CA2373851A1 - Nucleic acid-antibody conjugate for delivering a foreign nucleic acid in cells - Google Patents

Nucleic acid-antibody conjugate for delivering a foreign nucleic acid in cells Download PDF

Info

Publication number
CA2373851A1
CA2373851A1 CA002373851A CA2373851A CA2373851A1 CA 2373851 A1 CA2373851 A1 CA 2373851A1 CA 002373851 A CA002373851 A CA 002373851A CA 2373851 A CA2373851 A CA 2373851A CA 2373851 A1 CA2373851 A1 CA 2373851A1
Authority
CA
Canada
Prior art keywords
conjugate according
nucleic acid
molecule
antibody
conjugate
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
CA002373851A
Other languages
French (fr)
Inventor
Francois Hirsch
Antoine Durrbach
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centre National de la Recherche Scientifique CNRS
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Individual filed Critical Individual
Publication of CA2373851A1 publication Critical patent/CA2373851A1/en
Abandoned legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3038—Kidney, bladder
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6861—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from kidney or bladder cancer cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00—Drugs for disorders of the muscular or neuromuscular system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16—Anti-Parkinson drugs
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/06—Antihyperlipidemics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biomedical Technology (AREA)
  • Genetics & Genomics (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Immunology (AREA)
  • Cell Biology (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Oncology (AREA)
  • Psychology (AREA)
  • Urology & Nephrology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Communicable Diseases (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Hematology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Hospice & Palliative Care (AREA)
  • Obesity (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Physical Education & Sports Medicine (AREA)

Abstract

The invention concerns the techniques related to the insertion of foreign nucleic acid in cells. More particularly it concerns a DNA/antibody conjugate enabling an efficient foreign DNA expression in vivo or in vitro in protein form in target cells.

Description

Conjugué acide nucléique-anticorps pour délivrer un acide nucléique étranger dans les cellules La thérapie génique a pour objet de corriger un défaut génétique par intervention sur l'ADN. Elle peut étre réalisée selon deux approches distinctes : soit comme une correction du génotype par réparation de l'anomalie génique, soit par correction du phénotype par greffe d'une version normale du gène permettant ainsi de suppléer le gène défectueux toujours présent. La thérapie génique s'applique aussi bien au traitement des maladies génétiques constitutionnelles que acquises. Ainsi, un certains nombres de maladies génétiques constitutionnelles sont candidates à une thérapie génique ; on peut citer, entre autres, la mucoviscidose, la myopathie de Duchenne ou le déficit en adénosine désaminase (Cournoyer et al., 1991, "Gene tranfer of adenosine deaminase into primitive human hemotopoetic progenitor cells", Human Gene Therapie, 2 : 203). La thérapie génique s'applique aussi à la lutte contre les maladies acquises dont les maladies candidates sont les cancers et les maladies infectieuses et virales (SIDA, hépatites) .
Dans la thérapie des cancers, les premières expériences effectuées avec les lymphocytes infiltrant les tumeurs (TIL : tumor infiltrating lymphocytes) ont démontré que des cellules pouvaient être armées avec des facteurs cytotoxiques (TNF, tumor necrosis factor) (Rosenberg et al. 1990, "Gene transfer into humans : immunotherapy of patients with advanced melanoma using infiltrating lymphocytes modified by retroviral gene transduction" N. Eng. J. Med. 323 :570 578) ou étre dopées avec des cytokines ; ainsi Golumbek et ses collaborateurs ont obtenu un succès thérapeutique sur des cancers rénaux de souris traités par des cellules produisant de l'interleukine 4 (Golumbek et al. 1991, Science 254 :713-716).
La thérapie génique effectuée sur les cellules somatiques d'un individu affecté d'un défaut génétique pose de multiples problèmes méthodologiques, le gène réparé ou greffé devant être exprimé Nucleic acid-antibody conjugate to deliver an acid foreign nucleic acid in cells The aim of gene therapy is to correct a genetic defect by DNA intervention. It can be carried out according to two distinct approaches: either as a correction of the genotype by repair of the genetic anomaly, either by correcting the phenotype by transplant of a normal version of the gene thus making it possible to replace the defective gene still present. Gene therapy also applies well to the treatment of constitutional genetic diseases that acquired. So a number of genetic diseases constitutional candidates for gene therapy; we can cite, among others, cystic fibrosis, Duchenne muscular dystrophy or adenosine deaminase deficiency (Cournoyer et al., 1991, "Gene tranfer of adenosine deaminase into primitive human hemotopoetic progenitor cells ", Human Gene Therapie, 2: 203). Gene therapy applies also in the fight against acquired diseases including diseases candidates are cancers and infectious and viral diseases (AIDS, hepatitis).
In cancer therapy, the first experiences performed with lymphocytes infiltrating tumors (TIL: tumor infiltrating lymphocytes) have shown that cells can be armed with cytotoxic factors (TNF, tumor necrosis factor) (Rosenberg et al. 1990, "Gene transfer into humans: immunotherapy of patients with advanced melanoma using infiltrating lymphocytes modified by retroviral gene transduction "N. Eng. J. Med. 323: 570 578) or be doped with cytokines; thus Golumbek and his collaborators have achieved therapeutic success in cancers kidney of mice treated with interleukin-4 producing cells (Golumbek et al. 1991, Science 254: 713-716).
Gene therapy performed on the somatic cells of a individual affected by a genetic defect poses multiple problems methodological, the repaired or transplanted gene to be expressed

2 normalement de façon régulière, c'est-à-dire au bon endroit, au bon moment et en quantité normale adaptée aux besoins ; la correction ou la greffe devant être indéfiniment stable.
Parmi les stratégies de transfert génique somatique ex vivo développées pour tenter de cibler spécifiquement et efficacement les cellules d'intérêt, il convient de citer : (i) les stratégies utilisant les méthodes physiques telles que la co-précipitation par le phosphate de calcium, l'électroporation, la micro-injection, la fusion de protoplastes, la biolistique ou les véhicules artificiels tels les liposomes et les ligands de récepteur par exemple ; (ü) et celles faisant appel aux vecteurs viraux (rétrovirus, adénovirus, AAV, HSV) (Ragot et al., 1993 Nature 361 : 647-650). Parmi les stratégies de transfert génique somatique in vivo développées peuvent être citées les véhicules cellulaires ayant préalablement reçus le gène ex vivo (cellules souches hématopoïétiques, lymphocytes, hépatocytes, cellules endothéliales, cellules épithéliales), les vecteurs viraux, l'injection intra-musculaire d'ADN nu et les véhicules artificiels.
Une des difficultés actuelles de la thérapie génique porte sur le ciblage in vivo des cellules à modifier. Actuellement, seul un petit nombre d'approches virales ou synthétiques ont été développées ; elles exploitent essentiellement les interactions ligand-récepteur (Michael et Curiel, 1994, « Strategies to achieved targeted gene delivery via the receptor-mediated endocytosis pathway », Gene Therapy 1:223).
Différentes approches utilisant un vecteur viral ont ainsi été
expériementées. Une première approche a consisté à ponter via la streptavidine, des anticorps biotinylés dirigés contre une structure cellulaire cible à des anticorps également biotinylés dirigés contre les structures de l'enveloppe rétrovirale et donc associés à un rétrovirus (Roux et al., 1989, Proc. Natl. Acad. Sci. USA 86 :9079-9083). Une fois liés aux cellules, les vecteurs rétroviraux sont internalisés par endocytose et sont capables d'échapper au système lysosome-endosome par un mécanisme de transfert de l'endosome vers le cytoplasme, évitant ainsi la dégradation de l'ADN transfecté et 2 normally on a regular basis, i.e. in the right place, in the right time and in normal quantity adapted to needs; the correction or the graft must be indefinitely stable.
Among the strategies of somatic gene transfer ex vivo developed to try to target specifically and effectively cells of interest, it should be mentioned: (i) the strategies using the physical methods such as phosphate co-precipitation calcium, electroporation, micro-injection, protoplast fusion, biolistics or artificial vehicles such as liposomes and ligands receiver for example; (ü) and those using vectors viral (retrovirus, adenovirus, AAV, HSV) (Ragot et al., 1993 Nature 361: 647-650). Among the strategies of somatic gene transfer in developed vivo can be cited cell vehicles having previously received the ex vivo gene (stem cells hematopoietic, lymphocytes, hepatocytes, endothelial cells, epithelial cells), viral vectors, intramuscular injection naked DNA and artificial vehicles.
One of the current difficulties of gene therapy relates to the in vivo targeting of cells to be modified. Currently only a small a number of viral or synthetic approaches have been developed; they essentially exploit ligand-receptor interactions (Michael and Curiel, 1994, “Strategies to achieved targeted gene delivery via the receptor-mediated endocytosis pathway ”, Gene Therapy 1: 223).
Different approaches using a viral vector have thus been experienced. A first approach consisted of bridging via the streptavidin, biotinylated antibodies against a structure target cell to also biotinylated antibodies against structures of the retroviral envelope and therefore associated with a retrovirus (Roux et al., 1989, Proc. Natl. Acad. Sci. USA 86: 9079-9083). Once linked to cells, retroviral vectors are internalized by endocytosis and are able to escape the lysosome system-endosome by a transfer mechanism from the endosome to the cytoplasm, thus avoiding degradation of the transfected DNA and

3 permettant l'entrée dudit ADN dans le noyau cellulaire. Cette approche a révélé une absence de spécificité du ciblage in viUO due à l'accrochage non spécifique des vecteurs rétroviraux à la surface cellulaire. Une deuxième approche virale a été développée qui utilise des virus ectopiques modifiés pour porter une protéine-ligand d'enveloppe chimérique à leur surface (Kasahara et al. 1987 <~ Receptor-mediated in vitro gene transformation by a soluble DNA carrier system » J. Biol.
Chem. 262 :4429). Enfin, il convient de citer l'approche développée par Neda et al. ( 1991 <~ Chemical modification of an ecotropic murine leukemia virus results in redirection of its target cell specificity » J.
Biol. Chem. 266 : 14143).
Des approches synthétiques non virales ont également été
expérimentées. Elles sont réalisées par la formation d'un complexe entre un ligand capable de se lier à la surface de la cellule cible et avec l'ADN à transférer. Il convient de citer tout d'abord les approches utilisant les véhicules artificiels tels les liposomes recouverts d'anticorps (immunoliposomes); ce type d'approche ne s'est pas, à
présent, avérée satisfaisante car les immunoliposomes présentent une activité non spécifique vraisemblablement suite à l'accrochage non spécifique des liposomes aux membranes cellulaires. Il est également apparu que l'efficacité de transfert de gène contenu dans les liposomes reste modeste bien qu'il est supposé que la dégradation associée aux endosomes est évitée par l'utilisation des liposomes. Des approches alternatives utilisant des composés qui retiennent l'aptitude à interagir spécifiquement avec des récepteurs cellulaires de surface ont été
développées. En effet, différents récepteurs naturellement présents à la surface des cellules ont la propriété de s'internaliser dans la cellule après fixation sur leur ligand ; ainsi la transférine, dont le récepteur a une répartition tissulaire ubiquitaire, a fait l'objet de nombreuses expériences (transférinfection) (Zenke et al., 1990, Proc.Natl.Acad.Sci.
USA, 87 :3655-3659). Une autre alternative a consisté à cibler des asialoglycoprotéines présentent à la surface des hépatocytes (Wu et al., 1991, J. Biol. Chem. 266 :14338-14342). Enfin une autre technique 3 allowing the entry of said DNA into the cell nucleus. This approach revealed a lack of specific targeting in viUO due to the hooking nonspecific of retroviral vectors on the cell surface. A
second viral approach has been developed that uses viruses ectopics modified to carry an envelope ligand protein chimeric on their surface (Kasahara et al. 1987 <~ Receptor-mediated in vitro gene transformation by a soluble DNA carrier system ”J. Biol.
Chem. 262: 4429). Finally, it is worth mentioning the approach developed by Neda et al. (1991 <~ Chemical modification of an ecotropic murine leukemia virus results in redirection of its target cell specificity »J.
Biol. Chem. 266: 14143).
Synthetic non-viral approaches have also been experienced. They are carried out by the formation of a complex between a ligand capable of binding to the surface of the target cell and with the DNA to be transferred. We should first mention the approaches using artificial vehicles such as coated liposomes antibodies (immunoliposomes); this type of approach did not present, found to be satisfactory because immunoliposomes exhibit non-specific activity, presumably following hooking specific for liposomes to cell membranes. he is also appeared that the efficiency of gene transfer contained in liposomes remains modest although it is assumed that the degradation associated with endosomes is avoided by the use of liposomes. Approaches alternatives using compounds that retain the ability to interact specifically with surface cell receptors have been developed. Indeed, different receptors naturally present at the cell surface have the property of internalizing in the cell after fixation on their ligand; so the transferin, whose receptor has ubiquitous tissue distribution, has been the subject of numerous experiments (transferinfection) (Zenke et al., 1990, Proc.Natl.Acad.Sci.
USA, 87: 3655-3659). Another alternative was to target asialoglycoproteins present on the surface of hepatocytes (Wu et al., 1991, J. Biol. Chem. 266: 14338-14342). Finally another technique

