
AAT AAT TCC (SEQ ID NO: 121) 18) 5' CAG GGT GCC CTG GCC CCA GTA GTC AGC ATA GTA CGC
TAT AAT (SEQ ID NO: 122) 17) 5' CAG GGT GCC CTG GCC CCA GTA GGC AAA ATA GTA CGC
TAT (SEQ ID NO: 123) 16a) 5' CAG GGT GCC CTG GCC CCA GGC GTC AAA ATA GTA CGC
TAT (SEQ ID NO: 124) The six common primers for extension PCR are shown below. The sequences of the flanking BglII (top strand) and BstEII (bottom strand) sites are shown in bold type.
Forward Common primers 10) 5' AGT CTG AGA TCT GAA GAC ACG GCT GTG TAT TAC TGT
GCG AGA (SEQ ID NO: 125) 11) 5' GTG TAT TAC TGT GCG AGA GAT TCC TCA AAT ATG (SEQ
ID NO: 126) 12) 5' AGA GAT TCC TCA AAT ATG GTT CGG GGA ATT ATT ATA
GCG (SEQ ID NO: 127) Reverse Common primers 13) 5' CTT GAG ACG GTG ACC AGG GTG CCC TGG CCC CA (SEQ
ID NO: 128) 14) 5' CAG GGT GCC CTG GCC CCA GTA GTC AAA ATA GTA CGC
(SEQ ID NO: 129) 15) 5' GTA GTC AAA ATA GTA CGC TAT AAT AAT TCC CCG AAC
(SEQ ID NO: 130) The following table shows the starting template and primer pairs used sequentially to build synthetic DNA fragments containing substituted alanine residues.
TABLE III
PCR
reactions CDR Template Alanine Extension Extension Extension Residue Primer pair Primers Primers Primers D95 A 60 + 14 10 + 13 S96 A 59 + 14 10 + 13 S97 B 10 + 58 10 + 15 10 + 14 10 + 13 N98 B 10 + 57 10 + 15 10 + 14 10 + 13 M99 B 10 + 56 10 + 15 10 + 14 10 + 13 V100 A 55 + 14 10 + 14 10 + 13 R100a A 54 + 14 10 + 14 10 + 13 G100b A 11 + 53 10 + 14 10 + 13 I100c A 11 + 52 10 + 14 10 + 13 I100d A 11 + 51 10 + 14 10 + 13 I100e A 11 + 50 10 + 14 10 + 13 Y100g B 11 + 20 10 + 13 Y100h B 11 + 19 10 + 13 F100i B 11 + 18 10 + 13 D101 B 11 + 17 10 + 13 Y102 B 11 + 16a 10 + 13 For primers used for alanine scanning, the PCR
conditions were 20 cycles at 94 C for 20 sec, then 74 C for 40 sec. For extension reactions with primer pair 10 + 15, the conditions were 20-25 cycles of 94 C
for 20 sec, 42 for 1 min 30 sec, 74 C for 20 sec. For extension reactions with primer pair 10 + 14, the conditions were 20-25 cycles of 94 C for 20 sec, 48-50 for 1 min 30 sec, 74 C for 20 sec. For extension reactions with primer pair 10 + 13, the conditions were 20-25 cycles of 94 C for 20 sec, 64 for 1 min 30 sec, 74 C for 20 sec. The PCR products were digested with BglII and BstEII restriction enzymes and cloned into FabAT which had been digested with BglII and BstEII, thereby replacing the CDR3 of AT with the alanine substituted CDR3. The alanine substituted constructs were verified by DNA sequencing.
Substitution variants of heavy chain CDR3 A similar strategy to that used for the alanine scanning mutagenesis was utilized for the randomization of positions S96, S97 and N98 of the heavy chain CDR3 of "AT". Templates A and B were generated as previously described. Positions 96, 97 and 98 were randomized with a set of four primer for each position. The positions in parentheses have variable nucleotides as indicated.
For position S96.
23) 5' AAT AAT TCC CCG AAC CAT ATT TGA G(AT)(ACGT) ATC
TCT CGC ACA GTA (SEQ ID NO: 131) 24) 5' AAT AAT TCC CCG AAC CAT ATT TGA G(CG)(ACGT) ATC
TCT CGC ACA GTA (SEQ ID NO: 132) 25) 5' AAT AAT TCC CCG AAC CAT ATT TGA CT(CGT) ATC TCT
CGC ACA GTA (SEQ ID NO: 133) 26) 5' AAT AAT TCC CCG AAC CAT ATT TGA C(AC)(AT) ATC
TCT CGC ACA GTA (SEQ ID NO: 134) For position S97 27) 5' AAT AAT TCC CCG AAC CAT ATT G(AT)(ACGT) GGA ATC
TCT CGC ACA GTA (SEQ ID NO: 135) 28) 5' AAT AAT TCC CCG AAC CAT ATT G(CG)(ACGT) GGA ATC
TCT CGC ACA GTA (SEQ ID NO: 136) 29) 5' AAT AAT TCC CCG AAC CAT ATT CT(CGT) GGA ATC TCT
CGC ACA GTA (SEQ ID NO: 137) 30) 5' AAT AAT TCC CCG AAC CAT ATT C(AC)(AT) GGA ATC
TCT CGC ACA GTA (SEQ ID NO: 138) For position N98 31) 5' AAT AAT TCC CCG AAC CAT G(AT)(ACGT) TGA GGA ATC
TCT CGC ACA (SEQ ID NO: 139) 32) 5' AAT AAT TCC CCG AAC CAT G(CG)(ACGT) TGA GGA ATC
TCT CGC ACA (SEQ ID NO: 140) 33) 5' AAT AAT TCC CCG AAC CAT CT(CGT) TGA GGA ATC TCT
CGC ACA (SEQ ID NO: 141) 34) 5' AAT AAT TCC CCG AAC CAT C(AC)(AT) TGA GGA ATC
TCT CGC ACA (SEQ ID NO: 142) PCR reactions were done using the reverse randomization primer and primer 10. The resulting product was extended by four sequential PCR reactions using primer pairs 10 + 15, 10 + 14, 10 + 13 and 10 +
22. The 5' end of the heavy chain variable region of "AT" was amplified from a full length clone of the "AT"
heavy chain variable region using primers 16 and 72.
All PCR products were gel purified. The randomization products were overlapped with the 16/72 product, with flanking primers being 16 and 22. The full-length variable region was then cloned into a vector containing the IgG1 constant region as a HindIII/BsmBI
fragment. Full-length antibody clones were selected by sequencing.
Primers used the overlap PCR for randomization mutants.
10 5' AGT CTG AGA TCT GAA GAC ACG GCT GTG TAT TAC TGT
GCG AGA (SEQ ID NO: 143) 16 5' CAG CAG AAG CTT AGA CCA CCA TGG ACA TGA GGG TCC
CCG CTC AGC TCC TGG G (SEQ ID NO: 144) 72 5' CAC AGC CGT GTC TTC AGA TCT CAG ACT GCG CAG CTC
(SEQ ID NO: 145) 22 5' GTG GAG GCA CTA GAG ACG GTG ACC AGG GTG (SEQ ID
NO: 146) The S96A, S97A, and N98A variants were converted from Fabs to full length antibodies by PCR
amplification of the Fab clone having the bacterial signal sequence replaced with a mammalian signal sequence. Plasmid DNA from the Fab containing the desired mutation was used as template. Sequential primer pairs used were 21 + 22, 98 + 22, and 16 + 22.
Correct clones were selected by DNA sequence analysis.
Multiple alanine variants (S96A, S97A; S96A, N98A; S97A, N98A and S96A, S97A and N98A) were generated using the converted AT heavy chain full length IgGl plasmid as template. Initial PCR reaction were carried out with one of the primers listed below and primer 22. These products were then extended using primer pairs 10 + 22. That product was then overlapped with the 16/72 product using flanking primers 16 and 22, and cloned into the IgG1 constant region as before.
Correct clones were selected by DNA sequence analysis.
S96A, S97A
63) 5' GTG TAT TAC TGT GCG AGA GAT GCC GCA AAT ATG GTT
CGG GGA ATT ATT (SEQ ID NO: 147) S96A, N98A
64) 5' GTG TAT TAC TGT GCG AGA GAT GCC TCA GCT ATG GTT
CGG GGA ATT ATT ATA GC (SEQ ID NO: 148) S97A, N98A
65) 5' GTG TAT TAC TGT GCG AGA GAT TCC GCA GCT ATG GTT
CGG GGA ATT ATT ATA GC (SEQ ID NO: 149) S96A, S97A, N98A
A FLAG-murine OPGbp[158-316] polypeptide variant was constructed in which amino acid residues SVPTD at positions 229-233 inclusive as shown in Figure 1 (SEQ ID NO: 1) of W098/46751 were substituted with corresponding amino acid residues DLATE at positions 230-234 inclusive as shown in Figure 4 (SEQ ID NO: 3) of W098/46751. The resulting construct referred to as "FLAG-murine OPGbp[158-316]/DE" has the nucleic acid and protein sequence as shown in Figure 28. The amino acid sequence changes are located in a region of OPGbp between the D and E regions. Figure 29 shows a comparison of murine, human, and murine DE variant amino acid sequences in this region. The sequence changes in the murine variant are S229D, V230L, P231A
and D233E with the T at position 234 unchanged.
Flanking sequences in this region are virtually identical between murine and human OPGbp.
This molecule was constructed using a two step PCR reaction where the first step contained two separate PCR reactions, designated reaction A and reaction B. For both reaction A and reaction B, pAMG21-FLAG-murine OPGbp[158-316] DNA was used as a template for PCR. Reaction A employed oligonucleotides #2640-90 and #2640-91 for PCR, whereas reaction B
employed oligonucleotides #2640-92 and 2640-93.
Thermocycling was performed and PCR products from reactions A and B were purified from an agarose gel using methods available to one skilled in the art. The second step PCR reaction, designated reaction C, utilized purified reaction A and reaction B PCR
products as a template and oligonucleotides #2640-90 and #2640-93 as primers. Following thermocycling, the product from reaction C was cloned into the pCRII-TOPO
cloning vector (Invitrogen) & electroporated into DH10b (Gibco) cells using methods provided by the manufacturer. Clones were selected and sequence confirmed verifying that the introduced mutations resulted in changing the amino acid sequence SVPTD in murine OPGbp[158-316] to DLATE. The sequence verified DNA was then digested with NdeI and XhoI, purified, and subcloned into bacterial expression vector pAMG21 giving rise to plasmid pAMG21-FLAG-murine OPGbp[158-316] /DE.
2640-90: CCTCTCATATGGACTACAAGGAC (SEQ ID NO: 100) 2640-91: AGTAGCCAGGTCTCCCGATGTTTCATGATG (SEQ ID NO:
101) 2640-92: CTGGCTACTGAATATCTTCAGCTGATGGTG (SEQ ID NO:
102) 2640-93: CCTCTCCTCGAGTTAGTCTATGTCC (SEQ ID NO: 103) E.coli host GM94 (deposited with the American Type Culture Collection under accession number 202173) containing plasmid pAMG21-FLAG-murine OPGbp[158-316]/DE
was grown in 2XYT media to an exponential growth phase and induced to express the FLAG-murine OPGbp[158-316]/DE protein by addition of V. fischeri synthetic autoinducer to 100 ng/ml. Approximately 3-6 hours following induction, the cells were pelleted and recombinant FLAG-murine OPGbp[158-316]/DE protein was purified from the soluble fraction of E.coli using methods described in Lacey et al. ibid.
Binding of "AT" Antibody to human OPGbpfl43-3171 murine OPGbprl58-3161 and FLAG-murine OPGbp[l58-Costar E.I.A./R.I.A. Plates (Flat Bottom High Binding, Cat.#3590) were coated with 100 l/well of either human OPGbp[143-317]protein, murine OPGbp[158-316] protein, or FLAG-murine OPGbp[158-316]/DE protein at 3 g/ml in PBS, overnight at 4 C with agitation.
After overnight incubation, the protein solutions were removed from the plate and 200 l of 5% Chicken Serum (Gibco/BRL Cat# 16110-082) in PBST (PBS plus 0.05%
Tween 20) was added to each well of the plate and plates were incubated at room temperature (RT) for 90 min with agitation. After incubation and blocking, plates were washed 4 times with IX K-P wash solution in dH2O (Cat#50-63-00, Kirkegaard & Perry Laboratories) and dried. Purified "AT" antibody or human OPG [22-194]-Fc protein was serially diluted 1:1 from 2 ug/ml down to 1.953 ng/ml in PBST and 100 ul/well was added to appropriate wells of the microtiter plate coated with either human OPGbp[143-317], murine OPGbp[158-316], or FLAG-murine OPGbp[158-316]/DE protein.
Plates were incubated for three hours at room temperature with agitation, washed four times with lX
K-P wash solution and dried. Goat anti-human IgG (Fc) (Jackson ImmunoResearch, Cat# 109-036-098) was diluted 1:5000 in 5% Chicken Serum in PEST and 100 l was added to each well. Plates were incubated for 1.25 hours at room temperature with agitation, washed six times with 1X K-P wash solution, and dried. 100 l of undiluted ABTS substrate (Kirkegaard & Perry; Cat# 50-66-00) was added to each well and the dish was incubated at room temperature until sufficient blue-green color developed. Color development was stopped by addition of 100 l 1% SDS. Quantitation of color development was performed using a microtiter plate reader with detection at 405 nm.
The results of the EIA are shown in Figure 30. The "AT" antibody binds to human OPGbp[143-317]
but does not show detectable binding to murine OPGbp[158-316] over the antibody concentration range tested. However, the "AT" antibody binds to both FLAG-murine OPGbp[158-316]/DE and to human OPGbp[143-317]
under the assay conditions above. It was concluded that the amino acid changes in murine OPGbp[158-316]/DE
compared to murine OPGbp[158-316] were involved in binding of "AT" antibody.
The FLAG-murine OPGbp[158-316]/DE was assayed for activity in a RAW cell assay as described in Example 1 and observed to have a similar ED50 for osteoclast formation as human OPGbp[143-317], indicating that the DE variant is active in promoting osteoclast activity in vitro. Therefore, the binding of "AT" antibody to murine OPGbp[158-316]/DE is likely to inhibit osteoclast formation.
The epitope of the "AT" antibody is located to a region of human OPGbp which includes at least amino acids residues DLATE (residues 230 through 234 of human OPGbp as shown in Figure 4 of PCT W098/46751).
Example 11 Construction of "AT" Fab and Antibody Variants Three approaches were used to generate CDR
variants of "AT" antibody: alanine scanning mutagenesis of heavy chain CDR3 region, substitution mutagenesis of selected sites in heavy chain CDR3 region, and insertion mutagenesis of the light chain CDR3 region.
Alanine variants of heavy chain CDR3 Alanine scanning mutagenesis was done on the CDR3 region of the AT heavy chain. The amino acid sequence used for alanine scanning was:
DSSNMVRGIIIAYYFDY (SEQ ID NO:_104) Primers 12 and 15 were annealed to each other and extended by polymerase chain reaction (PCR) under the following conditions: 25 pmol of each primer, 6 cycles of 30 sec at 94 , 2 min at 55 , 20 sec at 74 .
12) 5' AGA GAT TCC TCA AAT ATG GTT CGG GGA ATT ATT ATA
GCG (SEQ ID NO: 105) 15) 5' GTA GTC AAA ATA GTA CGC TAT AAT AAT TCC CCG AAC
(SEQ ID NO: 106) The PCR product of this reaction is termed Template A.
Template A was extended by PCR using primers 11 and 14 under the following conditions: 0.5 microliters of template A, 10 pmol each primer, 15 cycles of 30 sec at 94 , 2 min at 43 , 20 sec at 74 .
11) 5' GTG TAT TAC TGT GCG AGA GAT TCC TCA AAT ATG
(SEQ ID NO: 107) 14) 5' CAG GGT GCC CTG GCC CCA GTA GTC AAA ATA GTA CGC
(SEQ ID NO: 108) The PCR product of this reaction is termed Template B.
Alanine variants of CDR3 were then generated using either template A or B. Two rounds of PCR were done (20 cycles of 94 C for 20 sec and 74 C for 40 sec) using a primer containing the desired alanine codon. The primer containing the alanine codon was in the forward orientation for CDR3 residues (numbering follows Kabat system, see Kabat et al. Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 4th edition (1991)) D95, S96, V100, R100a. The primer containing the alanine codon was in the reverse orientation for residues S97, N98, M99, G100b, I100c, I100d, I100e, Y100g, Y100h, F100i, D101, Y102.
The mutagenesis reactions were then followed by up to three extension reactions using six common primers.
These reactions extended the product to encompass the entire CDR3 region up to and including unique flanking restriction sites BglII and BstEII.
Primers for alanine substitution are shown below in the 5' to 3' orientation. The alanine codon is shown in bold type.
60) 5' GTG TAT TAC TGT GCG AGA GCT TCC TCA AAT ATG GTT
CGG (SEQ ID NO: 109) 59) 5' GTG TAT TAC TGT GCG AGA GAT GCC TCA AAT ATG GTT
CGG (SEQ ID NO: 110) 58) 5' AAT AAT TCC CCG AAC CAT ATT TGC GGA ATC TCT CGC
ACA GTA (SEQ ID NO: 111) 57) 5' AAT AAT TCC CCG AAC CAT AGC TGA GGA ATC TCT CGC
ACA (SEQ ID NO: 112) 56) 5' AAT AAT TCC CCG AAC GGC ATT TGA GGA ATC TCT CGC
(SEQ ID NO: 113) 55) 5' GAT TCC TCA AAT ATG GCT CGG GGA ATT ATT ATA GCG
(SEQ ID NO: 114) 54) 5' GAT TCC TCA AAT ATG GTT GCC GGA ATT ATT ATA GCG
TA (SEQ ID NO: 115) 53) 5' GTA GTC AAA ATA GTA CGC TAT AAT AAT TGC CCG AAC
CAT ATT TGA (SEQ ID NO: 116) 52) 5' GTA GTC AAA ATA GTA CGC TAT AAT GGC TCC CCG AAC
CAT ATT (SEQ ID NO: 117) 51) 5' GTA GTC AAA ATA GTA CGC TAT GGC AAT TCC CCG AAC
CAT (SEQ ID NO: 118) 50) 5' GTA GTC AAA ATA GTA CGC TGC AAT AAT TCC CCG AAC
(SEQ ID NO: 119) 20) 5' GGT GCC CTG GCC CCA GTA GTC AAA ATA GGC CGC TAT
AAT AAT TCC (SEQ ID NO: 120) 19) 5' GGT GCC CTG GCC CCA GTA GTC AAA AGC GTA CGC TAT
AAT AAT TCC (SEQ ID NO: 121) 18) 5' CAG GGT GCC CTG GCC CCA GTA GTC AGC ATA GTA CGC
TAT AAT (SEQ ID NO: 122) 17) 5' CAG GGT GCC CTG GCC CCA GTA GGC AAA ATA GTA CGC
TAT (SEQ ID NO: 123) 16a) 5' CAG GGT GCC CTG GCC CCA GGC GTC AAA ATA GTA CGC
TAT (SEQ ID NO: 124) The six common primers for extension PCR are shown below. The sequences of the flanking BglII (top strand) and BstEII (bottom strand) sites are shown in bold type.
