CA2358899A1 - Polypeptide - Google Patents

Polypeptide Download PDF

Info

Publication number
CA2358899A1
CA2358899A1 CA002358899A CA2358899A CA2358899A1 CA 2358899 A1 CA2358899 A1 CA 2358899A1 CA 002358899 A CA002358899 A CA 002358899A CA 2358899 A CA2358899 A CA 2358899A CA 2358899 A1 CA2358899 A1 CA 2358899A1
Authority
CA
Canada
Prior art keywords
polypeptide
seq
polynucleotide
identity
nucleotide sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
CA002358899A
Other languages
French (fr)
Inventor
Carlota Vinals-Bassols
Thierry Coche
Jean-Pol Cassart
Swann Romain Jean-Thomas Gaulis
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
GlaxoSmithKline Biologicals SA
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Individual filed Critical Individual
Publication of CA2358899A1 publication Critical patent/CA2358899A1/en
Abandoned legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Toxicology (AREA)
  • Immunology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Investigating Or Analysing Biological Materials (AREA)

Abstract

CASB612 polypeptides and polynucleotides and methods for producing such polypeptides by recombinant techniques are disclosed. Also disclosed are methods for utilizing CASB612 polypeptides and polynucleotides in diagnostic s, and vaccines for prophylactic and therapeutic treatment of cancers, particularly ovarian and colon cancers, autoimmune diseases, and related conditions.

Description

POLYPEPTIDE
The present invention relates to polynucleotides, herein referred to as polynucleotides, polypeptides encoded thereby (referred to herein as CASB612 polypeptides), recombinant materials and methods for their production. In another aspect, the invention relates to methods for using such polypeptides and polynucleotides, including the treatment of cancer and autoimmune diseases and other related conditions.
In a further aspect, the invention relates to methods for identifying agonists and antagonists/inhibitors using the materials provided by the invention, and treating conditions associated with 1o CASB612 polypeptide imbalance with the identified compounds. In a still further aspect, the invention relates to diagnostic assays for detecting diseases associated with inappropriate CASB612 polypeptide activity or levels.
Polypeptides and polynucleotides of the present invention are believed to be important immunogens for specific prophylactic or therapeutic immunization against tumours, because they are specifically expressed or highly over-expressed in tumours compared to normal cells and can thus be targeted by antigen-specific immune mechanisms leading to the destruction of the tumour cell. They can also be used to diagnose the occurrence of tumour cells. Furthermore, their inappropriate expression in certain circumstances can cause an 2o induction of autoimmune, inappropriate immune responses, which could be corrected through appropriate vaccination using the same polypeptides or polynucleotides. In this respect the most important biological activities to our purpose are the antigenic and immunogenic activities of the polypeptide of the present invention. A
polypeptide of the present invention may also exhibit at least one other biological activity of a polypeptide, which could qualify it as a target for therapeutic or prophylactic intervention different from that linked to the immune response.
Functional genomics relies heavily on high-throughput DNA sequencing technologies and the various tools of bioinformatics to identify gene sequences of potential interest from the 3o many molecular biology databases now available. cDNA libraries enriched for genes of relevance to a particular tissue or physiological situation can be constructed using recently developed subtractive cloning strategies. Furthermore, cDNAs found in libraries of certain tissues and not others can be identified using appropriate electronic screening methods.

High throughput genome- or gene-based biology allows new approaches to the identification and cloning of target genes for usefiil immune responses for the prevention and vaccine therapy of diseases such as cancer and autoimmunity.
In a first aspect, the present invention relates to CASB612 polypeptides. Such peptides include isolated polypeptides comprising an amino acid sequence which has at least 70%
identity, preferably at least 80% identity, more preferably at least 90%
identity, yet more preferably at least 95% identity, most preferably at least 97-99% identity, to that of SEQ
1o ID N0:2 over the entire length of SEQ ID N0:2. Such polypeptides include those comprising the amino acid of SEQ ID N0:2.
Further peptides of the present invention include isolated polypeptides in which the amino acid sequence has at least 70% identity, preferably at least 80%
identity, more 15 preferably at least 90% identity, yet more preferably at least 95%
identity, most preferably at least 97-99% identity, to the amino acid sequence of SEQ ID N0:2 over the entire length of SEQ ID N0:2. Such polypeptides include the polypeptide of SEQ
ID
N0:2.
2o Further peptides of the present invention include isolated polypeptides encoded by a polynucleotide comprising the sequence contained in SEQ ID NO:1.
The invention also provides an immunogenic fragment of a CASB612 polypeptide, that is a contiguous portion of the CASB612 polypeptide which has the same or similar 25 immunogenic properties to the polypeptide comprising the amino acid seqeunce of SEQ >D
N0:2. That is to say, the fragment (if necessary when coupled to a carrier) is capable of raising an immune response which recognises the CASB612 polypeptide. Such an immunogenic fragment may include, for example, the CASB612 polypeptide lacking an N-terminal leader sequence, a transmembrane domain or a C-terminal anchor domain. In a 3o preferred aspect the immunogenic fragment of CASB612 according to the invention comprises substantially all of the extracellular domain of a polypeptide which has at least 70% identity, preferably at least 80% identity, more preferably at least 90%
identity, yet more preferably at least 95% identity, most preferably at least 97-99%
identity, to that of SEQ ID N0:2 over the entire length of SEQ ID N0:2 The polypeptides or immunogenic fragment of the invention may be in the form of the "mature" protein or may be a part of a larger protein such as a precursor or a fusion protein. It is often advantageous to include an additional amino acid sequence which contains secretory or leader sequences, pro-sequences, sequences which aid in purification such as multiple histidine residues, or an additional sequence for stability during recombinant production. Furthermore, addition of exogenous polypeptide or lipid to tail or polynucleotide sequences to increase the immunogenic potential of the final molecule is also considered.
In one aspect, the invention relates to genetically engineered soluble fusion proteins comprising a polypeptide of the present invention, or a fragment thereof, and various portions of the constant regions of heavy or light chains of immunoglobulins of various subclasses (IgG, IgM, IgA, IgE). Preferred as an immunoglobulin is the constant part of the heavy chain of human IgG, particularly IgGI, where fusion takes place at the hinge region. In a particular embodiment, the Fc part can be removed simply by incorporation of a cleavage sequence which can be cleaved with blood clotting factor Xa.
Furthermore, this invention relates to processes for the preparation of these fusion proteins by genetic engineering, and to the use thereof for drug screening, diagnosis and therapy.
A further aspect of the invention also relates to polynucleotides encoding such fusion proteins.
Examples of fusion protein technology can be found in International Patent Application Nos. W094/29458 and W094/22914.
The proteins may be chemically conjugated, or expressed as recombinant fusion proteins allowing increased levels to be produced in an expression system as compared to non-fused protein. The fusion partner may assist in providing T helper epitopes (immunological fusion partner), preferably T helper epitopes recognised by humans, or assist in expressing the protein (expression enhancer) at higher yields than the native recombinant protein. Preferably the fusion partner will be both an immunological fusion partner and expression enhancing partner.

Fusion partners include protein D from Haemophilus influenza B and the non-structural protein from influenzae virus, NS 1 (hemagglutinin). Another immunological fusion partner is the protein known as LYTA. Preferably the C terminal portion of the molecule is used. Lyta is derived from Streptococcus pneumoniae which synthesize an N-acetyl-L-alanine amidase, amidase LYTA, (coded by the lytA gene {Gene, 43 (1986) page 272} an autolysin that specifically degrades certain bonds in the peptidoglycan backbone.
The C-terminal domain of the LYTA protein is responsible for the affinity to the choline or to some choline analogues such as DEAE. This property has been exploited for the development of E.coli C-LYTA expressing plasmids useful for expression of fusion to proteins. Purification of hybrid proteins containing the C-LYTA fragment at its amino terminus has been described {Biotechnology: 10, ( 1992) page 795-798 } . It is possible to use the repeat portion of the Lyta molecule found in the C terminal end starting at residue 178, for example residues 188 - 305.
The present invention also includes variants of the aforementioned polypeptides, that is polypeptides that vary from the referents by conservative amino acid substitutions, whereby a residue is substituted by another with like characteristics. Typical such substitutions are among Ala, Val, Leu and Ile; among Ser and Thr; among the acidic residues Asp and Glu;
among Asn and Gln; and among the basic residues Lys and Arg; or aromatic residues Phe 2o and Tyr. Particularly preferred are variants in which several, 5-10, 1-5, 1-3, 1-2 or 1 amino acids are substituted, deleted, or added in any combination.
Polypeptides of the present invention can be prepared in any suitable manner.
Such polypeptides include isolated naturally occurring polypeptides, recombinantly produced polypeptides, synthetically produced polypeptides, or polypeptides produced by a combination of these methods. Means for preparing such polypeptides are well understood in the art.
In a further aspect, the present invention relates to CASB612 polynucleotides.
Such 3o polynucleotides include isolated polynucleotides comprising a nucleotide sequence encoding a polypeptide which has at least 70% identity, preferably at least 80%
identity, more preferably at least 90% identity, yet more preferably at least 95% identity, to the amino acid sequence of SEQ ID N0:2, over the entire length of SEQ ID N0:2. In this regard, polypeptides which have at least 97% identity are highly preferred, whilst those with at least 98-99% identity are more highly preferred, and those with at least 99%
identity are most highly preferred. Such polynucleotides include a polynucleotide comprising the nucleotide sequence contained in SEQ m NO:1 encoding the polypeptide of SEQ >D N0:2.
Further polynucleotides of the present invention include isolated polynucleotides comprising a nucleotide sequence that has at least 70% identity, preferably at least 80%
identity, more preferably at least 90% identity, yet more preferably at least 95% identity, to a nucleotide sequence encoding a polypeptide of SEQ ll~ N0:2, over the entire coding region. In this to regard, polynucleotides which have at least 97% identity are highly preferred, whilst those with at least 98-99% identity are more highly preferred, and those with at least 99% identity are most highly preferred.
Further polynucleotides of the present invention include isolated polynucleotides 15 comprising a nucleotide sequence which has at least 70% identity, preferably at least 80%
identity, more preferably at least 90% identity, yet more preferably at least 95% identity, to SEQ ID NO:1 over the entire length of SEQ >D NO:1. In this regard, polynucleotides which have at least 97% identity are highly preferred, whilst those with at least 98-99%
identiy are more highly preferred, and those with at least 99% identity are most highly 2o preferred. Such polynucleotides include a polynucleotide comprising the polynucleotide of SEQ m NO:1 as well as the polynucleotide of SEQ )D NO:1. Said polynucleotide can be inserted in a suitable plasmid or recombinant microrganism vector and used for immunization ( see for example Wolffet. al., Science 247:1465-1468 (1990);
Corr et. al., J.
Exp. Med. 184:1555-1560 (1996); Doe et. al., Proc. Natl. Acad. Sci. 93:8578-8583 (1996)).
25 The invention also provides polynucleotides which are complementary to all the above described polynucleotides.
The invention also provides a fragment of a CASB612 polynucleotide which when administered to a subject has the same immunogenic properties as the polynucleotide of 3o SEQ ID NO:l.
The invention also provides a polynucleotide encoding an immunological fragment of a CASB612 polypeptide as hereinbefore defined.