4 appelée « antifection ~~ développée par l'un des inventeurs de la présente invention (Hirsch et al. « Antifection : a new method to targeted gene transfection » 1993, Transpl. Proc. 25 : 138) a été
décrite ; cette technique consiste à préparer un vecteur anticorps-ADN
qui est délivré à une population cellulaire sélectionnée (Brevet US 5 428 132).
Outre les problèmes de ciblage du vecteur, une autre difficulté à
surmonter dans les expériences de thérapie génique se situe dans le transfert, à l'intérieur des cellules, de l'ADN à transfecter et de la protection de cet ADN contre les activités nucléasiques des compartiments cellulaires lysosomiaux afin d'obtenir une expression conséquente du transgène.
Différentes approches ont été développées pour répondre à ce problème ; une efficacité accrue de l'expression du transgène a ainsi pu être obtenue en utilisant des agents lysosomotropiques tels la chloroquine (Zenke et al., 1990, Proc. Natl. Acad. Sci. USA 87 :3655-3659 ; Luthman et al., 1983, Nucleic Acids Res. 11 : 1295) ; de tels agents réduisent la destruction lysosomiale de l'ADN en augmentant le pH des endosomes et en inhibant le transfert du matériel internalisé
vers les lysosomes. Une autre approche consiste à utiliser des domaines protéiques ayant une activité de translocation cellulaire. La propriété de ces domaines est mise à profit pour faciliter l'échappement des acides nucléiques transfectés hors des vésicules endosomiales afin d'augmenter l'efficacité du transfert d'acide nucléique vers le noyau (Fominaya et Wels, 1995, J. Biol. Chem. 271 :10560). La demande internationale de brevet WO 94/04696 décrit un système de transfert d'acide nucléique composé d'un domaine de translocation provenant de l'exotoxine A de Pseudomonas aeruginosa ; l'efficacité de transfection et la spécificité d'un tel système de transfert apparait très bas. Une autre demande internationale de brevet WO 96/ 13599 décrit également un système de transfert d'acide nucléique composé d'une protéine monomérique recombinante comportant différents domaines S
fonctionnels dont un domaine de translocation dérivés de toxines, de préférence bactériennes, telle que l'exotoxine A.
Les stratégies de thérapie génique préalablement évoquées nécessitent des préparations laborieuses ou du matériel sophistiqué et peuvent présentées un certain risque biologique. Il existe à l'heure actuelle un besoin de développer un système de transfert simple et efficace d'acides nucléiques qui permette d'introduire spécifiquement dans les cellules cibles des acides nucléiques exprimés efficacement. A
ce titre, la technique d'antifection (brevet US 5 428 132), basée sur l'utilisation d'anticorps pour cibler des séquences d'ADN d'intérêt dans des cellules cibles, est extrémement prometteuse car les anticorps constituent un outil extrémement efficace pour diriger le vecteur de transfert vers un type cellulaire particulier du fait de la grand affinité
et de la grande spécificité des anticorps; de plus la multitude d'anticorps monoclonaux et polyclonaux disponibles dirigés contre les nombreuses structures cellulaires tumorales ou normales donne à
cette technologie un réel intérêt. Néanmoins la technique d'antifection décrite dans le brevet US 5 428 132 bien qu'elle permette un ciblage efficace, ne permet pas d'obtenir une expression conséquente du transgène transfecté.
C'est donc l'objet de la présente invention d'améliorer le taux d'expression du transgène transfecté dans les cellules cibles en utilisant la technologie d'antifection. Ces améliorations portent sur l'adjonction d'un domaine de translocation au complexe ADN-anticorps et/ou à l'utilisation de protéine de liaison à l'ADN pour coupler de manière non covalente l'ADN au complexe et/ou pour augmenter l'efficacité du transfert et/ou à l'adjonction d'un peptide clivable. Ces améliorations permettent de manière spectaculaire et inattendue d'augmenter de 2 à 10 fois le taux d'expression du transgène dans la cellule cible.
La présente invention concerne donc un conjugué pour le transfert d'une molécule d'acide nucléique dans une cellule caractérisé en ce qu'il comprend une molécule d'acide nucléique, un domaine de translocation et un anticorps spécifique d'un antigène de surface de ladite cellule, tel que ledit conjugué est transfecté efficacement dans ladite cellule.
Selon un premier mode de réalisation de l'invention (A) , le conjugué
selon l'invention est caractérisé en ce que lesdits molécule d'acide nucléique, domaine de translocation et anticorps sont conjugués au moyen d'au moins un agent de pontage.
Selon un mode préféré de réalisation (A), le conjugué se caractérise en ce qu'il comprend en outre un peptide clivable par au moins une enzyme glycolytique et/ou protéolytique, ledit anticorps étant lié audit domaine de translocation via ledit peptide clivable. Dans ce conjugué, l'anticorps et ledit peptide clivable peuvent être liés soit (i) de manière covalente via un agent de pontage sélectionné de préférence dans le groupe composé de la benzoquinone, de l'EDC, de l'APDP ; soit (ü) à
une molécule de type avidine au moyen d'un agent de pontage qui peut étre identique ou différent et qui est sélectionné de préférence dans le groupe composé de la biotine, la benzoquinone, de l'EDC, de l'APDP. Le domaine de translocation de ce composé est lié audit peptide clivable par une liaison chimique covalente. On entend désigner par liaison chimique covalente de préférence une liaison de type peptidique ; selon un mode particulier de réalisation le peptide correspondant au domaine de translocation lié au peptide clivable est obtenu par synthése chimique.
Dans ce mode de réalisation le domaine de translocation peut ètre lié à une molêcule d'acide nucléique soit i) au moyen d'un agent de pontage qui est de préférence l'APDP ; selon ce mode de réalisation un mode encore plus préféré de réalisation du conjugué de l'invention se caractérise en ce que ledit anticorps est lié
audit peptide clivable par une liaison covalente au moyen dudit agent de pontage EDC, ledit peptide clivable étant lié audit domaine de translocation par une liaison covalente au moyen d'une liaison chimique, ledit domaine de translocation étant lié audit acide nucléique par une liaison covalente au moyen dudit agent de pontage APDP.
ü) via une molécule de liaison aux acides nucléiques, ladite molécule de liaison aux acides nucléiques étant liée audit domaine de translocation par une liaison covalente au moyen d'un agent de pontage qui est de préférence l'APDP. Selon ce mode de réalisation, un mode de réalisation encore plus préféré consiste en ce que ledit anticorps est lié audit peptide clivable par une liaison covalente au moyen dudit agent de pontage EDC, ledit peptide clivable étant lié
audit domaine de translocation par une liaison covalente au moyen d'une liaison chimique, ledit domaine de translocation étant lié à ladite molécule de liaison aux acides nucléiques par une liaison covalente au moyen dudit agent de pontage APDP, ladite molécule de liaison aux acides nucléiques liant ledit acide nucléique par une liaison non covalente.
Selon un deuxième mode de réalisation (B), l'invention concerne un conjugué caractérisé en ce qu'il comprend en outre une molécule de liaison aux acides nucléiques, tel que ledit domaine de translocation, ledit anticorps et ladite molécule de liaison aux acides nucléiques sont liés à une molécule de type avidine au moyen d'un agent de pontage qui peut être identique ou différent, ladite molécule de liaison aux acides nucléiques étant liée à ladite molécule d'acide nucléique.
Selon un autre mode de réalisation (B), l'invention concerne un conjugué caractérisé en ce qu'il comprend en outre une molécule de liaison aux acides nucléiques et un peptide clivable par au moins une enzyme glycolytique et/ou protéolytique, tel que ledit domaine de translocation, ledit anticorps et ledit peptide clivable sont liés à une molécule de type avidine au moyen d'un agent de pontage qui peut étre identique ou différent, ladite molécule de liaison aux acides nucléiques étant liée à ladite molécule d'acide nucléique, ladite molécule de liaison aux acides nucléiques étant liée audit peptide clivable et à ladite molécule d'acide nucléique.

Selon un autre aspect (C), l'invention concerne un conjugué pour le transfert d'une molécule d'acide nucléique dans une cellule caractérisé en ce qu'il comprend une molécule d'acide nucléique, un anticorps spécifique d'un antigène de surface de cellule et une molécule de liaison aux acides nucléiques tel que ledit conjugué est transfecté efficacement dans ladite cellule ; ce conjugué se caractérise en ce que ladite molécule d'acide nucléique, ledit anticorps et ladite molécule de liaison aux acides nucléiques sont liés à une molécule de type avidine au moyen d'un agent de pontage qui peut étre identique ou différent, ladite molécule de liaison aux acides nucléiques étant liée à ladite molécule d'acide nucléique.
Selon un mode de réalisation (C) préféré le conjugué précédent se caractérise en ce qu'il comprend en outre un peptide clivable par au moins une enzyme glycolytique et/ou protéolytique, ledit anticorps étant lié à ladite molécule de liaison aux acides nucléiques via ledit peptide clivable ; dans ce conjugué, ledit anticorps et ledit peptide clivable sont liés soit (i) de manière covalente via un agent de pontage sélectionné de préférence dans le groupe composé de la benzoquinone, de l'EDC, de l'APDP, ou soit (ü) via une molécule de type avidine au moyen d'un agent de pontage qui peut être identique ou différent et sélectionné de préférence dans le groupe composé de la biotine, la benzoquinone, de l'EDC, de l'APDP. Dans ce conjugué, ledit peptide clivable est lié à ladite molécule de liaison aux acides nucléiques au moyen d'un agent de pontage qui est de préférence APDP, ladite molécule de liaison aux acides nucléiques liant ledit acide nucléique par une liaison non-covalente.
Selon un mode de réalisation (D), l'invention porte sur un conjugué pour le transfert d'une molécule d'acide nucléique dans une cellule caractérisé en ce qu'il comprend une molécule d'acide nucléique, un anticorps spécifique d'un antigène de surface de cellule et un peptide clivable par au moins une enzyme glycolytique et/ou protéolytique tel que ledit conjugué est transfecté efficacement dans ladite cellule. Dans ce conjugué, ledit anticorps et ledit peptide clivable sont liés soit (i) de manière covalente via un agent de pontage sélectionné de préférence dans le groupe composé de la benzoquinone, de l'EDC, de l'APDP, soit (ü) à une molécule de type avidine au moyen d'un agent de pontage qui peut ètre identique ou différent sélectionné
de préférence dans le groupe composé de la biotine, la benzoquinone, de l'EDC, de l'APDP. Dans ce conjugué, ledit peptide clivable est lié
audit acide nucléique soit (i) par une liaison covalente au moyen d'un agent de pontage qui est de préférence l'APDP, soit (ü) via une molécule de liaison aux acides nucléiques, ladite molécule de liaison aux acides nucléiques étant liée audit peptide clivable par une liaison covalente au moyen d'un agent de pontage qui est de préférence l'APDP. Selon un mode particulièrement préféré de l'invention ledit conjugué
comprend en outre un domaine de translocation qui est éventuellement lié de manière covalente au moyen d'un agent de pontage à ladite molécule d'acide nucléique et/ou à ladite molécule de liaison aux acides nucléiques. Selon un autre mode de réalisation, ledit domaine de translocation est présent au sein du conjugué sans y étre lié covalemment.
On entend désigner par peptide clivable, un peptide comportant une ou plusieurs séquences clivables par des enzymes glycolytiques et/ou protéolytiques de préférence endosomiales et/ou lysosomiales telles par exemple les cathepsines et la trypsine. Selon un mode particulier de réalisation, le peptide clivable de l'invention comporte au moins un site cathepsine B et/ou un site cathepsine D. De manière préférée, le peptide clivable comporte un site cathepsine B et un site cathepsine D séparés par au moins un acide aminé, de préférence par au moins deux acides aminés tel par exemple la glycine ; le peptide clivable de l'invention présente la séquence : X~-X2-F-Y-G-G-F-R- dans laquelle G représente la glycine, X~ et X2 des acides aminés permettant l'accrochage ou liaison chimique de l'anticorps telle par exemple deux lysines (K). F-Y représente le dipeptide composé des acides aminés phénylalanine-tyrosine qui est clivable par la cathepsine D ; cette séquence peut éventuellement être remplacée par L-Y (leucine-tyrosine), Y-L (tyrosine-leucine) ou F-F (phénylalanine-phénylalanine).
FR représente le dipeptide composé des acides aminés phénylalanine-arginine qui est clivable par la cathepsine B.
L'agent de pontage permet de lier de manière chimique (covalente), 4 called "antifection ~~ developed by one of the inventors of the present invention (Hirsch et al. "Antifection: a new method to targeted gene transfection ”1993, Transpl. Proc. 25: 138) was described; this technique consists in preparing an antibody-DNA vector which is delivered to a selected cell population (US Patent 5 428 132).
In addition to the problems of targeting the vector, another difficulty in overcome in gene therapy experiences lies in the transfer within the cells of the DNA to be transfected and the protection of this DNA against the nuclease activities of lysosomal cell compartments to obtain expression consequence of the transgene.
Different approaches have been developed to respond to this problem; increased efficiency of transgene expression thus has could be obtained using lysosomotropic agents such as chloroquine (Zenke et al., 1990, Proc. Natl. Acad. Sci. USA 87: 3655-3659; Luthman et al., 1983, Nucleic Acids Res. 11: 1295); such agents reduce lysosomal destruction of DNA by increasing the endosome pH and inhibiting the transfer of internalized material to lysosomes. Another approach is to use protein domains with cell translocation activity. The ownership of these areas is leveraged to facilitate escape nucleic acids transfected out of the endosomal vesicles so increase the efficiency of nucleic acid transfer to the nucleus (Fominaya and Wels, 1995, J. Biol. Chem. 271: 10560). Requirement international patent WO 94/04696 describes a transfer system nucleic acid composed of a translocation domain originating from exotoxin A from Pseudomonas aeruginosa; transfection efficiency and the specificity of such a transfer system appears very low. Another international patent application WO 96/13599 also describes a nucleic acid transfer system composed of a protein recombinant monomer with different domains S
functional including a translocation domain derived from toxins, preferably bacterial, such as exotoxin A.
Gene therapy strategies previously mentioned require laborious preparations or sophisticated equipment and may present some biological risk. It exists on time current need to develop a simple transfer system and efficient nucleic acid which allows to introduce specifically in target cells efficiently expressed nucleic acids. AT
As such, the anti-detection technique (US patent 5,428,132), based on the use of antibodies to target DNA sequences of interest in target cells, is extremely promising because antibodies constitute an extremely effective tool to direct the vector of transfer to a particular cell type due to the high affinity and the high specificity of the antibodies; moreover the multitude available monoclonal and polyclonal antibodies against many tumor or normal cell structures gives this technology a real interest. Nevertheless the anti-detection technique described in US Patent 5,428,132 although it allows targeting effective, does not allow a consistent expression of the transfected transgene.
It is therefore the object of the present invention to improve the rate for expression of the transfected transgene in target cells by using antifection technology. These improvements relate to the addition of a translocation domain to the DNA-antibody complex and / or the use of DNA binding protein to couple non-covalently DNA to the complex and / or to increase the efficiency of the transfer and / or the addition of a cleavable peptide. These improvements allow for dramatically and unexpectedly to increase the expression level of the transgene in the target cell.
The present invention therefore relates to a conjugate for transfer of a nucleic acid molecule in a cell characterized in that it includes a nucleic acid molecule, a domain of translocation and an antibody specific for a surface antigen of said cell, such that said conjugate is efficiently transfected into said cell.
According to a first embodiment of the invention (A), the conjugate according to the invention is characterized in that said acid molecule nucleic acid, translocation domain and antibodies are conjugated to using at least one bridging agent.
According to a preferred embodiment (A), the conjugate is characterized in that it further comprises a peptide cleavable by at least one glycolytic and / or proteolytic enzyme, said antibody being linked to said translocation domain via said cleavable peptide. In this conjugate, the antibody and said cleavable peptide can be linked either (i) so covalent via a bridging agent preferably selected from the group consisting of benzoquinone, EDC, APDP; either (ü) to an avidin-like molecule using a bridging agent which can be the same or different and which is preferably selected from the group composed of biotin, benzoquinone, EDC, APDP. The translocation domain of this compound is linked to said cleavable peptide by a covalent chemical bond. We mean by connection covalent chemical, preferably a peptide-type bond; according to a particular embodiment of the peptide corresponding to translocation domain linked to the cleavable peptide is obtained by chemical synthesis.
In this embodiment, the translocation domain can be linked to a nucleic acid molecule either i) by means of a bridging agent which is preferably APDP; according to this embodiment an even more preferred embodiment of the conjugate of the invention is characterized in that said antibody is linked to said peptide cleavable by a covalent bond by means of said agent of EDC bridging, said cleavable peptide being linked to said domain of translocation by a covalent bond by means of a bond chemical, said translocation domain being linked to said acid nucleic acid by a covalent bond by means of said bridging agent APDP.
ü) via a nucleic acid binding molecule, said molecule of binding to nucleic acids being linked to said domain of translocation by a covalent bond using an agent bypass which is preferably the APDP. According to this embodiment, a an even more preferred embodiment is that said antibody is linked to said cleavable peptide by a covalent bond to using said EDC bridging agent, said cleavable peptide being linked said domain of translocation by a covalent bond by means of a chemical bond, said translocation domain being linked to said nucleic acid binding molecule through a covalent bond to by means of said APDP bridging agent, said molecule binding to nucleic acids binding said nucleic acid by a non-binding covalent.
According to a second embodiment (B), the invention relates a conjugate characterized in that it further comprises a molecule of binding to nucleic acids, such as said translocation domain, said antibody and said nucleic acid binding molecule are linked to an avidin-like molecule by means of a bridging agent which may be the same or different, said molecule binding to nucleic acids being linked to said nucleic acid molecule.
According to another embodiment (B), the invention relates to a conjugate characterized in that it further comprises a molecule of binding to nucleic acids and a peptide cleavable by at least one glycolytic and / or proteolytic enzyme, such as said domain of translocation, said antibody and said cleavable peptide are linked to a avidin-like molecule using a bridging agent which can be identical or different, said nucleic acid binding molecule being linked to said nucleic acid molecule, said binding molecule to the nucleic acids being linked to said cleavable peptide and to said nucleic acid molecule.

According to another aspect (C), the invention relates to a conjugate for transferring a nucleic acid molecule into a cell characterized in that it comprises a nucleic acid molecule, a antibody specific for a cell surface antigen and a nucleic acid binding molecule such that said conjugate is efficiently transfected into said cell; this conjugate is characterized in that said nucleic acid molecule, said antibody and said nucleic acid binding molecule are linked to a molecule of avidin type using a bridging agent which may be identical or different, said nucleic acid binding molecule being linked to said nucleic acid molecule.
According to a preferred embodiment (C) the preceding conjugate is characterized in that it further comprises a peptide cleavable by at minus a glycolytic and / or proteolytic enzyme, said antibody being linked to said nucleic acid binding molecule via said cleavable peptide; in this conjugate, said antibody and said peptide cleavable are linked either (i) covalently via a bridging agent preferably selected from the group consisting of benzoquinone, EDC, APDP, or either (ü) via an avidin-like molecule at bridging agent which may be the same or different and preferably selected from the group consisting of biotin, the benzoquinone, EDC, APDP. In this conjugate, said peptide cleavable is linked to said nucleic acid binding molecule at by means of a bridging agent which is preferably APDP, said nucleic acid binding molecule binding said nucleic acid by a non-covalent bond.
According to one embodiment (D), the invention relates to a conjugate for the transfer of a nucleic acid molecule into a cell characterized in that it comprises an acid molecule nucleic acid, an antibody specific for a cell surface antigen and a peptide cleavable by at least one glycolytic enzyme and / or proteolytic such that said conjugate is efficiently transfected into said cell. In this conjugate, said antibody and said cleavable peptide are either (i) covalently linked via a bridging agent preferably selected from the group consisting of benzoquinone, EDC, APDP, or (ü) to an avidin-like molecule using a bridging agent which may be the same or different selected preferably in the group consisting of biotin, benzoquinone, EDC, APDP. In this conjugate, said cleavable peptide is linked said nucleic acid either (i) by a covalent bond by means of a bridging agent which is preferably APDP, ie (ü) via a molecule of binding to nucleic acids, said molecule of binding to acids nucleic acids being linked to said cleavable peptide by a covalent bond by means of a bridging agent which is preferably APDP. According to a particularly preferred mode of the invention said conjugate further includes a translocation domain which is optionally covalently linked with a bridging to said nucleic acid molecule and / or to said molecule binding to nucleic acids. According to another embodiment, said translocation domain is present within the conjugate without being there covalently linked.
The term “cleavable peptide” is intended to denote a peptide comprising one or more cleavable sequences by glycolytic enzymes and / or proteolytics, preferably endosomal and / or lysosomal such as for example cathepsins and trypsin. According to a mode particular embodiment, the cleavable peptide of the invention comprises at least minus one cathepsin B site and / or one cathepsin D site.
preferred, the cleavable peptide has a cathepsin B site and a site cathepsin D separated by at least one amino acid, preferably by at least two amino acids such as for example glycine; the peptide cleavable of the invention has the sequence: X ~ -X2-FYGGFR- in which G represents glycine, X ~ and X2 amino acids allowing the attachment or chemical bond of the antibody such as for example two lysines (K). FY represents the dipeptide composed of amino acids phenylalanine-tyrosine which is cleavable by cathepsin D; this sequence can optionally be replaced by LY (leucine-tyrosine), YL (tyrosine-leucine) or FF (phenylalanine-phenylalanine).
FR represents the dipeptide composed of the amino acids phenylalanine-arginine which is cleavable by cathepsin B.
The bridging agent makes it possible to bind chemically (covalently),