Forward Common primers 10) 5' AGT CTG AGA TCT GAA GAC ACG GCT GTG TAT TAC TGT
GCG AGA (SEQ ID NO: 125) 11) 5' GTG TAT TAC TGT GCG AGA GAT TCC TCA AAT ATG (SEQ
ID NO: 126) 12) 5' AGA GAT TCC TCA AAT ATG GTT CGG GGA ATT ATT ATA
GCG (SEQ ID NO: 127) Reverse Common primers 13) 5' CTT GAG ACG GTG ACC AGG GTG CCC TGG CCC CA (SEQ
ID NO: 128) 14) 5' CAG GGT GCC CTG GCC CCA GTA GTC AAA ATA GTA CGC
(SEQ ID NO: 129) 15) 5' GTA GTC AAA ATA GTA CGC TAT AAT AAT TCC CCG AAC
(SEQ ID NO: 130) The following table shows the starting template and primer pairs used sequentially to build synthetic DNA fragments containing substituted alanine residues.
TABLE III
PCR
reactions CDR Template Alanine Extension Extension Extension Residue Primer pair Primers Primers Primers D95 A 60 + 14 10 + 13 S96 A 59 + 14 10 + 13 S97 B 10 + 58 10 + 15 10 + 14 10 + 13 N98 B 10 + 57 10 + 15 10 + 14 10 + 13 M99 B 10 + 56 10 + 15 10 + 14 10 + 13 V100 A 55 + 14 10 + 14 10 + 13 R100a A 54 + 14 10 + 14 10 + 13 G100b A 11 + 53 10 + 14 10 + 13 I100c A 11 + 52 10 + 14 10 + 13 I100d A 11 + 51 10 + 14 10 + 13 I100e A 11 + 50 10 + 14 10 + 13 Y100g B 11 + 20 10 + 13 Y100h B 11 + 19 10 + 13 F100i B 11 + 18 10 + 13 D101 B 11 + 17 10 + 13 Y102 B 11 + 16a 10 + 13 For primers used for alanine scanning, the PCR
conditions were 20 cycles at 94 C for 20 sec, then 74 C for 40 sec. For extension reactions with primer pair 10 + 15, the conditions were 20-25 cycles of 94 C
for 20 sec, 42 for 1 min 30 sec, 74 C for 20 sec. For extension reactions with primer pair 10 + 14, the conditions were 20-25 cycles of 94 C for 20 sec, 48-50 for 1 min 30 sec, 74 C for 20 sec. For extension reactions with primer pair 10 + 13, the conditions were 20-25 cycles of 94 C for 20 sec, 64 for 1 min 30 sec, 74 C for 20 sec. The PCR products were digested with BglII and BstEII restriction enzymes and cloned into FabAT which had been digested with BglII and BstEII, thereby replacing the CDR3 of AT with the alanine substituted CDR3. The alanine substituted constructs were verified by DNA sequencing.
Substitution variants of heavy chain CDR3 A similar strategy to that used for the alanine scanning mutagenesis was utilized for the randomization of positions S96, S97 and N98 of the heavy chain CDR3 of "AT". Templates A and B were generated as previously described. Positions 96, 97 and 98 were randomized with a set of four primer for each position. The positions in parentheses have variable nucleotides as indicated.
For position S96.
23) 5' AAT AAT TCC CCG AAC CAT ATT TGA G(AT)(ACGT) ATC
TCT CGC ACA GTA (SEQ ID NO: 131) 24) 5' AAT AAT TCC CCG AAC CAT ATT TGA G(CG)(ACGT) ATC
TCT CGC ACA GTA (SEQ ID NO: 132) 25) 5' AAT AAT TCC CCG AAC CAT ATT TGA CT(CGT) ATC TCT
CGC ACA GTA (SEQ ID NO: 133) 26) 5' AAT AAT TCC CCG AAC CAT ATT TGA C(AC)(AT) ATC
TCT CGC ACA GTA (SEQ ID NO: 134) For position S97 27) 5' AAT AAT TCC CCG AAC CAT ATT G(AT)(ACGT) GGA ATC
TCT CGC ACA GTA (SEQ ID NO: 135) 28) 5' AAT AAT TCC CCG AAC CAT ATT G(CG)(ACGT) GGA ATC
TCT CGC ACA GTA (SEQ ID NO: 136) 29) 5' AAT AAT TCC CCG AAC CAT ATT CT(CGT) GGA ATC TCT
CGC ACA GTA (SEQ ID NO: 137) 30) 5' AAT AAT TCC CCG AAC CAT ATT C(AC)(AT) GGA ATC
TCT CGC ACA GTA (SEQ ID NO: 138) For position N98 31) 5' AAT AAT TCC CCG AAC CAT G(AT)(ACGT) TGA GGA ATC
TCT CGC ACA (SEQ ID NO: 139) 32) 5' AAT AAT TCC CCG AAC CAT G(CG)(ACGT) TGA GGA ATC
TCT CGC ACA (SEQ ID NO: 140) 33) 5' AAT AAT TCC CCG AAC CAT CT(CGT) TGA GGA ATC TCT
CGC ACA (SEQ ID NO: 141) 34) 5' AAT AAT TCC CCG AAC CAT C(AC)(AT) TGA GGA ATC
TCT CGC ACA (SEQ ID NO: 142) PCR reactions were done using the reverse randomization primer and primer 10. The resulting product was extended by four sequential PCR reactions using primer pairs 10 + 15, 10 + 14, 10 + 13 and 10 +
22. The 5' end of the heavy chain variable region of "AT" was amplified from a full length clone of the "AT"
heavy chain variable region using primers 16 and 72.
All PCR products were gel purified. The randomization products were overlapped with the 16/72 product, with flanking primers being 16 and 22. The full-length variable region was then cloned into a vector containing the IgG1 constant region as a HindIII/BsmBI
fragment. Full-length antibody clones were selected by sequencing.
Primers used the overlap PCR for randomization mutants.
10 5' AGT CTG AGA TCT GAA GAC ACG GCT GTG TAT TAC TGT
GCG AGA (SEQ ID NO: 143) 16 5' CAG CAG AAG CTT AGA CCA CCA TGG ACA TGA GGG TCC
CCG CTC AGC TCC TGG G (SEQ ID NO: 144) 72 5' CAC AGC CGT GTC TTC AGA TCT CAG ACT GCG CAG CTC
(SEQ ID NO: 145) 22 5' GTG GAG GCA CTA GAG ACG GTG ACC AGG GTG (SEQ ID
NO: 146) The S96A, S97A, and N98A variants were converted from Fabs to full length antibodies by PCR
amplification of the Fab clone having the bacterial signal sequence replaced with a mammalian signal sequence. Plasmid DNA from the Fab containing the desired mutation was used as template. Sequential primer pairs used were 21 + 22, 98 + 22, and 16 + 22.
Correct clones were selected by DNA sequence analysis.
Multiple alanine variants (S96A, S97A; S96A, N98A; S97A, N98A and S96A, S97A and N98A) were generated using the converted AT heavy chain full length IgGl plasmid as template. Initial PCR reaction were carried out with one of the primers listed below and primer 22. These products were then extended using primer pairs 10 + 22. That product was then overlapped with the 16/72 product using flanking primers 16 and 22, and cloned into the IgG1 constant region as before.
Correct clones were selected by DNA sequence analysis.
S96A, S97A
63) 5' GTG TAT TAC TGT GCG AGA GAT GCC GCA AAT ATG GTT
CGG GGA ATT ATT (SEQ ID NO: 147) S96A, N98A
64) 5' GTG TAT TAC TGT GCG AGA GAT GCC TCA GCT ATG GTT
CGG GGA ATT ATT ATA GC (SEQ ID NO: 148) S97A, N98A
65) 5' GTG TAT TAC TGT GCG AGA GAT TCC GCA GCT ATG GTT
CGG GGA ATT ATT ATA GC (SEQ ID NO: 149) S96A, S97A, N98A
66) 5' GTG TAT TAC TGT GCG AGA GAT GCC GCA GCT ATG GTT
CGG GGA ATT ATT ATA GC (SEQ ID NO: 150) 21) 5' GTG GTT GAG AGG TGC CAG ATG TCA GGT CCA GCT GGT
GCA G(SEQ ID NO: 151) 98) 5' CCG CTC AGC TCC TGG GGC TCC TGC TAT TGT GGT TGA
GAG GTG CCA GAT (SEQ ID NO: 152) Insertion Variants of light chain CDR3 region The AT light chain CDR3 contains a five amino acid loop having the sequence QHTRA (SEQ ID NO: 09).
Light chain CDR3 sequence variants were constructed as follows. The following primers were used for PCR using a plasmid containing Fab "AT" light chain cDNA as a template:
(HincII)CCG GTC AAC ACA CT(ACGT)(ACGT)(GT)G
CGG CGG CGC GGG CGT TCG GCC AAG GG (SEQ ID NO: 153) where (ACGT) indicates a mixed four bases in this position.
CCG GGC GCG CCT TAT TAA CAC TC(Ascl) (SEQ ID
NO: 154) The resulting PCR product had a CDR3 loop sequence increased from five to nine amino acids and changed from QHTRA to GHTXAAARA where X can be any amino acid.
The AT clone was digested with Hincll and AscI
digestion and the "AT" light chain CDR3 region was replaced with the variant sequence. Clones containing all twenty amino acid residues in the X position along with three alanine residues inserted in the CDR3 loop were isolated and their identity confirmed by DNA
sequencing.
CGG GGA ATT ATT ATA GC (SEQ ID NO: 150) 21) 5' GTG GTT GAG AGG TGC CAG ATG TCA GGT CCA GCT GGT
GCA G(SEQ ID NO: 151) 98) 5' CCG CTC AGC TCC TGG GGC TCC TGC TAT TGT GGT TGA
GAG GTG CCA GAT (SEQ ID NO: 152) Insertion Variants of light chain CDR3 region The AT light chain CDR3 contains a five amino acid loop having the sequence QHTRA (SEQ ID NO: 09).
Light chain CDR3 sequence variants were constructed as follows. The following primers were used for PCR using a plasmid containing Fab "AT" light chain cDNA as a template:
(HincII)CCG GTC AAC ACA CT(ACGT)(ACGT)(GT)G
CGG CGG CGC GGG CGT TCG GCC AAG GG (SEQ ID NO: 153) where (ACGT) indicates a mixed four bases in this position.
CCG GGC GCG CCT TAT TAA CAC TC(Ascl) (SEQ ID
NO: 154) The resulting PCR product had a CDR3 loop sequence increased from five to nine amino acids and changed from QHTRA to GHTXAAARA where X can be any amino acid.
The AT clone was digested with Hincll and AscI
digestion and the "AT" light chain CDR3 region was replaced with the variant sequence. Clones containing all twenty amino acid residues in the X position along with three alanine residues inserted in the CDR3 loop were isolated and their identity confirmed by DNA
sequencing.
Purification of Fab Variants Alanine substitution variants of heavy chain CDR3 and insertion variants of light chain CDR3 were produced and purified as Fab fragments by the following procedure. Each variant was grown in 50 ml of 2XYT
with 2% glucose and 100 g/ml amplicillin while shaking at 37 C up to an OD600of 0.8-1Ø Each culture was then spun down and resuspended in 50m1 of 2XYT with 100 g/ml Amplicillin with 1mM IPTG at 30 C to induce production of soluble Fabs. The soluble Fabs were then migrated to periplasmic area and concentrated over-night prior to release by osmotic shock. Osmotic shock was carried on by washing the cells by cold 0.5M sucrose solution in Tris buffer and EDTA to break the bacterial cell wall and then quickly diluting it into cold solution of low osmotic strength. The released soluble Fabs were purified on TALON metal affinity chromatography via 6X
His-tagged residues on the expressed Fab. The impurities was washed away with NaCl and lower Imidazole concentrations prior to eluting the protein by Imidazole. Expression and purification of each mutant was analyzed by reducing, non-reducing and anti-His western blots. Total protein concentration was determined by A280.
Example 12 BlAcore Analysis of "AT" variants The binding constant (Kd) on rate constant (Ka) and off rate constant (kd) for "AT" antibody variants, and off rate constant (Kd) for "AT" Fab variants were determined by surface plasmon resonance techniques (BlAcore) using immobilized OPGbp [143-317].
The results are shown in Tables IV - VIII. The light chain CDR3 variants described in Example 11 did not demonstrate detectable binding.
TABLE IV
BlAcore Analysis of "AT" Fabs from Alanine Scanning Mutagenesis of Heavy Chain CDR3 Kd(s ) AT (No substituted 0.284 alanines) D95A No detectable binding S96A 7.20x10 S97A 6.20x10 N98A 1.20x10 M99A 1.12 V100A 0.261 R(100a)A 0.303 G(100b)A 0.657 I(100c)A 0.53 I(100d)A 0.622 I(100e)A 6.90x10 A(100f) 0.197 Y(100g)A 7.40x10 Y(100h)A 0.368 F(100i)A 0.251 D110A 0.127 Y111A 0.414 TABLE V
BlAcore Analysis of "AT" Abs from Alanine Scanning Mutagenesis of Heavy Chain CDR3 Ka (Ms) Kd (s-") KD (nM) AT 1.70x10 2.00x10` 1.18 S96A 60xlO5 40xlO-4 2.50 S97A 5.30x10 1.50x10` 2.90 N98A 1.30x10 9.00x10` 0.67 S96A, S97A 3.17x105 2.84x10` 8.90 S97A, N98A No detectable binding S96A, S97A, No detectable N98A binding S96A, N98A No detectable binding TABLE VI
BlAcore Analysis of "AT" Abs Substituted at S96 of Heavy Chain CDR3 Ka (M S ) Kd(S ) KD (nM) S96F 3.17x10 2.68x10` 8.45 S96Q 1.16x10 3.59x10` 3.09 S96M 3.57x10 8.70x10` 2.43 S96V 5.37x10 1.21x10` 2.25 S961 2.99x10 4.66x10` 1.56 S96N 1.40x10 2.15x10` 1.53 S96P 1.45x10 1.88x10- 1.29 S96W 1.61x10 2.03x10 1.26 S96T 3.14x10 1.67x10` 0.53 S96D 2.28x10 1.18x10 0.51 S96R 6.97x10 2.62x10 0.38 S96E 2.54x10 9.01x10 0.35 S96K 4.55x10 1.41x10- 0.31 S96L 5.84x10 1.75x10 0.30 S96H 4.12x10 7.64x10 1.86 S96G 3.87x10 1.50xIO-2 3.85 S96Y 2.75x10 0-3 0.67 TABLE VII
BlAcore Analysis of "AT" Abs Substituted at S97 of Heavy Chain CDR3 Ka (M s ) Kd (S-') KD (nM) S97F No detectable binding S97Y No detectable binding S97G No detectable binding S97W No detectable binding S97D No detectable binding S97E Fast on Fast off 1940 S97R 4.09x10 1.18x10 28.90 S97P 1.10x10 2.69x10 24.50 S97M 2.33x10 2.90x10 12.40 S97Q 7.30x10 5.98x10- 8.19 S97N 8.95x10 4.11x10 4.59 S97H 8.39xlOb 2.48x10 3.00 S97T 4.63x10 1.16x10 2.51 S97V 3.04x10 3.58x10 1.18 S97L 7.50x10 6.90x10 0.92 S971 2.10x10 1.80x10 0.87 S97K 1.45x10 5.78x10 0.40 TABLE VIII
BlAcore Analysis of "AT" Abs Substituted at N98 of Heavy Chain CDR3 Ka (M15') Kd (s-1) KD (nM) N98K No detectable binding N98F 3.70x10 9.90x10 26600 N98Y 2.72xlO5 1.12x10 41.30 N98M 2.96x10 8.14x10 27.50 N98T 2.46x10 6.62x10 26.90 N98G 2.30x10 5.59x10 24.30 N981 5.68x10 4.36x10 7.60 N98W 2.62x10 6 7.68x10 2.93 N98E 2.72x10 3.59x10 1.32 N98P 1.51x10 1.71x10 1.13 N98H 2.20x10 2.34xl0 1.06 N98L 1.48x10 1.22x10 0.82 N98Q 1.86x10 _3 0.81 N98S 2.67x10 1.54x10 0.58 N98D 6.85x10 3.12x10 0.46 N98V 4.56x10 1.97x10 0.43 N98R 3.59x10 1.08x10 0.30 While the present invention has been described in terms of preferred embodiments, it was understood that variations and modifications will occur to those skilled in the art. Therefore, it was intended that the appended claims cover all such equivalent variations which would come within the scope of the invention as claimed.
SEQUENCE LISTING
<110> AMGEN INC.