The nucleotide sequence of SEQ ID NO:1 shows no homology with any lrnown gene.
The nucleotide sequence of SEQ ID NO:1 is a cDNA sequence and comprises a polypeptide encoding sequence (nucleotide 133 to 1242) encoding a polypeptide of 369 amino acids, the polypeptide of SEQ ID N0:2. The nucleotide sequence encoding the polypeptide of SEQ
ID N0:2 may be identical to the polypeptide encoding sequence contained in SEQ
ID
NO:1 or it may be a sequence other than the one contained in SEQ ID NO:l, which, as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID N0:2. The polypeptide of the SEQ ID N0:2 is not related to other lrnown proteins.
Preferred polypeptides and polynucleotides of the present invention are expected to have, inter alia, similar biological fimctions/properties to their homologous polypeptides and polynucleotides. Furthermore, preferred polypeptides, immunological fragments and polynucleotides of the present invention have at least one activity of either SEQ m NO:1 or SEQ 117 N0:2, as appropriate.
The present invention also relates to partial or other incomplete polynucleotide and polypeptide sequences which were first identified prior to the determination of the 2o corresponding full length sequences of SEQ ID NO:1 and SEQ 117 N0:2.
Accordingly, in a fiuther aspect, the present invention provides for an isolated polynucleotide which:
(a) comprises a nucleotide sequence which has at least 70% identity, preferably at least 80% identity, more preferably at least 90% identity, yet more preferably at least 95%
identity, even more preferably at least 97-99% identity to SEQ ID N0:3 over the entire length of SEQ ID N0:3;
(b) has a nucleotide sequence which has at least 70% identity, preferably at least 80%
identity, more preferably at least 90% identity, yet more preferably at least 95% identity, 3o even more preferably at least 97-99% identity, to SEQ ID NO:l over the entire length of SEQ ID N0:3;
(c) the polynucleotide of SEQ ID N0:3; or (d) a nucleotide sequence encoding a polypeptide which has at least 70%
identity, preferably at least 80% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97-99%
identity, to the amino acid sequence of SEQ 1D N0:4, over the entire length of SEQ ID N0:4;
as well as the polynucleotide of SEQ ID N0:3.
The present invention further provides for a polypeptide which:
(a) comprises an amino acid sequence which has at least 70% identity, preferably at least 80% identity, more preferably at least 90% identity, yet more preferably at least 95%
1o identity, most preferably at least 97-99% identity, to that of SEQ ID N0:2 over the entire length of SEQ ID N0:4;
(b) has an amino acid sequence which is at least 70% identity, preferably at least 80%
identity, more preferably at least 90% identity, yet more preferably at least 95% identity, most preferably at least 97-99% identity, to the amino acid sequence of SEQ ID
N0:2 15 over the entire length of SEQ D7 N0:4;
(c) comprises the amino acid of SEQ ID N0:4; and (d) is the polypeptide of SEQ ID N0:4;
as well as polypeptides encoded by a polynucleotide comprising the sequence contained in SEQ ID N0:3.
The nucleotide sequence of SEQ ID N0:3 and the peptide sequence encoded thereby are derived from EST (Expressed Sequence Tag) sequences. It is recognised by those skilled in the art that there will inevitably be some nucleotide sequence reading errors in EST
sequences (see Adams, M.D. et al, Nature 377 (supp) 3, 1995). Accordingly, the nucleotide sequence of SEQ ID N0:3 and the peptide sequence encoded therefrom are therefore subject to the same inherent limitations in sequence accuracy.
Furthermore, the peptide sequence encoded by SEQ 1D N0:3 comprises a region of identity or close homology and/or close structural similarity (for example a conservative amino acid difference) with the closest homologous or structurally similar protein.
Polynucleotides of the present invention may be obtained, using standard cloning and screening techniques, from a cDNA library derived from mRNA in cells of human colon cancer, lung cancer, uterine cancer, and fetal tissues (for example Sambrook et al., Molecular Cloning: A Laboratory Manual, 2"d Ed., Cold Spring harbor Laboratory Press, Cold Spring harbor, N.Y. (1989)). Polynucleotides of the invention can also be obtained from natural sources such as genomic DNA libraries or can be synthesized using well known and commercially available techniques.
When polynucleotides of the present invention are used for the recombinant production of polypeptides of the present invention, the polynucleotide may include the coding sequence for the mature polypeptide, by itself; or the coding sequence for the mature polypeptide in reading frame with other coding sequences, such as those encoding a leader or secretory 1o sequence, a pre-, or pro- or prepro- protein sequence, or other fusion peptide portions. For example, a marker sequence which facilitates purification of the fused polypeptide can be encoded. In certain preferred embodiments of this aspect of the invention, the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al., Proc Natl Acad Sci USA (1989) 86:821-824, or is an HA tag. The 15 polynucleotide may also contain non-coding 5' and 3' sequences, such as transcribed, non translated sequences, splicing and polyadenylation signals, ribosome binding sites and sequences that stabilize mRNA.
Further embodiments of the present invention include polynucleotides encoding polypeptide 2o variants which comprise the amino acid sequence of SEQ 1D N0:2 and in which several, for instance from S to 10, 1 to 5, 1 to 3, 1 to 2 or l, amino acid residues are substituted, deleted or added, in any combination.
Polynucleotides which are identical or sufficiently identical to a nucleotide sequence 25 contained in SEQ >D NO:1, may be used as hybridization probes for cDNA and genomic DNA or as primers for a nucleic acid amplification (PCR) reaction, to isolate full-length cDNAs and genomic clones encoding polypeptides of the present invention and to isolate cDNA and genomic clones of other genes (including genes encoding paralogs from human sources and orthologs and paralogs from species other than human) that have a high 30 sequence similarity to SEQ ID NO:1. Typically these nucleotide sequences are 70%
identical, preferably 80% identical, more preferably 90% identical, most preferably 95%
identical to that of the referent. The probes or primers will generally comprise at least 15 nucleotides, preferably, at least 30 nucleotides and may have at least SO
nucleotides.

Particularly preferred probes will have between 30 and 50 nucleotides.
Particularly preferred primers will have between 20 and 25 nucleotides. In particular, polypeptides or polynucleotides derived from sequences from homologous animal origin could be used as immunogens to obtain a cross-reactive immune response to the human gene.
A polynucleotide encoding a polypeptide of the present invention, including homologs from species other than human, may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions with a labeled probe having the sequence of SEQ ID NO: 1 or a fragment thereof; and isolating full-length 1 o cDNA and genomic clones containing said polynucleotide sequence. Such hybridization techniques are well known to the skilled artisan. Preferred stringent hybridization conditions include overnight incubation at 42oC in a solution comprising: 50% formamide, SxSSC
(150mM NaCI, lSmM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution, 10 % dextran sulfate, and 20 microgram/ml denatured, sheared salmon sperm 15 DNA; followed by washing the filters in O.lx SSC at about 65oC. Thus the present invention also includes polynucleotides obtainable by screening an appropriate library under stingent hybridization conditions with a labeled probe having the sequence of SEQ ID
NO: l or a fragment thereof.
2o The skilled artisan will appreciate that, in many cases, an isolated cDNA
sequence will be incomplete, in that the region coding for the polypeptide is short at the 5' end of the cDNA.
There are several methods available and well known to those skilled in the art to obtain 25 full-length cDNAs, or extend short cDNAs, for example those based on the method of Rapid Amplification of cDNA ends (RACE) (see, for example, Frohman et al., PNAS
USA 85, 8998-9002, 1988). Recent modifications of the technique, exemplified by the MarathonTM technology (Clontech Laboratories Inc.) for example, have significantly simplified the search for longer cDNAs. In the MarathonTM technology, cDNAs have 3o been prepared from mRNA extracted from a chosen tissue and an'adaptor' sequence ligated onto each end. Nucleic acid amplification (PCR) is then carried out to amplify the 'missing' S' end of the cDNA using a combination of gene specific and adaptor specific oligonucleotide primers. The PCR reaction is then repeated using 'nested' primers, that is, primers designed to anneal within the amplified product (typically an adaptor specific primer that anneals further 3' in the adaptor sequence and a gene specific primer that anneals further 5' in the known gene sequence). The products of this reaction can then be analysed by DNA sequencing and a full-length cDNA constructed either by joining the product directly to the existing cDNA to give a complete sequence, or carrying out a separate full-length PCR using the new sequence information for the design of the S' primer.
1 o Recombinant polypeptides of the present invention may be prepared by processes well known in the art from genetically engineered host cells comprising expression systems.
Accordingly, in a further aspect, the present invention relates to an expression system which comprises a polynucleotide of the present invention, to host cells which are genetically engineered with such expression sytems and to the production of polypeptides of the 15 invention by recombinant techniques. Cell-free translation systems can also be employed to produce such proteins using RNAs derived from the DNA constructs of the present invention.
For recombinant production, host cells can be genetically engineered to incorporate 2o expression systems or portions thereof for polynucleotides of the present invention.
Introduction of polynucleotides into host cells can be effected by methods described in many standard laboratory manuals, such as Davis et al., Basic Methods in Molecular Biology (1986) and Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989). Preferred such methods 25 include, for instance, calcium phosphate transfection, DEAF-dextran mediated transfection, transvection, microinjection, cationic lipid-mediated transfection, electroporation, transduction, scrape loading, ballistic introduction or infection.
Preferably the proteins of the invention are coexpressed with thioredoxin in trans (TIT).
30 Coexpression of thioredoxin in trans versus in cis is preferred to keep antigen free of thioredoxin without the need for protease. Thioredoxin coexpression eases the solubilisation of the proteins of the invention. Thioredoxin coexpression has also a significant impact on protein purification yield, on purified-protein solubility and quality.