5 électrostatique, non-covalente tout ou partie des composants du conjugué. Parmi les agents de pontage susceptibles d'étre utilisés dans la présente invention, il convient de citer la benzoquinone, la carbodümide et plus particulièrement l'EDC (1-Ethyl-3[3 Diméthylaminopropyl]carbodümide hydrochloride), la dimaléimide, 10 l'acide dithio-bis-nitrobenzoique (DTNB), le N-succinimidyl-S-acétyl-thioacétate (SATA), les agents pontants possédant un ou plusieurs groupements phénylazide réagissant avec les ultraviolets (U.V.) et de préférence le N-(-4-(azidosalicylamino)butyl]-3'-(2'-pyridyldithio)propionamide (APDP), le N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), le 6-hydrazinonicotimide (HYNIC), la biotine; la benzoquinone, fEDC, fAPDP et la biotine étant les agents de coupage préféremment utilisés. Par "molécule de type avidine", on entend désigner toutes molécules se liant avec une forte affinité à la biotine, et de préférence la molécule tétravalente d'avidine, la streptavidine, la neutravidine.
Selon un mode préféré de réalisation de l'invention, le conjugué
précédemment décrit selon les différents modes de réalisation de l'invention est caractérisé en ce que ledit agent de pontage est sélectionné dans le groupe composé de la benzoquinone, de la biotine, des carbodümides, des agents pontants présentant au moins un groupement phénylazide réagissant aux ultra-violets (UV). Selon un mode préféré, l'agent de pontage est sélectionné dans le groupe composé de la benzoquinone, de la biotine, de l'EDC, l'APDP.
Selon un autre mode préféré de réalisation de l'invention, le conjugué précédemment décrit selon le deuxième mode de réalisation (B) est caractérisé en ce que l'agent de pontage qui lie ledit domaine de translocation et ledit anticorps à la molécule de type avidine est la biotine et, l'agent de pontage qui lie ladite molécule de liaison aux acides nucléiques à la molécule de type avidine est la benzoquinone.
Selon un autre mode préféré de réalisation de l'invention, le conjugué
précédemment décrit selon le deuxième mode de réalisation (B) est caractérisé en ce que l'agent de pontage qui lie ledit domaine de translocation, ledit anticorps et ladite molécule de liaison aux acides nucléiques est la biotine. Selon un mode particulier de réalisation de l'invention, le conjugué précédemment décrit selon le deuxième mode de réalisation (B) se caractérise en ce que le domaine de translocation et la molécule de liaison aux acides nucléiques forment une protéine de fusion. Par protéine de fusion, on entend désigner une protéine qui renferme des domaines protéiques provenant de protéines différentes et codées par une même molécule d'ADN obtenue par la technologie de l'ADN recombinant. Cette protéine de fusion et l'anticorps sont liés à
une molécule de type avidine aux moyens d'agents de pontage qui sont identiques ou différents, ladite protéine de fusion étant liée à ladite molécule d'acide nucléique par son domaine de liaison aux acides nucléiques.
Selon un autre mode préféré de réalisation de l'invention, le conjuguë précédemment décrit selon le deuxième mode de réalisation (B) et qui comprend un peptide clivable est caractérisé en ce que l'agent de pontage qui lie ledit domaine de translocation et ledit anticorps à la molécule de type avidine est la biotine et, l'agent de pontage qui lie ledit peptide clivable à la molécule de type avidine est la benzoquinone. Selon un autre mode préféré de réalisation de l'invention, le conjugué précédemment décrit selon le deuxième mode de réalisation (B) est caractérisé en ce que l'agent de pontage qui lie ledit domaine de translocation, ledit anticorps et ledit peptide clivable est la biotine.
Selon un autre mode préféré de réalisation, le conjugué
précédemment décrit selon un autre mode de réalisation (C) de l'invention est caractérisé en ce que en ce que l'agent de pontage qui lie ledit anticorps à la molécule de type avidine est la biotine, et l'agent de pontage qui lie ladite molécule de liaison aux acides nucléiques à la molécule de type avidine est la benzoquinone. Selon un autre mode préféré de réalisation, le conjugué précédemment décrit est caractérisé
en ce que ledit agent de pontage est la biotine.
Le conjugué selon l'invention se caractérise en ce que la molécule d'acide nucléique du conjugué est choisie parmi l'ADN simple brin, l'ADN double brin, l'ARN simple brin, l'ARN double brin, l'hybride ARN/ADN. Selon un mode préféré de réalisation, ladite molécule d'acide nucléique est de l'ADN double brin ou de l'ARN simple brin qui code pour un produit protéique d'intérêt qui s'exprime efficacement dans ladite cellule. Les produits protéiques d'intérêt sont choisis dans un groupe composé des interleukines, des cytokines, des lymphokines, des chémokines, des facteurs de croissance, des protéines tueuses, des protéines qui permettent de lever la chimiorésistance et des enzymes de restriction ; les interleukines, cytokines et lymphokines sont choisies dans un groupe composé de préférence des interleukines Il-l, Il-2, Il-3, Il-4, Il-5, Il-6, Il-7, Il-8, Il-9, Il-10, Il-11, Il-12, Il-13, Il-14, Il-15, Il-16, Il-17 et Il-18, des interférons a-IFN, a-IFN et y-IFN ; de préférence le produit protéique d'intérêt est l'interleukine 2. Les facteurs de croissance sont de préférence les facteurs stimulateurs des colonies (colony stimulatingfactors) G-CSF,GM-CSF, M-CSF) et l'rythropoitine, il convient galement de citer facteurs les de croissance qui interagissent en les inhibant,avec les facteurs de transcription nucléaires tels NF-KB ; ces facteurs de croissance ont fait l'objet de la demande de brevet FR 98 14858. Les protéines tueuses sont choisies parmi le groupe composé des kinases, et de préférence la thymidine kinase, et des protéines pro-apoptotiques ; on entend désigner par protéines pro-apoptotiques les protéines qui interviennent dans l'apoptose ou promeuvent l'apoptose. Parmi les protéines pro-apoptotiques, il convient de citer les protéines de la famille de Bcl2, et plus particulièrement les protéines BIK (Bcl2-interacting protein), BAX
(Oltvai et al. 1993, Cell 74 :609-619), BAK (Chittenden et al. 1995, Nature 374 : 733-736 ; Kiefer et al. 1995, Nature 374 : 736-739) et BID
(BH3-interacting domain death agonist) (Wang et al. 1996, Genes Dev.

: 2859-2869); de préférence le produit protéique d'intérêt est la protéine BAX. Parmi les protéines pro-apoptotiques, il convient également de citer les caspases, la protéine AIF (apoptosis-inducing factor) (Susin et al. 1999, Nature 397 : 441-446) et les protéines de la 5 famille du facteur nécrosant des tumeurs (TNF, tumor necrosing factor), et plus particulièrement le TNF lui-même (01d 1985, Science 230 : 630-632), la protéine FASL (FAS-ligand) (Takahashi et al. 1994, Int. Immun. 6 :1567-1574) .
Selon un autre mode de réalisation de l'invention, la molécule 10 d'acide nucléique est un ARN antisens.
Selon l'invention, le conjugué selon l'invention se caractérise en ce que la molécule de liaison aux acides nucléiques lie ladite molécule d'acide nucléique par une liaison non-covalente. La moléculé de liaison aux acides nucléiques est soit un polymère polycationique soit une protéine de liaison aux acides nucléiques : (i) le polymère polycationique est choisi parmi la poly-L-lysine, la poly-D-lysine, le polyéthylènimine, la polyamidoamine, la polyamine et toutes polycations libres d'origine chimique ; de préférence, le polymère polycationique est la poly-L-lysine ; (ü) la protéine de liaison aux acides nucléiques est choisie parmi les histones, la protamine, l'ornithine, la putrescine, la spermidine, la spermine, les facteurs de transcription, les protéines homéobox ; de préférence, la protéine de liaison aux acides nucléiques est une protamine et/ou une histone.
Lors de la préparation du conjugué selon l'invention, qui comprend un domaine de liaison aux acides nucléiques tels que la protamine et/ou les histones, le domaine de liaison est de préférence ajouté en excès. Ce domaine de liaison est ensuite présent en excès dans le conjugué. Par le terme "en excès", on entend désigner que le domaine de liaison aux acides nucléiques et les autres composants du conjugué
ne sont pas présents en quantité stoechiométrique.
La présence en large excès de molécule de liaison aux acides nucléiques tels que la protamine ou les histones permet et favorise le compactage de la molécule d'acides nucléiques, permettant ainsi une transfection efficace de la molécule d'acide nucléique dans la cellule et plus particulièrement une translocation et un ciblage de la molécule d'acide nucléique dans le noyau de la cellule. Par ailleurs, le compactage de la molécule d'acide nucléique de l'invention par une molécule de liaison aux acides nucléiques telle que la protamine ou les histones permet de protéger ladite molécule d'acides nucléiques des dégradations par les nucléases cellulaires et extracellulaires.
L'utilisation de la protamine et des histones pour favoriser la transfection et l'expression de molécule d'acide nucléique est depuis longtemps connue de l'homme de l'art (Wienhues et al. ( 1987) et Dubes et Wegrzyn ( 1978)).
Le conjugué selon l'invention se caractérise en ce que ledit domaine de translocation dérive d'une toxine bactérienne ou virale sans contenir la partie de la toxine qui lui confèré son effet toxique: La toxine bactérienne ou virale est choisie parmi: l'exotoxine A de Pseudomonas, la toxine diphtérique, la toxine cholérique, la toxine anthrox de Bacillus, la toxine Pertussis, la toxine Shiga de Shigella, la toxine apparentée â la toxine Shiga, les toxines d'Escherichia coli, la colicine A, la d-endotoxine, l'hémagglutinine d'Haemophilus A. Dans un mode préféré de réalisation, le domaine de translocation est l'exotoxine A de Pseudomonas aeruginosa. Dans un autre mode préféré
de réalisation, le domaine de translocation est le fragment B non toxique de la toxine Shiga de Shigella.
Dans un autre mode préféré de réalisation, le domaine de translocation est un fragment de l'hémagglutinine d'Haemophilus A. Ce fragment de l'hémaglutinine de l'influenza A (HA) peut étre modifié â
son extrémité C-terminale par l'adjonction d'une cystéine ou par l'adjonction d'une courte séquence peptidique se terminant par une cystéine afin de faire réagir avec cette cystéine l'agent de couplage, qui est de préférence l'APDP.
Le conjugué selon l'invention est caractérisé en ce que l'anticorps est un anticorps monoclonal ou un anticorps polyclonal spécifique d'un antigène de surface membranaire. Selon un des modés préférés de réalisation de l'invention, l'anticorps se lie spécifiquement à
l'antigène 6250 caractéristique des carcinomes des cellules rénales humaines (RCC). Selon un mode préféré de réalisation de l'invention, l'anticorps de l'invention est l'anticorps 6250 décrit par Oosterwijk et 5 al. ( 1986, Int. J. Cancer. 38 :489-494) et qui a fait l'objet de la demande de brevet internationale WO 88/08854. Selon un autre mode préféré de réalisation, l'anticorps selon la présente invention est un anticorps monoclonal 5C5 obtenu par l'hybridome 5C5 déposé à la CNCM sous le N°I-2184. L'anticorps selon l'invention est soit sous la 10 forme d'un anticorps simple chaîne, soit sous la forme d'un anticorps chimérique ou d'un anticorps humanisé. Selon un mode particulier de réalisation, l'anticorps est un fragment d'anticorps, de préférence un fragment F(ab')2, Fab' ou Fv.
Le conjugué ADN-anticorps de la présente invention peut être 15 administré selon diverses voies connues par les personnes de l'art. Par exemple, il peut être administré par voie intraveineuse, par voie intrapéritonéale, par voie intramusculaire, par voie sous-cutanée, par voie intra-tumorale, par voie anale ou rectale.
Enfin, l'invention porte sur un conjugué tel que décrit précédemment à titre de médicament. Plus particulièrement, l'invention porte sur un conjugué tel que décrit précédemment à titre de médicament pour la thérapie génique et plus précisément pour le traitement des maladies génétiques acquises ou constitutionnelles.
Selon l'invention, les maladies acquises sont sélectionnées dans le groupe composé des cancers et des maladies infectieuses. Parmi les cancers selon l'invention, on peut citer, le carcinome des cellules rénales (RCC), le mélanome, la leucémie myéloide chronique, la leucémie myéloïde aiguë, le lymphome de Burkitt, le cancer pulmonaire à petites cellules, le neuroblastome, le rétinoblastome, le glioblastome, l'hépatocarcinome, rhabdomyosarcome, l'adénocarcinome gastrique, le carcinome colique, le cancer ovarien, le carcinome mammaire, le cancer de l'utérus, le carcinome du testicule.
De préférence, l'invention porte sur un conjugué tel que décrit précédemment à titre de médicament pour le traitement du carcinome des cellules rénales (RCC). Parmi les maladies infectieuses on peut citer de préférence le SIDA et les hépatites.
Selon l'invention, les maladies constitutionnelles sont sélectionnées de préférence dans le groupe composé des myopathies, et plus particulièrement de la myopathie de Duchenne (DM), la myopathie de Steinert et l'amyotrophie spinale (SMA), la mucoviscidose, la sclérose latérale amyotrophique (SLA), l'hémophilie, les hémoglobinopathies, les maladies neurodégénératives telles la maladie d'Alzheimer, la maladie de Parkinson et la chorée de Huntington, la maladie de Gaucher, la maladie de Lesch-Nyhan, les déficiences immunitaires liées à un déficit en adénosine désaminase ou en purine nucléoside phosphorylase, l'emphysème pulmonaire, l'hypercholestérolémie.
Il est évident que le composé selon l'invention a de multiples applications selon la nature de la séquence d'ADN et de la nature de l'anticorps sélectionnés. Ces multiples applications sont facilement envisageables par une personne de l'art et ne peuvent étre mentionnées de manière exhaustive.
L'invention porte également sur une composition pharmaceutique notamment pour le traitement des maladies par thérapie génique qui comprend une quantité thérapeutiquement efficace d'un conjugué
selon l'invention et un véhicule pharmaceutiquement acceptable.
La présente invention porte également sur un procédé de transfert d'une molécule d'acide nucléique dans une cellule, caractérisé en ce qu'on met en contact avec ladite cellule le conjugué selon l'invention de façon à transfecter ladite cellule avec ledit conjugué. De préférence, la molécule d'acide nucléique code pour un produit protéique d'intérét qui s'exprime efficacement dans ladite cellule transfectée.
Selon un mode préféré de réalisation de l'invention, la molécule d'acide nucléique est de l'ADN double brin codant pour un produit protéique d'intérêt. La présente invention fournit donc un système efficace qui permet le transit de la molécule d'ADN double brin à
travers la membrane cellulaire cytoplasmique, le transport vers le noyau, l'entrée dans le noyau et le maintien à l'état fonctionnel de cette molécule dans le noyau. La persistance de l'expression du produit protéique codé par la molécule d'ADN est obtenue soit par l'intégration stable de la molécule d'ADN dans l'ADN chromosomique de la cellule cible, soit par maintien de la molécule d'ADN sous la forme d'un réplicon extrachromosomique. C'est donc un des objets de la présente invention de fournir un procédé caractérisé en ce que ladite molécule d'acide nucléique se maintient sous la forme d'un réplicon extrachromosomique dans ladite cellule. Selon un autre mode de réalisation, la présente invention fournit un procédé caractérisé en ce que ladite molécule d'acide nucléique s'intègre dans l'ADN génomique et/ou mitochondrial de ladite cellule transfectée.
La cellule ciblée par le composé de la présente invention est une cellule procaryote ou eucaryote, animale ou végétale. Selon un mode de réalisation préféré, l'invention concerne un procédé caractérisé en ce que ladite cellule est une cellule eucaryote, de préférence une cellule de mammifère, et de manière préférée une cellule humaine.
Enfin, l'invention concerne les cellules transfectées par le conjugué
selon l'invention ; la cellule étant de préférence une cellule eucaryote, plus particulièrement de mammifère, et de manière préférée humaine.
D'autres caractéristiques et avantages de la présente invention seront mieux mis en évidence à la lecture des exemples suivants.
Dans ces exemples, on se référera aux figures suivantes Figure N° 1 : Production d'interleukine 2 murine par des lignées RCC antifectées par le conjugué G250/BZQ/I12 (G250=DNA) en présence ou non d'exotoxine A.
Figure N°2 : Production d'interleukine 2 murine par des lignées RCC antifectées par les conjugués G250-Biotinylé/avidine/BZQ/PL/Il2 (G250AvPL) et (G250+ExoT)-Biotinylé/avidine/BZQ/PL/I12 (G250AvPLTox) ; contrôle négatif avidine/BZQ/PL/I12 (AvPL).