<120> Antagonistic Selective Binding Agents Of Osteoprotegerin Binding Protein <130> 08-895589CA
<140> 2,400,929 <141> 2001-02-23 <150> 09/511,139 <151> 2000-02-23 <150> 09/791,153 <151> 2001-02-22 <160> 154 <170> Patentln version 3.0 <210> 1 <211> 11 <212> PRT
<213> Homo sapiens <400> 1 Arg Ala Ser Gln Ser Ile Ser Arg Tyr Leu Asn <210> 2 <211> 11 <212> PRT
<213> Homo sapiens <400> 2 Arg Ala Ser Gln Ser Val Gly Ser Tyr Leu Ala <210> 3 <211> 12 <212> PRT
<213> Homo sapiens <400> 3 Arg Ala Ser Gln Ser Val Ser Ser Ser Ser Leu Ala <210> 4 <211> 9 <212> PRT
<213> Homo sapiens <400> 4 Ser Gly Asp Ala Leu Pro Lys Gln Tyr <210> 5 <211> 7 <212> PRT
<213> Homo sapiens <400> 5 Gly Ala Ser Ser Leu Gln Ser <210> 6 <211> 7 <212> PRT
<213> Homo sapiens <400> 6 Asp Ala Thr Asn Arg Ala Thr <210> 7 <211> 7 <212> PRT
<213> Homo sapiens <400> 7 Gly Ala Ser Ser Arg Ala Thr <210> 8 <211> 7 <212> PRT
<213> Homo sapiens <400> 8 Glu Asp Ser Glu Arg Pro Ser <210> 9 <211> 5 <212> PRT
<213> Homo sapiens <400> 9 Gln His Thr Arg Ala <210> 10 <211> 5 <212> PRT
<213> Homo sapiens <400> 10 Gln His Arg Arg Thr <210> 11 <211> 5 <212> PRT
<213> Homo sapiens <400> 11 Gln Gln Tyr Gly Ala <210> 12 <211> ii <212> PRT
<213> Homo sapiens <400> 12 Gln Ser Thr Asp Ser Ser Gly Thr Tyr Val Val <210> 13 <211> 5 <212> PRT
<213> Homo sapiens <400> 13 Asn Tyr Ala Ile His <210> 14 <211> 5 <212> PRT
<213> Homo sapiens <400> 14 Asn Tyr Pro Met His <210> 15 <211> 5 <212> PRT
<213> Homo sapiens <400> 15 Asp Tyr Ala Met His <210> 16 <211> 17 <212> PRT
<213> Homo sapiens <400> 16 Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys Phe Gln Gly <210> 17 <211> 17 <212> PRT
<213> Homo sapiens <400> 17 Val Ile Ser Tyr Asp Gly Asn Asn Lys Tyr Tyr Ala Asp Ser Val Lys Gly <210> 18 <211> 17 <212> PRT
<213> Homo sapiens <400> 18 Gly Ile Ser Trp Asn Ser Gly Arg Ile Gly Tyr Ala Asp Ser Val Lys Gly <210> 19 <211> 17 <212> PRT
<213> Homo sapiens <400> 19 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 20 <211> 7 <212> PRT
<213> Homo sapiens <400> 20 Gly Gly Gly Gly Phe Asp Tyr <210> 21 <211> 14 <212> PRT
<213> Homo sapiens <400> 21 Gly Gly Ser Thr Ser Ala Arg Tyr Ser Ser Gly Trp Tyr Tyr <210> 22 <211> 18 <212> DNA
<213> Homo sapiens <400> 22 ccgactttgc acctagtt 18 <210> 23 <211> 24 <212> DNA
<213> Homo sapiens <400> 23 tttgtcgtct ttccagacgt tagt 24 <210> 24 <211> 20 <212> PRT
<213> Homo sapiens <400> 24 Thr Asp Ile Pro Ser Gly Ser His Lys Val Ser Leu Ser Ser Trp Tyr His Asp Arg Gly <210> 25 <211> 19 <212> PRT
<213> Homo sapiens <400> 25 Met Glu Trp Ser Trp Val Phe Leu Phe Phe Leu Ser Val Thr Thr Gly Val His Ser <210> 26 <211> 45 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (18)..(44) <400> 26 cagaagctta gaccacc atg gaa tgg agc tgg gtc ttt ctc ttc t 45 Met Glu Trp Ser Trp Val Phe Leu Phe <210> 27 <211> 9 <212> PRT
<213> Homo sapiens <400> 27 Met Glu Trp Ser Trp Val Phe Leu Phe <210> 28 <211> 44 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (2) .. (43) <400> 28 a get ggg tct ttc tct tct tcc tgt cag taa cga ctg gtg tcc a 44 Ala Gly Ser Phe Ser Ser Ser Cys Gln Arg Leu Val Ser <210> 29 <211> 9 <212> PRT
<213> Homo sapiens <400> 29 Ala Gly Ser Phe Ser Ser Ser Cys Gln <210> 30 <211> 4 <212> PRT
<213> Homo sapiens <400> 30 Arg Leu Val Ser <210> 31 <211> 42 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(42) <400> 31 tca gta acg act ggt gtc cac tca cag gtc cag ctg gtg cag 42 Ser Val Thr Thr Gly Val His Ser Gln Val Gln Leu Val Gln <210> 32 <211> 14 <212> PRT
<213> Homo sapiens <400> 32 Ser Val Thr Thr Gly Val His Ser Gln Val Gln Leu Val Gln <210> 33 <211> 30 <212> DNA
<213> Homo sapiens <400> 33 gtggaggcac tagagacggt gaccagggtg 30 <210> 34 <211> 22 <212> PRT
<213> Homo sapiens <400> 34 Met Asp Met Arg Val Pro Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp Leu Arg Gly Ala Arg Cys <210> 35 <211> 48 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (17)..(46) <400> 35 cagaagcttg accacc atg gac atg agg gtc ccc get cag ctc ctg gg 48 Met Asp Met Arg Val Pro Ala Gln Leu Leu <210> 36 <211> 10 <212> PRT
<213> Homo sapiens <400> 36 Met Asp Met Arg Val Pro Ala Gln Leu Leu <210> 37 <211> 48 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (3) .. (47) <400> 37 cc get cag ctc ctg ggg ctc ctg cta ttg tgg ttg aga ggt gcc aga t 48 Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp Leu Arg Gly Ala Arg <210> 38 <211> 15 <212> PRT
<213> Homo sapiens <400> 38 Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp Leu Arg Gly Ala Arg <210> 39 <211> 44 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (2)..(43) <400> 39 g tgg ttg aga ggt gcc aga tgt gaa att gtg atg aca cag tct c 44 Trp Leu Arg Gly Ala Arg Cys Glu Ile Val Met Thr Gln Ser <210> 40 <211> 14 <212> PRT
<213> Homo sapiens <400> 40 Trp Leu Arg Gly Ala Arg Cys Glu Ile Val Met Thr Gln Ser <210> 41 <211> 32 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (20)..(31) <400> 41 tttggacgtc gacttatta aca ctc tcc cct g 32 Thr Leu Ser Pro <210> 42 <211> 4 <212> PRT
<213> Homo sapiens <400> 42 Thr Leu Ser Pro <210> 43 <211> 30 <212> PRT
<213> Homo sapiens <400> 43 Met Asp Ala Met Lys Arg Gly Leu Cys Cys Val Leu Leu Leu Cys Gly Ala Val Phe Val Phe Ser Pro Ser Arg Gly Arg Phe Arg Arg <210> 44 <211> 645 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(645) <400> 44 tct cac agt gca ctt gaa att gtg atg acg cag tct cca tcc tcc ctg 48 Ser His Ser Ala Leu Glu Ile Val Met Thr Gln Ser Pro Ser Ser Leu tct gcg tct gtt gga gac aga gtc acc atc act tgc cgg gca agt cag 96 Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln agc att agc aga tat tta aat tgg tat cag ctt aaa cca ggg aaa gcc 144 Ser Ile Ser Arg Tyr Leu Asn Trp Tyr Gln Leu Lys Pro Gly Lys Ala cct agg ctc ctg atc tat ggt gca tcc agt ttg caa agt gga gtc cca 192 Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Leu Gln Ser Gly Val Pro tca agg ttc agt ggc agt gga tct ggg gca gag ttc act ctc acc atc 240 Ser Arg Phe Ser Gly Ser Gly Ser Gly Ala Glu Phe Thr Leu Thr Ile agc agt cta caa cct gaa gac att gcc act tac tac tgt caa cac act 288 Ser Ser Leu Gln Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Gln His Thr cgg gcg ttc ggc caa ggg acc aag gtt gaa atc aag cga act gtg get 336 Arg Ala Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala gca cca tct gtc ttc atc ttc ccg cca tct gat gag cag ttg aaa tct 384 Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser gga act gcc tct gtt gtg tgc ctg ctg aat aac ttc tat ccc aga gag 432 Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu gcc aaa gta cag tgg aag gtg gat aac gcc ctc caa tcg ggt aac tcc 480 Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser cag gag agt gcc aca gag cag gac agc aag gac agc acc tac agc ctc 528 Gln Glu Ser Ala Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu agc agc acc ctg acg ctg agc aaa gca gac tac gag aaa cac aaa gtc 576 Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val tac gcc tgc gaa gtc acc cat cag ggc ctg agc tcg ccc gtc aca aag 624 Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys agc ttc aac agg gga gag tgt 645 Ser Phe Asn Arg Gly Glu Cys <210> 45 <211> 215 <212> PRT
<213> Homo sapiens <400> 45 Ser His Ser Ala Leu Glu Ile Val Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Arg Tyr Leu Asn Trp Tyr Gln Leu Lys Pro Gly Lys Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Ala Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Gln His Thr Arg Ala Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Ala Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 46 <211> 645 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(645) <400> 46 tct cac agt gca ctt gaa att gtg ctg act cag tct cca gcc acc ctg 48 Ser His Ser Ala Leu Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu tct ttt tct ccg ggt gaa aga gcc acc ctc tcc tgc agg gcc agt cag 96 Ser Phe Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln agt gtt ggc agc tac tta gcc tgg tac cag cag aga cct ggc cag get 144 Ser Val Gly Ser Tyr Leu Ala Trp Tyr Gln Gln Arg Pro Gly Gln Ala ccc agg ccc ctc atc tat gat gca acc aac agg gcc act ggc atc cca 192 Pro Arg Pro Leu Ile Tyr Asp Ala Thr Asn Arg Ala Thr Gly Ile Pro acc agg ttc agt ggc agt ggg tct ggg aca gac ttc act ctc acc atc 240 Thr Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile agc agc cta gag cct gaa gat ttt gca act tat tac tgt caa cac cga 288 Ser Ser Leu Glu Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln His Arg agg act ttt ggc cgg ggg acc aag ttg gag atc aaa cga act gtg get 336 Arg Thr Phe Gly Arg Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala gca cca tct gtc ttc atc ttc ccg cca tct gat gag cag ttg aaa tct 384 Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser gga act gcc tct gtt gtg tgc ctg ctg aat aac ttc tat ccc aga gag 432 Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu gcc aaa gta cag tgg aag gtg gat aac gcc ctc caa tcg ggt aac tcc 480 Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gin Ser Gly Asn Ser cag gag agt gtc aca gag cag gac agc aag gac agc acc tac agc ctc 528 Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu agc agc acc ctg acg ctg agc aaa gca gac tac gag aaa cac aaa gtc 576 Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val tac gcc tgc gaa gtc act cat cag ggc ctg agc tcg ccc gtc aca aag 624 Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys agc ttc aac agg gga gag tgt 645 Ser Phe Asn Arg Gly Glu Cys <210> 47 <211> 215 <212> PRT
<213> Homo sapiens <400> 47 Ser His Ser Ala Leu Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Phe Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Gly Ser Tyr Leu Ala Trp Tyr Gln Gln Arg Pro Gly Gln Ala Pro Arg Pro Leu Ile Tyr Asp Ala Thr Asn Arg Ala Thr Gly Ile Pro Thr Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln His Arg Arg Thr Phe Gly Arg Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gin Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 48 <211> 645 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(645) <400> 48 cac agt gca ctt gaa att gtg atg aca cag tct cca ggc acc ctg tct 48 His Ser Ala Leu Glu Ile Val Met Thr Gln Ser Pro Gly Thr Leu Ser ttg tct cca ggg gaa aga gcc acc ctc tcc tgc agg gcc agt cag agt 96 Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gin Ser gtt agc agc agc tcc tta gcc tgg tac cag cag aaa cct ggc cag get 144 Val Ser Ser Ser Ser Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala ccc agg ctc ctc atc tat ggt gca tcc agc agg gcc act ggc atc cca 192 Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro gac agg ttc agt ggc agt ggg tct ggg aca gac ttc act ctc acc atc 240 Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile agc aga ctg gag cct gaa gat ttt gca gtg tat tac tgt cag cag tat 288 Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr ggt get ttc ggc gga ggg acc aag gtg gag atc aaa cga act gtg get 336 Gly Ala Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala gca cca tct gtc ttc atc ttc ccg cca tct gat gag cag ttg aaa tct 384 Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser gga act gcc tct gtt gtg tgc ctg ctg aat aac ttc tat ccc aga gag 432 Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu gcc aaa gta cag tgg aag gtg gat aac gcc ctc caa tcg ggt aac tcc 480 Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser cag gag agt gtc aca gag cag gac agc aag gac agc acc tac agc ctc 528 Gin Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu agc agc acc ctg acg ctg agc aaa gca gac tac gag aaa cac aaa gtc 576 Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val tac gcc tgc gaa gtc acc cat cag ggc ctg aac tcg ccc gtc aca aag 624 Tyr Ala Cys Glu Val Thr His Gln Gly Leu Asn Ser Pro Val Thr Lys agc ttc aac agg gga gag tgt 645 Ser Phe Asn Arg Gly Glu Cys <210> 49 <211> 215 <212> PRT
<213> Homo sapiens <400> 49 His Ser Ala Leu Glu Ile Val Met Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Ser Ser Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr Gly Ala Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gin Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Asn Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 50 <211> 654 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(654) <400> 50 tct cac agt gca cag tct gtg ctg act cag cca ccc tcg gtg tca gtg 48 Ser His Ser Ala Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Val tcc cca gga cag acg gcc acg atc acc tgc tct gga gat gca ttg cca 96 Ser Pro Gly Gln Thr Ala Thr Ile Thr Cys Ser Gly Asp Ala Leu Pro aag caa tat gtt tat tgg tac cgg cag aag cca ggc cag gcc cct cta 144 Lys Gln Tyr Val Tyr Trp Tyr Arg Gln Lys Pro Gly Gln Ala Pro Leu ttg gtg ata tat gaa gac agt gag agg ccc tca ggg atc cct gaa cga 192 Leu Val Ile Tyr Glu Asp Ser Glu Arg Pro Ser Gly Ile Pro Glu Arg ttc tct ggc tcc agt tca ggg act gaa gtc acg ttg agt atc agt gga 240 Phe Ser Gly Ser Ser Ser Gly Thr Glu Val Thr Leu Ser Ile Ser Gly gtc cag gca gaa gac gag get gac tat tat tgt caa tca aca gac agc 288 Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Thr Asp Ser agt ggg act tat gtc gtc ttc ggc gga ggg acc aag ctg acc gtc cta 336 Ser Gly Thr Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu agt cag ccc aag get gcc ccc tcg gtc act ctg ttc ccg ccc tcc tct 384 Ser Gln Pro Lys Ala Ala Pro Ser Val Thr Leu Phe Pro Pro Ser Ser gag gag ctt caa gcc aac aag gcc aca ctg gtg tgt ctc ata agt gac 432 Glu Glu Leu Gln Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Ser Asp ttc tac ccg gga gcc gtg aca gtg gcc tgg aag gca gat agc agc ccc 480 Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Ser Ser Pro gtc aag gcg gga gtg gag acc acc aca ccc tcc aaa caa agc aac aac 528 Val Lys Ala Gly Val Glu Thr Thr Thr Pro Ser Lys Gln Ser Asn Asn aag tac gcg gcc agc agc tat ctg agc ctg acg cct gag cag tgg aag 576 Lys Tyr Ala Ala Ser Ser Tyr Leu Ser Leu Thr Pro Glu Gln Trp Lys tcc cac aga agc tac agc tgc cag gtc acg cat gaa ggg agc acc gtg 624 Ser His Arg Ser Tyr Ser Cys Gln Val Thr His Glu Gly Ser Thr Val gag aag aca gtg gcc cct aca gaa tgt tca 654 Glu Lys Thr Val Ala Pro Thr Glu Cys Ser <210> 51 <211> 218 <212> PRT
<213> Homo sapiens <400> 51 Ser His Ser Ala Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln Thr Ala Thr Ile Thr Cys Ser Gly Asp Ala Leu Pro Lys Gln Tyr Val Tyr Trp Tyr Arg Gln Lys Pro Gly Gln Ala Pro Leu Leu Val Ile Tyr Glu Asp Ser Glu Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser Ser Ser Gly Thr Glu Val Thr Leu Ser Ile Ser Gly Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Thr Asp Ser Ser Gly Thr Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Ser Gin Pro Lys Ala Ala Pro Ser Val Thr Leu Phe Pro Pro Ser Ser Glu Glu Leu Gln Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Ser Asp Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Ser Ser Pro Val Lys Ala Gly Val Glu Thr Thr Thr Pro Ser Lys Gln Ser Asn Asn Lys Tyr Ala Ala Ser Ser Tyr Leu Ser Leu Thr Pro Glu Gln Trp Lys Ser His Arg Ser Tyr Ser Cys Gln Val Thr His Glu Gly Ser Thr Val Glu Lys Thr Val Ala Pro Thr Glu Cys Ser <210> 52 <211> 690 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(690) <400> 52 gcc cag gtc cag ctg gtg cag tct ggg get gag gtg agg aag cct ggg 48 Ala Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly gcc tca gtg aag gtt tcc tgc aag get tct gga tac gac ttc agt aat 96 Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn tat get ata cat tgg gtg cgc cag gcc ccc gga caa agg ctt gag tgg 144 Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp atg gga tgg atc aac get ggc aat ggg aac aca aaa ttt tca cag aag 192 Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys ttc cag ggc aga atc acc gtt acc agg gac aca gcc gcg agc aca gcc 240 Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala tac atg gag ctg cgc agt ctg aga tct gaa gac acg get gtg tat tac 288 Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr tgt gcg aga gat tcc tca aat atg gtt cgg gga att att ata gcg tac 336 Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr tat ttt gac tac tgg ggc cag ggc acc ctg gtc acc gtc tca agc gcc 384 Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala tcc acc aag ggc cca tcg gtc ttc ccc ctg gca ccc tcc tcc aag agc 432 Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser acc tct ggg ggc aca gcg gcc ctg ggc tgc ctg gtc aag gac tac ttc 480 Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe ccc gaa ccg gtg acg gtg tcg tgg aac tca ggc gcc ctg acc agc ggc 528 Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly gtc cac acc ttc ccg get gtc cta cag tcc tca gga ctc tac tcc ctc 576 Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu agc agc gta gtg acc gtg ccc tcc agc agc ttg ggc acc cag acc tac 624 Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr atc tgc aac gtg aat cac aag ccc agc aac acc aag gtg gac aag aaa 672 Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys gtt gag ccc aaa tct tgt 690 Val Glu Pro Lys Ser Cys <210> 53 <211> 230 <212> PRT
<213> Homo sapiens <400> 53 Ala Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys <210> 54 <211> 690 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1) .. (690) <400> 54 gcc gag gtc cag ctg gtg cag tct ggg get gag gtg agg aag cct ggg 48 Ala Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly gcc tca gtg aag gtt tcc tgc aag get tct gga tac gac ttc agt aat 96 Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn tat get ata cat tgg gtg cgc cag gcc ccc gga caa agg ctt gag tgg 144 Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp atg gga tgg atc aac get ggc aat ggg aac aca aaa ttt tca cag aag 192 Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys ttc cag ggc aga atc acc gtt acc agg gac aca gcc gcg agc aca gcc 240 Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala tac atg gag ctg cgc agt ctg aga tct gaa gac acg get gtg tat tac 288 Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr tgt gcg aga gat tcc tca aat atg gtt cgg gga att att ata gcg tac 336 Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr tat ttt gac tac tgg ggc cag ggc acc ctg gtc acc gtc tca agc gcc 384 Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala tcc acc aag ggc cca tcg gtc ttc ccc ctg gca ccc tcc tcc aag agc 432 Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser acc tct ggg ggc aca gcg gcc ctg ggc tgc ctg gtc aag gac tac ttc 480 Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe ccc gaa ccg gtg acg gtg tcg tgg aac tca ggc gcc ctg acc agc ggc 528 Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly gtc cac acc ttc ccg get gtc cta cag tcc tca gga ctc tac tcc ctc 576 Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu agc agc gta gtg acc gtg ccc tcc agc agc ttg ggc acc cag acc tac 624 Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr atc tgc aac gtg aat cac aag ccc agc aac acc aag gtg gac aag aaa 672 Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys gtt gag ccc aaa tct tgt 690 Val Glu Pro Lys Ser Cys <210> 55 <211> 230 <212> PRT