Representative examples of appropriate hosts include bacterial cells, such as Streptococci, Staphylococci, E. coli, Streptomyces and Bacillus subtilis cells; fungal cells, such as yeast cells and Aspergillus cells; insect cells such as Drosophila S2 and Spodoptera Sf~ cells;
animal cells such as CHO, COS, HeLa, C127, 3T3, BHK, HEK 293 and Bowes melanoma cells; and plant cells.
A great variety of expression systems can be used, for instance, chromosomal, episomal and virus-derived systems, e.g., vectors derived from bacterial plasmids, from to bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, such as cosmids and phagemids. The 15 expression systems may contain control regions that regulate as well as engender expression. Generally, any system or vector which is able to maintain, propagate or express a polynucleotide to produce a polypeptide in a host may be used. The appropriate nucleotide sequence may be inserted into an expression system by any of a variety of well-known and routine techniques, such as, for example, those set forth in Sambrook et 2o al., Molecular Cloning, A Laboratory Manual (supra). Appropriate secretion signals may be incorporated into the desired polypeptide to allow secretion of the translated protein into the lumen of the endoplasmic reticulum, the periplasmic space or the extracellular environment. These signals may be endogenous to the polypeptide or they may be heterologous signals.
The expression system may also be a recombinant live microorganism, such as a virus or bacterium. The gene of interest can be inserted into the genome of a live recombinant virus or bacterium. Inoculation and in vivo infection with this live vector will lead to in vivo expression of the antigen and induction of immune responses. Viruses and bacteria 3o used for this purpose are for instance: poxviruses (e.g; vaccinia, fowlpox, canarypox), alphaviruses (Sindbis virus, Semliki Forest Virus, Venezuelian Equine Encephalitis Virus), adenoviruses, adeno-associated virus, picornaviruses (poliovirus, rhinovirus), herpesviruses (varicella zoster virus, etc), Listeria, Salmonella , Shigella, BCG. These viruses and bacteria can be virulent, or attenuated in various ways in order to obtain live vaccines. Such live vaccines also form part of the invention.
Polypeptides of the present invention can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Most preferably, ion metal affinity chromatography (1MAC) is employed for purification. Well known techniques for 1o refolding proteins may be employed to regenerate active conformation when the polypeptide is denatured during intracellular synthesis, isolation and or purification.
Another important aspect of the invention relates to a method for inducing , re-enforcing or modulating an immunological response in a mammal which comprises inoculating the mammal with a fragment or the entire polypeptide or polynucleotide of the invention, adequate to produce antibody and/or T cell immune response for prophylaxis or for therapeutic treatment of cancer and autoimmune disease and related conditions.
Yet another aspect of the invention relates to a method of inducing, re-enforcing or modulating immunological response in a mammal which comprises, delivering a polypeptide of the present invention via a vector or cell directing expression of the polynucleotide and coding for the polypeptide in vivo in order to induce such an immunological response to produce immune responses for prophylaxis or treatment of said mammal from diseases.
A fizrther aspect of the invention relates to an immunological/vaccine formulation (composition) which, when introduced into a mammalian host, induces, re-enforces or modulates an immunological response in that mammal to a polypeptide of the present invention wherein the composition comprises a polypeptide or polynucleotide of the invention or an immunological fragment thereof as herein before defined.The vaccine 3o formulation, may fizrther comprise a suitable Garner. Since a polypeptide may be broken down in the stomach, it is preferably administered parenterally (for instance, subcutaneous, intramuscular, intravenous, or intradermal injection).
Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents or thickening agents.
The formulations may be presented in unit-dose or multi-dose containers, for example, sealed ampoules and vials and may be stored in a freeze-dried condition requiring only the addition of the sterile liquid Garner immediately prior to use.
A further aspect of the invention relates to the in vitro induction of immune responses to a fragment or the entire polypeptide or polynucleotide of the present invention or a 1o molecule comprising the polypeptide or polynucleotide of the present invention, using cells from the immune system of a mammal, and reinfusing these activated immune cells of the mammal for the treatment of disease. Activation of the cells from the immune system is achieved by in vitro incubation with the entire polypeptide or polynucleotide of the present invention or a molecule comprising the polypeptide or polynucleotide of the 15 present invention in the presence or absence of various immunomodulator molecules.
A further aspect of the invention relates to the immunization of a mammal by administration of antigen presenting cells modified by in vitro loading with part or the entire polypeptide of the present invention or a molecule comprising the polypeptide of the present invention and administered in vivo in an immunogenic way.
Alternatively, 20 antigen presenting cells can be transfected in vitro with a vector containing a fragment or the entire polynucleotide of the present invention or a molecule comprising the polynucleotide of the present invention, such as to express the corresponding polypeptide, and administered in vivo in an immunogenic way.
25 The vaccine formulation of the invention may also include adjuvant systems for enhancing the immunogenicity of the formulation. Preferably the adjuvant system raises preferentially a TH1 type of response.
An immune response may be broadly distinguished into two extreme catagories, being a 3o humoral or cell mediated immune responses (traditionally characterised by antibody and cellular effector mechanisms of protection respectively). These categories of response have been termed TH1-type responses (cell-mediated response), and TH2-type immune responses (humoral response).

Extreme TH1-type immune responses may be characterised by the generation of antigen specific, haplotype restricted cytotoxic T lymphocytes, and natural killer cell responses.
In mice TH1-type responses are often characterised by the generation of antibodies of the IgG2a subtype, whilst in the human these correspond to IgGl type antibodies.
TH2-type immune responses are characterised by the generation of a broad range of immunoglobulin isotypes including in mice IgGl, IgA, and IgM.
It can be considered that the driving force behind the development of these two types of 1o immune responses are cytokines. High levels of THl-type cytokines tend to favour the induction of cell mediated immune responses to the given antigen, whilst high levels of TH2-type cytokines tend to favour the induction of humoral immune responses to the antigen.
15 The distinction of TH1 and TH2-type immune responses is not absolute. In reality an individual will support an immune response which is described as being predominantly TH1 or predominantly TH2. However, it is often convenient to consider the families of cytokines in terms of that described in murine CD4 +ve T cell clones by Mosmann and Coffinan (Mosmann, T.R. and Coffman, R.L. (1989) THI and TH2 cells: different 20 patterns of lymphokine secretion lead to different functional properties.
Annual Review of Immunology, 7, p145-173). Traditionally, THl-type responses are associated with the production of the INF-y and IL-2 cytokines by T-lymphocytes. Other cytokines often directly associated with the induction of THl-type immune responses are not produced by T-cells, such as IL-12. In contrast, TH2- type responses are associated with the secretion 25 of IL-4, IL-5, IL-6 and IL-13.
It is known that certain vaccine adjuvants are particularly suited to the stimulation of either TH1 or TH2 - type cytokine responses. Traditionally the best indicators of the TH1:TH2 balance of the immune response after a vaccination or infection includes direct 3o measurement of the production of TH1 or TH2 cytokines by T lymphocytes in vitro after restimulation with antigen, and/or the measurement of the IgGI :IgG2a ratio of antigen specific antibody responses.

Thus, a TH1-type adjuvant is ore which preferentially stimulates isolated T-cell populations to produce high levels of THl-type cytokines when re-stimulated with antigen in vitro, and promotes development of both CD8+ cytotoxic T
lymphocytes and antigen specific immunoglobulin responses associated with TH1-type isotype.
Adjuvants which are capable of preferential stimulation of the TH1 cell response are described in International Patent Application No. WO 94/00153 and WO 95/17209.
3 De-O-acylated monophosphoryl lipid A (3D-MPL) is one such adjuvant. This is known 1o from GB 2220211 (Ribi). Chemically it is a mixture of 3 De-O-acylated monophosphoryl lipid A with 4, 5 or 6 acylated chains and is manufactured by Ribi Immunochem, Montana. A preferred form of 3 De-O-acylated monophosphoryl lipid A
is disclosed in European Patent 0 689 454 B1 (SmithKline Beecham Biologicals SA).
15 Preferably, the particles of 3D-MPL are small enough to be sterile filtered through a 0.22micron membrane (European Patent number 0 689 454).
3D-MPL will be present in the range of 10~g - 100~,g preferably 25-SOpg per dose wherein the antigen will typically be present in a range 2-SO~g per dose.
2o Another preferred adjuvant comprises QS21, an Hplc purified non-toxic fraction derived from the bark of Quillaja Saponaria Molina. Optionally this may be admixed with 3 De-O-acylated monophosphoryl lipid A (3D-MPL), optionally together with an carrier.
The method of production of QS21 is disclosed in US patent No. 5,057,540.
Non-reactogenic adjuvant formulations containing QS21 have been described previously (WO 96/33739). Such formulations comprising QS21 and cholesterol have been shown to be successful TH1 stimulating adjuvants when formulated together with an antigen.
3o Further adjuvants which are preferential stimulators of THl cell response include immunomodulatory oligonucleotides, for example unmethylated CpG sequences as disclosed in WO 96/02555.

Combinations of different TH1 stimulating adjuvants, such as those mentioned hereinabove, are also contemplated as providing an adjuvant which is a preferential stimulator of TH1 cell response. For example, QS21 can be formulated together with 3D-MPL. The ratio of QS21 : 3D-MPL will typically be in the order of 1 : 10 to 10 : l;
preferably 1:5 to S : 1 and often substantially 1 : 1. The preferred range for optimal synergy is 2.5 : 1 to 1 : 1 3D-MPL: QS21.
Preferably a carrier is also present in the vaccine composition according to the invention.
The Garner may be an oil in water emulsion, or an aluminium salt, such as aluminium to phosphate or aluminium hydroxide.
A preferred oil-in-water emulsion comprises a metabolisible oil, such as squalene, alpha tocopherol and Tween 80. In a particularly preferred aspect the antigens in the vaccine composition according to the invention are combined with QS21 and 3D-MPL in such an emulsion. Additionally the oil in water emulsion may contain span 85 and/or lecithin and/or tricaprylin.
Typically for human administration QS21 and 3D-MPL will be present in a vaccine in the range of lp,g - 200p,g, such as 10-100p,g, preferably 10~g - SOpg per dose.
Typically the oil in water will comprise from 2 to 10% squalene, from 2 to 10% alpha tocopherol and from 0.3 to 3% tween 80. Preferably the ratio of squalene: alpha tocopherol is equal to or less than 1 as this provides a more stable emulsion. Span 85 may also be present at a level of 1%. In some cases it may be advantageous that the vaccines of the present invention will further contain a stabiliser.
Non-toxic oil in water emulsions preferably contain a non-toxic oil, e.g.
squalane or squalene, an emulsifier, e.g. Tween 80, in an aqueous carrier. The aqueous Garner may be, for example, phosphate buffered saline.
3o A particularly potent adjuvant formulation involving QS21, 3D-MPL and tocopherol in an oil in water emulsion is described in WO 95/17210.