Figure 3 : Expression de la molécule CD4 à la surface de cellules de cancer de rein humain après antifection in vitro (°% de cellules positives) Figure 4 : Mesure de la sécrétion d'IL-2 de souris 11 jours après antifection de cellules de cancer de rein humain in vitro Figure 5 : Induction de la mort de cellules de rein humain après antifection in vitro par l'ADNc de Bax humain.
Figure 6 : Mesure du volume de tumeurs obtenues aux jours J=7 et J=19 après la greffe tumorale après antifection in vivo de l'ADNc de Bax murin avec une injection (30 ~.g d'ADN) au jour J=7.
Figure 7 : Infiltration de tumeurs par des cellules CD 16+ après antifection de l'ADNc de Bax murin EXEMPLES
EXEMPLE 1 : MATERIELS ET METHODES (voir Dûrrbach et al., The antibody-mediated endocytosis of 6250 tumor-associated antigen allows targeted gene transfer to human renal-cell carcinoma in vitro, Cancer Gene Therapy, Sous Presse) 1.1. Cellules Les lignées cellulaires de carcinome rénal utilisées sont IGR/RCC-17 (HIEG), IGR/RCC-40 (ROB), IGR/RCC-47 (FRAP), IGR/ RCC-58 (MOJ) qui dérivent de trois tumeurs primaires (-17, -et -47) et d'une métastase surrénale (-58), de quatre patients atteints de RCC au stade métastatique. Selon les critères histologiques, le RCC-17, -40 et -58 correspondent à des carcinomes à cellules claires et le RCC-47 à une forme particulière de carcinome à cellules claires avec des foci papillaires typiques hautement tumorigéniques chez la souris SCID (Angevin et al.
( 1997) Proc. Am. Asso. Cancer Res. 38 : 238 ; Goulkhova et al.
(1998) Genes Chrom. Cancer 22 :171-178). L'établissement de la culture in vitro ainsi que la caractérisation des lignées cellulaires de RCC ont été réalisées comme précédemment décrit (Angevin et al. (1997 Int. J. Cancer 72 :434-440). Les cellules sont cultivées à
37°C dans une atmosphère comportant 5% de C02 dans du milieu MEM modifié par Dulbecco avec du Glutamax-1 (Gibco BRL, Paisley, Scotland) supplémenté avec 10% de sérum de veau fétal (Seromed, Berlin, Allemagne), 5% d'acides aminés non-essentiels, 10 mM de pyruvate de sodium (Gibco BRL) et un mélange de pénicilline/streptomycine (lOmg/ml) (Seromed).
1.2. Immunophénotypage de l'antigène 6250 L'expression de l'antigène 6250 associé aux tumeurs RCC a été
directement testée par immunomarquage indirect en utilisant l'anticorps monoclonal IgG 1 6250 (mAb 6250) de souris précédemment décrit (Oosterwijk et al., 1986, Int. J. Cancer.
38:489-494). Une suspension de 5.105 cellules, obtenues par trypsination, a été lavée deux fois dans du milieu de culture des RCC ; les cellules sont ensuite incubées avec le mAb 6250, lavées 3 fois dans du PBS (Phosphate-buffered saline), puis incubées avec un fragment F(ab')2 d'anticorps IgG de chèvre anti-souris marqué au FITC. L'anticorps monoclonal NKTA ayant le même isotype (IgG 1 dirigé contre un déterminant clonotypique du TCRa/ a) (fourni gracieusement par le Docteur Thierry Hercend, France) a été utilisé comme contrôle négatif. La cytométrie de flux a été réalisée avec un cytomètre FACScan (Becton-Dickinson, Sunnyvale, CA, USA) utilisant le logiciel Cellquest.

1.3. Expériences d'endocptose L'anticorps 6250 et l'apo-transferrine humaine chargée en fer (Sigma, St-Louis, MO, USA) ont été couplés respectivement avec de la fluorescéine isothiocyanate (Sigma) et avec du chlorure de 5 sulfonyl Rhodamine B lissamine tel décrit précédemment (Maxfield et al., 1978, Cell 14 :805-810 ; Brandzaeg, 1973, Scan.
J. Immunol. 2 : 273-290). Les protéines conjuguées sont séparées des fluorochromes libres par gel filtration sur une colonne de Sephadex G50 (Pharmacie, Uppsala, Sweden). La liaison 10 spécifique des protéines couplées avec les récepteurs cellulaires de surface a été déterminée par des expériences de compétition utilisant une concentration 100 fois supérieure de protéines non-couplées. L'ADN plasmidique BMGnéo-mIL2 contenant le cDNA de l'interleukine 2 de souris (IL-2) sous le contrôle du promoteur 15 inductible du gène de la métallothionéine (Karasuyama et Melchers, 1988, Eur. J. Immunol. 18: 97-104) (1 mg/ml) est incubé (vol/vol) avec EZ-link-Biotin-LC-ASA reconstitué dans l'éthanol (2 mg/ml) (Pierce, Rockford, IL, USA) et exposé pendant 15 min aux UV (365 nm) à 4°C. L'ADN plasmidique est ensuite 20 précipité à l'éthanol (concentration finale 70%) pendant 30 min à -20°C. L'efficacité du marquage est déterminée par un test ELISA
sur des microplaques couvertes de poly-L-lysine en utilisant de la phosphatase-alkaline conjuguée à de la streptavidine.
Pour tester l'endocytose, les cellules cultivées deux jours sur des lamelles sont lavées trois fois avec du RPMI-1640 (Gibco BRL) contenant 1 mg/ml de sérum albumine bovine (BSA), puis sont incubées deux fois 15 min dans du RPMI-1640 contenant 1 mg/ml de BSA à 37°C avec ou sans cytochalasine D (5 OM) (Sigma). Les cellules sont ensuite incubées une heure à 4°C avec de la transferrine conjuguée à la rhodamine (50 nM) et de l'anticorps monoclonal 6250 marqué au FITC dans du RPMI-1640 contenant 1 mg/ml de BSA avec ou sans cytochalasine D (5 ~M) puis transférées à 37°C pendant des temps variables avec de la WO 00/67697 ~ PCT/FR00/01259 transferrine-Rhodamine seulement (pulse) ou avec le mAb 6250 marqué au FITC. Les cellules sont lavées trois fois avec du PBS
froid, fixées 20 min avec une solution de paraformaldéhyde 4%, glutaraldéhyde 0.025% dans du PBS à 4°C et préparées pour l'analyse en épifluorescence. Pour analyser la distribution du conjugué mAb 6250-plasmide par double marquage, les cellules ont été incubées en permanence comme décrit ci-dessus soit avec du mAb 6250 marqué au FITC conjugué avec de l'ADN
plasmidique biotinylé ou soit avec un mélange de mAb 6250 marqué au FITC et de l'ADN plasmidique biotinylé, comme contrôle.
Après fixation, les cellules sont lavées deux fois dans du PBS, incubées 10 min avec 0,1% de borohydrate de sodium dans du PBS (ICN, Costa Mesa, CA, USA) et puis 10 min avec du chlorure d'ammonium (50 mM dans du PBS) (Sigma). Selon les conditions expérimentales, les cellules sont soit directement analysées par immunofluorescence pour détecter le mAb 6250 marqué au FITC ou soit perméabilisées avec du PBS contenant 0,05% de saponine ou 0,1% de Triton X100 (ICN) puis marquées avec de la streptavidine conjuguée au Texas-red (20 mg/ml) (Pierce). Les filaments d'actine sont marqués avec de la phalloidine-rhodamine selon les recommandations du fabricant (Sigma) .
Les cellules sont ensuite visualisées avec un microscope Axiophot (Zeiss, Oberkochen, Germany) .
1.4. Antifection et analyse de l'expression hétérologue Pour la transfection, 3.105 cellules de RCC fraichement trypsinées sont incubées pendant 30 min à 4°C avec des concentrations différentes de conjugués mAb-ADN selon l'invention dans 1 ml de RPMI-1640 sans sérum. Les cellules sont ensuite incubées pendant 4 heures à 37°C dans 1 ml de RPMI-1640 sans-sérum contenant 4.105 M de chloroquine (Sigma) et finalement WO 00!67697 PCT/FR00/01259 resuspendues dans 2 ml de DMEM supplémenté avec du glutamax-1 (Gibco BRL) et 10% de sérum de veau fétal. Dans des expériences séparées, les cellules de RCC sont incubées avec l'ADNc d'IL-2 de souris conjugué au mAb 6250 en présence de cytochalasine D pendant 1 heure à 4°C et 4 heures à 37°C. Les conjugués toujours liés à la surface cellulaire ont été décrochés avec une solution de RPMI-1640 pH2,2 contenant de la glycine 0,1 M pendant 2 min à 4°C. Deux volumes de RPMI-1640 pH 9,0 sont ensuite ajoutés pendant 3 min et les cellules sont incubées dans un milieu de culture normal. Pour déterminer la production d'interleukine 2 murine, 100 ~l de surnageants de culture de cellules ont été prélevés à des jours différents après la transfection. La production de cytokine dans le milieu a été
déterminée en utilisant le kit ELISA DuoSeT spécifique de l'IL-2 de souris (Réf. 80-3573-00) (seuil de détection de 15 pg/ml) (Genzyme Diagnostics, Cambridge, MA, USA) EXEMPLE 2: Conjugués G250/BZQ/I12 et G250/BZQ/I12+ExoT
2.1. Préparation du conjugué G250/BZQ/I12 Le conjugué G250/BZQ/Il2 est préparé par couplage entre l'anticorps monoclonal 6250 et un plasmide codant pour l'interleukine 2 murine (mIl-2) au moyen de la benzoquinone (BZQ) selon la méthode de couplage précédemment décrite par Poncet et al. (1996, Gene Therapy 3 : 731-738).
La BZQ dissoute dans de l'éthanol absolu à une concentration de mg/ml est ajoutée à une solution d'anticorps monoclonal 30 purifié en solution dans du PBS à une concentration d'au moins 2 mg/ml pour donner une solution finale contenant 3 mg/ml de BZQ. 1/ 10 du volume final est ensuite ajouté sous la forme de tampon de phosphate de potassium 1M pH 6Ø Après 90 min. à

température ambiante, dans l'obscurité, l'anticorps monoclonal activé est séparé de l'excès de BZQ par chromatographie sur une colonne G25M (Pharmacia) présaturée en 1% BSA dans du NaCI
0,15M, collecté puis mélangé avec l'ADN plasmidique purifié ( 10 fois la quantité d'anticorps). La solution est mélangée avec 0.1 M
de tampon carbonate pH 8,7 et incubée 48 heures à 4°C. Le conjugué mAb-ADN est concentré par filtration sur gel sur une colonne FPLC Superose 6HR (Pharmacia) pour éliminer les excès d'anticorps libre susceptibles d'entrer en compétition avec le conjugué ADN-anticorps. Les fractions collectées sont dialysées contre du PBS et concentrées en utilisant une cartouche Centricon 10 (Amicon, MA, USA). Les quantités de conjugués solubles purifiés sont exprimées comme la quantité d'ADN
plasmidique initialement utilisée dans la réaction.
2.2. Antifection de lignées RCC avec les conjugués G250/BZQ/I12 et G250/BZQ/I12+ExoT
Nous avons comparé la mesure d'Il-2 après transfert de ce conjugué dans des lignées RCC après addition ou non d'exotoxine A (ExoT) de Pseudomonas Aeruginosa dans le milieu de culture.
L'exotoxine A commercialisée par Sigma est ajoutée au conjugué
G250/BZQ/I12.
Les conjugués G250/BZQ/Il2 et G250/BZQ/I12+ExoT sont mis en contact avec 105 cellules de lignées RCC en culture dans un milieu dépourvu en sérum pendant 4 heures à 37°C selon le protocole préalablement décrit. Les cellules sont remises en culture en milieu normal après lavages. La production d'Il-2 est mesurée 10 jours plus tard en utilisant le kit ELISA DuoSeT (Réf.
80-3573-00, Genzyme Diagnostics).
Les cellules antifectées avec le conjugué G250/BZQ/Il2+ExoT
produisent environ 3 fois plus d'Il-2 murine (371 pg/ 106 cellules) que les cellules antifectées par le conjugué G250/BZQ/I12 (165 pg/ 10~ cellules) (Figure N° 1).

EXEMPLE 3 : Conjugués 6250-Biotinylé/avidine /BZQ/PL/I12 et (6250+ExoT)-Biotinylé/avidine/BZQ/PL/I12 3.1. Préparation des conjugués Le corps central des conjugués G250-Biotinylé/ avidine/ BZQ/ PL/ Il2 et (G250+ExoT)-Biotinylé/avidine/BZQ/PL/I12 se compose d'une molécule tétravalente d'avidine (Av) qui est dans un premier temps activée par la benzoquinone selon le protocole précédemment décrit.
L'avidine activée lie les molécules de poly-L-lysine qui sont des molécules très affines pour l'ADN. Le complexe Avidine/BZQ/PL
est mis en contact avec le plasmide codant l'interleukine 2 de souris (Il-2). Le complexe est ensuite associé à l'anticorps monoclonal 6250 et/ou à l'exotoxine A (ExoT) tous deux préalablement biotinylés.
3.2. Antifection de lignées RCC avec les conjugués 6250 Biotinylé/ avidine/BZQ/PL/I12 et (6250+ExoT)-Biotinplé/
avidine/ BZQ / PL/ I12 Les différents complexes sont mis en contact avec 105 cellules de lignées RCC en culture dans un milieu dépourvu en sérum pendant 4 heures à 37°C selon le protocole préalablement décrit.
Les cellules sont remises en culture en milieu normal après lavages. La production d'Il-2 est mesurée 10 jours plus tard en utilisant le kit ELISA DuoSeT (Réf. 80-3573-00, Genzyme Diagnostics).
Les résultats sont présentés dans la figure N°2. Dans l'expérience contrôle dans laquelle l'anticorps monoclonal 6250 a été omis, une certaine production de mIl-2 est mesurée ( 127 pg/ 106 cellules, AvPL) due certainement à l'accrochage non spécifique des pg/ 10~ cellules) (Figure N° 1) molécules de poly-L-lysine et/ou d'avidine à la surface des cellules. L'addition de mAb 6250 au complexe avidine / BZQ / PL/ I12 augmente de 2 fois la production d'interleukine 2 murine (261 pg/ 106 cellules au lieu de 127 5 pg/ 106 cellules); la présence supplémentaire d'exotoxine A (ExoT) permet d'augmenter de 10 fois la production de mIl-2 ( 1347 pg/ 106 cellules) (Figure N°2).
EXEMPLE 4 : Conjugué 6250-biotinplé/neutravidine/histone H1 10 biotinylê/peptide fusiogène de l'hémaglutinine d'Influenzae (HA) biotinylé/ CD4 Les différents complexes tels que mentionnés sur les figures sont mis en contact avec des RCC, comme décrit dans l'exemple 3, section 3.2.
La figure 3 représente l'analyse en cytométrie en flux des cellules RCC
humaines portant l'Ag 6250, collectées 7 jours après antifection de l'ADNc codant pour la molécule de CD4 humain et marquées par un AcM anti-CD4 humain. Environ 20% des cellules expriment de la sorte cette molécule. Le vecteur utilisé comprenait la totalité des molécules, G250,H l,HA,ADNc. La séquence du peptide HA utilisé est la suivante GLFEAIAGFIENGWEGMIDGGGCGSGSYTDIEMNRLGKG.
EXEMPLE 5 : Conjugué 6250-biotinylé/neutravidine/histone H1 biotinplé/I12 et Conjugué 6250 biotinplé/neutravidine/histone H1 biotinylé/peptide fusogëne HA biotinplé/I12 La figure 4 représente le résultat d'une antifection de cellules RCC
humaines portant l'Ag 6250, collectées 11 jours après antifection d.e l'ADNc codant pour l'interleukine-2 de souris. La quantité d'IL-2 sécrétée par les RCC mises en contact avec l'ADNc seul ou couplé à la neutravidine est de 80 pg/ 106 cellules, 1200 pg/ 106 cellules pour les RCC mises en contact avec un conjugué comprenant G250/H 1 /ADNc et 3100 pg/ 106 cellules pour les RCC mises en contact avec un conjugué comprenant G250/Hl/HA/ADNc.
EXEMPLE 6 . 6250 biotinylé/neutravidine/histone H1 biotinylé/BAX et 6250 biotinylé/neutravidine/histone H1 biotinylé/peptide fusogène HA biotinylé/BAX
La figure 5 représente le résultat d'une antifection de cellules RCC
humaines portant l'Ag 6250, collectées 11 jours après antifection de l'ADNc codant pour la molécule pro-apoptotique Bax humaine. La mort cellulaire a été appréciée par coloration au bleu de Trypan. L'ADNc contrôle utilisé correspond au gène de la green fluorescent protein (GFP). On peut noter une augmentation importante de la perte de viabilité liée à l'accrochage de l'AcM 6250 « Vecteur BAX sans HA », accrue par l'accrochage du peptide fusiogène de HA « Vecteur BAX avec HA ».
EXEMPLE 7 . Antifection in vivo avec le conjugué 5C5 biotinylé/ neutravidine/ histone H 1 biotinylé/ peptide fusogène HA
biotinylé/BAX marin 7.1. Protocole Différents conjugués sont préparés à partir de - 10 ~g d'anticorps 5C5 - 30 ug d'ADN BAX marin - 15 ~g d'histone H 1 - 0.5 pg de peptide HA
- 4 ug de neutravidine.
Neuf souris nude irradiées servant de contrôle, ont reçu une greffe de tumeur RCC en sous-cutanée au jour J = 0. Ces souris greffées n'ont pas de conjugué.