<213> Homo sapiens <400> 55 Ala Glu Val Gin Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys <210> 56 <211> 660 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(660) <400> 56 gcc gag gtc cag ctg gtg cag tct ggg gga ggc ttg gtc cag cct ggg 48 Ala Glu Val Gln Leu Val Gln Ser Gly Gly Gly Leu Val Gln Pro Gly ggg tcc ctg aga ctc tcc tgt tta gtc tct gga ttc acc ttc aat aac 96 Gly Ser Leu Arg Leu Ser Cys Leu Val Ser Gly Phe Thr Phe Asn Asn tat cct atg cac tgg gtc cgc cag get cca ggc aag ggg ctg gag tgg 144 Tyr Pro Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp gtg gca gtt ata tca tat gat gga aat aat aaa tac tac gca gac tcc 192 Val Ala Val Ile Ser Tyr Asp Gly Asn Asn Lys Tyr Tyr Ala Asp Ser gtg aag ggc cga ttc acc atc tcc aga gac aat tcc aag aac acg ctg 240 Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu tat ttg caa atg aac agc ctg aga tct gag gac acg gcc gtg tat tac 288 Tyr Leu Gln Met Asn Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr tgt gcg agg ggg ggc ggt ggc ttt gac tac tgg ggc cag gga acc ctg 336 Cys Ala Arg Gly Gly Gly Gly Phe Asp Tyr Trp Gly Gln Gly Thr Leu gtc acc gtc tca agc gcc tcc acc aag ggc cca tcg gtc ttc ccc ctg 384 Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu gca ccc tcc tcc aag agc acc tct ggg ggc aca gcg gcc ctg ggc tgc 432 Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys ctg gtc aag gac tac ttc ccc gaa ccg gtg acg gtg tcg tgg aac tca 480 Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser ggc gcc ctg acc agc ggc gtc cac acc ttc ccg get gtc cta cag tcc 528 Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser tca gga ctc tac tcc ctc agc agc gta gtg acc gtg ccc tcc agc agc 576 Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser ttg ggc acc cag acc tac atc tgc aac gtg aat cac aag CCC agc aac 624 Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn acc aag gtg gac aag aaa gtt gag ccc aaa tct tgt 660 Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys <210> 57 <211> 220 <212> PRT
<213> Homo sapiens <400> 57 Ala Glu Val Gln Leu Val Gln Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Leu Val Ser Gly Phe Thr Phe Asn Asn Tyr Pro Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Val Ile Ser Tyr Asp Gly Asn Asn Lys Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Gly Gly Gly Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys <210> 58 <211> 681 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(681) <400> 58 gcc gag gtg cag ctg ctg gag tct ggg gga ggc ttg gta caa cct ggc 48 Ala Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly agg tcc ctg aga ctc tcc tgt gca gcc tct gga ttc acc ttt gat gat 96 Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp tat gcc atg cac tgg gtc cgg caa get cca ggg aag ggc ctg gag tgg 144 Tyr Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp gtc tca ggt att agt tgg aat agt ggt agg ata ggc tat gcg gac tct 192 Val Ser Gly Ile Ser Trp Asn Ser Gly Arg Ile Gly Tyr Ala Asp Ser gtg aag ggc cga ttc acc atc tcc aga gac aac gcc aag aac tcc ctg 240 Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu tat ctg caa atg aac agt ctg aga cct gag gac acg gcc ttc tat tac 288 Tyr Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Phe Tyr Tyr tgt gca aaa ggg ggt tct aca agc gcg agg tat agc agt ggc tgg tac 336 Cys Ala Lys Gly Gly Ser Thr Ser Ala Arg Tyr Ser Ser Gly Trp Tyr tac tgg ggc cag ggc acc ctg gtc acc gtc tca agc gcc tcc acc aag 384 Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys ggc cca tcg gtc ttc ccc ctg gca ccc tcc tcc aag agc acc tct ggg 432 Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly ggc aca gcg gcc ctg ggc tgc ctg gtc aag gac tac ttc ccc gaa ccg 480 Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro gtg acg gtg tcg tgg aac tca ggc gcc ctg acc agc ggc gtc cac acc 528 Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr ttc ccg get gtc cta cag tcc tca gga ctc tac tcc ctc agc agc gta 576 Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val gtg acc gtg ccc tcc agc agc ttg ggc acc cag acc tac atc tgc aac 624 Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn gtg aat cac aag ccc agc aac acc aag gtg gac aag aaa gtt gag ccc 672 Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro aaa tct tgt 681 Lys Ser Cys <210> 59 <211> 227 <212> PRT
<213> Homo sapiens <400> 59 Ala Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Ser Trp Asn Ser Gly Arg Ile Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Phe Tyr Tyr Cys Ala Lys Gly Gly Ser Thr Ser Ala Arg Tyr Ser Ser Gly Trp Tyr Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys <210> 60 <211> 141 <212> PRT
<213> Homo sapiens <400> 60 Gln Val Gin Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Ala Met His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Tyr Ser Gln Lys Phe Gln Gly Arg Val Thr Ile Thr Arg Asp Thr Ser Ala Ser Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Leu Leu Trp Phe Gly Glu Leu Leu Tyr Tyr Tyr Gly Ser Gly Ser Tyr Tyr Asn Ile Thr Met Val Arg Gly Val Ile Ile Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 61 <211> 126 <212> PRT
<213> Homo sapiens <400> 61 Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 62 <211> 126 <212> PRT
<213> Homo sapiens <400> 62 Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 63 <211> 113 <212> PRT
<213> Homo sapiens <400> 63 Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Val Ile Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 64 <211> 116 <212> PRT
<213> Homo sapiens <400> 64 Glu Val Gln Leu Val Gln Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Leu Val Ser Gly Phe Thr Phe Asn Asn Tyr Pro Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Val Ile Ser Tyr Asp Gly Asn Asn Lys Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Gly Gly Gly Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 65 <211> 132 <212> PRT
<213> Homo sapiens <400> 65 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Ser Trp Asn Ser Gly Ser Ile Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Leu Tyr Tyr Cys Ala Lys Asp Gly Tyr Ser Ser Gly Trp Tyr Gly Ile Ala Val Ala Gly Val Gln Trp Leu Val Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 66 <211> 123 <212> PRT
<213> Homo sapiens <400> 66 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Ser Trp Asn Ser Gly Arg Ile Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Phe Tyr Tyr Cys Ala Lys Gly Gly Ser Thr Ser Ala Arg Tyr Ser Ser Gly Trp Tyr Tyr Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser <210> 67 <211> 107 <212> PRT
<213> Homo sapiens <400> 67 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser Thr Pro Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys <210> 68 <211> 103 <212> PRT
<213> Homo sapiens <400> 68 Glu Ile Val Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Arg Tyr Leu Asn Trp Tyr Gln Leu Lys Pro Gly Lys Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Ala Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Gln His Thr Arg Ala Phe Gly Gln Gly Thr Lys Val Glu Ile Lys <210> 69 <211> 107 <212> PRT
<213> Homo sapiens <400> 69 Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr Asp Ala Ser Asn Arg Ala Thr Gly Ile Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Arg Ser Asn Trp Pro Tyr Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys <210> 70 <211> 103 <212> PRT
<213> Homo sapiens <400> 70 Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Phe Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Gly Ser Tyr Leu Ala Trp Tyr Gln Gln Arg Pro Gly Gln Ala Pro Arg Pro Leu Ile Tyr Asp Ala Thr Asn Arg Ala Thr Gly Ile Pro Thr Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln His Arg Arg Thr Phe Gly Arg Gly Thr Lys Leu Glu Ile Lys <210> 71 <211> 107 <212> PRT
<213> Homo sapiens <400> 71 Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr Asp Ala Ser Asn Arg Ala Thr Gly Ile Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Arg Ser Asn Trp Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys <210> 72 <211> 104 <212> PRT
<213> Homo sapiens <400> 72 Glu Ile Val Met Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Ser Ser Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr Gly Ala Phe Gly Gly Gly Thr Lys Val Glu Ile Lys <210> 73 <211> 108 <212> PRT
<213> Homo sapiens <400> 73 Ser Tyr Glu Leu Met Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln Thr Ala Arg Ile Thr Cys Ser Gly Asp Ala Leu Pro Lys Gln Tyr Ala Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val Ile Tyr Lys Asp Ser Glu Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser Ser Ser Gly Thr Thr Val Thr Leu Thr Ile Ser Gly Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Ala Asp Ser Ser Gly Thr Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu <210> 74 <211> 108 <212> PRT
<213> Homo sapiens <400> 74 Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln Thr Ala Thr Ile Thr Cys Ser Gly Asp Ala Leu Pro Lys Gln Tyr Val Tyr Trp Tyr Arg Gln Lys Pro Gly Gln Ala Pro Leu Leu Val Ile Tyr Glu Asp Ser Glu Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser Ser Ser Gly Thr Glu Val Thr Leu Ser Ile Ser Gly Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Thr Asp Ser Ser Gly Thr Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu <210> 75 <211> 522 <212> DNA
<213> Mus musculus <220>
<221> CDS
<222> (4)..(513) <400> 75 cat atg gac tac aag gac gac gat gac aag aag ctt aag cct gag gcc 48 Met Asp Tyr Lys Asp Asp Asp Asp Lys Lys Leu Lys Pro Glu Ala cag cca ttt gca cac ctc acc atc aat get gcc agc atc cca tcg ggt 96 Gln Pro Phe Ala His Leu Thr Ile Asn Ala Ala Ser Ile Pro Ser Gly tcc cat aaa gtc act ctg tcc tct tgg tac cac gat cga ggc tgg gcc 144 Ser His Lys Val Thr Leu Ser Ser Trp Tyr His Asp Arg Gly Trp Ala aag atc tct aac atg acg tta agc aac gga aaa cta agg gtt aac caa 192 Lys Ile Ser Asn Met Thr Leu Ser Asn Gly Lys Leu Arg Val Asn Gln gat ggc ttc tat tac ctg tac get aac att tgc ttt cgg cat cat gaa 240 Asp Gly Phe Tyr Tyr Leu Tyr Ala Asn Ile Cys Phe Arg His His Glu aca tcg gga gac ctg get act gaa tat ctt cag ctg atg gtg tat gtc 288 Thr Ser Gly Asp Leu Ala Thr Glu Tyr Leu Gln Leu Met Val Tyr Val gtt aaa acc agc atc aaa atc cca agt tct cat aac ctg atg aaa gga 336 Val Lys Thr Ser Ile Lys Ile Pro Ser Ser His Asn Leu Met Lys Gly ggg agc acg aaa aac tgg tcg ggc aat tct gaa ttc cac ttt tat tcc 384 Gly Ser Thr Lys Asn Trp Ser Gly Asn Ser Glu Phe His Phe Tyr Ser ata aat gtt ggg gga ttt ttc aag ctc cga get ggt gaa gaa att agc 432 Ile Asn Val Gly Gly Phe Phe Lys Leu Arg Ala Gly Glu Glu Ile Ser att cag gtg tcc aac cct tcc ctg ctg gat ccg gat caa gat gcg acg 480 Ile Gln Val Ser Asn Pro Ser Leu Leu Asp Pro Asp Gln Asp Ala Thr tac ttt ggg get ttc aaa gtt cag gac ata gac taactcgag 522 Tyr Phe Gly Ala Phe Lys Val Gln Asp Ile Asp <210> 76 <211> 170 <212> PRT
<213> Mus musculus <400> 76 Met Asp Tyr Lys Asp Asp Asp Asp Lys Lys Leu Lys Pro Glu Ala Gln Pro Phe Ala His Leu Thr Ile Asn Ala Ala Ser Ile Pro Ser Gly Ser His Lys Val Thr Leu Ser Ser Trp Tyr His Asp Arg Gly Trp Ala Lys Ile Ser Asn Met Thr Leu Ser Asn Gly Lys Leu Arg Val Asn Gln Asp Gly Phe Tyr Tyr Leu Tyr Ala Asn Ile Cys Phe Arg His His Glu Thr Ser Gly Asp Leu Ala Thr Glu Tyr Leu Gln Leu Met Val Tyr Val Val Lys Thr Ser Ile Lys Ile Pro Ser Ser His Asn Leu Met Lys Gly Gly Ser Thr Lys Asn Trp Ser Gly Asn Ser Glu Phe His Phe Tyr Ser Ile Asn Val Gly Gly Phe Phe Lys Leu Arg Ala Gly Glu Glu Ile Ser Ile Gln Val Ser Asn Pro Ser Leu Leu Asp Pro Asp Gln Asp Ala Thr Tyr Phe Gly Ala Phe Lys Val Gln Asp Ile Asp <210> 77 <211> 39 <212> PRT
<213> Homo sapiens <400> 77 Gly Phe Tyr Tyr Leu Tyr Ala Asn Ile Cys Phe Arg His His Glu Thr Ser Gly Asp Leu Ala Thr Glu Tyr Leu Gln Leu Met Val Tyr Val Thr Lys Thr Ser Ile Lys Ile Pro <210> 78 <211> 39 <212> PRT
<213> Mus musculus <400> 78 Gly Phe Tyr Tyr Leu Tyr Ala Asn Ile Cys Phe Arg His His Glu Thr Ser Gly Ser Val Pro Thr Asp Tyr Leu Gln Leu Met Val Tyr Val Val Lys Thr Ser Ile Lys Ile Pro <210> 79 <211> 39 <212> PRT
<213> Mus musculus <400> 79 Gly Phe Tyr Tyr Leu Tyr Ala Asn Ile Cys Phe Arg His His Glu Thr Ser Gly Asp Leu Ala Thr Glu Tyr Leu Gln Leu Met Val Tyr Val Val Lys Thr Ser Ile Lys Ile Pro <210> 80 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (1) .. (1) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 80 Xaa Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 81 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (2)..(2) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 81 Asp Xaa Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 82 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (3) .. (3) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 82 Asp Ser Xaa Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 83 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (4) .. (4) <223> x is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 83 Asp Ser Ser Xaa Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 84 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (5) .. (5) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 84 Asp Ser Ser Asn Xaa Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 85 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (6) .. (6) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 85 Asp Ser Ser Asn Met Xaa Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 86 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (7) .. (7) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 86 Asp Ser Ser Asn Met Val Xaa Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 87 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (8)..(8) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 87 Asp Ser Ser Asn Met Val Arg Xaa Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 88 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (9) .. (9) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 88 Asp Ser Ser Asn Met Val Arg Gly Xaa Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 89 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (10)..(10) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 89 Asp Ser Ser Asn Met Val Arg Gly Ile Xaa Ile Ala Tyr Tyr Phe Asp Tyr <210> 90 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (11)..(11) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 90 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Xaa Ala Tyr Tyr Phe Asp Tyr <210> 91 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (12)..(12) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 91 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Xaa Tyr Tyr Phe Asp Tyr <210> 92 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (13)..(13) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 92 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Xaa Tyr Phe Asp Tyr <210> 93 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (14)..(14) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> mist feature <223> Synthetic <400> 93 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Xaa Phe Asp Tyr <210> 94 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> mist feature <222> (15)..(15) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> mist feature <223> Synthetic <400> 94 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Xaa Asp Tyr <210> 95 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (16)..(16) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 95 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Xaa Tyr <210> 96 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (17)..(17) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 96 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Xaa <210> 97 <211> 9 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (4)..(7) <223> First occurrence of x from left to right denotes any amino acid r esidue other than arginine, the second, third and fourth occurren ces of X denote any amino acid residu <220>
<221> misc feature <223> Synthetic <400> 97 Gln His Thr Xaa Xaa Xaa Xaa Arg Ala <210> 98 <211> 9 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (4) .. (4) <223> X is any amino acid residue other than arginine <220>