The present invention also provides a polyvalent vaccine composition comprising a vaccine formulation of the invention in combination with other antigens, in particular antigens useful for treating cancers, autoimmune diseases and related conditions. Such a polyvalent vaccine composition may include a TH-1 inducing adjuvant as hereinbefore described.
This invention also relates to the use of polynucleotides, in the form of primers derived from the polynucleotides of the present invention, and of polypeptides, in the form of antibodies or reagents specific for the polypeptide of the present invention, as diagnostic reagents.
1o The identification of genetic or biochemical markers in blood or tissues that will enable the detection of very early changes along the carcinogenesis pathway will help in determining the best treatment for the patient. Surrogate tumour markers, such as polynucleotide expression, can be used to diagnose different forms and states of cancer. The identification of expression levels of the polynucleotides of the invention will be useful in both the 15 staging of the cancerous disorder and grading the nature of the cancerous tissue. The staging process monitors the advancement of the cancer and is determined on the presence or absence of malignant tissue in the areas biopsied. The polynucleotides of the invention can help to perfect the staging process by identifying markers for the aggresivity of a cancer, for example the presence in different areas of the body. The grading of the cancer describes 2o how closely a tumour resembles normal tissue of its same type and is assessed by its cell morphology and other markers of differentiation. The polynucleotides of the invention can be useful in determining the tumour grade as they can help in the determination of the differentiation status of the cells of a tumour.
25 The diagnostic assays offer a process for diagnosing or determining a susceptibility to cancers, autoimmune disease and related conditions through diagnosis by methods comprising determining from a sample derived from a subject an abnormally decreased or increased level of polypeptide or mRNA. This method of diagnosis is known as differential expression. The expression of a particular gene is compared between a 3o diseased tissue and a normal tissue. A difference between the polynucleotide-related gene, mRNA, or protein in the two tissues is compared, for example in molecular weight, amino acid or nucleotide sequence, or relative abundance, indicates a change in the gene, or a gene which regulates it, in the tissue of the human that was suspected of being diseased.
Decreased or increased expression can be measured at the RNA level. PolyA RNA
is first isolated from the two tissues and the detection of mRNA encoded by a gene corresponding to a differentially expressed polynucleotide of the invention can be detected by, for example, in situ hybridization in tissue sections, reverse trascriptase-PCR, using Northern blots containing poly A+ mRNA, or any other direct or inderect RNA detection method. An increased or decreased expression of a given RNA in a 1o diseased tissue compared to a normal tissue suggests that the transcript and/or the expressed protein has a role in the disease. Thus detection of a higher or lower level of mRNA
corresponding to SEQ ID NO 1 or 3 relative to normal level is indicative of the presence of cancer in the patient.
mRNA expression levels in a sample can be determined by generation of a library of expressed sequence tags (ESTs) from the sample. The relative representation of ESTs in the library can be used to assess the relative representation of the gene transcript in the starting sample. The EST analysis of the test can then be compared to the EST
analysis of a reference sample to determine the relative expression levels of the polynucleotide of interest.
Other mRNA analyses can be carried out using serial analysis of gene expression (SAGE) methodology (Velculescu et. Al. Science (1995) 270:484) , differential display methodology (For example, US 5,776,683) or hybridization analysis which relies on the specificity of nucleotide interactions.
Alternatively, the comparison could be made at the protein level. The protein sizes in the two tissues may be compared using antibodies to detect polypeptides in Western blots of protein extracts from the two tissues. Expression levels and subcellular localization may 3o also be detected immunologically using antibodies to the corresponding protein. Further assay techniques that can be used to determine levels of a protein, such as a polypeptide of the present invention, in a sample derived from a host are well-known to those of skill in the art. A raised or decreased level of polypeptide expression in the diseased tissue compared with the same protein expression level in the normal tissue indicates that the expressed protein may be involved in the disease.
In the assays of the present invention, the diagnosis can be determined by detection of gene product expression levels encoded by at least one sequence set forth in SEQ ID
NOS: 1 or 3.
A comparison of the mRNA or protein levels in a diseased versus normal tissue may also be used to follow the progression or remission of a disease.
A large number of polynucleotide sequences in a sample can be assayed using 1o polynucleotide arrays. These can be used to examine differential expression of genes and to determine gene function. For example, arrays of the polynucleotide sequences SEQ ID NO:
1 or 3 can be used to determine if any of the polynucleotides are differentially expressed between a normal and cancer cell. In one embodiment of the invention, an array of oligonucleotides probes comprising the SEQ ID NO: 1 or 3 nucleotide sequence or 15 fragments thereof can be constructed to conduct efficient screening of e.g., genetic mutations. Array technology methods are well known and have general applicability and can be used to address a variety of questions in molecular genetics including gene expression, genetic linkage, and genetic variability (see for example: M.Chee et aL, Science, Vol 274, pp 610-613 (1996)).
"Diagnosis" as used herein includes determination of a subject's susceptibility to a disease, determination as to whether a subject presently has the disease, and also the prognosis of a subject affected by the disease.
The present invention, further relates to a diagnostic kit for performing a diagnostic assay which comprises:
(a) a polynucleotide of the present invention, preferably the nucleotide sequence of SEQ
ID NO: 1 or 3, or a fragment thereof ;
(b) a nucleotide sequence complementary to that of (a);
(c) a polypeptide of the present invention, preferably the polypeptide of SEQ
ID NO: 2 or 4, or a fragment thereof; or (d) an antibody to a polypeptide of the present invention, preferably to the polypeptide of SEQ ID N0:2 or 4.

The nucleotide sequences of the present invention are also valuable for chromosomal localisation. The sequence is specifically targeted to, and can hybridize with, a particular location on an individual human chromosome. The mapping of relevant sequences to chromosomes according to the present invention is an important first step in correlating those sequences with gene associated disease. Once a sequence has been mapped to a precise chromosomal location; the physical position of the sequence on the chromosome can be correlated with genetic map data. Such data are found in, for example, V.
McKusick, Mendelian Inheritance in Man (available on-line through Johns Hopkins University Welch 1o Medical Library). The relationship between genes and diseases that have been mapped to the same chromosomal region are then identified through linkage analysis (coinheritance of physically adjacent genes).The differences in the cDNA or genomic sequence between affected and unaffected individuals can also be determined.
15 The polypeptides of the invention or their fragments or analogs thereof, or cells expressing them, can also be used as immunogens to produce antibodies immunospecific for polypeptides of the present invention. The term "immunospecific" means that the antibodies have substantially greater affinity for the polypeptides of the invention than their affinity for other related polypeptides in the prior art.
In a further aspect the invention provides an antibody immunospecific for a polypeptide according to the invention or an immunological fragment thereof as hereinbefore defined.
Preferably the antibody is a monoclonal antibody Antibodies generated against polypeptides of the present invention may be obtained by administering the polypeptides or epitope-bearing fragments, analogs or cells to an animal, preferably a non-human animal, using routine protocols. For preparation of monoclonal antibodies, any technique which provides antibodies produced by continuous cell line cultures can be used. Examples include the hybridoma technique (Kohler, G. and Milstein, C., Nature (1975) 256:495-497), the trioma technique, the human B-cell hybridoma technique (Kozbor et al., Immunology Today (1983) 4:72) and the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, 77-96, Alan R. Liss, Inc., 1985).

Techniques for the production of single chain antibodies, such as those described in U.S.
Patent No. 4,946,778, can also be adapted to produce single chain antibodies to polypeptides of this invention. Also, transgenic mice, or other organisms, including other mammals, may be used to express humanized antibodies.
The above-described antibodies may be employed to isolate or to identify clones expressing the polypeptide or to purify the polypeptides by affinity chromatography.
The antibody of the invention may also be employed to prevent or treat cancer, particularly ovarian and colon cancer, autoimmune disease and related conditions.
Another aspect of the invention relates to a method for inducing or modulating an immunological response in a mammal which comprises inoculating the mammal with a polypeptide of the present invention, adequate to produce antibody and/or T
cell immune response to protect or ameliorate the symptoms or progression of the disease.
Yet another aspect of the invention relates to a method of inducing or modulating immunological response in a mammal which comprises, delivering a polypeptide of the present invention via a vector directing expression of the polynucleotide and coding for the polypeptide in vivo in order to induce such an immunological response to produce 2o antibody to protect said animal from diseases.
It will be appreciated that the present invention therefore provides a method of treating abnormal conditions such as, for instance, cancer and autoimmune diseases, in particular, ovarian and colon cancer, related to either a presence of, an excess of, or an under-expression of, CASB612 polypeptide activity.
The present invention further provides for a method of screening compounds to identify those which stimulate or which inhibit the function of the CASB612 polypeptide. In general, agonists or antagonists may be employed for therapeutic and prophylactic purposes 3o for such diseases as hereinbefore mentioned. Compounds may be identified from a variety of sources, for example, cells, cell-free preparations, chemical libraries, and natural product mixtures. Such agonists, antagonists or inhibitors so-identified may be natural or modified substrates, ligands, receptors, enzymes, etc., as the case may be, of the polypeptide; or may be structural or functional mimetics thereof (see Coligan et al., Current Protocols in Immunology 1(2):Chapter S (1991)). Screening methods will be known to those skilled in the art. Further screening methods may be found in for example D. Bennett et al., J Mol Recognition, 8:52-58 (1995); and K. Johanson et al., J Biol Chem, 270(16):9459-(1995) and references therein.
Thus the invention provides a method for screening to identify compounds which stimulate or which inhibit the function of the polypeptide of the invention which comprises a method selected from the group consisting of l0 (a) measuring the binding of a candidate compound to the polypeptide (or to the cells or membranes bearing the polypeptide) or a fusion protein thereof by means of a label directly or indirectly associated with the candidate compound;
(b) measuring the binding of a candidate compound to the polypeptide (or to the cells or membranes bearing the polypeptide) or a fusion protein thereof in the presense of a 15 labeled competitior;
(c) testing whether the candidate compound results in a signal generated by activation or inhibition of the polypeptide, using detection systems appropriate to the cells or cell membranes bearing the polypeptide;
(d) mixing a candidate compound with a solution containing a polypeptide of claim 1, to 20 form a mixture, measuring activity of the polypeptide in the mixture, and comparing the activity of the mixture to a standard; or (e) detecting the effect of a candidate compound on the production of mRNA
encoding said polypeptide and said polypeptide in cells, using for instance, an ELISA
assay.
The polypeptide of the invention may be used to identify membrane bound or soluble receptors, if any, through standard receptor binding techniques known in the art. Well known screening methods may also be used to identify agonists and antagonists of the polypeptide of the invention which compete with the binding of the polypeptide of the invention to its receptors, if any.
Thus, in another aspect, the present invention relates to a screening kit for identifying agonists, antagonists, ligands, receptors, substrates, enzymes, etc. for polypeptides of the present invention; or compounds which decrease or enhance the production of such polypeptides, which comprises:
(a) a polypeptide of the present invention;
(b) a recombinant cell expressing a polypeptide of the present invention;
(c) a cell membrane expressing a polypeptide of the present invention; or (d) antibody to a polypeptide of the present invention;
which polypeptide is preferably that of SEQ ID N0:2.
It will be readily appreciated by the skilled artisan that a polypeptide of the present 1o invention may also be used in a method for the structure-based design of an agonist, antagonist or inhibitor of the polypeptide, by:
(a) determining in the first instance the three-dimensional structure of the polypeptide;
(b) deducing the three-dimensional structure for the likely reactive or binding sites) of an agonist, antagonist or inhibitor;
15 (c) synthesing candidate compounds that are predicted to bind to or react with the deduced binding or reactive site; and (d) testing whether the candidate compounds axe indeed agonists, antagonists or inhibitors.
2o Gene therapy may also be employed to effect the endogenous production of polypeptide by the relevant cells in the subject. For an overview of gene therapy, see Chapter 20, Gene Therapy and other Molecular Genetic-based Therapeutic Approaches, (and references cited therein) in Human Molecular Genetics, T Strachan and A P
Read, BIOS Scientific Publishers Ltd (1996).
Vaccine preparation is generally described in Pharmaceutical Biotechnology, Vo1.61 Vaccine Design - the subunit and adjuvant approach, edited by Powell and Newman, Plenurn Press, 1995. New Trends and Developments in Vaccines, edited by Voller et al., University Park Press, Baltimore, Maryland, U.S.A. 1978. Encapsulation within 3o liposomes is described, for example, by Fullerton, U.S. Patent 4,235,877.
Conjugation of proteins to macromolecules is disclosed, for example, by Likhite, U.S. Patent 4,372,945 and by Armor et al., U.S. Patent 4,474,757.