Dix souris nude irradiées ont reçu une greffe de tumeur RCC en sous-cutanée au jour J = 0 puis au jour J = 7, elles ont reçu par voie intraveineuse le conjugué neutravidine-/HA/hl/Bax en une seule injection.
Dix souris nude irradiées ont reçu une greffe de tumeur RCC en sous-cutanée au jour J = 0 puis au jour J = 7, elles ont reçu par voie intraveineuse le conjugué 5C5/neutravidine/HA/H1/Bax en une seule injection.
La taille des tumeurs a ensuite été évaluée au jour JS, J8, J 12 et J 19 après l'injection les souris ont été sacrifiées au jour J 19.
7.2. Rêsultats Une diminution de la croissance tumorale inférieure à celle notée dans les groupes contrôles est observée chez 6 souris sur 10 recevant le complexe entier et 1 sur 10 dans le groupe traité avec le complexe sans anticorps, et ce à jour 19 après la première injection (figure N°6).
De façon intéressante, le marquage retrouvée dans les tumeurs antifectées avec Bax, à l'aide d'un AcM fluorescent dirigé contre la molécule CD 16 de souris présente sur des cellules de type natural killer (cellules NK), macrophages, granulocytes indique clairement la possibilité de recruter des cellules effectrices pouvant participer pleinement à la réponse anti-tumorale (figure N°7).

REFERENCES
Angevin et al. 1997, Proc. Am. Asso. Cancer Res. 38 : 238.
Angevin et al. 1997, Int. J. Cancer 72 :434.
Brandzaeg 1973, Scan. J. Immunol. 2 : 273.
Chittenden et al. 1995, Nature 374 : 733 Cournoyer et al. 1991, Human Gene Therapy, 2 : 203.
Dürrbach et al. (Sous Presse) Cancer Gene Therapy.
Dubes et Wegrzyn 1978, Protoplasma 96 : 209-223.
Fominaya et Wels 1995, J. Biol. Chem. 271 :10560.
Golumbek et al. 1991, Science 254 :713.
Goulkhova et al. 1998, Genes Chrom. Cancer 22 :171.
Hirsch et al. 1993, Transpl. Proc. 25 : 138.
Karasuyama et Melchers 1988, Eur. J. Immunol. 18 : 97.
Kasahara et al. 1987, J. Biol. Chem. 262 :4429.
Kiefer et al. 1995, Nature 374 : 736 Luthman et al. 1983, Nucleic Acids Res. 11 : 1295.
Maxfield et al. 1978, Cell 14 :805.
Michael et Curiel 1994, Gene Therapy 1:223.
Neda et al. 1991, J. Biol. Chem. 266 : 14143.
Old 1985, Science 230 : 630 Oltvai et al. 1993, Cell 74 :609 Oosterwijk et a1.1986, Int. J. Cancer. 38 :489.
Poncet et a1.1996, Gene Therapy 3 : 731.
Ragot et al. 1993, Nature 361 : 647.
Rosenberg et al. 1990, N. Eng. J. Med. 323 :570.
Roux et al. 1989, Proc.Natl.Acad.Sci. USA 86 :9079.
Susin et al. 1999, Nature 397 : 441.
Takahashi et al. 1994, Int. Immun. 6 :1567 Wang et al. 1996, Genes Dev. 10 : 2859 Wienhues et al. 1987, DNA 6(1) : 81-89.

Wu et al. 1991, ,1. Biol. Chem. 266 :14338.
Zenke et al. 1990, Proc.Natl.Acad.Sci. USA, 87:3655. 5 electrostatic, non-covalent all or part of the components of the conjugate. Among the bridging agents likely to be used in the present invention, it is worth mentioning benzoquinone, carbodümide and more particularly EDC (1-Ethyl-3 [3 Dimethylaminopropyl] carbodümide hydrochloride), dimaleimide, 10 dithio-bis-nitrobenzoic acid (DTNB), N-succinimidyl-S-acetyl-thioacetate (SATA), bridging agents having one or more phenylazide groups reacting with ultraviolet (UV) and preferably N - (- 4- (azidosalicylamino) butyl] -3 '- (2'-pyridyldithio) propionamide (APDP), N-succinimidyl-3- (2-pyridyldithio) propionate (SPDP), 6-hydrazinonicotimide (HYNIC), biotin; benzoquinone, fEDC, fAPDP and biotin being the agents of cutting preferably used. By "avidin-like molecule" we mean intends to designate all molecules which bind with a strong affinity to biotin, and preferably the tetravalent avidin molecule, the streptavidin, neutravidin.
According to a preferred embodiment of the invention, the conjugate previously described according to the different embodiments of the invention is characterized in that said bridging agent is selected from the group consisting of benzoquinone, biotin, carbodümides, bridging agents having at least one phenylazide group reacting to ultraviolet (UV) rays. According to a preferred mode, the bridging agent is selected from the group composed of benzoquinone, biotin, EDC, APDP.
According to another preferred embodiment of the invention, the conjugate previously described according to the second embodiment (B) is characterized in that the bridging agent which binds said domain of translocation and said antibody to the avidin-like molecule is the biotin and, the bridging agent that binds said binding molecule to Nucleic acids in the avidin-like molecule is benzoquinone.
According to another preferred embodiment of the invention, the conjugate previously described according to the second embodiment (B) is characterized in that the bridging agent which binds said domain of translocation, said antibody and said acid binding molecule nucleic acid is biotin. According to a particular embodiment of the invention, the conjugate previously described according to the second mode of realization (B) is characterized in that the translocation domain and the nucleic acid binding molecule form a protein of fusion. By fusion protein is meant a protein which contains protein domains from different proteins and coded by the same DNA molecule obtained by the technology of recombinant DNA. This fusion protein and the antibody are linked to an avidin-like molecule by means of bridging agents which are identical or different, said fusion protein being linked to said nucleic acid molecule by its acid binding domain nucleic acids.
According to another preferred embodiment of the invention, the conjugate previously described according to the second embodiment (B) and which comprises a cleavable peptide is characterized in that the bridging agent which binds said translocation domain and said antibody to the avidin-like molecule is biotin and, the bypass which links said cleavable peptide to the avidin-like molecule is the benzoquinone. According to another preferred embodiment of the invention, the conjugate previously described according to the second mode (B) is characterized in that the bridging agent which binds said translocation domain, said antibody and said peptide cleavable is biotin.
According to another preferred embodiment, the conjugate previously described according to another embodiment (C) of the invention is characterized in that in that the bridging agent which binds said antibody to the avidin-like molecule is biotin, and the agent of bridging which binds said nucleic acid binding molecule to the avidin-like molecule is benzoquinone. According to another mode preferred embodiment, the previously described conjugate is characterized in that said bridging agent is biotin.
The conjugate according to the invention is characterized in that the molecule of the conjugate nucleic acid is chosen from single-stranded DNA, double stranded DNA, single stranded RNA, double stranded RNA, hybrid RNA / DNA. According to a preferred embodiment, said molecule nucleic acid is double stranded DNA or single stranded RNA which code for a protein product of interest that expresses itself effectively in said cell. The protein products of interest are chosen from a group made up of interleukins, cytokines, lymphokines, chemokines, growth factors, killer proteins, proteins that lift chemoresistance and enzymes restriction; interleukins, cytokines and lymphokines are chosen from a group preferably made up of Il-1 interleukins, Il-2, Il-3, Il-4, Il-5, Il-6, Il-7, Il-8, Il-9, Il-10, Il-11, Il-12, Il-13, Il-14, Il-15, Il-16, Il-17 and Il-18, interferons a-IFN, a-IFN and y-IFN; of preferably the protein product of interest is interleukin 2. The growth factors are preferably stimulating factors colonies (colony stimulatingfactors) G-CSF, GM-CSF, M-CSF) and arthropoitin, it is also worth mentioning factors of the growth that interact by inhibiting them, with the factors of nuclear transcripts such as NF-KB; these growth factors have made the subject of patent application FR 98 14858. Killer proteins are selected from the group consisting of kinases, and preferably the thymidine kinase, and pro-apoptotic proteins; we hear designate by pro-apoptotic proteins the proteins which intervene in apoptosis or promote apoptosis. Among the proteins pro-apoptotics, proteins of the Bcl2 family should be mentioned, and more particularly the proteins BIK (Bcl2-interacting protein), BAX
(Oltvai et al. 1993, Cell 74: 609-619), BAK (Chittenden et al. 1995, Nature 374: 733-736; Kiefer et al. 1995, Nature 374: 736-739) and IDB
(BH3-interacting domain death agonist) (Wang et al. 1996, Genes Dev.

: 2859-2869); preferably the protein product of interest is the BAX protein. Among the pro-apoptotic proteins, also to mention the caspases, the protein AIF (apoptosis-inducing factor) (Susin et al. 1999, Nature 397: 441-446) and proteins from 5 family of tumor necrotizing factor (TNF, tumor necrosing factor), and more specifically the TNF itself (01d 1985, Science 230: 630-632), the FASL protein (FAS-ligand) (Takahashi et al. 1994, Int. Immun. 6: 1567-1574).
According to another embodiment of the invention, the molecule 10 nucleic acid is an antisense RNA.
According to the invention, the conjugate according to the invention is characterized in that that the nucleic acid binding molecule binds said molecule of nucleic acid through a non-covalent bond. The binding molecule to nucleic acids is either a polycationic polymer or a nucleic acid binding protein: (i) the polymer polycationic is chosen from poly-L-lysine, poly-D-lysine, polyethylenimine, polyamidoamine, polyamine and all free polycations of chemical origin; preferably the polymer polycationic is poly-L-lysine; (ü) acid binding protein nucleic acid is selected from histones, protamine, ornithine, putrescine, spermidine, spermine, transcription factors, homeobox proteins; preferably the protein binding to nucleic acid is a protamine and / or a histone.
During the preparation of the conjugate according to the invention, which comprises a binding domain to nucleic acids such as protamine and / or histones, the binding domain is preferably added as excess. This binding domain is then present in excess in the conjugate. By the term "in excess" is meant to mean that the domain for binding to nucleic acids and other components of the conjugate are not present in stoichiometric quantity.
The presence in large excess of acid binding molecule nucleic acids such as protamine or histones allows and promotes compaction of the nucleic acid molecule, thus allowing a efficient transfection of the nucleic acid molecule into the cell and more particularly a translocation and targeting of the molecule of nucleic acid in the nucleus of the cell. In addition, the compaction of the nucleic acid molecule of the invention by a nucleic acid binding molecule such as protamine or histones helps protect said nucleic acid molecule from degradation by cellular and extracellular nucleases.
The use of protamine and histones to promote transfection and expression of nucleic acid molecule is since long known to those skilled in the art (Wienhues et al. (1987) and Dubes and Wegrzyn (1978)).
The conjugate according to the invention is characterized in that said domain translocation is derived from a bacterial or viral toxin without contain the part of the toxin which gives it its toxic effect:
bacterial or viral toxin is chosen from: exotoxin A from Pseudomonas, diphtheria toxin, cholera toxin, toxin Bacillus anthrox, Pertussis toxin, Shiga shigella toxin, toxin related to Shiga toxin, Escherichia coli toxins, colicin A, d-endotoxin, hemagglutinin from Haemophilus A. In a preferred embodiment, the translocation domain is exotoxin A from Pseudomonas aeruginosa. In another preferred mode of realization, the translocation domain is fragment B not Shiga toxin Shiga toxin.
In another preferred embodiment, the domain of translocation is a fragment of the hemagglutinin from Haemophilus A. This influenza A (HA) hemaglutinin fragment can be modified â
its C-terminal end by the addition of a cysteine or by the addition of a short peptide sequence ending in a cysteine in order to react with this cysteine the coupling agent, which is preferably the APDP.
The conjugate according to the invention is characterized in that the antibody is a monoclonal antibody or a specific polyclonal antibody of a membrane surface antigen. According to one of the preferred modes of the invention, the antibody specifically binds to the 6250 antigen characteristic of renal cell carcinomas human (RCC). According to a preferred embodiment of the invention, the antibody of the invention is the 6250 antibody described by Oosterwijk and 5 al. (1986, Int. J. Cancer. 38: 489-494) and which was the subject of the international patent application WO 88/08854. According to another mode preferred embodiment, the antibody according to the present invention is a 5C5 monoclonal antibody obtained by the 5C5 hybridoma deposited at the CNCM under N ° I-2184. The antibody according to the invention is either under the 10 as a single chain antibody, either as an antibody chimeric or a humanized antibody. According to a particular mode of embodiment, the antibody is an antibody fragment, preferably a fragment F (ab ') 2, Fab' or Fv.
The DNA-antibody conjugate of the present invention can be 15 administered by various routes known to those skilled in the art. Through example, it can be administered intravenously, intraperitoneally, intramuscularly, subcutaneously, intra-tumor route, anal or rectal route.
Finally, the invention relates to a conjugate as described previously as a drug. More specifically, the invention relates to a conjugate as described above by way of of medication for gene therapy and more specifically for the treatment of acquired or constitutional genetic diseases.
According to the invention, the acquired diseases are selected from the group made up of cancers and infectious diseases. From cancers according to the invention, there may be mentioned, cell carcinoma kidney disease (RCC), melanoma, chronic myeloid leukemia, acute myeloid leukemia, Burkitt's lymphoma, cancer small cell lung, neuroblastoma, retinoblastoma, glioblastoma, hepatocarcinoma, rhabdomyosarcoma, gastric adenocarcinoma, colon carcinoma, ovarian cancer, breast carcinoma, uterine cancer, testicular carcinoma.
Preferably, the invention relates to a conjugate as described previously as a drug for the treatment of carcinoma kidney cells (RCC). Among the infectious diseases one can preferably mention AIDS and hepatitis.
According to the invention, constitutional diseases are selected preferably in the group consisting of myopathies, and more particularly Duchenne muscular dystrophy (DM), myopathy of Steinert and spinal muscular atrophy (SMA), cystic fibrosis, sclerosis lateral amyotrophic (ALS), hemophilia, hemoglobinopathies, neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease and Huntington's disease, Gaucher disease, Lesch-Nyhan disease, immune deficiency linked to deficit in adenosine deaminase or in purine nucleoside phosphorylase, pulmonary emphysema, hypercholesterolemia.
It is evident that the compound according to the invention has multiple applications according to the nature of the DNA sequence and the nature of the selected antibody. These multiple applications are easily conceivable by a person skilled in the art and cannot be mentioned in full.
The invention also relates to a pharmaceutical composition especially for the treatment of diseases by gene therapy which includes a therapeutically effective amount of a conjugate according to the invention and a pharmaceutically acceptable vehicle.
The present invention also relates to a transfer method of a nucleic acid molecule in a cell, characterized in that the conjugate according to the invention is brought into contact with said cell so as to transfect said cell with said conjugate. Preferably, the nucleic acid molecule codes for a protein product of interest which is effectively expressed in said transfected cell.
According to a preferred embodiment of the invention, the molecule nucleic acid is double stranded DNA encoding a product protein of interest. The present invention therefore provides a system efficient which allows the transit of the double stranded DNA molecule to across the cytoplasmic cell membrane, transport to the nucleus, entering the nucleus and maintaining the functional state of this molecule in the nucleus. Persistence of product expression protein encoded by the DNA molecule is obtained either by integration stable molecule of DNA in the chromosomal DNA of the cell target, either by keeping the DNA molecule in the form of a extrachromosomal replicon. It is therefore one of the objects of this invention of providing a method characterized in that said molecule of nucleic acid is maintained in the form of a replicon extrachromosomal in said cell. According to another mode of embodiment, the present invention provides a method characterized in that that said nucleic acid molecule integrates into genomic DNA
and / or mitochondrial of said transfected cell.
The cell targeted by the compound of the present invention is a prokaryotic or eukaryotic, animal or plant cell. According to a mode of preferred embodiment, the invention relates to a method characterized in that said cell is a eukaryotic cell, preferably a cell mammal, and preferably a human cell.
Finally, the invention relates to cells transfected with the conjugate according to the invention; the cell preferably being a eukaryotic cell, more particularly mammalian, and preferably human.
Other features and advantages of the present invention will be better highlighted on reading the following examples.
In these examples, reference is made to the following figures Figure N ° 1: Production of murine interleukin 2 by lines RCC antifected by the G250 / BZQ / I12 conjugate (G250 = DNA) in presence or absence of exotoxin A.
Figure N ° 2: Production of murine interleukin 2 by lines RCC antifected by conjugates G250-Biotinylated / avidin / BZQ / PL / Il2 (G250AvPL) and (G250 + ExoT) -Biotinylated / avidin / BZQ / PL / I12 (G250AvPLTox); negative control avidin / BZQ / PL / I12 (AvPL).