<221> misc feature <223> Synthetic <400> 98 Gln His Thr Xaa Ala Ala Ala Arg Ala <210> 99 <211> 10 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic <400> 99 Asp Tyr Lys Asp Asp Asp Asp Lys Lys Leu <210> 100 <211> 23 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 100 cctctcatat ggactacaag gac 23 <210> 101 <211> 30 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 101 agtagccagg tctcccgatg tttcatgatg 30 <210> 102 <211> 30 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 102 ctggctactg aatatcttca gctgatggtg 30 <210> 103 <211> 25 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 103 cctctcctcg agttagtcta tgtcc 25 <210> 104 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic <400> 104 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 105 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 105 agagattcct caaatatggt tcggggaatt attatagcg 39 <210> 106 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 106 gtagtcaaaa tagtacgcta taataattcc ccgaac 36 <210> 107 <211> 33 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 107 gtgtattact gtgcgagaga ttcctcaaat atg 33 <210> 108 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 108 cagggtgccc tggccccagt agtcaaaata gtacgc 36 <210> 109 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 109 gtgtattact gtgcgagagc ttcctcaaat atggttcgg 39 <210> 110 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 110 gtgtattact gtgcgagaga tgcctcaaat atggttcgg 39 <210> 111 <211> 42 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 111 aataattccc cgaaccatat ttgcggaatc tctcgcacag to 42 <210> 112 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 112 aataattccc cgaaccatag ctgaggaatc tctcgcaca 39 <210> 113 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 113 aataattccc cgaacggcat ttgaggaatc tctcgc 36 <210> 114 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 114 gattcctcaa atatggctcg gggaattatt atagcg 36 <210> 115 <211> 38 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 115 gattcctcaa atatggttgc cggaattatt atagcgta 38 <210> 116 <211> 45 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 116 gtagtcaaaa tagtacgcta taataattgc ccgaaccata tttga 45 <210> 117 <211> 42 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 117 gtagtcaaaa tagtacgcta taatggctcc ccgaaccata tt 42 <210> 118 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 118 gtagtcaaaa tagtacgcta tggcaattcc ccgaaccat 39 <210> 119 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 119 gtagtcaaaa tagtacgctg caataattcc ccgaac 36 <210> 120 <211> 45 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 120 ggtgccctgg ccccagtagt caaaataggc cgctataata attcc 45 <210> 121 <211> 45 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 121 ggtgccctgg ccccagtagt caaaagcgta cgctataata attcc 45 <210> 122 <211> 42 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 122 cagggtgccc tggccccagt agtcagcata gtacgctata at 42 <210> 123 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 123 cagggtgccc tggccccagt aggcaaaata gtacgctat 39 <210> 124 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 124 cagggtgccc tggccccagg cgtcaaaata gtacgctat 39 <210> 125 <211> 42 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 125 agtctgagat ctgaagacac ggctgtgtat tactgtgcga ga 42 <210> 126 <211> 33 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 126 gtgtattact gtgcgagaga ttcctcaaat atg 33 <210> 127 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 127 agagattcct caaatatggt tcggggaatt attatagcg 39 <210> 128 <211> 32 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 128 cttgagacgg tgaccagggt gccctggccc ca 32 <210> 129 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 129 cagggtgccc tggccccagt agtcaaaata gtacgc 36 <210> 130 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 130 gtagtcaaaa tagtacgcta taataattcc ccgaac 36 <210> 131 <211> 46 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 131 aataattccc cgaaccatat ttgagatacg tatctctcgc acagta 46 <210> 132 <211> 46 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 132 aataattccc cgaaccatat ttgagcgacg tatctctcgc acagta 46 <210> 133 <211> 44 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 133 aataattccc cgaaccatat ttgactcgta tctctcgcac agta 44 <210> 134 <211> 44 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 134 aataattccc cgaaccatat ttgacacata tctctcgcac agta 44 <210> 135 <211> 46 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 135 aataattccc cgaaccatat tgatacgtgg aatctctcgc acagta 46 <210> 136 <211> 46 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 136 aataattccc cgaaccatat tgcgacgtgg aatctctcgc acagta 46 <210> 137 <211> 44 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 137 aataattccc cgaaccatat tctcgtggaa tctctcgcac agta 44 <210> 138 <211> 44 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 138 aataattccc cgaaccatat tcacatggaa tctctcgcac agta 44 <210> 139 <211> 43 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 139 aataattccc cgaaccatga tacgttgagg aatctctcgc aca 43 <210> 140 <211> 43 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 140 aataattccc cgaaccatgc gacgttgagg aatctctcgc aca 43 <210> 141 <211> 41 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 141 aataattccc cgaaccatct cgttgaggaa tctctcgcac a 41 <210> 142 <211> 41 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 142 aataattccc cgaaccatca cattgaggaa tctctcgcac a 41 <210> 143 <211> 42 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 143 agtctgagat ctgaagacac ggctgtgtat tactgtgcga ga 42 <210> 144 <211> 52 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 144 cagcagaagc ttagaccacc atggacatga gggtccccgc tcagctcctg gg 52 <210> 145 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 145 cacagccgtg tcttcagatc tcagactgcg cagctc 36 <210> 146 <211> 30 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 146 gtggaggcac tagagacggt gaccagggtg 30 <210> 147 <211> 48 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 147 gtgtattact gtgcgagaga tgccgcaaat atggttcggg gaattatt 48 <210> 148 <211> 53 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 148 gtgtattact gtgcgagaga tgcctcagct atggttcggg gaattattat agc 53 <210> 149 <211> 53 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 149 gtgtattact gtgcgagaga ttccgcagct atggttcggg gaattattat agc 53 <210> 150 <211> 53 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 150 gtgtattact gtgcgagaga tgccgcagct atggttcggg gaattattat agc 53 <210> 151 <211> 40 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 151 gtggttgaga ggtgccagat gtcaggtcca gctggtgcag 40 <210> 152 <211> 48 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 152 ccgctcagct cctggggctc ctgctattgt ggttgagagg tgccagat 48 <210> 153 <211> 51 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 153 ccggtcaaca cactacgtac gtgtgcggcg gcgcgggcgt tcggccaagg g 51 <210> 154 <211> 23 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 154 ccgggcgcgc cttattaaca ctc 23
with 2% glucose and 100 g/ml amplicillin while shaking at 37 C up to an OD600of 0.8-1Ø Each culture was then spun down and resuspended in 50m1 of 2XYT with 100 g/ml Amplicillin with 1mM IPTG at 30 C to induce production of soluble Fabs. The soluble Fabs were then migrated to periplasmic area and concentrated over-night prior to release by osmotic shock. Osmotic shock was carried on by washing the cells by cold 0.5M sucrose solution in Tris buffer and EDTA to break the bacterial cell wall and then quickly diluting it into cold solution of low osmotic strength. The released soluble Fabs were purified on TALON metal affinity chromatography via 6X
His-tagged residues on the expressed Fab. The impurities was washed away with NaCl and lower Imidazole concentrations prior to eluting the protein by Imidazole. Expression and purification of each mutant was analyzed by reducing, non-reducing and anti-His western blots. Total protein concentration was determined by A280.
Example 12 BlAcore Analysis of "AT" variants The binding constant (Kd) on rate constant (Ka) and off rate constant (kd) for "AT" antibody variants, and off rate constant (Kd) for "AT" Fab variants were determined by surface plasmon resonance techniques (BlAcore) using immobilized OPGbp [143-317].
The results are shown in Tables IV - VIII. The light chain CDR3 variants described in Example 11 did not demonstrate detectable binding.
TABLE IV
BlAcore Analysis of "AT" Fabs from Alanine Scanning Mutagenesis of Heavy Chain CDR3 Kd(s ) AT (No substituted 0.284 alanines) D95A No detectable binding S96A 7.20x10 S97A 6.20x10 N98A 1.20x10 M99A 1.12 V100A 0.261 R(100a)A 0.303 G(100b)A 0.657 I(100c)A 0.53 I(100d)A 0.622 I(100e)A 6.90x10 A(100f) 0.197 Y(100g)A 7.40x10 Y(100h)A 0.368 F(100i)A 0.251 D110A 0.127 Y111A 0.414 TABLE V
BlAcore Analysis of "AT" Abs from Alanine Scanning Mutagenesis of Heavy Chain CDR3 Ka (Ms) Kd (s-") KD (nM) AT 1.70x10 2.00x10` 1.18 S96A 60xlO5 40xlO-4 2.50 S97A 5.30x10 1.50x10` 2.90 N98A 1.30x10 9.00x10` 0.67 S96A, S97A 3.17x105 2.84x10` 8.90 S97A, N98A No detectable binding S96A, S97A, No detectable N98A binding S96A, N98A No detectable binding TABLE VI
BlAcore Analysis of "AT" Abs Substituted at S96 of Heavy Chain CDR3 Ka (M S ) Kd(S ) KD (nM) S96F 3.17x10 2.68x10` 8.45 S96Q 1.16x10 3.59x10` 3.09 S96M 3.57x10 8.70x10` 2.43 S96V 5.37x10 1.21x10` 2.25 S961 2.99x10 4.66x10` 1.56 S96N 1.40x10 2.15x10` 1.53 S96P 1.45x10 1.88x10- 1.29 S96W 1.61x10 2.03x10 1.26 S96T 3.14x10 1.67x10` 0.53 S96D 2.28x10 1.18x10 0.51 S96R 6.97x10 2.62x10 0.38 S96E 2.54x10 9.01x10 0.35 S96K 4.55x10 1.41x10- 0.31 S96L 5.84x10 1.75x10 0.30 S96H 4.12x10 7.64x10 1.86 S96G 3.87x10 1.50xIO-2 3.85 S96Y 2.75x10 0-3 0.67 TABLE VII
BlAcore Analysis of "AT" Abs Substituted at S97 of Heavy Chain CDR3 Ka (M s ) Kd (S-') KD (nM) S97F No detectable binding S97Y No detectable binding S97G No detectable binding S97W No detectable binding S97D No detectable binding S97E Fast on Fast off 1940 S97R 4.09x10 1.18x10 28.90 S97P 1.10x10 2.69x10 24.50 S97M 2.33x10 2.90x10 12.40 S97Q 7.30x10 5.98x10- 8.19 S97N 8.95x10 4.11x10 4.59 S97H 8.39xlOb 2.48x10 3.00 S97T 4.63x10 1.16x10 2.51 S97V 3.04x10 3.58x10 1.18 S97L 7.50x10 6.90x10 0.92 S971 2.10x10 1.80x10 0.87 S97K 1.45x10 5.78x10 0.40 TABLE VIII
BlAcore Analysis of "AT" Abs Substituted at N98 of Heavy Chain CDR3 Ka (M15') Kd (s-1) KD (nM) N98K No detectable binding N98F 3.70x10 9.90x10 26600 N98Y 2.72xlO5 1.12x10 41.30 N98M 2.96x10 8.14x10 27.50 N98T 2.46x10 6.62x10 26.90 N98G 2.30x10 5.59x10 24.30 N981 5.68x10 4.36x10 7.60 N98W 2.62x10 6 7.68x10 2.93 N98E 2.72x10 3.59x10 1.32 N98P 1.51x10 1.71x10 1.13 N98H 2.20x10 2.34xl0 1.06 N98L 1.48x10 1.22x10 0.82 N98Q 1.86x10 _3 0.81 N98S 2.67x10 1.54x10 0.58 N98D 6.85x10 3.12x10 0.46 N98V 4.56x10 1.97x10 0.43 N98R 3.59x10 1.08x10 0.30 While the present invention has been described in terms of preferred embodiments, it was understood that variations and modifications will occur to those skilled in the art. Therefore, it was intended that the appended claims cover all such equivalent variations which would come within the scope of the invention as claimed.
SEQUENCE LISTING
<110> AMGEN INC.
<120> Antagonistic Selective Binding Agents Of Osteoprotegerin Binding Protein <130> 08-895589CA
<140> 2,400,929 <141> 2001-02-23 <150> 09/511,139 <151> 2000-02-23 <150> 09/791,153 <151> 2001-02-22 <160> 154 <170> Patentln version 3.0 <210> 1 <211> 11 <212> PRT
<213> Homo sapiens <400> 1 Arg Ala Ser Gln Ser Ile Ser Arg Tyr Leu Asn <210> 2 <211> 11 <212> PRT
<213> Homo sapiens <400> 2 Arg Ala Ser Gln Ser Val Gly Ser Tyr Leu Ala <210> 3 <211> 12 <212> PRT
<213> Homo sapiens <400> 3 Arg Ala Ser Gln Ser Val Ser Ser Ser Ser Leu Ala <210> 4 <211> 9 <212> PRT
<213> Homo sapiens <400> 4 Ser Gly Asp Ala Leu Pro Lys Gln Tyr <210> 5 <211> 7 <212> PRT
<213> Homo sapiens <400> 5 Gly Ala Ser Ser Leu Gln Ser <210> 6 <211> 7 <212> PRT
<213> Homo sapiens <400> 6 Asp Ala Thr Asn Arg Ala Thr <210> 7 <211> 7 <212> PRT
<213> Homo sapiens <400> 7 Gly Ala Ser Ser Arg Ala Thr <210> 8 <211> 7 <212> PRT
<213> Homo sapiens <400> 8 Glu Asp Ser Glu Arg Pro Ser <210> 9 <211> 5 <212> PRT
<213> Homo sapiens <400> 9 Gln His Thr Arg Ala <210> 10 <211> 5 <212> PRT
<213> Homo sapiens <400> 10 Gln His Arg Arg Thr <210> 11 <211> 5 <212> PRT
<213> Homo sapiens <400> 11 Gln Gln Tyr Gly Ala <210> 12 <211> ii <212> PRT
<213> Homo sapiens <400> 12 Gln Ser Thr Asp Ser Ser Gly Thr Tyr Val Val <210> 13 <211> 5 <212> PRT
<213> Homo sapiens <400> 13 Asn Tyr Ala Ile His <210> 14 <211> 5 <212> PRT
<213> Homo sapiens <400> 14 Asn Tyr Pro Met His <210> 15 <211> 5 <212> PRT
<213> Homo sapiens <400> 15 Asp Tyr Ala Met His <210> 16 <211> 17 <212> PRT
<213> Homo sapiens <400> 16 Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys Phe Gln Gly <210> 17 <211> 17 <212> PRT
<213> Homo sapiens <400> 17 Val Ile Ser Tyr Asp Gly Asn Asn Lys Tyr Tyr Ala Asp Ser Val Lys Gly <210> 18 <211> 17 <212> PRT
<213> Homo sapiens <400> 18 Gly Ile Ser Trp Asn Ser Gly Arg Ile Gly Tyr Ala Asp Ser Val Lys Gly <210> 19 <211> 17 <212> PRT
<213> Homo sapiens <400> 19 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 20 <211> 7 <212> PRT
<213> Homo sapiens <400> 20 Gly Gly Gly Gly Phe Asp Tyr <210> 21 <211> 14 <212> PRT
<213> Homo sapiens <400> 21 Gly Gly Ser Thr Ser Ala Arg Tyr Ser Ser Gly Trp Tyr Tyr <210> 22 <211> 18 <212> DNA
<213> Homo sapiens <400> 22 ccgactttgc acctagtt 18 <210> 23 <211> 24 <212> DNA
<213> Homo sapiens <400> 23 tttgtcgtct ttccagacgt tagt 24 <210> 24 <211> 20 <212> PRT
<213> Homo sapiens <400> 24 Thr Asp Ile Pro Ser Gly Ser His Lys Val Ser Leu Ser Ser Trp Tyr His Asp Arg Gly <210> 25 <211> 19 <212> PRT
<213> Homo sapiens <400> 25 Met Glu Trp Ser Trp Val Phe Leu Phe Phe Leu Ser Val Thr Thr Gly Val His Ser <210> 26 <211> 45 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (18)..(44) <400> 26 cagaagctta gaccacc atg gaa tgg agc tgg gtc ttt ctc ttc t 45 Met Glu Trp Ser Trp Val Phe Leu Phe <210> 27 <211> 9 <212> PRT
<213> Homo sapiens <400> 27 Met Glu Trp Ser Trp Val Phe Leu Phe <210> 28 <211> 44 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (2) .. (43) <400> 28 a get ggg tct ttc tct tct tcc tgt cag taa cga ctg gtg tcc a 44 Ala Gly Ser Phe Ser Ser Ser Cys Gln Arg Leu Val Ser <210> 29 <211> 9 <212> PRT
<213> Homo sapiens <400> 29 Ala Gly Ser Phe Ser Ser Ser Cys Gln <210> 30 <211> 4 <212> PRT
<213> Homo sapiens <400> 30 Arg Leu Val Ser <210> 31 <211> 42 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(42) <400> 31 tca gta acg act ggt gtc cac tca cag gtc cag ctg gtg cag 42 Ser Val Thr Thr Gly Val His Ser Gln Val Gln Leu Val Gln <210> 32 <211> 14 <212> PRT
<213> Homo sapiens <400> 32 Ser Val Thr Thr Gly Val His Ser Gln Val Gln Leu Val Gln <210> 33 <211> 30 <212> DNA
<213> Homo sapiens <400> 33 gtggaggcac tagagacggt gaccagggtg 30 <210> 34 <211> 22 <212> PRT
<213> Homo sapiens <400> 34 Met Asp Met Arg Val Pro Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp Leu Arg Gly Ala Arg Cys <210> 35 <211> 48 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (17)..(46) <400> 35 cagaagcttg accacc atg gac atg agg gtc ccc get cag ctc ctg gg 48 Met Asp Met Arg Val Pro Ala Gln Leu Leu <210> 36 <211> 10 <212> PRT
<213> Homo sapiens <400> 36 Met Asp Met Arg Val Pro Ala Gln Leu Leu <210> 37 <211> 48 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (3) .. (47) <400> 37 cc get cag ctc ctg ggg ctc ctg cta ttg tgg ttg aga ggt gcc aga t 48 Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp Leu Arg Gly Ala Arg <210> 38 <211> 15 <212> PRT
<213> Homo sapiens <400> 38 Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp Leu Arg Gly Ala Arg <210> 39 <211> 44 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (2)..(43) <400> 39 g tgg ttg aga ggt gcc aga tgt gaa att gtg atg aca cag tct c 44 Trp Leu Arg Gly Ala Arg Cys Glu Ile Val Met Thr Gln Ser <210> 40 <211> 14 <212> PRT
<213> Homo sapiens <400> 40 Trp Leu Arg Gly Ala Arg Cys Glu Ile Val Met Thr Gln Ser <210> 41 <211> 32 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (20)..(31) <400> 41 tttggacgtc gacttatta aca ctc tcc cct g 32 Thr Leu Ser Pro <210> 42 <211> 4 <212> PRT
<213> Homo sapiens <400> 42 Thr Leu Ser Pro <210> 43 <211> 30 <212> PRT
<213> Homo sapiens <400> 43 Met Asp Ala Met Lys Arg Gly Leu Cys Cys Val Leu Leu Leu Cys Gly Ala Val Phe Val Phe Ser Pro Ser Arg Gly Arg Phe Arg Arg <210> 44 <211> 645 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(645) <400> 44 tct cac agt gca ctt gaa att gtg atg acg cag tct cca tcc tcc ctg 48 Ser His Ser Ala Leu Glu Ile Val Met Thr Gln Ser Pro Ser Ser Leu tct gcg tct gtt gga gac aga gtc acc atc act tgc cgg gca agt cag 96 Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln agc att agc aga tat tta aat tgg tat cag ctt aaa cca ggg aaa gcc 144 Ser Ile Ser Arg Tyr Leu Asn Trp Tyr Gln Leu Lys Pro Gly Lys Ala cct agg ctc ctg atc tat ggt gca tcc agt ttg caa agt gga gtc cca 192 Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Leu Gln Ser Gly Val Pro tca agg ttc agt ggc agt gga tct ggg gca gag ttc act ctc acc atc 240 Ser Arg Phe Ser Gly Ser Gly Ser Gly Ala Glu Phe Thr Leu Thr Ile agc agt cta caa cct gaa gac att gcc act tac tac tgt caa cac act 288 Ser Ser Leu Gln Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Gln His Thr cgg gcg ttc ggc caa ggg acc aag gtt gaa atc aag cga act gtg get 336 Arg Ala Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala gca cca tct gtc ttc atc ttc ccg cca tct gat gag cag ttg aaa tct 384 Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser gga act gcc tct gtt gtg tgc ctg ctg aat aac ttc tat ccc aga gag 432 Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu gcc aaa gta cag tgg aag gtg gat aac gcc ctc caa tcg ggt aac tcc 480 Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser cag gag agt gcc aca gag cag gac agc aag gac agc acc tac agc ctc 528 Gln Glu Ser Ala Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu agc agc acc ctg acg ctg agc aaa gca gac tac gag aaa cac aaa gtc 576 Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val tac gcc tgc gaa gtc acc cat cag ggc ctg agc tcg ccc gtc aca aag 624 Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys agc ttc aac agg gga gag tgt 645 Ser Phe Asn Arg Gly Glu Cys <210> 45 <211> 215 <212> PRT