The amount of protein in each vaccine dose is selected as an amount which induces an immunoprotective response without significant, adverse side effects in typical vaccinees.
Such amount will vary depending upon which specific immunogen is employed.
Generally, it is expected that each dose will comprise 1-1000p,g of protein, preferably 2-100p,g, most preferably 4-40pg. An optimal amount for a particular vaccine can be ascertained by standard studies involving observation of antibody titres and other responses in subjects. Following an initial vaccination, subjects may receive a boost in about 4 weeks.
"Isolated" means altered "by the hand of man" from the natural state. If an "isolated"
composition or substance occurs in nature, it has been changed or removed from its original environment, or both. For example, a polynucleotide or a polypeptide naturally present in a living animal is not "isolated," but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is "isolated", as the term is employed herein.
"Polynucleotide" generally refers to any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA including single and double stranded regions.
"Variant" refers to a polynucleotide or polypeptide that differs from a reference polynucleotide or polypeptide, but retains essential properties. A typical variant of a polynucleotide differs in nucleotide sequence from another, reference polynucleotide.
Changes in the nucleotide sequence of the variant may or may not alter the amino acid sequence of a polypeptide encoded by the reference polynucleotide. Nucleotide changes may result in amino acid substitutions, additions, deletions, fusions and truncations in the polypeptide encoded by the reference sequence, as discussed below. A typical variant of a polypeptide differs in amino acid sequence from another, reference polypeptide.
Generally, differences are limited so that the sequences of the reference polypeptide and 3o the variant are closely similar overall and, in many regions, identical. A
variant and reference polypeptide may differ in amino acid sequence by one or more substitutions, additions, deletions in any combination. A substituted or inserted amino acid residue may or may not be one encoded by the genetic code. A variant of a polynucleotide or polypeptide may be a naturally occurnng such as an allelic variant, or it may be a variant that is not known to occur naturally. Non-naturally occurnng variants of polynucleotides and polypeptides may be made by mutagenesis techniques or by direct synthesis.
"Identity," as known in the art, is a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences. In the art, "identity" also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences. "Identity" and "similarity" can be readily calculated by known 1o methods, including but not limited to those described in (Computational Molecular Biology, Lesk, A.M., ed., Oxford University Press, New York, 1988;
Biocomputing:
Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993;
Computer Analysis of Sequence Data, Part I, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J.
Applied Math., 48: 1073 (1988). Preferred methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Preferred computer 2o program methods to determine identity and similarity between two sequences include, but are not limited to, the GCG program package (Devereux, J., et al., Nucleic Acids Research 12(1): 387 (1984)), BLASTP, BLASTN, and FASTA (Atschul, S.F. et al., J.
Molec. Biol. 21 S: 403-410 (1990). The BLAST X program is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al., NCBI NLM NIH
Bethesda, MD 20894; Altschul, S., et al., J. Mol. Biol. 215: 403-410 (1990). The well known Smith Waterman algorithm may also be used to determine identity.
The preferred algorithm used is FASTA. The preferred parameters for polypeptide or polynuleotide sequence comparison using this algorithm include the following:
3o Gap Penalty: l2 Gap extension penalty: 4 Word size: 2, max 6 Preferred parameters for polypeptide sequence comparison with other methods include the following:
1) Algorithm: Needleman and Wunsch, J. Mol Biol. 48: 443-453 (1970) Comparison matrix: BLOSSUM62 from Hentikoff and Hentikoff, Proc. Natl. Acad.
Sci.
USA. 89:10915-10919 (1992) Gap Penalty: 12 Gap Length Penalty: 4 A program useful with these parameters is publicly available as the "gap"
program from 1o Genetics Computer Group, Madison WI. The aforementioned parameters are the default parameters for polypeptide comparisons (along with no penalty for end gaps).
Preferred parameters for polynucleotide comparison include the following:
1) Algorithm: Needleman and Wunsch, J. Mol Biol. 48: 443-453 (1970) Comparison matrix: matches = +10, mismatch = 0 Gap Penalty: 50 Gap Length Penalty: 3 A program useful with these parameters is publicly available as the "gap"
program from 2o Genetics Computer Group, Madison WI. The aforementioned parameters are the default parameters for polynucleotide comparisons.
By way of example, a polynucleotide sequence of the present invention may be identical to the reference sequence of SEQ ID NO:l, that is be 100% identical, or it may include up to a certain integer number of nucleotide alterations as compared to the reference sequence. Such alterations are selected from the group consisting of at least one nucleotide deletion, substitution, including transition and transversion, or insertion, and wherein said alterations may occur at the 5' or 3' terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either 3o individually among the nucleotides in the reference sequence or in one or 'more contiguous groups within the reference sequence. The number of nucleotide alterations is determined by multiplying the total number of nucleotides in SEQ ID NO:1 by the numerical percent of the respective percent identity(divided by 100) and subtracting that product from said total number of nucleotides in SEQ ID NO:1, or:
nn ~ xn - (xn' Y) wherein nn is the number of nucleotide alterations, xn is the total number of nucleotides in SEQ ID NO:1, and y is, for instance, 0.70 for 70%, 0.80 for 80%, 0.85 for 85%, 0.90 for 90%, 0.95 for 95%,etc., and wherein any non-integer product of xn and y is rounded down to the nearest integer prior to subtracting it from xn. Alterations of a polynucleotide sequence encoding the polypeptide of SEQ ID N0:2 may create nonsense, missense or frameshift mutations in this coding sequence and thereby alter the 1o polypeptide encoded by the polynucleotide following such alterations.
Similarly, a polypeptide sequence of the present invention may be identical to the reference sequence of SEQ ID N0:2, that is be 100% identical, or it may include up to a certain integer number of amino acid alterations as compared to the reference sequence such that the % identity is less than 100%. Such alterations are selected from the group consisting of at least one amino acid deletion, substitution, including conservative and non-conservative substitution, or insertion, and wherein said alterations may occur at the amino- or carboxy-terminal positions of the reference polypeptide sequence or anywhere between those terminal positions, interspersed either individually among the amino acids 2o in the reference sequence or in one or more contiguous groups within the reference sequence. The number of amino acid alterations for a given % identity is determined by multiplying the total number of amino acids in SEQ ID N0:2 by the numerical percent of the respective percent identity(divided by 100) and then subtracting that product from said total number of amino acids in SEQ ID N0:2, or:
naSxa - (xa ~ Y) wherein na is the number of amino acid alterations, xa is the total number of amino acids in SEQ ID N0:2, and y is, for instance 0.70 for 70%, 0.80 for 80%, 0.85 for 85% etc., and wherein any non-integer product of xa and y is rounded down to the nearest integer prior to subtracting it from xa.

"Homolog" is a generic term used in the art to indicate a polynucleotide or polypeptide sequence possessing a high degree of sequence relatedness to a subject sequence. Such relatedness may be quntified by determining the degree of identity and/or similarity between the sequences being compared as hereinbefore described. Falling within this generic term are the terms "ortholog", meaning a polynucleotide or polypeptide that is the functional equivalent of a polynucleotide or polypeptide in another species and "paralog"
meaning a functionally similar sequence when considered within the same species.

