CA2328061A1

CA2328061A1 - Novel compounds

Info

Publication number: CA2328061A1
Application number: CA002328061A
Authority: CA
Inventors: Joelle Thonnard
Original assignee: Individual
Current assignee: GlaxoSmithKline Biologicals SA
Priority date: 1998-05-12
Filing date: 1999-05-10
Publication date: 1999-11-18
Also published as: WO1999058562A3; EP1086127A1; AU4260199A; WO1999058562A2; GB9810193D0

Abstract

The invention provides BASB009 polypeptides and polynucleotides encoding BASB009 polypeptides and methods for producing such polypeptides by recombinant techniques. Also provided are diagnostic, prophylactic and therapeutic uses.

Description

WO 99/5$562 PCT/EP99/03262 Novel Compounds FIELD OF THE INVENTION
This invention relates to polynucleotides, (herein referred to as "BASB009 polynucleotide(s)"), polypeptides encoded by them (referred to herein as "BASB009" or "BASB009 polypeptide(s)"), recombinant materials and methods for their production. In another aspect, the invention relates to methods for using such polypeptides and polynucleotides, including vaccines against bacterial infections. In a further aspect, the invention relates to diagnostic assays for detecting infection of certain pathogens.

Moraxella catarrhalis (also named Branhamella catarrhalis) is a Gram negative bacteria frequently isolated from the human upper respiratory tract. It is responsible for several pathologies the main ones being otitis media in infants and children, and pneumonia in elderlies. It is also responsible of sinusitis, nosocomial infections and less frequently of invasive diseases.
Otitis media is an important childhood disease both by the number of cases and its potential sequelae. More than 3.5 millions cases are recorded every year in the United States, and it is estimated that 80 % of the children have experienced at least one episode of otitis before reaching the age of 3 (Klein, JO ( 1994) Clin.Inf:Dis 19:823). Left untreated, or becoming chronic, this disease may lead to hearing losses that could be temporary (in the case of fluid accumulation in the middle ear) or permanent (if the auditive nerve is damaged). In infants, such hearing losses may be responsible for a delayed speech learning.
Three bacterial species are primarily isolated from the middle ear of children with otitis media: Streptococcus pneumoniae, non typeable Haemophilus influenzae (NTIii) and M.
catarrhalis. They are present in 60 to 90 % of the cases. A review of recent studies shows that S. pneumoniae and NTHi represent both about 30 %, and M. catarrhalis about 15 % of the otitis media cases (Murphy, TF (1996) Microbiol.Rev. 60:267). Other bacteria could be isolated from the middle ear (H, in~luenzae type B, S. pyogenes etc) but at a much lower frequency (2 % of the cases or less).
Epidemiological data indicate that, for the pathogens found in the middle ear, the colonization of the upper respiratory tract is an absolute prerequisite for the development of an otitis; other are however also required to Iead to the disease (Dickinson, DP et al. (1988) J. Infect.Dis. 158:205, Faden, HL et al. (1991) Ann.Otorhinol.Laryngol.
100:612). These are important to trigger the migration of the bacteria into the middle ear via the Eustachian tubes, followed by the initiation of an inflammatory process. These factors are unknown todate. It has been postulated that a transient anomaly of the immune system following a viral infection, for example, could cause an inability to control the colonization of the respiratory tract (Faden, HL et al (1994) J. Infect.Dis. 169:1312). An alternative explanation is that the exposure to environmental factors allow a more important colonization of some children, who subsequently become susceptible to the development of otitis media because of the sustained presence of middle ear pathogens (Murphy, TF (1996) Microbiol.Rev.
60:267).
The immune response to M. catarrhalis is poorly characterized. The analysis of strains isolated sequentially from the nasopharynx of babies followed from 0 to 2 years of age, indicates that they get and eliminate frequently new strains. This indicates that an efficacious immune response against this bacteria is mounted by the colonized children (Faden, HL et al ( 1994) J. Infect.Dis. 169:1312).
In most adults tested, bactericidal antibodies have been identified (Chapman, AJ et al.
(1985) J. Infect.Dis. 15I :878). Strains of M. catarrhalis present variations in their capacity to resist serum bactericidal activity: in general, isolates from diseased individuals are more WO 99/58562 PC'T/EP99/03Z6Z
resistant than those who are simply colonized (Hol, C et al. {1993) Lancet 341:1281, 3ordan, KI. et al. (1990) Am.J.Med. 88 (suppl. SA):28S). Serum resistance could therfore be considered as a virulence factor of the bacteria. An opsonizing activity has been observed in the sera of children recovering from otitis media.
The antigens targetted by these different immune responses in humans have not been identified, with the exception of OMP B 1, a 84 kDa protein which expression is regulated by iron, and that is recognized by the sera of patients with pneumonia (Sethi, S, et al. (1995) Infect.Imrnun. 63:1516), and of UspAl and UspA2 (Chen D. et al.(1999), Infect.Immun.
67:1310).
A few other membrane proteins present on the surface of M. catarrhalis have been characterized using biochemical method, or for their potential implication in the induction of a protective immunity (for review, see Murphy, fF (1996) Microbiol.Rev.
60:267). In a 1 S mouse pneumonia model, the presence of antibodies raised against some of them (UspA, CopB) favors a faster clearance of the pulmonary infection. Another polypeptide (OMP CD) is highly conserved among M. catarrhalis strains, and presents homologies with a porin of Pseudomonas aeruginosa, which has been demonstrated efficacious against this bacterium in animal models.
The frequency of Moraxella catarrhalis infections has risen dramatically in the past few decades. This has been attributed to the emergence of multiply antibiotic resistant strains and an increasing population of people with weakened immune systems. It is no longer uncommon to isolate Moraxella catarrhalis strains that are resistant to some or all of the standard antibiotics. This phenomenon has created an unmet medical need and demand for new anti-microbial agents, vaccines, drug screening methods, and diagnostic tests for this organism.