<213> Homo sapiens <400> 45 Ser His Ser Ala Leu Glu Ile Val Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Arg Tyr Leu Asn Trp Tyr Gln Leu Lys Pro Gly Lys Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Ala Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Gln His Thr Arg Ala Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Ala Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 46 <211> 645 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(645) <400> 46 tct cac agt gca ctt gaa att gtg ctg act cag tct cca gcc acc ctg 48 Ser His Ser Ala Leu Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu tct ttt tct ccg ggt gaa aga gcc acc ctc tcc tgc agg gcc agt cag 96 Ser Phe Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln agt gtt ggc agc tac tta gcc tgg tac cag cag aga cct ggc cag get 144 Ser Val Gly Ser Tyr Leu Ala Trp Tyr Gln Gln Arg Pro Gly Gln Ala ccc agg ccc ctc atc tat gat gca acc aac agg gcc act ggc atc cca 192 Pro Arg Pro Leu Ile Tyr Asp Ala Thr Asn Arg Ala Thr Gly Ile Pro acc agg ttc agt ggc agt ggg tct ggg aca gac ttc act ctc acc atc 240 Thr Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile agc agc cta gag cct gaa gat ttt gca act tat tac tgt caa cac cga 288 Ser Ser Leu Glu Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln His Arg agg act ttt ggc cgg ggg acc aag ttg gag atc aaa cga act gtg get 336 Arg Thr Phe Gly Arg Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala gca cca tct gtc ttc atc ttc ccg cca tct gat gag cag ttg aaa tct 384 Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser gga act gcc tct gtt gtg tgc ctg ctg aat aac ttc tat ccc aga gag 432 Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu gcc aaa gta cag tgg aag gtg gat aac gcc ctc caa tcg ggt aac tcc 480 Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gin Ser Gly Asn Ser cag gag agt gtc aca gag cag gac agc aag gac agc acc tac agc ctc 528 Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu agc agc acc ctg acg ctg agc aaa gca gac tac gag aaa cac aaa gtc 576 Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val tac gcc tgc gaa gtc act cat cag ggc ctg agc tcg ccc gtc aca aag 624 Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys agc ttc aac agg gga gag tgt 645 Ser Phe Asn Arg Gly Glu Cys <210> 47 <211> 215 <212> PRT
<213> Homo sapiens <400> 47 Ser His Ser Ala Leu Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Phe Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Gly Ser Tyr Leu Ala Trp Tyr Gln Gln Arg Pro Gly Gln Ala Pro Arg Pro Leu Ile Tyr Asp Ala Thr Asn Arg Ala Thr Gly Ile Pro Thr Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln His Arg Arg Thr Phe Gly Arg Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gin Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 48 <211> 645 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(645) <400> 48 cac agt gca ctt gaa att gtg atg aca cag tct cca ggc acc ctg tct 48 His Ser Ala Leu Glu Ile Val Met Thr Gln Ser Pro Gly Thr Leu Ser ttg tct cca ggg gaa aga gcc acc ctc tcc tgc agg gcc agt cag agt 96 Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gin Ser gtt agc agc agc tcc tta gcc tgg tac cag cag aaa cct ggc cag get 144 Val Ser Ser Ser Ser Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala ccc agg ctc ctc atc tat ggt gca tcc agc agg gcc act ggc atc cca 192 Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro gac agg ttc agt ggc agt ggg tct ggg aca gac ttc act ctc acc atc 240 Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile agc aga ctg gag cct gaa gat ttt gca gtg tat tac tgt cag cag tat 288 Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr ggt get ttc ggc gga ggg acc aag gtg gag atc aaa cga act gtg get 336 Gly Ala Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala gca cca tct gtc ttc atc ttc ccg cca tct gat gag cag ttg aaa tct 384 Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser gga act gcc tct gtt gtg tgc ctg ctg aat aac ttc tat ccc aga gag 432 Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu gcc aaa gta cag tgg aag gtg gat aac gcc ctc caa tcg ggt aac tcc 480 Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser cag gag agt gtc aca gag cag gac agc aag gac agc acc tac agc ctc 528 Gin Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu agc agc acc ctg acg ctg agc aaa gca gac tac gag aaa cac aaa gtc 576 Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val tac gcc tgc gaa gtc acc cat cag ggc ctg aac tcg ccc gtc aca aag 624 Tyr Ala Cys Glu Val Thr His Gln Gly Leu Asn Ser Pro Val Thr Lys agc ttc aac agg gga gag tgt 645 Ser Phe Asn Arg Gly Glu Cys <210> 49 <211> 215 <212> PRT
<213> Homo sapiens <400> 49 His Ser Ala Leu Glu Ile Val Met Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Ser Ser Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr Gly Ala Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gin Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Asn Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 50 <211> 654 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(654) <400> 50 tct cac agt gca cag tct gtg ctg act cag cca ccc tcg gtg tca gtg 48 Ser His Ser Ala Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Val tcc cca gga cag acg gcc acg atc acc tgc tct gga gat gca ttg cca 96 Ser Pro Gly Gln Thr Ala Thr Ile Thr Cys Ser Gly Asp Ala Leu Pro aag caa tat gtt tat tgg tac cgg cag aag cca ggc cag gcc cct cta 144 Lys Gln Tyr Val Tyr Trp Tyr Arg Gln Lys Pro Gly Gln Ala Pro Leu ttg gtg ata tat gaa gac agt gag agg ccc tca ggg atc cct gaa cga 192 Leu Val Ile Tyr Glu Asp Ser Glu Arg Pro Ser Gly Ile Pro Glu Arg ttc tct ggc tcc agt tca ggg act gaa gtc acg ttg agt atc agt gga 240 Phe Ser Gly Ser Ser Ser Gly Thr Glu Val Thr Leu Ser Ile Ser Gly gtc cag gca gaa gac gag get gac tat tat tgt caa tca aca gac agc 288 Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Thr Asp Ser agt ggg act tat gtc gtc ttc ggc gga ggg acc aag ctg acc gtc cta 336 Ser Gly Thr Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu agt cag ccc aag get gcc ccc tcg gtc act ctg ttc ccg ccc tcc tct 384 Ser Gln Pro Lys Ala Ala Pro Ser Val Thr Leu Phe Pro Pro Ser Ser gag gag ctt caa gcc aac aag gcc aca ctg gtg tgt ctc ata agt gac 432 Glu Glu Leu Gln Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Ser Asp ttc tac ccg gga gcc gtg aca gtg gcc tgg aag gca gat agc agc ccc 480 Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Ser Ser Pro gtc aag gcg gga gtg gag acc acc aca ccc tcc aaa caa agc aac aac 528 Val Lys Ala Gly Val Glu Thr Thr Thr Pro Ser Lys Gln Ser Asn Asn aag tac gcg gcc agc agc tat ctg agc ctg acg cct gag cag tgg aag 576 Lys Tyr Ala Ala Ser Ser Tyr Leu Ser Leu Thr Pro Glu Gln Trp Lys tcc cac aga agc tac agc tgc cag gtc acg cat gaa ggg agc acc gtg 624 Ser His Arg Ser Tyr Ser Cys Gln Val Thr His Glu Gly Ser Thr Val gag aag aca gtg gcc cct aca gaa tgt tca 654 Glu Lys Thr Val Ala Pro Thr Glu Cys Ser <210> 51 <211> 218 <212> PRT
<213> Homo sapiens <400> 51 Ser His Ser Ala Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln Thr Ala Thr Ile Thr Cys Ser Gly Asp Ala Leu Pro Lys Gln Tyr Val Tyr Trp Tyr Arg Gln Lys Pro Gly Gln Ala Pro Leu Leu Val Ile Tyr Glu Asp Ser Glu Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser Ser Ser Gly Thr Glu Val Thr Leu Ser Ile Ser Gly Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Thr Asp Ser Ser Gly Thr Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Ser Gin Pro Lys Ala Ala Pro Ser Val Thr Leu Phe Pro Pro Ser Ser Glu Glu Leu Gln Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Ser Asp Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Ser Ser Pro Val Lys Ala Gly Val Glu Thr Thr Thr Pro Ser Lys Gln Ser Asn Asn Lys Tyr Ala Ala Ser Ser Tyr Leu Ser Leu Thr Pro Glu Gln Trp Lys Ser His Arg Ser Tyr Ser Cys Gln Val Thr His Glu Gly Ser Thr Val Glu Lys Thr Val Ala Pro Thr Glu Cys Ser <210> 52 <211> 690 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(690) <400> 52 gcc cag gtc cag ctg gtg cag tct ggg get gag gtg agg aag cct ggg 48 Ala Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly gcc tca gtg aag gtt tcc tgc aag get tct gga tac gac ttc agt aat 96 Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn tat get ata cat tgg gtg cgc cag gcc ccc gga caa agg ctt gag tgg 144 Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp atg gga tgg atc aac get ggc aat ggg aac aca aaa ttt tca cag aag 192 Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys ttc cag ggc aga atc acc gtt acc agg gac aca gcc gcg agc aca gcc 240 Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala tac atg gag ctg cgc agt ctg aga tct gaa gac acg get gtg tat tac 288 Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr tgt gcg aga gat tcc tca aat atg gtt cgg gga att att ata gcg tac 336 Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr tat ttt gac tac tgg ggc cag ggc acc ctg gtc acc gtc tca agc gcc 384 Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala tcc acc aag ggc cca tcg gtc ttc ccc ctg gca ccc tcc tcc aag agc 432 Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser acc tct ggg ggc aca gcg gcc ctg ggc tgc ctg gtc aag gac tac ttc 480 Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe ccc gaa ccg gtg acg gtg tcg tgg aac tca ggc gcc ctg acc agc ggc 528 Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly gtc cac acc ttc ccg get gtc cta cag tcc tca gga ctc tac tcc ctc 576 Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu agc agc gta gtg acc gtg ccc tcc agc agc ttg ggc acc cag acc tac 624 Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr atc tgc aac gtg aat cac aag ccc agc aac acc aag gtg gac aag aaa 672 Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys gtt gag ccc aaa tct tgt 690 Val Glu Pro Lys Ser Cys <210> 53 <211> 230 <212> PRT
<213> Homo sapiens <400> 53 Ala Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys <210> 54 <211> 690 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1) .. (690) <400> 54 gcc gag gtc cag ctg gtg cag tct ggg get gag gtg agg aag cct ggg 48 Ala Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly gcc tca gtg aag gtt tcc tgc aag get tct gga tac gac ttc agt aat 96 Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn tat get ata cat tgg gtg cgc cag gcc ccc gga caa agg ctt gag tgg 144 Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp atg gga tgg atc aac get ggc aat ggg aac aca aaa ttt tca cag aag 192 Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys ttc cag ggc aga atc acc gtt acc agg gac aca gcc gcg agc aca gcc 240 Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala tac atg gag ctg cgc agt ctg aga tct gaa gac acg get gtg tat tac 288 Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr tgt gcg aga gat tcc tca aat atg gtt cgg gga att att ata gcg tac 336 Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr tat ttt gac tac tgg ggc cag ggc acc ctg gtc acc gtc tca agc gcc 384 Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala tcc acc aag ggc cca tcg gtc ttc ccc ctg gca ccc tcc tcc aag agc 432 Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser acc tct ggg ggc aca gcg gcc ctg ggc tgc ctg gtc aag gac tac ttc 480 Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe ccc gaa ccg gtg acg gtg tcg tgg aac tca ggc gcc ctg acc agc ggc 528 Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly gtc cac acc ttc ccg get gtc cta cag tcc tca gga ctc tac tcc ctc 576 Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu agc agc gta gtg acc gtg ccc tcc agc agc ttg ggc acc cag acc tac 624 Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr atc tgc aac gtg aat cac aag ccc agc aac acc aag gtg gac aag aaa 672 Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys gtt gag ccc aaa tct tgt 690 Val Glu Pro Lys Ser Cys <210> 55 <211> 230 <212> PRT
<213> Homo sapiens <400> 55 Ala Glu Val Gin Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys <210> 56 <211> 660 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(660) <400> 56 gcc gag gtc cag ctg gtg cag tct ggg gga ggc ttg gtc cag cct ggg 48 Ala Glu Val Gln Leu Val Gln Ser Gly Gly Gly Leu Val Gln Pro Gly ggg tcc ctg aga ctc tcc tgt tta gtc tct gga ttc acc ttc aat aac 96 Gly Ser Leu Arg Leu Ser Cys Leu Val Ser Gly Phe Thr Phe Asn Asn tat cct atg cac tgg gtc cgc cag get cca ggc aag ggg ctg gag tgg 144 Tyr Pro Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp gtg gca gtt ata tca tat gat gga aat aat aaa tac tac gca gac tcc 192 Val Ala Val Ile Ser Tyr Asp Gly Asn Asn Lys Tyr Tyr Ala Asp Ser gtg aag ggc cga ttc acc atc tcc aga gac aat tcc aag aac acg ctg 240 Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu tat ttg caa atg aac agc ctg aga tct gag gac acg gcc gtg tat tac 288 Tyr Leu Gln Met Asn Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr tgt gcg agg ggg ggc ggt ggc ttt gac tac tgg ggc cag gga acc ctg 336 Cys Ala Arg Gly Gly Gly Gly Phe Asp Tyr Trp Gly Gln Gly Thr Leu gtc acc gtc tca agc gcc tcc acc aag ggc cca tcg gtc ttc ccc ctg 384 Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu gca ccc tcc tcc aag agc acc tct ggg ggc aca gcg gcc ctg ggc tgc 432 Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys ctg gtc aag gac tac ttc ccc gaa ccg gtg acg gtg tcg tgg aac tca 480 Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser ggc gcc ctg acc agc ggc gtc cac acc ttc ccg get gtc cta cag tcc 528 Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser tca gga ctc tac tcc ctc agc agc gta gtg acc gtg ccc tcc agc agc 576 Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser ttg ggc acc cag acc tac atc tgc aac gtg aat cac aag CCC agc aac 624 Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn acc aag gtg gac aag aaa gtt gag ccc aaa tct tgt 660 Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys <210> 57 <211> 220 <212> PRT
<213> Homo sapiens <400> 57 Ala Glu Val Gln Leu Val Gln Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Leu Val Ser Gly Phe Thr Phe Asn Asn Tyr Pro Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Val Ile Ser Tyr Asp Gly Asn Asn Lys Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Gly Gly Gly Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys <210> 58 <211> 681 <212> DNA
<213> Homo sapiens <220>
<221> CDS
<222> (1)..(681) <400> 58 gcc gag gtg cag ctg ctg gag tct ggg gga ggc ttg gta caa cct ggc 48 Ala Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly agg tcc ctg aga ctc tcc tgt gca gcc tct gga ttc acc ttt gat gat 96 Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp tat gcc atg cac tgg gtc cgg caa get cca ggg aag ggc ctg gag tgg 144 Tyr Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp gtc tca ggt att agt tgg aat agt ggt agg ata ggc tat gcg gac tct 192 Val Ser Gly Ile Ser Trp Asn Ser Gly Arg Ile Gly Tyr Ala Asp Ser gtg aag ggc cga ttc acc atc tcc aga gac aac gcc aag aac tcc ctg 240 Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu tat ctg caa atg aac agt ctg aga cct gag gac acg gcc ttc tat tac 288 Tyr Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Phe Tyr Tyr tgt gca aaa ggg ggt tct aca agc gcg agg tat agc agt ggc tgg tac 336 Cys Ala Lys Gly Gly Ser Thr Ser Ala Arg Tyr Ser Ser Gly Trp Tyr tac tgg ggc cag ggc acc ctg gtc acc gtc tca agc gcc tcc acc aag 384 Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys ggc cca tcg gtc ttc ccc ctg gca ccc tcc tcc aag agc acc tct ggg 432 Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly ggc aca gcg gcc ctg ggc tgc ctg gtc aag gac tac ttc ccc gaa ccg 480 Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro gtg acg gtg tcg tgg aac tca ggc gcc ctg acc agc ggc gtc cac acc 528 Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr ttc ccg get gtc cta cag tcc tca gga ctc tac tcc ctc agc agc gta 576 Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val gtg acc gtg ccc tcc agc agc ttg ggc acc cag acc tac atc tgc aac 624 Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn gtg aat cac aag ccc agc aac acc aag gtg gac aag aaa gtt gag ccc 672 Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro aaa tct tgt 681 Lys Ser Cys <210> 59 <211> 227 <212> PRT
<213> Homo sapiens <400> 59 Ala Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Ser Trp Asn Ser Gly Arg Ile Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Phe Tyr Tyr Cys Ala Lys Gly Gly Ser Thr Ser Ala Arg Tyr Ser Ser Gly Trp Tyr Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys <210> 60 <211> 141 <212> PRT
<213> Homo sapiens <400> 60 Gln Val Gin Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Ala Met His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Tyr Ser Gln Lys Phe Gln Gly Arg Val Thr Ile Thr Arg Asp Thr Ser Ala Ser Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Leu Leu Trp Phe Gly Glu Leu Leu Tyr Tyr Tyr Gly Ser Gly Ser Tyr Tyr Asn Ile Thr Met Val Arg Gly Val Ile Ile Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 61 <211> 126 <212> PRT
<213> Homo sapiens <400> 61 Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 62 <211> 126 <212> PRT
<213> Homo sapiens <400> 62 Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Arg Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Ser Asn Tyr Ala Ile His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Phe Ser Gln Lys Phe Gln Gly Arg Ile Thr Val Thr Arg Asp Thr Ala Ala Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 63 <211> 113 <212> PRT
<213> Homo sapiens <400> 63 Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Val Ile Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 64 <211> 116 <212> PRT
<213> Homo sapiens <400> 64 Glu Val Gln Leu Val Gln Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Leu Val Ser Gly Phe Thr Phe Asn Asn Tyr Pro Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Val Ile Ser Tyr Asp Gly Asn Asn Lys Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Gly Gly Gly Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 65 <211> 132 <212> PRT
<213> Homo sapiens <400> 65 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Ser Trp Asn Ser Gly Ser Ile Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Leu Tyr Tyr Cys Ala Lys Asp Gly Tyr Ser Ser Gly Trp Tyr Gly Ile Ala Val Ala Gly Val Gln Trp Leu Val Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 66 <211> 123 <212> PRT
<213> Homo sapiens <400> 66 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Ser Trp Asn Ser Gly Arg Ile Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Phe Tyr Tyr Cys Ala Lys Gly Gly Ser Thr Ser Ala Arg Tyr Ser Ser Gly Trp Tyr Tyr Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser <210> 67 <211> 107 <212> PRT