EXAMPLES
Example 1 Real-time RT-PCR analysis Real-time RT-PCR (LT. Gibson. 1996. Genome Research: 6,996) is used to compare mRNA transcript abundance of the candidate antigen in tumour and normal colon tissues from multiple patients. In addition, mRNA levels of the candidate gene are re-evaluated by this approach in a panel of normal tissues.
Total RNA is extracted from snap frozen colon tissue biopsies using TriPure reagent (Boehringer). Total RNA from normal tissues is from InVitrogen as above. Poly-A+
to mRNA is purified from total RNA after DNAase treatment using oligo-dT
magnetic beads (Dynal). Quantification of the mRNA is performed by spectrofluorimetry (BioRad) using SybrII dye (Molecular Probes). Primers for amplification are designed with the Perkin-Elmer Primer Express software using default options for TaqMan amplification conditions.
15 Real-time reactions are assembled according to standard PCR protocols using 2 ng of purified mRNA for each reaction. SybrI dye (Molecular Probes) is added at a final dilution of 1/75000 for real-time detection. Amplification (40 cycles) and real-time detection is performed in a PE 7700 system. Ct values are calculated using the Sequence Detector software for the tumour (CtT) and normal (CtN) samples of each 2o patient. The difference between Ct values (CtN-CtT) is a direct measure of the difference in transcript levels between the tumour and normal tissues. As Ct values are log-linearly related to copy number and that the efficiency of PCR amplification under the prevailing experimental conditions is close to the theoretical amplification efficiency, 2 ~~tN-ccT> is an estimate of the relative transcript levels in the two tissues (i.e. fold mRNA
over-25 expression in tumor).The percentage of over-expressing patients and the average level of mRNA over-expression in the tumours of these patients is calculated from the data set of 6 patients (duplicate measures).
TABLE 3:
Patients over-expressing CASB612Average level of over-expression in colon tumours in colon tumours (%) (fold) Table 4: Real-time RT-PCR Ct values for CASB612 in 6 paired colon samples NIT NIT NIT NIT NIT NIT

experiment 1 37/32.531.5/29.530/24.527/29.533.5%2727.5/25 Ct CtN-CtT 4.5 2 5.5 -2.5 6.5 2.5 experiment 2 32/30 30/27.527.5/23.525.5/2730.5/2626.5/23.5 Ct CtN-CtT 2 2.5 4 -1.5 4.5 3 N: normal colon T: colon tumor Example 2 Identification of the full length cDNA sequence 1 o Colon tumour cDNA libraries are constructed using the Lambda Zap system (Stratagene) from 2 pg of polyA+ mRNA as described in the supplied protocol. 1.5 x106 independent phage are plated for each screening of the library. Phage plaques are transferred onto nylon filters, hybridised using a cDNA probe labelled with AlkPhos Direct (Amersham Pharmacia) and positive phage are detected by chemiluminescence. The positive phage are 15 excised from the agar plat, eluted in SOOp.I SM buffer and confirmed by gene-specific PCR.
Eluted phage are converted to single strand M13 bacteriophage by in vivo excision. The bacteriophage is then converted to double strand plasmid DNA by infection of E. coli.
Infected bacteria are plated and submitted to a second round of screening with the cDNA
probe. Plasmid DNA is purified from positive bacterial clones and submitted to Southern 2o blot analysis to estimated the size of the cDNA inserts. CDNA inserts from multiple independent clones are sequenced on both strands.
When the full length gene cannot be obtained directly from the cDNA library, missing sequence is isolated using RACE technology (Marathon Kit, ClonTech.). This approach 25 relies on reverse transcribing mRNA into double strand cDNA, ligating linkers onto the ends of the cDNA and amplifying the desired extremity of the cDNA using a gene-specific primer and one of the linker oligonucleotides. Marathon PCR products are cloned into a plasmid and sequenced.
3o Example 3:
3.1 Expression and purification of tumour-specific antigens Expression in microbial hosts is used to produce the antigen of the invention for vaccine purposes and to produce protein fragments or whole protein for rapid purification and generation of antibodies needed for characterization of the naturally expressed protein by immunohistochemistry or for follow-up of purification.
Recombinant proteins may be expressed in two microbial hosts, E. coli and in yeast (such as Saccharomyces cerevisiae or Pichia pastoris). This allows the selection of the expression system with the best features for this particular antigen production. In general, the recombinant antigen will be expressed in E. coli and the reagent protein expressed in yeast.
1o The expression strategy first involves the design of the primary structure of the recombinant antigen. In general an expression fusion partner (EFP) is placed at the N
terminal extremity to improve levels of expression that could also include a region useful for modulating the immunogenic properties of the antigen, an immune fusion partner (IFP). In addition, an affinity fusion partner (AFP ) useful for facilitating further 15 purification is included at the C-terminal end.
When the recombinant strains are available, the recombinant product is characterized by the evaluation of the level of expression and the prediction of further solubility of the protein by analysis of the behavior in the crude extract.
After growth on appropriate culture medium and induction of the recombinant protein 20 expression, total extracts are analyzed by SDS-PAGE. The recombinant proteins are visualized in stained gels and identified by Western blot analysis using specific antibodies.
A comparative evaluation of the different versions of the expressed antigen will allow the selection of the most promising candidate that is to be used for further purification and 25 immunological evaluation.
The purification work follows a classical approach based on the presence of an His affinity tail in the recombinant protein. In a typical experiment the disrupted cells are filtered and the acellular extracts loaded onto an Ion Metal Affinity Chromatography (IMAC; Ni~NTA from Qiagen) that will specifically retain the recombinant protein.
3o The retained proteins are eluted by 0-500 mM Imidazole gradient (possibly in presence of a detergent) in a phosphate buffer. This step is optimally followed by an Anion Exchange resin step and a Size Exclusion chromatography step depending on the success of the Imac step and the nature of the contaminants.

3.2 Antibody production and immunohistochemistry Small amounts of relatively purified protein can be used to generate immunological tools in order to a) detect the expression by immunohistochemistry in normal or cancer tissue sections;
b) detect the expression, and to follow the protein during the purification process (ELISA/ Western Blot); or c) characterise/ quantify the purified protein (ELISA).
to 3.2.1 Polyclonal antibodies:
Immuni~atinn 2- 3 Rabbits are immunized , intramuscularly (LM.) , 3 times at 3 weeks intervals with 100ug of protein, formulated in the adjuvant 3D-MPL/QS21 . 3 weeks after each immunisation a blood sample is taken and the antibody titer estimated in the serum by t5 ELISA using the protein as coating antigen following a standard protocol.
ELISA
96 well microplates (maxisorb Nunc) are coated with Sp,g of protein overnight at 4°C.
After lhour saturation at 37°C with PBS NCS 1%, serial dilution of the rabbit sera is 2o added for 1H 30 at 37°C (starting at 1/10). After 3 washings in PBS
Tween, anti rabbit biotinylated anti serum (Amersham ) is added (1/5000). Plates are washed and peroxydase coupled streptavidin (1/5000) is added for 30 min at 37°C.
After washing, 501 TMB (BioRad) is added for 7 min and the reaction then stopped with HzS04 0.2M.
The OD can be measured at 450 nm and midpoint dilutions calculated by SoftmaxPro.
3.2.2 Monoclonal antibodies:
Immuni~atinn 5 BALB/c mice are immunized 3 times at 3 week intervals with S ~.g of purified protein.
Bleedings are performed 14 days post II and 1 week post 3. The sera is tested by Elisa on purified protein used as coated antigen. Based on these results (midpoint dilution >
10000 ) one mouse is selected for fusion Fu.cinnl H,4 Tcnlnrtinn Spleen cells are fused with the SP2/0 myeloma according to a standard protocol using PEG 40% and DMSO 5%. Cells are then seeded in 96 well plates 2.5 x104 - 105 cells/well and resistant clones will be selected in HAT medium. The supernatant of these hybridomas will be tested for their content in specific antibodies and when positive, will be submitted to 2 cycles of limited dilution . After 2 rounds of screening, 3 hybridomas will be chosen for ascitis production.
3.2.3 Immunohistochemistry When antibodies are available, immuno staining is performed on normal or cancer 1 o tissue sections, in order to determine ~ the level of expression of the protein antigen of the invention in cancer relative to normal tissue or ~ the proportion of cancers of a certain type expressing the antigen ~ if other cancer types also express the antigen ~ the proportion of cells expressing the antigen in a cancer tissue ~ the cellular localisation of the antigen Tissue sample preparation After dissection, the tissue sample is mounted on a cork disk in OCT compound and rapidly frozen in isopentane previously super cooled in liquid nitrogen (-160°C). The block will then be conserved at -70°C until use. 7-10~,m sections will be realized in a cryostat chamber (-20, -30°C).
Staining Tissue sections are dried for 5 min at room Temperature (RT), fixed in acetone for l Omin at RT,dried again, and saturated with PBS 0.5% BSA 5% serum. After 30 min at RT either a direct or indirect staining is performed using antigen specific antibodies. A
direct staining leads to a better specificity but a less intense staining whilst an indirect staining leads to a more intense but less specific staining.
3.3 Analysis of human cellular immune responses to the antigen of the invention The immunological relevance of the antigen of the invention can be assessed by in vitro priming of human T cells. All T cell lymphocyte lines and dendritic cells are derived from PBMCs (peripheral blood mononuclear cells) of healthy donors (preferred subtype). An HLA-A2.1lKb transgenic mice is also used for screening of HLA-A2.1 peptides.
Newly discovered antigen-specific CD8+ T cell lines are raised and maintained by weekly in vitro stimulation. The lytic activity and the y-IFN production of the CD8 lines in response to the antigen or antigen derived-peptides is tested using standard procedures.
to Two strategies to raise the CD8+ T cell lines are used: a peptide-based approach and a whole gene-based approach. Both approaches require the full-length cDNA of the newly discovered antigen in the correct reading frame to be either cloned in an appropriate delivery system or to be used to predict the sequence of HLA binding peptides.
15 Peptide-based approach The HLA-A2 binding peptide sequences are predicted by the Parker's algorithm.
Peptides are then screened in the HLA-A2.1/Kb transgenic mice model (Vitiello et al.).
Briefly, transgenic mice are immunized with adjuvanted HLA-A2 peptides, those unable to induce a CD8 response (as defined by an efficient lysis of peptide-pulsed autologous 2o spleen cells) will be further analyzed in the human system.
Human dendritic cells (cultured according to Romani et al.) will be pulsed with peptides and used to stimulated CD8-sorted T cells (by Facs). After several weekly stimulations, the CD8 lines will be first tested on peptide-pulsed autologous BLCL (EBV-B
transformed cell lines). To verify the proper in vivo processing of the peptide, the CD8 25 lines will be tested on cDNA-transfected tumour cells (HLA-A2 transfected LnCaP, Skov3 or CAMA tumour cells).
Whole gene-based approach CD8+ T cell lines will be primed and stimulated with either gene-gun transfected 3o dendritic cells, retrovirally transduced B7.1-transfected fibroblastes, recombinant pox virus (Kim et al.) or adenovirus (Butterfield et al.) infected dentridic cells. Virus infected cells are very efficient to present antigenic peptides since the antigen is expressed at high level but can only be used once to avoid the over-growth of viral T cells lines.

After alternated stimulations, the CD8 lines are tested on cDNA-transfected tumour cells as indicated above. Peptide specificity and identity is determined to confirm the immunological validation.
References Vitiello et al. (L. Sherman), J. Exp. Med., J. Exp. Med, 1991, 173:1007-1015.
Romani et al., J. Exp. Med., 1994, 180:83-93.
Kim et al., J. Immunother., 1997, 20:276-286.
1o Butterfield et al., J. Immunol., 1998, 161:5607-5613.
All publications, including but not limited to patents and patent applications, cited in this specification are herein incorporated by reference as if each individual publication were specifically and individually indicated to be incorporated by reference herein as though ~ s fully set forth.