Figure 3: Expression of the CD4 molecule on the surface of cells human kidney cancer after in vitro antifection (°% of cells positive) Figure 4: Measurement of IL-2 secretion from mice 11 days later in vitro human kidney cancer cell antifection Figure 5: Induction of human kidney cell death after in vitro antifection with human Bax cDNA.
Figure 6: Measurement of the volume of tumors obtained on days D = 7 and D = 19 after tumor graft after in vivo cDNA antifection murine Bax with an injection (30 ~ .g of DNA) on day D = 7.
Figure 7: Infiltration of tumors by CD 16+ cells after murine Bax cDNA antifection EXAMPLES
EXAMPLE 1: MATERIALS AND METHODS (see Dûrrbach et al., The antibody-mediated endocytosis of 6250 tumor-associated antigen allows targeted gene transfer to human renal-cell carcinoma in vitro, Cancer Gene Therapy, In Press) 1.1. Cells The renal carcinoma cell lines used are IGR / RCC-17 (HIEG), IGR / RCC-40 (ROB), IGR / RCC-47 (FRAP), IGR / RCC-58 (MOJ) which are derived from three primary tumors (-17, -and -47) and adrenal metastasis (-58), from four patients with metastatic RCC. According to the criteria histological, RCC-17, -40 and -58 correspond to clear cell carcinomas and RCC-47 to a particular form clear cell carcinoma with typical papillary foci highly tumorigenic in SCID mice (Angevin et al.
(1997) Proc. Am. Asso. Cancer Res. 38: 238; Goulkhova et al.
(1998) Genes Chrom. Cancer 22: 171-178). The establishment of the in vitro culture as well as the characterization of cell lines of RCC were performed as previously described (Angevin and al. (1997 Int. J. Cancer 72: 434-440). The cells are grown at 37 ° C in an atmosphere containing 5% C02 in medium MEM modified by Dulbecco with Glutamax-1 (Gibco BRL, Paisley, Scotland) supplemented with 10% fetal calf serum (Seromed, Berlin, Germany), 5% non-essential amino acids, 10 mM sodium pyruvate (Gibco BRL) and a mixture of penicillin / streptomycin (10 mg / ml) (Seromed).
1.2. Immunophenotyping of the 6250 antigen The expression of the 6250 antigen associated with RCC tumors was directly tested by indirect immunostaining using mouse IgG 1 6250 monoclonal antibody (mAb 6250) previously described (Oosterwijk et al., 1986, Int. J. Cancer.
38: 489-494). A suspension of 5.105 cells, obtained by trypsination, was washed twice in culture medium RCC; the cells are then incubated with mAb 6250, washed 3 times in PBS (phosphate-buffered saline), then incubated with an F (ab ') 2 fragment of goat anti-mouse IgG antibody marked at FITC. The NKTA monoclonal antibody having the same isotype (IgG 1 directed against a clonotypic determinant of TCRa / a) (courtesy of Doctor Thierry Hercend, France) was used as a negative control. Flow cytometry was performed with a FACScan cytometer (Becton-Dickinson, Sunnyvale, CA, USA) using Cellquest software.

1.3. Endocptosis experiences Antibody 6250 and human iron-loaded apo-transferrin (Sigma, St-Louis, MO, USA) were paired with fluorescein isothiocyanate (Sigma) and with chloride 5 sulfonyl Rhodamine B lissamine as described above (Maxfield et al., 1978, Cell 14: 805-810; Brandzaeg, 1973, Scan.
J. Immunol. 2: 273-290). Conjugated proteins are separated free fluorochromes by gel filtration on a column of Sephadex G50 (Pharmacy, Uppsala, Sweden). The link 10 specific proteins coupled with cellular receptors area was determined by competitive experiments using a 100 times higher concentration of non-protein coupled. BMGneo-mIL2 plasmid DNA containing cDNA from mouse interleukin 2 (IL-2) under the control of the promoter 15 inducible of the metallothionein gene (Karasuyama and Melchers, 1988, Eur. J. Immunol. 18: 97-104) (1 mg / ml) is incubated (vol / vol) with EZ-link-Biotin-LC-ASA reconstituted in ethanol (2 mg / ml) (Pierce, Rockford, IL, USA) and exposed for 15 min at UV (365 nm) at 4 ° C. The plasmid DNA is then 20 ethanol precipitated (final concentration 70%) for 30 min at -20 ° C. The effectiveness of labeling is determined by an ELISA test on microplates covered with poly-L-lysine using phosphatase-alkaline conjugated to streptavidin.
To test endocytosis, cells grown two days on coverslips are washed three times with RPMI-1640 (Gibco BRL) containing 1 mg / ml bovine serum albumin (BSA), then are incubated twice 15 min in RPMI-1640 containing 1 mg / ml of BSA at 37 ° C with or without cytochalasin D (5 OM) (Sigma). The cells are then incubated for one hour at 4 ° C. with rhodamine-conjugated transferrin (50 nM) and monoclonal antibody 6250 labeled with FITC in RPMI-1640 containing 1 mg / ml of BSA with or without cytochalasin D (5 ~ M) then transferred to 37 ° C for variable times with WO 00/67697 ~ PCT / FR00 / 01259 transferrin-Rhodamine only (pulse) or with mAb 6250 marked at FITC. Cells are washed three times with PBS
cold, fixed 20 min with a 4% paraformaldehyde solution, 0.025% glutaraldehyde in PBS at 4 ° C and prepared for epifluorescence analysis. To analyze the distribution of mAb 6250-plasmid conjugate by double labeling, cells were continuously incubated as described above either with FITC labeled mAb 6250 conjugated with DNA
biotinylated plasmid or either with a mixture of mAb 6250 labeled with FITC and biotinylated plasmid DNA, as control.
After fixation, the cells are washed twice in PBS, incubated for 10 min with 0.1% sodium borohydrate in PBS (ICN, Costa Mesa, CA, USA) and then 10 min with ammonium chloride (50 mM in PBS) (Sigma). According to experimental conditions the cells are either directly analyzed by immunofluorescence to detect mAb 6250 FITC-labeled or permeabilized with PBS containing 0.05% saponin or 0.1% Triton X100 (ICN) then labeled with Texas-red conjugated streptavidin (20 mg / ml) (Pierce). Actin filaments are marked with phalloidin-rhodamine according to the manufacturer's recommendations (Sigma).
The cells are then visualized with an Axiophot microscope (Zeiss, Oberkochen, Germany).
1.4. Antifection and analysis of heterologous expression For transfection, 3.105 freshly trypsinized RCC cells are incubated for 30 min at 4 ° C with concentrations different from mAb-DNA conjugates according to the invention in 1 ml of RPMI-1640 without serum. The cells are then incubated for 4 hours at 37 ° C in 1 ml of serum-free RPMI-1640 containing 4.105 M chloroquine (Sigma) and finally WO 00! 67697 PCT / FR00 / 01259 resuspended in 2 ml DMEM supplemented with glutamax-1 (Gibco BRL) and 10% fetal calf serum. In separate experiments, RCC cells are incubated with mouse IL-2 cDNA conjugated to mAb 6250 in the presence of cytochalasin D for 1 hour at 4 ° C and 4 hours at 37 ° C. The conjugates still linked to the cell surface were unhooked with RPMI-1640 pH2.2 solution containing glycine 0.1 M for 2 min at 4 ° C. Two volumes of RPMI-1640 pH 9.0 are then added for 3 min and the cells are incubated in a normal culture medium. To determine production murine interleukin 2, 100 ~ l culture supernatants cells were removed on different days after the transfection. Cytokine production in the medium was determined using the IL-2 specific DuoSeT ELISA kit from mouse (Ref. 80-3573-00) (detection threshold of 15 pg / ml) (Genzyme Diagnostics, Cambridge, MA, USA) EXAMPLE 2: Conjugates G250 / BZQ / I12 and G250 / BZQ / I12 + ExoT
2.1. Preparation of the G250 / BZQ / I12 conjugate The G250 / BZQ / Il2 conjugate is prepared by coupling between monoclonal antibody 6250 and a plasmid encoding murine interleukin 2 (mIl-2) using benzoquinone (BZQ) according to the coupling method previously described by Poncet et al. (1996, Gene Therapy 3: 731-738).
BZQ dissolved in absolute ethanol at a concentration of mg / ml is added to a solution of monoclonal antibody 30 purified in solution in PBS at a concentration of at least 2 mg / ml to give a final solution containing 3 mg / ml of BZQ. 1/10 of the final volume is then added in the form of potassium phosphate buffer 1M pH 6Ø After 90 min. at room temperature, in the dark, the monoclonal antibody activated is separated from excess BZQ by chromatography on a G25M column (Pharmacia) presaturated in 1% BSA in NaCl 0.15M, collected and then mixed with purified plasmid DNA (10 times the amount of antibody). The solution is mixed with 0.1 M
of carbonate buffer pH 8.7 and incubated for 48 hours at 4 ° C. The mAb-DNA conjugate is concentrated by gel filtration on a FPLC Superose 6HR column (Pharmacia) to remove excess free antibodies likely to compete with the DNA-antibody conjugate. The collected fractions are dialyzed against PBS and concentrated using a cartridge Centricon 10 (Amicon, MA, USA). The quantities of conjugates purified soluble are expressed as the amount of DNA
plasmid initially used in the reaction.
2.2. Antifection of RCC lines with conjugates G250 / BZQ / I12 and G250 / BZQ / I12 + ExoT
We compared the measurement of Il-2 after transfer of this conjugated in RCC lines after addition or not of exotoxin A (ExoT) of Pseudomonas Aeruginosa in the culture medium.
Exotoxin A marketed by Sigma is added to the conjugate G250 / BZQ / I12.
The conjugates G250 / BZQ / Il2 and G250 / BZQ / I12 + ExoT are used contact with 105 cells of RCC lines in culture in a medium without serum for 4 hours at 37 ° C depending on the previously described protocol. The cells are put back in culture in normal medium after washes. The production of Il-2 is measured 10 days later using the DuoSeT ELISA kit (Ref.
80-3573-00, Genzyme Diagnostics).
Cells antifected with the G250 / BZQ / Il2 + ExoT conjugate produce about 3 times more murine Il-2 (371 pg / 106 cells) that cells antifected by the conjugate G250 / BZQ / I12 (165 pg / 10 ~ cells) (Figure No. 1).

EXAMPLE 3 Conjugates 6250-Biotinylated / avidin / BZQ / PL / I12 and (6250 + ExoT) -Biotinylated / avidin / BZQ / PL / I12 3.1. Preparation of conjugates The central body of the G250- conjugates Biotinylated / avidin / BZQ / PL / Il2 and (G250 + ExoT) -Biotinylated / avidin / BZQ / PL / I12 consists of one molecule tetravalent of avidin (Av) which is initially activated with benzoquinone according to the protocol previously described.
Activated avidin binds poly-L-lysine molecules which are very affine molecules for DNA. The Avidin / BZQ / PL complex is brought into contact with the plasmid coding for interleukin 2 of mouse (Il-2). The complex is then associated with the antibody monoclonal 6250 and / or exotoxin A (ExoT) both previously biotinylated.
3.2. Antifection of RCC lines with 6250 conjugates Biotinylated / avidin / BZQ / PL / I12 and (6250 + ExoT) -Biotinplé /
avidin / BZQ / PL / I12 The different complexes are brought into contact with 105 cells of RCC lines in culture in a serum-free medium for 4 hours at 37 ° C according to the protocol previously described.
The cells are returned to culture in normal medium after washes. The production of Il-2 is measured 10 days later in using the DuoSeT ELISA kit (Ref. 80-3573-00, Genzyme Diagnostics).
The results are presented in Figure No. 2. In the experience control in which the monoclonal antibody 6250 was omitted, a certain production of mIl-2 is measured (127 pg / 106 cells, AvPL) certainly due to the non-specific attachment of pg / 10 ~ cells) (Figure N ° 1) poly-L-lysine and / or avidin molecules on the surface of cells. Addition of mAb 6250 to the complex avidin / BZQ / PL / I12 increases production by 2 times murine interleukin 2 (261 pg / 106 cells instead of 127 5 µg / 106 cells); the additional presence of exotoxin A (ExoT) increases the production of mIl-2 by 10 times (1347 pg / 106 cells) (Figure No. 2).
EXAMPLE 4 Conjugate 6250-biotinplé / neutravidine / histone H1 10 biotinyl / fusiogenic peptide of Influenzae hemaglutinin (HA) biotinylated / CD4 The different complexes as mentioned in the figures are set in contact with RCCs, as described in Example 3, section 3.2.
FIG. 3 represents the flow cytometry analysis of RCC cells human carrying Ag 6250, collected 7 days after detection of cDNA encoding the human CD4 molecule and labeled with a Human anti-CD4 mAb. About 20% of cells express in this way this molecule. The vector used included all of the molecules, G250, H 1, HA, cDNA. The sequence of the HA peptide used is as follows GLFEAIAGFIENGWEGMIDGGGCGSGSYTDIEMNRLGKG.
EXAMPLE 5 Conjugate 6250-biotinylated / neutravidine / histone H1 biotined / I12 and Conjugate 6250 biotined / neutravidin / histone H1 biotinylated / biotinplicated HA fusogenic peptide / I12 FIG. 4 represents the result of an RCC cell antifection human carrying Ag 6250, collected 11 days after detection of cDNA encoding mouse interleukin-2. The amount of IL-2 secreted by RCCs brought into contact with cDNA alone or coupled to neutravidin is 80 pg / 106 cells, 1200 pg / 106 cells for RCCs brought into contact with a conjugate comprising G250 / H 1 / cDNA
and 3100 pg / 106 cells for RCCs contacted with a conjugate comprising G250 / Hl / HA / cDNA.
EXAMPLE 6. 6250 biotinylated / neutravidin / histone H1 biotinylated / BAX and 6250 biotinylated / neutravidin / histone H1 biotinylated / fusogenic peptide HA biotinylated / BAX
FIG. 5 represents the result of an RCC cell antifection human carrying Ag 6250, collected 11 days after detection of the cDNA coding for the pro-apoptotic molecule Bax human. The death cell was assessed by staining with Trypan blue. CDNA
control used corresponds to the green fluorescent protein gene (GFP). We can note a significant increase in the loss of viability linked to the attachment of the AcM 6250 "Vector BAX without HA", increased by the attachment of the fusiogenic peptide of HA "BAX vector with HA ”.
EXAMPLE 7. In vivo antifection with 5C5 conjugate biotinylated / neutravidin / histone H 1 biotinylated / fusogenic peptide HA
biotinylated / marine BAX
7.1. Protocol Different conjugates are prepared from - 10 ~ g of 5C5 antibody - 30 ug of marine BAX DNA
- 15 ~ g of histone H 1 - 0.5 pg of HA peptide - 4 ug of neutravidin.
Nine irradiated nude mice used for control, received a transplant of RCC tumor subcutaneously on day D = 0. These grafted mice did not no conjugate.

Ten irradiated nude mice received an RCC tumor transplant under-cutaneous on day D = 0 then on day D = 7, they received by intravenous neutravidin- / HA / hl / Bax conjugate in one injection.
Ten irradiated nude mice received an RCC tumor transplant under-cutaneous on day D = 0 then on day D = 7, they received by intravenous 5C5 / neutravidin / HA / H1 / Bax conjugate in one injection.
The size of the tumors was then evaluated on day JS, D8, D 12 and D 19 after the injection the mice were sacrificed on day D 19.
7.2. Results A decrease in tumor growth less than that noted in the control groups is observed in 6 out of 10 mice receiving the whole complex and 1 in 10 in the group treated with the complex without antibodies, and this at day 19 after the first injection (Figure No. 6).
Interestingly, the labeling found in tumors antifected with Bax, using a fluorescent mAb directed against mouse CD 16 molecule present on natural cells killer (NK cells), macrophages, granulocytes clearly indicates the possibility of recruiting effector cells which can participate fully to the anti-tumor response (Figure No. 7).