<213> Homo sapiens <400> 67 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser Thr Pro Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys <210> 68 <211> 103 <212> PRT
<213> Homo sapiens <400> 68 Glu Ile Val Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Arg Tyr Leu Asn Trp Tyr Gln Leu Lys Pro Gly Lys Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Ala Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Gln His Thr Arg Ala Phe Gly Gln Gly Thr Lys Val Glu Ile Lys <210> 69 <211> 107 <212> PRT
<213> Homo sapiens <400> 69 Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr Asp Ala Ser Asn Arg Ala Thr Gly Ile Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Arg Ser Asn Trp Pro Tyr Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys <210> 70 <211> 103 <212> PRT
<213> Homo sapiens <400> 70 Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Phe Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Gly Ser Tyr Leu Ala Trp Tyr Gln Gln Arg Pro Gly Gln Ala Pro Arg Pro Leu Ile Tyr Asp Ala Thr Asn Arg Ala Thr Gly Ile Pro Thr Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln His Arg Arg Thr Phe Gly Arg Gly Thr Lys Leu Glu Ile Lys <210> 71 <211> 107 <212> PRT
<213> Homo sapiens <400> 71 Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr Asp Ala Ser Asn Arg Ala Thr Gly Ile Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Arg Ser Asn Trp Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys <210> 72 <211> 104 <212> PRT
<213> Homo sapiens <400> 72 Glu Ile Val Met Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Ser Ser Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr Gly Ala Phe Gly Gly Gly Thr Lys Val Glu Ile Lys <210> 73 <211> 108 <212> PRT
<213> Homo sapiens <400> 73 Ser Tyr Glu Leu Met Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln Thr Ala Arg Ile Thr Cys Ser Gly Asp Ala Leu Pro Lys Gln Tyr Ala Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val Ile Tyr Lys Asp Ser Glu Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser Ser Ser Gly Thr Thr Val Thr Leu Thr Ile Ser Gly Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Ala Asp Ser Ser Gly Thr Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu <210> 74 <211> 108 <212> PRT
<213> Homo sapiens <400> 74 Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln Thr Ala Thr Ile Thr Cys Ser Gly Asp Ala Leu Pro Lys Gln Tyr Val Tyr Trp Tyr Arg Gln Lys Pro Gly Gln Ala Pro Leu Leu Val Ile Tyr Glu Asp Ser Glu Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser Ser Ser Gly Thr Glu Val Thr Leu Ser Ile Ser Gly Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Thr Asp Ser Ser Gly Thr Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu <210> 75 <211> 522 <212> DNA
<213> Mus musculus <220>
<221> CDS
<222> (4)..(513) <400> 75 cat atg gac tac aag gac gac gat gac aag aag ctt aag cct gag gcc 48 Met Asp Tyr Lys Asp Asp Asp Asp Lys Lys Leu Lys Pro Glu Ala cag cca ttt gca cac ctc acc atc aat get gcc agc atc cca tcg ggt 96 Gln Pro Phe Ala His Leu Thr Ile Asn Ala Ala Ser Ile Pro Ser Gly tcc cat aaa gtc act ctg tcc tct tgg tac cac gat cga ggc tgg gcc 144 Ser His Lys Val Thr Leu Ser Ser Trp Tyr His Asp Arg Gly Trp Ala aag atc tct aac atg acg tta agc aac gga aaa cta agg gtt aac caa 192 Lys Ile Ser Asn Met Thr Leu Ser Asn Gly Lys Leu Arg Val Asn Gln gat ggc ttc tat tac ctg tac get aac att tgc ttt cgg cat cat gaa 240 Asp Gly Phe Tyr Tyr Leu Tyr Ala Asn Ile Cys Phe Arg His His Glu aca tcg gga gac ctg get act gaa tat ctt cag ctg atg gtg tat gtc 288 Thr Ser Gly Asp Leu Ala Thr Glu Tyr Leu Gln Leu Met Val Tyr Val gtt aaa acc agc atc aaa atc cca agt tct cat aac ctg atg aaa gga 336 Val Lys Thr Ser Ile Lys Ile Pro Ser Ser His Asn Leu Met Lys Gly ggg agc acg aaa aac tgg tcg ggc aat tct gaa ttc cac ttt tat tcc 384 Gly Ser Thr Lys Asn Trp Ser Gly Asn Ser Glu Phe His Phe Tyr Ser ata aat gtt ggg gga ttt ttc aag ctc cga get ggt gaa gaa att agc 432 Ile Asn Val Gly Gly Phe Phe Lys Leu Arg Ala Gly Glu Glu Ile Ser att cag gtg tcc aac cct tcc ctg ctg gat ccg gat caa gat gcg acg 480 Ile Gln Val Ser Asn Pro Ser Leu Leu Asp Pro Asp Gln Asp Ala Thr tac ttt ggg get ttc aaa gtt cag gac ata gac taactcgag 522 Tyr Phe Gly Ala Phe Lys Val Gln Asp Ile Asp <210> 76 <211> 170 <212> PRT
<213> Mus musculus <400> 76 Met Asp Tyr Lys Asp Asp Asp Asp Lys Lys Leu Lys Pro Glu Ala Gln Pro Phe Ala His Leu Thr Ile Asn Ala Ala Ser Ile Pro Ser Gly Ser His Lys Val Thr Leu Ser Ser Trp Tyr His Asp Arg Gly Trp Ala Lys Ile Ser Asn Met Thr Leu Ser Asn Gly Lys Leu Arg Val Asn Gln Asp Gly Phe Tyr Tyr Leu Tyr Ala Asn Ile Cys Phe Arg His His Glu Thr Ser Gly Asp Leu Ala Thr Glu Tyr Leu Gln Leu Met Val Tyr Val Val Lys Thr Ser Ile Lys Ile Pro Ser Ser His Asn Leu Met Lys Gly Gly Ser Thr Lys Asn Trp Ser Gly Asn Ser Glu Phe His Phe Tyr Ser Ile Asn Val Gly Gly Phe Phe Lys Leu Arg Ala Gly Glu Glu Ile Ser Ile Gln Val Ser Asn Pro Ser Leu Leu Asp Pro Asp Gln Asp Ala Thr Tyr Phe Gly Ala Phe Lys Val Gln Asp Ile Asp <210> 77 <211> 39 <212> PRT
<213> Homo sapiens <400> 77 Gly Phe Tyr Tyr Leu Tyr Ala Asn Ile Cys Phe Arg His His Glu Thr Ser Gly Asp Leu Ala Thr Glu Tyr Leu Gln Leu Met Val Tyr Val Thr Lys Thr Ser Ile Lys Ile Pro <210> 78 <211> 39 <212> PRT
<213> Mus musculus <400> 78 Gly Phe Tyr Tyr Leu Tyr Ala Asn Ile Cys Phe Arg His His Glu Thr Ser Gly Ser Val Pro Thr Asp Tyr Leu Gln Leu Met Val Tyr Val Val Lys Thr Ser Ile Lys Ile Pro <210> 79 <211> 39 <212> PRT
<213> Mus musculus <400> 79 Gly Phe Tyr Tyr Leu Tyr Ala Asn Ile Cys Phe Arg His His Glu Thr Ser Gly Asp Leu Ala Thr Glu Tyr Leu Gln Leu Met Val Tyr Val Val Lys Thr Ser Ile Lys Ile Pro <210> 80 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (1) .. (1) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 80 Xaa Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 81 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (2)..(2) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 81 Asp Xaa Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 82 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (3) .. (3) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 82 Asp Ser Xaa Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 83 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (4) .. (4) <223> x is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 83 Asp Ser Ser Xaa Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 84 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (5) .. (5) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 84 Asp Ser Ser Asn Xaa Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 85 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (6) .. (6) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 85 Asp Ser Ser Asn Met Xaa Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 86 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (7) .. (7) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 86 Asp Ser Ser Asn Met Val Xaa Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 87 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (8)..(8) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 87 Asp Ser Ser Asn Met Val Arg Xaa Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 88 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (9) .. (9) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 88 Asp Ser Ser Asn Met Val Arg Gly Xaa Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 89 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (10)..(10) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 89 Asp Ser Ser Asn Met Val Arg Gly Ile Xaa Ile Ala Tyr Tyr Phe Asp Tyr <210> 90 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (11)..(11) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 90 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Xaa Ala Tyr Tyr Phe Asp Tyr <210> 91 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (12)..(12) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 91 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Xaa Tyr Tyr Phe Asp Tyr <210> 92 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (13)..(13) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 92 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Xaa Tyr Phe Asp Tyr <210> 93 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (14)..(14) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> mist feature <223> Synthetic <400> 93 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Xaa Phe Asp Tyr <210> 94 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> mist feature <222> (15)..(15) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> mist feature <223> Synthetic <400> 94 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Xaa Asp Tyr <210> 95 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (16)..(16) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 95 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Xaa Tyr <210> 96 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (17)..(17) <223> X is any amino acid different from the amino acid normally reside nt at that positio <220>
<221> misc feature <223> Synthetic <400> 96 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Xaa <210> 97 <211> 9 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (4)..(7) <223> First occurrence of x from left to right denotes any amino acid r esidue other than arginine, the second, third and fourth occurren ces of X denote any amino acid residu <220>
<221> misc feature <223> Synthetic <400> 97 Gln His Thr Xaa Xaa Xaa Xaa Arg Ala <210> 98 <211> 9 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <222> (4) .. (4) <223> X is any amino acid residue other than arginine <220>
<221> misc feature <223> Synthetic <400> 98 Gln His Thr Xaa Ala Ala Ala Arg Ala <210> 99 <211> 10 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic <400> 99 Asp Tyr Lys Asp Asp Asp Asp Lys Lys Leu <210> 100 <211> 23 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 100 cctctcatat ggactacaag gac 23 <210> 101 <211> 30 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 101 agtagccagg tctcccgatg tttcatgatg 30 <210> 102 <211> 30 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 102 ctggctactg aatatcttca gctgatggtg 30 <210> 103 <211> 25 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 103 cctctcctcg agttagtcta tgtcc 25 <210> 104 <211> 17 <212> PRT
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic <400> 104 Asp Ser Ser Asn Met Val Arg Gly Ile Ile Ile Ala Tyr Tyr Phe Asp Tyr <210> 105 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 105 agagattcct caaatatggt tcggggaatt attatagcg 39 <210> 106 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 106 gtagtcaaaa tagtacgcta taataattcc ccgaac 36 <210> 107 <211> 33 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 107 gtgtattact gtgcgagaga ttcctcaaat atg 33 <210> 108 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 108 cagggtgccc tggccccagt agtcaaaata gtacgc 36 <210> 109 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 109 gtgtattact gtgcgagagc ttcctcaaat atggttcgg 39 <210> 110 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 110 gtgtattact gtgcgagaga tgcctcaaat atggttcgg 39 <210> 111 <211> 42 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 111 aataattccc cgaaccatat ttgcggaatc tctcgcacag to 42 <210> 112 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 112 aataattccc cgaaccatag ctgaggaatc tctcgcaca 39 <210> 113 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 113 aataattccc cgaacggcat ttgaggaatc tctcgc 36 <210> 114 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 114 gattcctcaa atatggctcg gggaattatt atagcg 36 <210> 115 <211> 38 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 115 gattcctcaa atatggttgc cggaattatt atagcgta 38 <210> 116 <211> 45 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 116 gtagtcaaaa tagtacgcta taataattgc ccgaaccata tttga 45 <210> 117 <211> 42 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 117 gtagtcaaaa tagtacgcta taatggctcc ccgaaccata tt 42 <210> 118 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 118 gtagtcaaaa tagtacgcta tggcaattcc ccgaaccat 39 <210> 119 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 119 gtagtcaaaa tagtacgctg caataattcc ccgaac 36 <210> 120 <211> 45 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 120 ggtgccctgg ccccagtagt caaaataggc cgctataata attcc 45 <210> 121 <211> 45 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 121 ggtgccctgg ccccagtagt caaaagcgta cgctataata attcc 45 <210> 122 <211> 42 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 122 cagggtgccc tggccccagt agtcagcata gtacgctata at 42 <210> 123 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 123 cagggtgccc tggccccagt aggcaaaata gtacgctat 39 <210> 124 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 124 cagggtgccc tggccccagg cgtcaaaata gtacgctat 39 <210> 125 <211> 42 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 125 agtctgagat ctgaagacac ggctgtgtat tactgtgcga ga 42 <210> 126 <211> 33 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 126 gtgtattact gtgcgagaga ttcctcaaat atg 33 <210> 127 <211> 39 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 127 agagattcct caaatatggt tcggggaatt attatagcg 39 <210> 128 <211> 32 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 128 cttgagacgg tgaccagggt gccctggccc ca 32 <210> 129 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 129 cagggtgccc tggccccagt agtcaaaata gtacgc 36 <210> 130 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 130 gtagtcaaaa tagtacgcta taataattcc ccgaac 36 <210> 131 <211> 46 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 131 aataattccc cgaaccatat ttgagatacg tatctctcgc acagta 46 <210> 132 <211> 46 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 132 aataattccc cgaaccatat ttgagcgacg tatctctcgc acagta 46 <210> 133 <211> 44 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 133 aataattccc cgaaccatat ttgactcgta tctctcgcac agta 44 <210> 134 <211> 44 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 134 aataattccc cgaaccatat ttgacacata tctctcgcac agta 44 <210> 135 <211> 46 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 135 aataattccc cgaaccatat tgatacgtgg aatctctcgc acagta 46 <210> 136 <211> 46 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 136 aataattccc cgaaccatat tgcgacgtgg aatctctcgc acagta 46 <210> 137 <211> 44 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 137 aataattccc cgaaccatat tctcgtggaa tctctcgcac agta 44 <210> 138 <211> 44 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 138 aataattccc cgaaccatat tcacatggaa tctctcgcac agta 44 <210> 139 <211> 43 <212> DNA
<213> Artificial sequence <220>
<221> mist feature <223> Synthetic oglionucleotide <400> 139 aataattccc cgaaccatga tacgttgagg aatctctcgc aca 43 <210> 140 <211> 43 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 140 aataattccc cgaaccatgc gacgttgagg aatctctcgc aca 43 <210> 141 <211> 41 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 141 aataattccc cgaaccatct cgttgaggaa tctctcgcac a 41 <210> 142 <211> 41 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 142 aataattccc cgaaccatca cattgaggaa tctctcgcac a 41 <210> 143 <211> 42 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 143 agtctgagat ctgaagacac ggctgtgtat tactgtgcga ga 42 <210> 144 <211> 52 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 144 cagcagaagc ttagaccacc atggacatga gggtccccgc tcagctcctg gg 52 <210> 145 <211> 36 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 145 cacagccgtg tcttcagatc tcagactgcg cagctc 36 <210> 146 <211> 30 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 146 gtggaggcac tagagacggt gaccagggtg 30 <210> 147 <211> 48 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 147 gtgtattact gtgcgagaga tgccgcaaat atggttcggg gaattatt 48 <210> 148 <211> 53 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 148 gtgtattact gtgcgagaga tgcctcagct atggttcggg gaattattat agc 53 <210> 149 <211> 53 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 149 gtgtattact gtgcgagaga ttccgcagct atggttcggg gaattattat agc 53 <210> 150 <211> 53 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 150 gtgtattact gtgcgagaga tgccgcagct atggttcggg gaattattat agc 53 <210> 151 <211> 40 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 151 gtggttgaga ggtgccagat gtcaggtcca gctggtgcag 40 <210> 152 <211> 48 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 152 ccgctcagct cctggggctc ctgctattgt ggttgagagg tgccagat 48 <210> 153 <211> 51 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 153 ccggtcaaca cactacgtac gtgtgcggcg gcgcgggcgt tcggccaagg g 51 <210> 154 <211> 23 <212> DNA
<213> Artificial sequence <220>
<221> misc feature <223> Synthetic oglionucleotide <400> 154 ccgggcgcgc cttattaaca ctc 23
Claims (32)
1. An antibody or antigen binding domain comprising:
(a) a Fab heavy chain amino acid sequence as shown in SEQ ID
NO: 51 or SEQ ID NO: 53 and a Fab light chain amino acid sequence as shown in SEQ ID NO: 43 or SEQ ID NO: 45;
wherein the antibody or antigen binding domain binds selectively to human osteoprotegerin binding protein (OPGbp) and decreases or inhibits bone resorption.
(a) a Fab heavy chain amino acid sequence as shown in SEQ ID
NO: 51 or SEQ ID NO: 53 and a Fab light chain amino acid sequence as shown in SEQ ID NO: 43 or SEQ ID NO: 45;
wherein the antibody or antigen binding domain binds selectively to human osteoprotegerin binding protein (OPGbp) and decreases or inhibits bone resorption.
2. The antibody of Claim 1 further comprising a human Fc region.
3. An antibody or antigen binding domain which recognizes an epitope on human OPGbp recognized by an antibody or antigen binding domain comprising the Fab heavy chain amino acid sequence as shown in SEQ ID NO: 51 or SEQ ID NO:
53 and the Fab light chain amino acid sequence as shown in SEQ ID NO: 43 or SEQ
ID NO: 45.