SEQUENCE INFORMATION
SEQ ID NO:1 GAACCCCGCCGCGCGCGCTTTGAATTTCCCAGCCGCTAAGCGCCTCTCCTGGTCGGTGTCCCAGGCAGAAAGGTGCAGA
G
ACCCATCTGACGCAGGACTCCAGGTAGACAAGCTCCAGCAGAGAGTGGCCAGatgtggtgcctggagcgactccgcttg g gtcctgagtgccttcggcggagcggagactggcttctcccgggtcgggcccgcggagccaagtctcgcaccaccgccgc g tgcgcaaatgtgctcactccggaccgcatccctgagttctgcatcccgccacggctcatgccccgcctggccttggctg c gctccggaattcttgggtcgaagaagcagggatggacgagggcgccggccgcacagactgggacccgcgctcgcaggcc g cgctgtcactgccgcacctgccccgtgtgcgcaccgcctacggcttctgcgcgctgctcgagagcccgcacacgcgccg c aaggagtcgctcctgctcgggggcccgcccgcgccccggccccgggcccacacctacggcggcggcggcggcccggacg c ccycctggggaccctgygcgkcccgcgaggtccgggcccggccacccccgcggcccccggcggtccccgcctgccccag g acgcgctcgctgcggggccccgccgctgccgcctcctgcgcgtccccgacgggctgctgagtcgcgcgctgcgggctgg a aggagtcgccgcctggcccgcgtccgctccgtctccagcgggaacgaggacgaggagcgccgcgcgggatccgagtccc c ggcccgggccccctcctcgagcccgctgtcatccagggccccgcttcctgagcgcctggaggccaagggcaccgtggct c tgggccgcgccggcgacgccctgcgcctggctgctgagtactgtccgggaacccggcgtctccgcctccggctgctccg c gcggagagcctggtcggaggcgcccccgggccccgcgccgtccgctgccgcctcagcctcgtcctgcggccgccgggca c ygcgcktyggcaatgcagcrctgtggtggggcgcagccgcaaggcctcctttgaccaggacttttgcttcgacggcctc t cggaagacgaggtgcgccgcctggccgttcgcgtcaaggcccgggatgagggtcgcggccgggatcggggccgcctgct g ggccagggtgagctgtccctgggcgccctcctgctgctctgaGGGCCCAGCCCTCCCCGGGGCGCTCTGCCCTGGAGAC
T
CCGGACACTGACAGCCGCGTGGTACAGAATAAACGTTATTTATTTTTTTATTTATGATACTGCTTTATTGACGTTTTAC
T
TCCTCACCATCCACATTTGTCATCGTCTRTTGGTAAAGAAGAAAAAGATAATGACTCCCTGTTCTGTTCACAGGACCCC
C
ATATCTCTTTCCAGACCATTTTTGCATTCCAAGGAAAAATGGGTTGGCTTGGGACTGGGAGAGAAAGGAAGTACACCCA
T
CTGCATTGTTT
SEQ ID N0:2 MWCLERLRLGPECLRRSGDWLLPGRARGAKSRTTAACANVLTPDRIPEFCIPPRLMPRLALAALRNSWVEEAGMDEGAG
R

TDWDPRSQAALSLPHLPRVRTAYGFCALLESPHTRRKESLLLGGPPAPRPRAHTYGGGGGPDAXLGTLXXPRGPGPATP
A
APGGPRLPQDALAAGPRRCRLLRVPDGLLSRALRAGRSRRLARVRSVSSGNEDEERRAGSESPARAPSSSPLSSRAPLP
E
RLEAKGTVALGRAGDALRLAAEYCPGTRRLRLRLLRAESLVGGAPGPRAVRCRLSLVLRPPGTAXXQCSXVVGRSRKAS
F
SEQ ID N0:3 GCGGGGCCCCGCCGCTGCCGCATCCTGCGCGTCCCCGACGGGCTGCTGAGTCGCGCGCTGCGGGCTGGAAGGAGTCGCC
G
CCTGGCCCGCGTCCGCTCCGTCTCCAGCGGGAACGAGGACGAGGAGCGCCGCGCGGGATCCGAGTCCCCGGCCCGGGCC
C
CCTCCTCGAGCCCGCTGTCATCCAGGGCCCCGCTTCCTGAGCGCCTGGAGGCCAAGGGCACCGTGGCTCTGGGCCGCGC
C
GGCGACGCCCTGCGCCTGGCTGCTGAGTACTGTCCGGGAACCCGGCGTCTCCGCCTCCGGCTGCTCCGCGCGGAGAGCC
T
GGTCGGAGGCGCCCCCGGGCCCCGCGCAGTCCGCTGCCGCCTCA
SEQ ID N0:4 AGPRRCRILRVPDGLLSRALRAGRSRRLARVRSVSSGNEDEERRAGSESPARAPSSSPLSSRAPLPERLEAKGTVALGR
A
GDALRLAAEYCPGTRRLRLRLLRAESLVGGAPGPRAVRCRL

SEQUENCE LISTING
<110> SmithKline Beecham Biologicals S.A.
<120> Novel Compounds <130> BC45216 <160> 4 <170> FastSEQ for Windows Version 3.0 <210> 1 <211> 1531 <212> DNA
<213> homo sapiens <400>

gaaccccgccgcgcgcgctttgaatttcccagccgctaagcgcctctcctggtcggtgtc60 ccaggcagaaaggtgcagagacccatctgacgcaggactccaggtagacaagctccagca120 gagagtggccagatgtggtgcctggagcgactccgcttgggtcctgagtgccttcggcgg180 agcggagactggcttctcccgggtcgggcccgcggagccaagtctcgcaccaccgccgcg240 tgcgcaaatgtgctcactccggaccgcatccctgagttctgcatcccgccacggctcatg300 ccccgcctggccttggctgcgctccggaattcttgggtcgaagaagcagggatggacgag360 ggcgccggccgcacagactgggacccgcgctcgcaggccgcgctgtcactgccgcacctg420 ccccgtgtgcgcaccgcctacggcttctgcgcgctgctcgagagcccgcacacgcgccgc480 aaggagtcgctcctgctcgggggcccgcccgcgccccggccccgggcccacacctacggc540 ggcggcggcggcccggacgcccycctggggaccctgygcgkcccgcgaggtccgggcccg600 gccacccccgcggcccccggcggtccccgcctgccccaggacgcgctcgctgcggggccc660 cgccgctgccgcctcctgcgcgtccccgacgggctgctgagtcgcgcgctgcgggctgga720 aggagtcgccgcctggcccgcgtccgctccgtctccagcgggaacgaggacgaggagcgc780 cgcgcgggatccgagtccccggcccgggccccctcctcgagcccgctgtcatccagggcc840 ccgcttcctgagcgcctggaggccaagggcaccgtggctctgggccgcgccggcgacgcc900 ctgcgcctggctgctgagtactgtccgggaacccggcgtctccgcctccggctgctccgc960 gcggagagcctggtcggaggcgcccccgggccccgcgccgtccgctgccgcctcagcctc1020 gtcctgcggccgccgggcacygcgcktyggcaatgcagcrctgtggtggggcgcagccgc1080 aaggcctcctttgaccaggacttttgcttcgacggcctctcggaagacgaggtgcgccgc1140 ctggccgttcgcgtcaaggcccgggatgagggtcgcggccgggatcggggccgcctgctg1200 ggccagggtgagctgtccctgggcgccctcctgctgctctgagggcccagccctccccgg1260 ggcgctctgccctggagactccggacactgacagccgcgtggtacagaataaacgttatt1320 tatttttttatttatgatactgctttattgacgttttacttcctcaccatccacatttgt1380 catcgtctrttggtaaagaagaaaaagataatgactccctgttctgttcacaggaccccc1440 atatctctttccagaccatttttgcattccaaggaaaaatgggttggcttgggactggga1500 gagaaaggaagtacacccatctgcattgttt 1531 <210> 2 <211> 320 <212> PRT
<213> homo sapiens <400> 2 Met Trp Cys Leu Glu Arg Leu Arg Leu Gly Pro Glu Cys Leu Arg Arg $5 1 5 10 15 Ser Gly Asp Trp Leu Leu Pro Gly Arg Ala Arg Gly Ala Lys Ser Arg Thr Thr Ala Ala Cys Ala Asn Val Leu Thr Pro Asp Arg Ile Pro Glu Phe Cys Ile Pro Pro Arg Leu Met Pro Arg Leu Ala Leu Ala Ala Leu Arg Asn Ser Trp Val Glu Glu Ala Gly Met Asp Glu Gly Ala Gly Arg Thr Asp Asp ArgSerGln AlaAla LeuSerLeuProHisLeu Trp Pro Pro Arg Arg AlaTyrGly PheCys AlaLeuLeuGluSerPro Val Thr His Thr Arg GluSerLeu LeuLeu GlyGlyProProAlaPro Arg Lys Arg Pro Ala ThrTyrGly GlyGly GlyGlyProAspAlaXaa Arg His Leu Gly Leu XaaProArg GlyPro GlyProAlaThrProAla Thr Xaa Ala Pro Gly ArgLeuPro GlnAsp AlaLeuAlaAlaGlyPro Gly Pro Arg Arg Arg LeuArgVal ProAsp GlyLeuLeuSerArgAla Cys Leu Leu Arg Gly SerArgArg LeuAla ArgValArgSerValSer Ala Arg Ser Gly Glu GluGluArg ArgAla GlySerGluSerProAla Asn Asp Arg Ala Ser SerProLeu SerSer ArgAlaProLeuProGlu Pro Ser Arg Leu Ala GlyThrVal AlaLeu GlyArgAlaGlyAspAla Glu Lys Leu Arg Ala GluTyrCys ProGly ThrArgArgLeuArgLeu Leu Ala Arg Leu Arg GluSerLeu ValGly GlyAlaProGlyProArg Leu Ala Ala Val Cys LeuSerLeu ValLeu ArgProProGlyThrAla Arg Arg Xaa Xaa Cys XaaValVal GlyArg SerArgLysAlaSerPhe Gln Ser <210> 3 <211> 364 <212> DNA

<213> homo sapiens <400> 3 gcggggcccc gtccccgacg ggctgctgag 60 gccgctgccg tcgcgcgctg catcctgcgc cgggctggaa gtccgctccg tctccagcgg 120 ggagtcgccg gaacgaggac cctggcccgc gaggagcgcc gcccgggccc cctcctcgag 180 gcgcgggatc cccgctgtca cgagtccccg tccagggccc gccaagggca ccgtggctct 240 cgcttcctga gggccgcgcc gcgcctggag ggcgacgccc tgtccgggaa cccggcgtct 300 tgcgcctggc ccgcctccgg tgctgagtac ctgctccgcg gcccccgggc cccgcgcagt 360 cggagagcct ccgctgccgc ggtcggaggc ctca 364 <210> 4 <211> 121 <212> PRT