REFERENCES
Angevin et al. 1997, Proc. Am. Asso. Cancer Res. 38: 238.
Angevin et al. 1997, Int. J. Cancer 72: 434.
Brandzaeg 1973, Scan. J. Immunol. 2: 273.
Chittenden et al. 1995, Nature 374: 733 Cournoyer et al. 1991, Human Gene Therapy, 2: 203.
Dürrbach et al. (In Press) Cancer Gene Therapy.
Dubes and Wegrzyn 1978, Protoplasma 96: 209-223.
Fominaya and Wels 1995, J. Biol. Chem. 271: 10560.
Golumbek et al. 1991, Science 254: 713.
Goulkhova et al. 1998, Genes Chrom. Cancer 22: 171.
Hirsch et al. 1993, Transpl. Proc. 25: 138.
Karasuyama and Melchers 1988, Eur. J. Immunol. 18: 97.
Kasahara et al. 1987, J. Biol. Chem. 262: 4429.
Kiefer et al. 1995, Nature 374: 736 Luthman et al. 1983, Nucleic Acids Res. 11: 1295.
Maxfield et al. 1978, Cell 14: 805.
Michael and Curiel 1994, Gene Therapy 1: 223.
Neda et al. 1991, J. Biol. Chem. 266: 14143.
Old 1985, Science 230: 630 Oltvai et al. 1993, Cell 74: 609 Oosterwijk and a1.1986, Int. J. Cancer. 38: 489.
Poncet et al. 1996, Gene Therapy 3: 731.
Ragot et al. 1993, Nature 361: 647.
Rosenberg et al. 1990, N. Eng. J. Med. 323: 570.
Roux et al. 1989, Proc.Natl.Acad.Sci. USA 86: 9079.
Susin et al. 1999, Nature 397: 441.
Takahashi et al. 1994, Int. Immun. 6: 1567 Wang et al. 1996, Genes Dev. 10: 2859 Wienhues et al. 1987, DNA 6 (1): 81-89.

Wu et al. 1991,, 1. Biol. Chem. 266: 14338.
Zenke et al. 1990, Proc.Natl.Acad.Sci. USA, 87: 3655.

Claims (63)

REVENDICATIONS 30 1. Conjugué pour le transfert d'une molécule d'acide nucléique dans une cellule caractérisé en ce qu'il comprend une molécule d'acide nucléique, un domaine de translocation et un anticorps spécifique d'un antigène de surface de ladite cellule, tel que ladite molécule d'acide nucléique, ledit domaine de translocation et ledit anticorps sont conjugués au moyen d'au moins un agent de pontage, et tel que ledit conjugué est transfecté efficacement dans ladite cellule. 1. Conjugate for the transfer of a nucleic acid molecule into a cell characterized by comprising an acid molecule nucleic acid, a translocation domain and a specific antibody of a surface antigen of said cell, such as said molecule of nucleic acid, said translocation domain and said antibody are conjugated by means of at least one bridging agent, and such that said conjugate is efficiently transfected into said cell. 2. Conjugué selon la revendication 1 caractérisé en ce qu'il comprend en outre un peptide clivable par au moins une enzyme glycolytique et/ou protéolytique, ledit anticorps étant lié audit domaine de translocation via ledit peptide clivable. 2. Conjugate according to claim 1 characterized in that it comprises additionally a peptide cleavable by at least one glycolytic enzyme and/or proteolytic, said antibody being linked to said domain of translocation via said cleavable peptide. 3. Conjugué selon la revendication 2 caractérisé en ce que ledit anticorps et ledit peptide clivable sont liés de manière covalente via un agent de pontage sélectionné de préférence dans le groupe composé de la benzoquinone, de l'EDC, de l'APDP. 3. Conjugate according to claim 2 characterized in that said antibody and said cleavable peptide are covalently linked via a coupling agent preferably selected from the group composed of benzoquinone, EDC, APDP. 4. Conjugué selon la revendication 2 caractérisé en ce que ledit anticorps et ledit peptide clivable sont liés à une molécule de type avidine au moyen d'un agent de pontage qui peut être identique ou différent et qui est sélectionné de préférence dans le groupe composé de la biotine, la benzoquinone, de l'EDC, de l'APDP. 4. Conjugate according to claim 2 characterized in that said antibody and said cleavable peptide are linked to a molecule of the type avidin by means of a bridging agent which may be the same or different and which is preferably selected from the group composed of biotin, benzoquinone, EDC, APDP. 5. Conjugué selon la revendication 3 ou 4 caractérisé en ce que ledit domaine de translocation est lié audit peptide clivable par une liaison chimique covalente. 5. Conjugate according to claim 3 or 4 characterized in that said translocation domain is linked to said cleavable peptide by a covalent chemical bond. 6. Conjugué selon la revendication 5 caractérisé en ce que ledit domaine de translocation est lié à une molécule d'acide nucléique au moyen d'un agent de pontage. 6. Conjugate according to claim 5 characterized in that said translocation domain is bound to a nucleic acid molecule using a coupling agent. 7. Conjugué selon la revendication 6 caractérisé en ce que ledit agent de pontage est l'APDP. 7. Conjugate according to claim 6 characterized in that said agent bridging is the APDP. 8. Conjugué selon l'une quelconque des revendications 6 et 7 caractérisé en ce que ledit anticorps est lié audit peptide clivable par une liaison covalente au moyen dudit agent de pontage EDC, ledit peptide clivable étant lié audit domaine de translocation par une liaison covalente au moyen d'une liaison chimique, ledit domaine de translocation étant lié audit acide nucléique par une liaison covalente au moyen dudit agent de pontage APDP. 8. Conjugate according to any one of claims 6 and 7 characterized in that said antibody is bound to said cleavable peptide by a covalent bond by means of said EDC bridging agent, said cleavable peptide being linked to said translocation domain by a covalent bond by means of a chemical bond, said translocation domain being linked to said nucleic acid by a covalent bonding by means of said APDP bridging agent. 9. Conjugué selon la revendication 5 caractérisé en ce que la liaison entre ledit domaine de translocation et ladite molécule d'acide nucléique est réalisée au moyen d'une molécule de liaison aux acides nucléiques, ladite molécules de liaison aux acides nucléiques étant liée audit domaine de translocation par une liaison covalente au moyen d'un agent de pontage. 9. Conjugate according to claim 5 characterized in that the bond between said translocation domain and said acid molecule nucleic acid is carried out by means of a molecule of binding to the nucleic acids, said nucleic acid binding molecules being linked to said translocation domain by a covalent bond using a coupling agent. 10. Conjugué selon la revendication 9 caractérisé en ce que ledit agent de pontage est l'APDP. 10. Conjugate according to claim 9 characterized in that said bridging agent is APDP. 11. Conjugué selon l'une quelconque des revendications 9 et 10 caractérisé en ce que ledit anticorps est lié audit peptide clivable par une liaison covalente au moyen dudit agent de pontage EDC, ledit peptide clivable étant lié audit domaine de translocation par une liaison covalente au moyen d'une liaison chimique, ledit domaine de translocation étant lié à ladite molécule de liaison aux acides nucléiques par une liaison covalente au moyen dudit agent de pontage APDP, ladite molécule de liaison aux acides nucléiques liant ledit acide nucléique par une liaison non-covalente. 11. Conjugate according to any one of claims 9 and 10 characterized in that said antibody is bound to said cleavable peptide by a covalent bond by means of said EDC bridging agent, said cleavable peptide being linked to said translocation domain by a covalent bond by means of a chemical bond, said translocation domain being bound to said cell-binding molecule nucleic acids by a covalent bond using said agent APDP bridging molecule, said nucleic acid binding molecule linking said nucleic acid by a non-covalent bond. 12. Conjugué selon la revendication 1 caractérisé en ce qu'il comprend en outre une molécule de liaison aux acides nucléiques, tel que ledit domaine de translocation, ledit anticorps et ladite molécule de liaison aux acides nucléiques sont liés à une molécule de type avidine au moyen d'un agent de pontage qui peut être identique ou différent, ladite molécule de liaison aux acides nucléiques liant ladite molécule d'acide nucléique. 12. Conjugate according to claim 1 characterized in that it further comprises a nucleic acid binding molecule, such as said translocation domain, said antibody and said nucleic acid binding molecule are bound to a molecule of avidin type by means of a bridging agent which can be same or different, said acid-binding molecule nuclei binding said nucleic acid molecule. 13. Conjugué selon la revendication 1 caractérisé en ce qu'il comprend en outre une molécule de liaison aux acides nucléiques et un peptide clivable par au moins une enzyme glycolytique et/ou protéolytique, tel que ledit domaine de translocation, ledit anticorps et ledit peptide clivable sont liés à une molécule de type avidine au moyen d'un agent de pontage qui peut être identique ou différent, ladite molécule de liaison aux acides nucléiques étant liée à ladite molécule d'acide nucléique, ladite molécule de liaison aux acides nucléiques étant liée audit peptide clivable et à ladite molécule d'acide nucléique. 13. Conjugate according to claim 1 characterized in that it further comprises a nucleic acid binding molecule and a peptide cleavable by at least one glycolytic enzyme and/or proteolytic, such as said translocation domain, said antibody and said cleavable peptide are bound to an avidin-like molecule at the means of a coupling agent which may be identical or different, said nucleic acid binding molecule being bound to said nucleic acid molecule, said acid-binding molecule nuclei being linked to said cleavable peptide and to said molecule of nucleic acid. 14. Conjugué pour le transfert d'une molécule d'acide nucléique dans une cellule caractérisé en ce qu'il comprend une molécule d'acide nucléique, un anticorps spécifique d'un antigène de surface de cellule et une molécule de liaison aux acides nucléiques tel que ledit conjugué est transfecté efficacement dans ladite cellule. 14. Conjugate for Transfer of Nucleic Acid Molecule in a cell characterized in that it comprises a molecule nucleic acid, an antibody specific for a surface antigen cell and a nucleic acid binding molecule such as said conjugate is efficiently transfected into said cell. 15. Conjugué selon la revendication 14 caractérisé en ce qu'il comprend en outre un peptide clivable par au moins une enzyme glycolytique et/ou protéolytique, ledit anticorps étant lié à ladite molécule de liaison aux acides nucléiques via ledit peptide clivable. 15. Conjugate according to claim 14 characterized in that it further comprises a peptide cleavable by at least one enzyme glycolytic and/or proteolytic, said antibody being bound to said nucleic acid binding molecule via said cleavable peptide. 16. Conjugué selon la revendication 15 caractérisé en ce que ledit anticorps et ledit peptide clivable sont liés de manière covalente via un agent de pontage sélectionné de préférence dans le groupe composé de la benzoquinone, de l'EDC, de l'APDP. 16. Conjugate according to claim 15 characterized in that said antibody and said cleavable peptide are covalently linked via a coupling agent preferably selected from the group composed of benzoquinone, EDC, APDP. 17. Conjugué selon la revendication 15 caractérisé en ce que ledit anticorps et ledit peptide clivable sont liés à une molécule de type avidine au moyen d'un agent de pontage qui peut être identique ou différent sélectionné de préférence dans le groupe composé de la biotine, la benzoquinone, de l'EDC, de l'APDP. 17. Conjugate according to claim 15 characterized in that said antibody and said cleavable peptide are linked to a molecule of the type avidin by means of a bridging agent which may be the same or different preferably selected from the group consisting of the biotin, benzoquinone, EDC, APDP. 18. Conjugué selon la revendication 16 ou 17 caractérisé en ce que ledit peptide clivable est lié à ladite molécule de liaison aux acides nucléiques au moyen d'un agent de pontage, ladite molécule de liaison aux acides nucléiques liant ledit acide nucléique par une liaison non-covalente. 18. Conjugate according to claim 16 or 17 characterized in that said cleavable peptide is bound to said acid-binding molecule nuclei by means of a bridging agent, said molecule of binding to nucleic acids binding said nucleic acid by a non-covalent bond. 19. Conjugué selon la revendication 18 caractérisé en ce que ledit agent de pontage est l'APDP. 19. Conjugate according to claim 18 characterized in that said bridging agent is APDP. 20. Conjugué pour le transfert d'une molécule d'acide nucléique dans une cellule caractérisé en ce qu'il comprend une molécule d'acide nucléique, un anticorps spécifique d'un antigène de surface de cellule et un peptide clivable par au moins une enzyme glycolytique et/ou protéolytique tel que ledit conjugué est transfecté
efficacement dans ladite cellule. 20. Conjugate for Transfer of Nucleic Acid Molecule in a cell characterized in that it comprises a molecule nucleic acid, an antibody specific for a surface antigen of cell and a peptide cleavable by at least one enzyme glycolytic and/or proteolytic such that said conjugate is transfected effectively in said cell. 21. Conjugué selon la revendication 20 caractérisé en ce que ledit anticorps et ledit peptide clivable sont liés de manière covalente via un agent de pontage sélectionné de préférence dans le groupe composé de la benzoquinone, de l'EDC, de l'APDP. 21. Conjugate according to claim 20 characterized in that said antibody and said cleavable peptide are covalently linked via a coupling agent preferably selected from the group composed of benzoquinone, EDC, APDP. 22. Conjugué selon la revendication 20 caractérisé en ce que ledit anticorps et ledit peptide clivable sont liés à une molécule de type avidine au moyen d'un agent de pontage qui peut être identique ou différent sélectionné de préférence dans le groupe composé de la biotine, la benzoquinone, de l'EDC, de l'APDP. 22. Conjugate according to claim 20 characterized in that said antibody and said cleavable peptide are linked to a molecule of the type avidin by means of a bridging agent which may be the same or different preferably selected from the group consisting of the biotin, benzoquinone, EDC, APDP. 23. Conjugué selon la revendication 21 ou 22 caractérisé en ce que ledit peptide clivable est lié audit acide nucléique par une liaison covalente au moyen d'un agent de pontage. 23. Conjugate according to claim 21 or 22 characterized in that said cleavable peptide is linked to said nucleic acid by a bond covalent by means of a bridging agent. 24. Conjugué selon la revendication 21 ou 22 caractérisé en ce que la liaison entre ledit peptide clivable et ladite molécule d'acide nucléique est réalisée au moyen d'une molécule de liaison aux acides nucléiques, ladite molécule de liaison aux acides nucléiques étant liée audit peptide clivable par une liaison covalente au moyen d'un agent de pontage. 24. Conjugate according to claim 21 or 22 characterized in that the bond between said cleavable peptide and said acid molecule nucleic acid is carried out by means of a molecule of binding to the nucleic acids, said nucleic acid binding molecule being linked to said cleavable peptide by a covalent bond by means of of a bridging agent. 25. Conjugué selon les revendications 23 et 24 caractérisé en ce que ledit agent de pontage est l'APDP. 25. Conjugate according to claims 23 and 24 characterized in that said bridging agent is APDP. 26. Conjugué selon l'une quelconque des revendications 20 à 25 caractérisée en ce que ledit conjugué comprend en outre un domaine de translocation. 26. Conjugate according to any one of claims 20 to 25 characterized in that said conjugate further comprises a translocation domain. 27. Conjugué selon la revendication 26 caractérisé en ce que ledit domaine de translocation est lié de manière covalente au moyen d'un agent de pontage à ladite molécule d'acide nucléique et/ou à
ladite molécule de liaison aux acides nucléiques. 27. Conjugate according to claim 26 characterized in that said translocation domain is covalently linked by means of a bridging agent to said nucleic acid molecule and/or to said nucleic acid binding molecule. 28. Conjugué selon l'une quelconque des revendications 1, 6, 8, 13, 14, 17 et 22 caractérisé en ce que ledit agent de pontage est sélectionné dans le groupe composé de la benzoquinone, de la biotine, des carbodiimides, des agents pontants présentant au moins un groupement phénylazide réagissant aux ultra-violets (UV). 28. Conjugate according to any one of claims 1, 6, 8, 13, 14, 17 and 22 characterized in that said coupling agent is selected from the group consisting of benzoquinone, biotin, carbodiimides, bridging agents with at least least one ultraviolet (UV)-reactive phenylazide group. 29. Conjugué selon la revendication 1 caractérisé en ce que ledit agent de pontage est sélectionné dans le groupe composé de la benzoquinone, de la biotine, de l'EDC, l'APDP. 29. Conjugate according to claim 1 characterized in that said bridging agent is selected from the group consisting of the benzoquinone, biotin, EDC, APDP. 30. Conjugué selon la revendication 12 caractérisé en ce que l'agent de pontage qui lie ledit domaine de translocation et ledit anticorps à
la molécule de type avidine est la biotine et, l'agent de pontage qui lie ladite molécule de liaison aux acides nucléiques à la molécule de type avidine est la benzoquinone. 30. Conjugate according to claim 12, characterized in that the agent bridging which links said translocation domain and said antibody to the avidin-like molecule is biotin and, the bridging agent that binds said nucleic acid binding molecule to the molecule of avidin type is benzoquinone. 31. Conjugué selon la revendication 13 caractérisé en ce que l'agent de pontage qui lie ledit domaine de translocation et ledit anticorps à
la molécule de type avidine est la biotine et, l'agent de pontage qui lie ledit peptide clivable à la molécule de type avidine est la benzoquinone. 31. Conjugate according to claim 13, characterized in that the agent bridging which links said translocation domain and said antibody to the avidin-like molecule is biotin and, the bridging agent that binds said cleavable peptide to the avidin-like molecule is the benzoquinone. 32. Conjugué selon la revendication 12 caractérisé en ce que l'agent de pontage qui lie ledit domaine de translocation, ledit anticorps et ladite molécule de liaison aux acides nucléiques est la biotine. 32. Conjugate according to claim 12, characterized in that the agent bridging which links said translocation domain, said antibody and said nucleic acid binding molecule is biotin. 33. Conjugué selon la revendication 13 caractérisé en ce que l'agent de pontage qui lie ledit domaine de translocation, ledit anticorps et ledit peptide clivable est la biotine. 33. Conjugate according to claim 13, characterized in that the agent bridging which links said translocation domain, said antibody and said cleavable peptide is biotin. 34. Conjugué selon la revendication 17 caractérisé en ce que l'agent de pontage qui lie ledit anticorps à la molécule de type avidine est la biotine, et l'agent de pontage qui lie ladite molécule de liaison aux acides nucléiques à la molécule de type avidine est la benzoquinone. 34. Conjugate according to claim 17, characterized in that the agent bridging which binds said antibody to the avidin-like molecule is the biotin, and the bridging agent which binds said binding molecule to nucleic acids to the avidin-like molecule is benzoquinone. 35. Conjugué selon la revendication 17 caractérisé en ce que ledit agent de pontage est la biotine. 35. Conjugate according to claim 17 characterized in that said bridging agent is biotin. 36. Conjugué selon l'une quelconque des revendications 1 à 35 caractérisé en ce que ladite molécule d'acide nucléique est choisie parmi l'ADN simple brin, l'ADN double brin, l'ARN simple brin, l'ARN double brin, l'hybride ARN/ADN. 36. Conjugate according to any one of claims 1 to 35 characterized in that said nucleic acid molecule is selected among single-stranded DNA, double-stranded DNA, single-stranded RNA, double-stranded RNA, RNA/DNA hybrid. 37. Conjugué selon la revendication 36 caractérisé en ce que ladite molécule d'acide nucléique est de l'ADN double brin ou de l'ARN
simple brin qui code pour un produit protéique d'intérêt qui s'exprime efficacement dans ladite cellule. 37. Conjugate according to claim 36 characterized in that said nucleic acid molecule is double stranded DNA or RNA
single strand that encodes a protein product of interest that is expressed effectively in said cell. 38. Conjugué selon la revendication 35 caractérisé en ce que ledit produit protéique d'intérêt est choisi dans un groupe composé des cytokines, des lymphokines, des chémokines, des facteurs de croissance, des gènes tueurs, des gênes qui permettent de lever la chimiorésistance, des enzymes de restriction. 38. Conjugate according to claim 35 characterized in that said protein product of interest is selected from a group consisting of cytokines, lymphokines, chemokines, factors of growth, killer genes, genes that make it possible to lift the chemoresistance, restriction enzymes. 39. Conjugué selon la revendication 38 caractérisé en ce que le produit protéique d'intérêt est la protéine Bax. 39. Conjugate according to claim 38 characterized in that the protein product of interest is Bax protein. 40. Conjugué selon la revendication 36 caractérisée en ce que ladite molécule d'acide nucléique est un ARN antisens. 40. Conjugate according to claim 36 characterized in that said nucleic acid molecule is antisense RNA. 41. Conjugué selon l'une quelconque des revendications 8 à 10, 12 à
19, 24, 30, 32, 34 caractérisé en ce que la molécule de liaison aux acides nucléiques lie ladite molécule d'acide nucléique par une liaison non-covalente. 41. Conjugate according to any one of claims 8 to 10, 12 to 19, 24, 30, 32, 34 characterized in that the molecule binding to the nucleic acids binds said nucleic acid molecule by a non-covalent bond. 42. Conjugué selon l'une quelconque des revendications 8 à 10, 12 à
19, 24, 30, 32, 34, 41 caractérisé en ce que la molécule de liaison aux acides nucléiques est un polymère polycationique ou une protéine de liaison aux acides nucléiques. 42. Conjugate according to any one of claims 8 to 10, 12 to 19, 24, 30, 32, 34, 41 characterized in that the binding molecule to nucleic acids is a polycationic polymer or a nucleic acid binding protein. 43. Conjugué selon la revendication 42 caractérisé en ce que ledit polymère polycationique est choisi parmi la poly-L-lysine, la poly-D-lysine, le polyéthylènimine, la polyamidoamine, la polyamine, et les polycations libres. 43. Conjugate according to claim 42 characterized in that said polycationic polymer is chosen from poly-L-lysine, poly-D-lysine, polyethylenimine, polyamidoamine, polyamine, and free polycations. 44. Conjugué selon la revendication 43 caractérisé en ce que ledit polymère polycationique est la poly-L-lysine. 44. Conjugate according to claim 43 characterized in that said polycationic polymer is poly-L-lysine. 45. Conjugué selon la revendication 42 caractérisé en ce que ladite protéine de liaison aux acides nucléiques est choisie parmi les histones, la protamine, l'ornithine, la putrescine, la spermidine, la spermine, les facteurs de transcription, les protéines homéobox. 45. Conjugate according to claim 42 characterized in that said nucleic acid binding protein is selected from histones, protamine, ornithine, putrescine, spermidine, spermine, transcription factors, homeobox proteins. 46. Conjugué selon la revendication 45 caractérisé en ce que ladite protéine de liaison aux acides nucléiques est sélectionnée dans le groupe composé de la protamine et des histones. 46. Conjugate according to claim 45 characterized in that said nucleic acid binding protein is selected from the group consisting of protamine and histones. 47. Conjugué selon l'une quelconque des revendications 1 à 13 et 26, 27, 30 à 33 caractérisé en ce que ledit domaine de translocation dérive d'une toxine virale sans contenir la partie de la toxine qui lui confère son effet toxique. 47. Conjugate according to any one of claims 1 to 13 and 26, 27, 30 to 33 characterized in that said translocation domain derived from a viral toxin without containing the part of the toxin which imparts its toxic effect. 48. Conjugué selon la revendication 47 caractérisé en ce que ledit domaine de translocation est un fragment de l'hémagglutinine d'Haemophilus A. 48. Conjugate according to claim 47 characterized in that said translocation domain is a fragment of hemagglutinin of Haemophilus A. 49. Conjugué selon l'une quelconque des revendications 1 à 48 caractérisé en ce que ledit anticorps est un anticorps monoclonal ou un anticorps polyclonal. 49. Conjugate according to any one of claims 1 to 48 characterized in that said antibody is a monoclonal antibody or a polyclonal antibody. 50. Conjugué selon la revendication 49 caractérisé en ce que ledit anticorps est spécifique d'un antigène de surface membranaire. 50. Conjugate according to claim 49 characterized in that said antibody is specific for a membrane surface antigen. 51. Conjugué selon la revendication 50 caractérisé en ce que ledit antigène est l'antigène G250. 51. Conjugate according to claim 50 characterized in that said antigen is the G250 antigen. 52. Conjugué selon la revendication 50 caractérisé en ce que ledit anticorps est l'anticorps monoclonal 5C5 obtenu par l'hybdridome 5C5 déposé à la CNCM sous le N° I-2184. 52. Conjugate according to claim 50 characterized in that said antibody is the 5C5 monoclonal antibody obtained by the hybridoma 5C5 filed with the CNCM under No. I-2184. 53. Conjugué selon l'une quelconque des revendications 1 à 52 à
titre de médicament. 53. Conjugate according to any one of claims 1 to 52 to drug title. 54. Conjugué selon l'une quelconque des revendications 1 à 52 à
titre de médicament pour la thérapie génique. 54. Conjugate according to any one of claims 1 to 52 to title of drug for gene therapy. 55. Conjugué selon les revendications 53 et 54 à titre de médicament pour le traitement des maladies génétiques acquises ou constitutionnelles. 55. Conjugate according to claims 53 and 54 as medicinal product for the treatment of acquired genetic diseases or constitutional. 56. Conjugué selon la revendication 55 à titre de médicament pour le traitement des maladies génétiques acquises choisies parmi les cancers et les maladies infectieuses. 56. Conjugate according to claim 55 as a medicament for the treatment of acquired genetic diseases chosen from among the cancers and infectious diseases. 57. Conjugué selon la revendication 56 à titre de médicament pour le traitement du carcinome des cellules rénales (RCC). 57. Conjugate according to claim 56 as a medicament for the treatment of renal cell carcinoma (RCC). 58. Conjugué selon l'une quelconque des revendications 1 à 52 à
titre de médicament destiné au transfert d'une molécule d'acide nucléique dans une cellule caractérisé en ce que ladite cellule est mise en contact avec ledit conjugué de façon à transfecter ladite cellule avec ledit conjugué. 58. Conjugate according to any one of claims 1 to 52 to titer of drug intended for the transfer of an acid molecule nucleus in a cell characterized in that said cell is contacting said conjugate so as to transfect said cell with said conjugate. 59. Conjugué selon la revendication 58 caractérisé en ce que ladite molécule d'acide nucléique code pour un produit protéique d'intérêt qui s'exprime efficacement dans ladite cellule transfectée. 59. Conjugate according to claim 58 characterized in that said nucleic acid molecule codes for a protein product of interest which is expressed effectively in said transfected cell. 60. Conjugué selon la revendication 58 caractérisé en ce que ladite molécule d'acide nucléique se maintient sous la forme d'un réplicon extrachromosomique dans ladite cellule. 60. Conjugate according to claim 58 characterized in that said nucleic acid molecule maintains itself as a replicon extrachromosomal in said cell. 61. Conjugué selon la revendication 58 caractérisé en ce que ladite molécule d'acide nucléique s'intègre dans l'ADN génomique et/ou mitochondrial de ladite cellule transfectée. 61. Conjugate according to claim 58 characterized in that said nucleic acid molecule integrates into genomic DNA and/or mitochondrial of said transfected cell. 62. Conjugué selon les revendications 58 à 61 caractérisé en ce que ladite cellule est une cellule eucaryote. 62. Conjugate according to claims 58 to 61 characterized in that said cell is a eukaryotic cell. 63. Composition pharmaceutique notamment pour le traitement des maladies par thérapie génique qui comprend une quantité
thérapeutiquement efficace d'un conjugué selon l'une quelconque des revendications 1 à 52 et un véhicule pharmaceutiquement acceptable. 63. Pharmaceutical composition in particular for the treatment of diseases by gene therapy which includes a quantity therapeutically effective of a conjugate according to any of claims 1 to 52 and a carrier pharmaceutically acceptable.
CA002373851A 1999-05-10 2000-05-10 Nucleic acid-antibody conjugate for delivering a foreign nucleic acid in cells Abandoned CA2373851A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
FR9905943A FR2793414B1 (en) 1999-05-10 1999-05-10 NUCLEIC ACID-ANTIBODY CONJUGATE FOR DELIVERING FOREIGN NUCLEIC ACID TO CELLS
FR99/05943 1999-05-10
PCT/FR2000/001259 WO2000067697A2 (en) 1999-05-10 2000-05-10 Nucleic acid-antibody conjugate for delivering a foreign nucleic acid in cells