53 and the Fab light chain amino acid sequence as shown in SEQ ID NO: 43 or SEQ
ID NO: 45.
4. An antibody or antigen binding domain which binds selectively to human OPGbp and decreases or inhibits bone resorption, the antibody comprising a variable light (V l) chain and a variable heavy (V h) chain:
wherein each V l chain comprises CDR amino acid sequences designated CDR1(V
l), CDR2(V l) and CDR3(V l) separated by framework amino acid sequences, CDR1(V l) being selected from the group consisting of:
RASQSISRYLN (SEQ ID NO: 01);
RASQSVGSYLA (SEQ ID NO: 02);
RASQSVSSSSLA (SEQ ID NO: 03); and SQDALPKQY (SEQ ID NO: 04);
CDR2(V l) being selected from the group consisting of:
GASSLQS (SEQ ID NO: 05);
DATNRAT (SEQ ID NO: 06);
GASSRAT (SEQ ID NO: 07); and EDSERPS (SEQ ID NO: 08);
and CDR3(V l) being selected from the group consisting of:
QHTRA (SEQ ID NO: 09);
QHRRT (SEQ ID NO: 10);
QQYGA (SEQ ID NO: 11); and QSTDSSGTYVV (SEQ ID NO: 12);
wherein CDR1(V l), CDR2(V l) and CDR3(V l) are selected independently of each other; and wherein each V h chain comprises CDR amino acid sequences designated CDR1(V h), CDR2(V h) and CDR3(V h) separated by framework amino acid sequences, CDR1(V h) being selected from the group consisting of:
NYAIH (SEQ ID NO: 13);
NYPMH (SEQ ID NO: 14); and DYAMH (SEQ ID NO: 15) CDR2(V h) being selected from the group consisting of:
WINAGNGNTKFSQKFQG (SEQ ID NO: 16);
VISYDGNNKYYADSVKG (SEQ ID NO: 17); and GISWNSGRIGYADSVKG (SEQ ID NO: 18) CDR3(V h) being selected from the group consisting of:
DSSNMVRGIIIAYYFDY (SEQ ID NO: 19);
GGGGFDY (SEQ ID NO: 20); and GGSTSARYSSGWYY (SEQ ID NO: 21) wherein CDR1(V h), CDR2(V h) and CDR3(V h) are selected independently of each other.
wherein each V l chain comprises CDR amino acid sequences designated CDR1(V
l), CDR2(V l) and CDR3(V l) separated by framework amino acid sequences, CDR1(V l) being selected from the group consisting of:
RASQSISRYLN (SEQ ID NO: 01);
RASQSVGSYLA (SEQ ID NO: 02);
RASQSVSSSSLA (SEQ ID NO: 03); and SQDALPKQY (SEQ ID NO: 04);
CDR2(V l) being selected from the group consisting of:
GASSLQS (SEQ ID NO: 05);
DATNRAT (SEQ ID NO: 06);
GASSRAT (SEQ ID NO: 07); and EDSERPS (SEQ ID NO: 08);
and CDR3(V l) being selected from the group consisting of:
QHTRA (SEQ ID NO: 09);
QHRRT (SEQ ID NO: 10);
QQYGA (SEQ ID NO: 11); and QSTDSSGTYVV (SEQ ID NO: 12);
wherein CDR1(V l), CDR2(V l) and CDR3(V l) are selected independently of each other; and wherein each V h chain comprises CDR amino acid sequences designated CDR1(V h), CDR2(V h) and CDR3(V h) separated by framework amino acid sequences, CDR1(V h) being selected from the group consisting of:
NYAIH (SEQ ID NO: 13);
NYPMH (SEQ ID NO: 14); and DYAMH (SEQ ID NO: 15) CDR2(V h) being selected from the group consisting of:
WINAGNGNTKFSQKFQG (SEQ ID NO: 16);
VISYDGNNKYYADSVKG (SEQ ID NO: 17); and GISWNSGRIGYADSVKG (SEQ ID NO: 18) CDR3(V h) being selected from the group consisting of:
DSSNMVRGIIIAYYFDY (SEQ ID NO: 19);
GGGGFDY (SEQ ID NO: 20); and GGSTSARYSSGWYY (SEQ ID NO: 21) wherein CDR1(V h), CDR2(V h) and CDR3(V h) are selected independently of each other.
5. The antibody of Claim 4 comprising a variable light (V l) chain and a variable heavy (V h) chain wherein:
the V l chain comprises CDR1 having the sequence RASQSISRYLN (SEQ
ID NO: 01), CDR2 having the sequence GASSLQS (SEQ ID NO: 05), and CDR3 having the sequence QHTRA (SEQ ID NO: 09); and the V h chain comprises CDR1 having the sequence NYAIH (SEQ ID NO:
13), CDR2 having the sequence WINAGNGNTKFSQKFQG (SEQ ID NO: 16), and CDR3 having the sequence DSSNMVRGIIIAYYFDY (SEQ ID NO: 19);
wherein CDR1, CDR2 and CDR3 on each V l and V h chain are separated by framework amino acid sequences.
the V l chain comprises CDR1 having the sequence RASQSISRYLN (SEQ
ID NO: 01), CDR2 having the sequence GASSLQS (SEQ ID NO: 05), and CDR3 having the sequence QHTRA (SEQ ID NO: 09); and the V h chain comprises CDR1 having the sequence NYAIH (SEQ ID NO:
13), CDR2 having the sequence WINAGNGNTKFSQKFQG (SEQ ID NO: 16), and CDR3 having the sequence DSSNMVRGIIIAYYFDY (SEQ ID NO: 19);
wherein CDR1, CDR2 and CDR3 on each V l and V h chain are separated by framework amino acid sequences.
6. The antibody of Claim 4 or 5 further comprising a human Fc region.
7. The antibody of Claims 1, 3 or 4 which is a monoclonal antibody, a humanized antibody, a bispecific antibody, a single chain antibody, or a heteroantibody.
8. An isolated nucleic acid molecule encoding the antibody of Claim 1 or 4.
9. An expression vector comprising the nucleic acid molecule of Claim 8.
10. A host cell comprising the expression vector of Claim 9.
11. The host cell of Claim 10 which is a CHO cell.
12. A method of producing an antibody which selectively binds osteoprotegerin binding protein comprising culturing the host cell of Claim 11 under conditions which allow expression of the nucleic acid molecule and recovering the antibody.
13. The antibody of any one of Claims 1, 3 or 4 comprising an isotype selected from IgG, IgM, IgA, IgE and IgD.
14. The antibody of Claim 13 wherein the isotype is IgG1, IgG2, IgG3 or IgG4.
15. A composition comprising the antibody or antigen binding domain of any one of Claims 1, 3 or 4 and a pharmaceutically acceptable carrier.
16. A use of an effective amount of the composition of Claim 15 for inhibiting osteoclast formation or activation in a mammal in need thereof.
17. A use of an effective amount of the composition of Claim 15 for the preparation of a medicament for inhibiting osteoclast formation or activation in a mammal in need thereof.
18. A use of an effective amount of the composition of Claim 15 for inhibiting bone resorption in a mammal in need thereof.
19. A use of an effective amount of the composition of Claim 15 for the preparation of a medicament for inhibiting bone resorption in a mammal in need thereof.
20. A use of a therapeutically or prophylactically effective amount of the composition of Claim 15 for preventing or treating loss of bone mass in a mammal in need thereof.
21. A use of a therapeutically or prophylactically effective amount of the composition of Claim 15 for the preparation of a medicament for preventing or treating loss of bone mass in a mammal in need thereof.
22. The use of Claims 20 or 21 wherein loss of bone mass results from osteoporosis, metastasis of cancer to bone, rheumatoid arthritis, hypercalcemia of malignancy, and steroid-induced osteoporosis.
23. The use of any one of Claims 16 to 22 wherein said composition further comprises at least one additional bone anti-resorptive agent.
24. The use of Claim 23 wherein the anti-resorptive agent is estrogen, a bisphosphonate, or a selective estrogen receptor modulator.
25. The use of any one of Claims 16 to 22 wherein said composition further comprises an anabolic agent for bone.
26. The use of Claim 25 wherein the anabolic agent is parathyroid hormone or a complex of insulin-like growth factor and insulin-like growth factor binding protein.
27. The use of any one of Claims 16 to 22 further comprising a use of an interleukin-1 inhibitor or a tumor necrosis factor-alpha inhibitor.
28. An isolated antibody or antigen binding domain which recognizes a DE
epitope comprising amino acid residues from about position 212 to about position 250 in the amino acid sequence of human osteoprotegerin binding protein (OPGbp), wherein the antibody inhibits the formation or activation of osteoclasts.
epitope comprising amino acid residues from about position 212 to about position 250 in the amino acid sequence of human osteoprotegerin binding protein (OPGbp), wherein the antibody inhibits the formation or activation of osteoclasts.
29. The antibody or antigen binding domain of Claim 28 wherein the DE
epitope comprises the sequence DLATE.
epitope comprises the sequence DLATE.
30. An isolated antibody or antigen binding domain which binds to murine osteoprotegerin binding protein (OPGbp) comprising the amino acid substitutions S229D, V230L, P231A, and D233E, but does not bind to murine OPGbp lacking said substitutions.
31. The antibody or antigen binding domain of Claim 30 which inhibits the formation or activation of osteoclasts.
32. The antibody or antigen binding domain of Claims 28, 29, or 30 which inhibits bone resorption.
Applications Claiming Priority (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US51113900A | 2000-02-23 | 2000-02-23 | |
| US09/511,139 | 2000-02-23 | ||
| US09/791,153 | 2001-02-22 | ||
| US09/791,153 US20030103978A1 (en) | 2000-02-23 | 2001-02-22 | Selective binding agents of osteoprotegerin binding protein |
| PCT/US2001/005973 WO2001062932A1 (en) | 2000-02-23 | 2001-02-23 | Antagonistic selective binding agents of osteoprotegerin binding protein |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CA2400929A1 CA2400929A1 (en) | 2001-08-30 |
| CA2400929C true CA2400929C (en) | 2011-05-31 |
Family
ID=27057130
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CA2400929A Expired - Lifetime CA2400929C (en) | 2000-02-23 | 2001-02-23 | Antagonistic selective binding agents of osteoprotegerin binding protein |
Country Status (9)
| Country | Link |
|---|---|
| EP (1) | EP1257648B2 (en) |
| JP (1) | JP4401613B2 (en) |
| AU (1) | AU3868001A (en) |
| CA (1) | CA2400929C (en) |
| DE (1) | DE60134459D1 (en) |
| DK (1) | DK2105449T3 (en) |
| MX (1) | MXPA02008144A (en) |
| SI (1) | SI1257648T2 (en) |
| WO (1) | WO2001062932A1 (en) |
Families Citing this family (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2144386T5 (en) | 1996-12-23 | 2012-12-07 | Immunex Corporation | Ligand for the NF-kappa b receptor activator, the ligand is a member of the TNF superfamily |
| WO1999058674A2 (en) | 1998-05-14 | 1999-11-18 | Immunex Corporation | Method of inhibiting osteoclast activity |
| US6316408B1 (en) | 1997-04-16 | 2001-11-13 | Amgen Inc. | Methods of use for osetoprotegerin binding protein receptors |
| ATE363533T1 (en) | 1997-04-16 | 2007-06-15 | Amgen Inc | OSTEOPROTEGERIN BINDING PROTEINS AND RECEPTORS |
| JP4854174B2 (en) | 2000-09-22 | 2012-01-18 | イミュネックス・コーポレーション | Screening assay for agonist or antagonist of NF-κB receptor activator |
| JP4212470B2 (en) | 2001-06-26 | 2009-01-21 | アムジェン フレモント インク. | Antibody to OPGL |
| DE10210427A1 (en) * | 2002-03-09 | 2003-10-09 | Hans Konrad Mueller-Hermelink | Human monoclonal antibody |
| PL375041A1 (en) | 2002-04-05 | 2005-11-14 | Amgen Inc. | Human anti-opgl neutralizing antibodies as selective opgl pathway inhibitors |
| WO2004005351A2 (en) | 2002-07-04 | 2004-01-15 | Oncomab Gmbh | Neoplasm specific antibodies and uses thereof |
| DE10311248A1 (en) | 2003-03-14 | 2004-09-30 | Müller-Hermelink, Hans Konrad, Prof. Dr. | Human monoclonal antibody |
| CN100457901C (en) * | 2003-04-30 | 2009-02-04 | 独立行政法人科学技术振兴机构 | Human anti-human interleukin-18 antibody and its fragments and their utilization method |
| WO2005030793A2 (en) | 2003-09-24 | 2005-04-07 | Millennium Pharmaceuticals, Inc. | Antibodies which bind human cxcr3 |
| EP1531162A1 (en) | 2003-11-14 | 2005-05-18 | Heinz Vollmers | Adenocarcinoma specific antibody SAM-6, and uses thereof |
| DE10353175A1 (en) | 2003-11-14 | 2005-06-16 | Müller-Hermelink, Hans Konrad, Prof. Dr. | Human monoclonal antibody with fatliquoring effect |
| US7501119B2 (en) | 2004-06-30 | 2009-03-10 | Mayo Foundation For Medical Education And Research | Methods and molecules for modulating an immune response |
| US20060099203A1 (en) | 2004-11-05 | 2006-05-11 | Pease Larry R | B7-DC binding antibody |
| JP5902367B2 (en) * | 2004-06-30 | 2016-04-13 | メイヨ・ファウンデーション・フォー・メディカル・エデュケーション・アンド・リサーチ | antibody |
| WO2015018421A1 (en) | 2013-08-07 | 2015-02-12 | Rigshospitalet Copenhagen University Hospital | Antibodies, compounds and derivatives thereof for use in the treatment of male infertility |
| PL3043785T3 (en) | 2013-09-13 | 2022-02-28 | National University Corporation Chiba University | Application of r-ketamine and salt thereof as pharmaceuticals |
| EP3753557B1 (en) | 2018-02-15 | 2025-11-05 | National University Corporation Chiba University | Preventive or therapeutic agent and pharmaceutical composition for inflammatory diseases or bone diseases |
| JP2021523228A (en) | 2018-05-04 | 2021-09-02 | パーセプション ニューロサイエンス,インコーポレイティド | Treatment of substance abuse |
| CN119790065A (en) | 2022-08-24 | 2025-04-08 | 美国安进公司 | Anti-drug antibody assay |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BR9714401A (en) † | 1996-12-13 | 2000-04-18 | Schering Corp | Mammalian cell surface antigens; related rulers |
| ES2144386T5 (en) † | 1996-12-23 | 2012-12-07 | Immunex Corporation | Ligand for the NF-kappa b receptor activator, the ligand is a member of the TNF superfamily |
| IL127115A (en) † | 1997-04-15 | 2013-08-29 | Daiichi Sankyo Co Ltd | Agent for treating diseases associated with bone metabolism abnormality |
| ATE363533T1 (en) † | 1997-04-16 | 2007-06-15 | Amgen Inc | OSTEOPROTEGERIN BINDING PROTEINS AND RECEPTORS |
| PL196790B1 (en) * | 1998-09-15 | 2008-01-31 | Pharmexa As | Application of animal OPGL polypeptide or its subsequence, or the OPGL analogue, use of fragment of nucleic acid, use of the vector transmitting fragment of nucleic acid, use of non-pathogenic transformed cell, application of a compound containing such fr |
-
2001
- 2001-02-23 AU AU3868001A patent/AU3868001A/en active Pending
- 2001-02-23 EP EP01911158.2A patent/EP1257648B2/en not_active Expired - Lifetime
- 2001-02-23 MX MXPA02008144A patent/MXPA02008144A/en active IP Right Grant
- 2001-02-23 JP JP2001562706A patent/JP4401613B2/en not_active Expired - Lifetime
- 2001-02-23 CA CA2400929A patent/CA2400929C/en not_active Expired - Lifetime
- 2001-02-23 DK DK08010991.1T patent/DK2105449T3/en active
- 2001-02-23 DE DE60134459T patent/DE60134459D1/en not_active Expired - Lifetime
- 2001-02-23 WO PCT/US2001/005973 patent/WO2001062932A1/en not_active Ceased
- 2001-02-23 SI SI200130847A patent/SI1257648T2/en unknown
Also Published As
| Publication number | Publication date |
|---|---|
| EP1257648A1 (en) | 2002-11-20 |
| JP4401613B2 (en) | 2010-01-20 |
| CA2400929A1 (en) | 2001-08-30 |
| DE60134459D1 (en) | 2008-07-31 |
| JP2003523772A (en) | 2003-08-12 |
| SI1257648T2 (en) | 2016-11-30 |
| MXPA02008144A (en) | 2002-11-29 |
| EP1257648B1 (en) | 2008-06-18 |
| DK2105449T3 (en) | 2019-10-07 |
| AU3868001A (en) | 2001-09-03 |
| EP1257648B2 (en) | 2016-09-14 |
| WO2001062932A1 (en) | 2001-08-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2330197B1 (en) | Antagonistic selective binding agents of osteoprotegerin binding protein | |
| CA2400929C (en) | Antagonistic selective binding agents of osteoprotegerin binding protein | |
| AU2001238680B2 (en) | Antagonistic selective binding agents of osteoprotegerin binding protein | |
| DE DK et al. | Thousand Oaks, CA 91320-1799 (US) | |
| DE DK et al. | Designated Extension States | |
| DE DK et al. | ANTAGONISTISCHE SELEKTIVE BINDUNGSAGENZIEN DES OSTEOPROTEGERIN-BINDUNGSPROTEINS AGENTS DE LIAISON SELECTIFS ANTAGONISTES DE PROTEINE DE LIAISON D’OSTEOPROTEGERINE | |
| AU2001238680A1 (en) | Antagonistic selective binding agents of osteoprotegerin binding protein | |
| HK1136308A (en) | Antagonistic selective binding agents of osteoprotegerin binding protein | |
| HK1158696B (en) | Antagonistic selective binding agents of osteoprotegerin binding protein | |
| HK1136308B (en) | Antagonistic selective binding agents of osteoprotegerin binding protein | |
| CA2502668C (en) | Fully human antibody fab fragments with human interferon-gamma neutralizing activity |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| EEER | Examination request | ||
| MKEX | Expiry |
Effective date: 20210223 |