<213> homo sapiens <400> 4 Ala Gly Arg CysArgIle LeuArg ValProAspGlyLeuLeu Pro Arg Ser Arg Leu AlaGlyArg SerArg ArgLeuAlaArgValArg Ala Arg Ser Val Ser AsnGluAsp Glu ArgArgAlaGlySerGlu Ser Gly Glu Ser Pro Arg ProSerSer Pro LeuSerSerArgAlaPro Ala Ala Ser Leu Pro Arg GluAlaLys Thr ValAlaLeuGlyArgAla Glu Leu Gly

Claims (31)

Claims
1. An isolated polypeptide comprising an amino acid sequence which has at least 70%
identity to the amino acid sequence of SEQ ID NO:2 over the entire length of of SEQ ID
NO:2.
2. An isolated polypeptide as claimed in claim 1 in which the amino acid sequence has at least 95% identity to SEQ ID NO:2.
3. The polypeptide as claimed in claim 1 comprising the amino acid sequence of SEQ ID
NO:2.
4. The isolated polypeptide of SEQ ID NO:2.
5. A polypeptide comprising an immunogenic fragment of a polypeptide as claimed in any one of claims 1 to 4 in which the immunogenic activity of the immunogenic fragment is substantially the same as the polypeptide of SEQ ID NO:2
6. An isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide that has at least 70% identity to the amino acid sequence of SEQ ID NO:2, over the entire length of SEQ ID NO:2; or a nucleotide sequence complementary to said isolated polynucleotide.
7. An isolated polynucleotide comprising a nucleotide sequence that has at least 70%
identity to a nucleotide sequence encoding a polypeptide of SEQ ID NO:2, over the entire coding region; or a nucleotide sequence complementary to said isolated polynucleotide.
8. An isolated polynucleotide which comprises a nucleotide sequence which has at least 70% identity to that of SEQ ID NO:1 over the entire length of SEQ ID NO:1; or a nucleotide sequence complementary to said isolated polynucleotide.
9. The isolated polynucleotide as defined in any one of claims 6 to 8 in which the identity is at least 95%.
10. An isolated polynucleotide selected from:
(a) a polynucleotide comprising a nucleotide sequence encoding the polypeptide of SEQ
ID NO:2;
(b) the polynucleotide of SEQ ID NO:1; and (c) a polynucleotide obtainable by screening an appropriate library under stringent hybridization conditions with a labeled probe having the sequence of SEQ ID
NO:1 or a fragment thereof;
or a nucleotide sequence complementary to said isolated polynucleotide
11. An expression vector or a recombinant live microorganism comprising an isolated polynucleotide according to any one of claims 6 - 10.
12. A host cell comprising the expression vector of claim 11 or a membrane thereof expressing the polypeptide of claim 1.
13. A process for producing a polypeptide of claim 1 comprising culturing a host cell of claim 12 under conditions sufficient for the production of said polypeptide and recovering the polypeptide from the culture medium.
14. A vaccine comprising an effective amount of the polypeptide of any one of claims 1 to 5 and a pharmaceutically acceptable carrier.
15. A vaccine comprising an effective amount of the polynucleotide of any one of claims 6 to 10 and a pharmaceutically effective carrier.
16. A vaccine comprising an effective amount of antigen presenting cells, modified by in vitro loading with a polypeptide of any one of claims 1 to 5, or genetically modified in vitro to express a polypeptide of claim 1 and a pharmaceutically effective carrier.
17. A vaccine as claimed in any one of claims 14 to 16 which additionally comprises a TH-1 inducing adjuvant.
18. A vaccine as claimed in claim 17 in which the TH-1 inducing adjuvant is selected from the group of adjuvants comprising: 3D-MPL, QS21, a mixture of QS21 and cholesterol, and a CpG oligonucleotide.
19. An antibody immunospecific for the polypeptide or immunological fragment as claimed in any one of claims 1 to 5.
20. A method for screening to identify compounds which stimulate or which inhibit the function of the polypeptide of any one of claims 1 to 5 which comprises a method selected from the group consisting of:
(a) measuring the binding of a candidate compound to the said polypeptide (or to the cells or membranes bearing the polypeptide) or a fusion protein thereof by means of a label directly or indirectly associated with the candidate compound;
(b) measuring the binding of a candidate compound to the said polypeptide (or to the cells or membranes bearing the polypeptide) or a fusion protein thereof in the presense of a labeled competitior;
(c) testing whether the candidate compound results in a signal generated by activation or inhibition of the said polypeptide, using detection systems appropriate to the cells or cell membranes bearing the polypeptide;
(d) mixing a candidate compound with a solution containing a polypeptide of any one of claims 1 to 5, to form a mixture, measuring activity of the polypeptide in the mixture, and comparing the activity of the mixture to a standard; or (e) detecting the effect of a candidate compound on the production of mRNA
encoding said polypeptide and said polypeptide in cells, using for instance, an ELISA
assay.
21. A method for the treatment of a subject by immunoprophylaxis or therapy comprising in vitro induction of immune responses to a molecule of any one of claims 1 to 5, using in vitro incubation of the polypeptide of any one of claims 1 to 5 or the polynucleotide of any one of claims 6 to 10 with cells from the immune system of a mammal, and reinfusing these activated immune cells to the mammal for the treatment of disease.
22. A method as claimed in claim 21 wherein the treatment is for ovarian or colon cancer.
23. An agonist or antagonist to the polypeptide of claims 1 to 5.
24. A compound which is:
(a) an agonist or antagonist to the polypeptide of claims 1 to 5;
(b) isolated polynucleotide of claims 6 to 10; or (c) a nucleic acid molecule that modulates the expression of the nucleotide sequence encoding the polypeptide of any one of claims 1 to 5;
for use in therapy.
25. A process for diagnosing a disease or a susceptibility to a disease in a subject related to expression or activity of a polypeptide of any one of claims 1 to 5 in a subject comprising analyzing for the presence or amount of said polypeptide in a sample derived from said subject.
26. A process for diagnosing a disease or a susceptibility to a disease in a subject related to expression or activity of a polynucleotide of any one of claims 6 to 10 in a subject comprising analyzing for the presence or amount of said polynucleotide in a sample derived from said subject.
27. A process for diagnosing the presence of colon cancer or a susceptibility to colon cancer in a subject related to expression or activity of a polypeptide of any one of claims 1 to 5 in a subject comprising analyzing for the presence or amount of said polypeptide in a sample derived from said subject.
28. A process for diagnosing the presence of colon cancer or a susceptibility to colon cancer in a subject related to expression or activity of a polynucleotide of any one of claims 6 to 10 in a subject comprising analyzing for the presence or amount of said polynucleotide in a sample derived from said subject.
29. An isolated polynucleotide selected form the group consisting of:

(a) an isolated polynucleotide comprising a nucleotide sequence which has at least 70%
identity to SEQ ID NO:3 over the entire length of SEQ ID NO:3;
(b) an isolated polynucleotide comprising the polynucleotide of SEQ ID NO:3;
(c) the polynucleotide of SEQ ID NO:3; or (d) an isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide which has at least 70% identity to the amino acid sequence of SEQ ID NO:4, over the entire length of SEQ ID NO:4.
30. A polypeptide selected from the group consisting of:
(a) a polypeptide which comprises an amino acid sequence which has at least 70%
identity to that of SEQ ID NO:4 over the entire length of SEQ ID NO:4;
(b) a polypeptide in which the amino acid sequence has at least 70% identity to the amino acid sequence of SEQ ID NO:4 over the entire length of SEQ ID NO:4;
(c) a polypeptide which comprises the amino acid of SEQ ID NO:4;
(d) a polypeptide which is the polypeptide of SEQ ID NO:4; or (e) a polypeptide which is encoded by a polynucleotide comprising the sequence contained in SEQ ID NO:3.
31. A live vaccine composition comprising an expression vector or recombinant live micro-organism according to claim 11.
CA002358899A 1999-01-20 2000-01-17 Polypeptide Abandoned CA2358899A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
GBGB9901256.9A GB9901256D0 (en) 1999-01-20 1999-01-20 Novel compounds
GB9901256.9 1999-01-20
PCT/EP2000/000347 WO2000043511A1 (en) 1999-01-20 2000-01-17 Polypeptide

Publications (1)

Publication Number Publication Date
CA2358899A1 true CA2358899A1 (en) 2000-07-27

Family

ID=10846214

Family Applications (1)

Application Number Title Priority Date Filing Date
CA002358899A Abandoned CA2358899A1 (en) 1999-01-20 2000-01-17 Polypeptide

Country Status (8)

Country Link
EP (1) EP1144633A1 (en)
JP (1) JP2002534978A (en)
CN (1) CN1344317A (en)
AU (1) AU2109200A (en)
CA (1) CA2358899A1 (en)
GB (1) GB9901256D0 (en)
HK (1) HK1045173A1 (en)
WO (1) WO2000043511A1 (en)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020160959A1 (en) * 2000-08-17 2002-10-31 Nicolette Charles A. Therapeutic compounds for ovarian cancer
US6861410B1 (en) 2002-03-21 2005-03-01 Chiron Corporation Immunological adjuvant compositions
EP3112375A1 (en) * 2015-07-03 2017-01-04 Ludwig-Maximilians-Universität München Antigenic peptides for the diagnosis, therapy monitoring and/or treatment of psoriasis vulgaris

Also Published As

Publication number Publication date
JP2002534978A (en) 2002-10-22
WO2000043511A1 (en) 2000-07-27
GB9901256D0 (en) 1999-03-10
CN1344317A (en) 2002-04-10
EP1144633A1 (en) 2001-10-17
HK1045173A1 (en) 2002-11-15
AU2109200A (en) 2000-08-07

Similar Documents

Publication Publication Date Title
AU766789B2 (en) Novel uses
EP1650221B1 (en) Novel compounds
US7470782B2 (en) CASB618 polynucleotides and polypeptides and their use
US6635255B1 (en) CASB414:antigen overexpressed in several tumors
CA2323760A1 (en) Human casb12 polypeptide, a serine protease
AU3430800A (en) Novel compounds
CA2358899A1 (en) Polypeptide
CA2323501A1 (en) Compounds related to pap-1
CA2387043A1 (en) Colon-tumour-associated antigens
CA2358697A1 (en) Polynucleotides and their applications in diagnostics
ZA200107445B (en) CASB618 polynucleotides and polypeptides and their use.

Legal Events

Date Code Title Description
FZDE Discontinued