Publications (1)

Publication Number Publication Date
CA2373851A1 true CA2373851A1 (en) 2000-11-16

Family

ID=9545418

Family Applications (1)

Application Number Title Priority Date Filing Date
CA002373851A Abandoned CA2373851A1 (en) 1999-05-10 2000-05-10 Nucleic acid-antibody conjugate for delivering a foreign nucleic acid in cells

Country Status (7)

Country Link
EP (1) EP1175498A2 (en)
JP (1) JP2002543810A (en)
AU (1) AU4415200A (en)
CA (1) CA2373851A1 (en)
FR (1) FR2793414B1 (en)
IL (1) IL146399A0 (en)
WO (1) WO2000067697A2 (en)

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004066989A1 (en) * 2003-01-31 2004-08-12 Novartis Ag Down-regulation of target-gene with pei/single-stranded oligoribonucleotide comp lexes
JP4521519B2 (en) * 2003-05-26 2010-08-11 学校法人慶應義塾 Partial histone tail type immunoporter
FR2958645B1 (en) * 2010-04-09 2012-08-31 Commissariat Energie Atomique HEMI-ANTIBODY WITH SELF-ASSEMBLY
US10540907B2 (en) 2014-07-31 2020-01-21 Intelligent Technologies International, Inc. Biometric identification headpiece system for test taking
US10410535B2 (en) 2014-08-22 2019-09-10 Intelligent Technologies International, Inc. Secure testing device
US9959777B2 (en) 2014-08-22 2018-05-01 Intelligent Technologies International, Inc. Secure testing device, system and method
US10438106B2 (en) 2014-11-04 2019-10-08 Intellignet Technologies International, Inc. Smartcard
CN108530540B (en) * 2018-03-30 2021-06-15 华南农业大学 Anti-spermidine monoclonal antibody hybridoma cell strain 4E4, monoclonal antibody thereof and application

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5166320A (en) * 1987-04-22 1992-11-24 University Of Connecticut Carrier system and method for the introduction of genes into mammalian cells
EP0366707A1 (en) * 1987-05-06 1990-05-09 OOSTERWIJK, Egbert Monoclonal antibodies to renal cell carcinoma
US5428132A (en) * 1987-10-11 1995-06-27 United States Of America Conjugate and method for integration of foreign DNA into cells
IL106760A (en) * 1992-08-25 1999-12-31 Miles Inc Protein-nucleic acid hybrid construct for translocating an exogenous nucleic acid into a target cell and nucleus
US5574142A (en) * 1992-12-15 1996-11-12 Microprobe Corporation Peptide linkers for improved oligonucleotide delivery
IL112372A (en) * 1994-02-07 2001-08-26 Res Dev Foundation Non-viral vector for the delivery of genetic information to cells
JPH09511916A (en) * 1994-11-01 1997-12-02 ベルス，ビンフリート Nucleic acid transfer system
GB9614699D0 (en) * 1996-07-12 1996-09-04 John P Robarts Research Inst T Hybrid herpes virus-based vector for gene delivery and expression
DE19717904A1 (en) * 1997-04-23 1998-10-29 Diagnostikforschung Inst Acid-labile and enzymatically cleavable dye constructs for diagnostics with near infrared light and for therapy
WO1998056425A1 (en) * 1997-06-11 1998-12-17 The School Of Pharmacy, University Of London Pharmaceutical compositions containing antibody-enzyme conjugates in combination with prodrugs

Also Published As

Publication number Publication date
FR2793414A1 (en) 2000-11-17
WO2000067697A2 (en) 2000-11-16
FR2793414B1 (en) 2003-05-23
AU4415200A (en) 2000-11-21
IL146399A0 (en) 2002-07-25
EP1175498A2 (en) 2002-01-30
JP2002543810A (en) 2002-12-24
WO2000067697A3 (en) 2001-06-28

Similar Documents

Publication Publication Date Title
US20210346504A1 (en) Exosomes For Delivery Of Biotherapeutics
Elfinger et al. Characterization of lactoferrin as a targeting ligand for nonviral gene delivery to airway epithelial cells
Xu et al. Systemic tumor-targeted gene delivery by anti-transferrin receptor scFv-immunoliposomes
JP3222461B2 (en) New protein-polycation conjugate
US20070219118A1 (en) Therapeutic methods for nucleic acid delivery vehicles
Narang et al. Targeted delivery of small and macromolecular drugs
JP2002514892A (en) Use of synthetic virus-like particles in gene therapy
KR20070061770A (en) Sirna-hydrophilic polymer conjugates for intracellular delivery of sirna and method thereof
JP2002502243A (en) Integrin-targeting vector with transfection activity
Bäumer et al. Immunoprotein-mediated siRNA delivery
CN111989138A (en) Humanized anti-Prostate Specific Membrane Antigen (PSMA) antibody drug conjugates
CA2373851A1 (en) Nucleic acid-antibody conjugate for delivering a foreign nucleic acid in cells
CA2101332C (en) Antibody polycation conjugates
May et al. Assessment of cell type specific gene transfer of polyoma virus like particles presenting a tumor specific antibody Fv fragment
US20240158814A1 (en) Dendritic peptide conjugated polymers for efficient intracellular delivery of nucleic acids to immune cells
Germershaus et al. HER2 targeted polyplexes: the effect of polyplex composition and conjugation chemistry on in vitro and in vivo characteristics
JP2023528293A (en) Single domain antibodies and their use in cancer therapy
González et al. Pegylation: An overview and recent advances reported in the patent literature
EP0934342B1 (en) Composition containing chitosan
CN112876566A (en) Construction and application of CD3 specific lentivirus
EP4238581A1 (en) Targeted delivery of oligonucleotides into eukaryotic cells using hybrid maltose/cyclodextrin polyplexes
Gao et al. Polymeric Gene Delivery Carriers for Pulmonary Diseases
Sadowski et al. Ligand-Mediated Modulation of the Type III Tyrosine-Kinase Receptor c-kit is a possible specific Entrance Mechanism for Immunotoxins in c-kit+ Leukemia
FR2754823A1 (en) Compounds prepared by acid hydrolysis of chitosan

Legal Events

Date Code Title Description
EEER Examination request
FZDE Discontinued