SUMMARY OF THE INVENTION
The present invention relates to BASB009, in particular BASB009 polypeptides and BASB009 polynucleotides, recombinant materials and methods for their production. In another aspect, the invention relates to methods for using such polypeptides and polynucleotides, including prevention and treatment of microbial diseases, amongst others.
In a further aspect, the invention relates to diagnostic assays for detecting diseases associated with microbial infections and conditions associated with such infections, such as assays for detecting expression or activity of BASB009 polynucleotides or polypeptides.
Various changes and modifications within the spirit and scope of the disclosed invention will become readily apparent to those skilled in the art from reading the following descriptions and from reading the other parts of the present disclosure.
DESCRIPTION OF THE INVENTION
The invention relates to BASB009 polypeptides and polynucleotides as described in greater detail below. In particular, the invention relates to polypeptides and polynucleotides of BASB009 of Moraxella catarrhalis, which is related by amino acid sequence homology to TIyC hemolysin protein of Serpulina hyodysenteriae. The invention relates especially to BASB009 having the nucleotide and amino acid sequences set out in SEQ ID
N0:1,3,5 or 7 and SEQ ID N0:2,4,6 or 8 respectively. It is understood that sequences recited in the Sequence Listing below as "DNA" represent an exemplification of one embodiment of the invention, since those of ordinary skill will recognize that such sequences can be usefully employed in polynucleotides in general, including ribopolynucieotides.

Polypeptides In one aspect of the invention there are provided polypeptides of Moraxella catarrhalis referred to herein as "BASB009" and "BASB009 polypeptides" as well as biologically, diagnostically, prophylactically, clinically or therapeutically useful variants thereof, and compositions comprising the same.
The present invention further provides for:
(a) an isolated polypeptide which comprises an amino acid sequence which has at least 85% identity, preferably at least 90% identity, more preferably at least 95%
identity, most preferably at least 97-99% or exact identity, to that of SEQ ID N0:2, 4, 6 or 8;
(b) a polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence which has at least 85% identity, preferably at least 90% identity, more preferably at least 95% identity, even more preferably at least 97-99% or exact identity to 1 S SEQ ID NO:1, 3, S or 7 over the entire length of SEQ ID NO:1, 3, S or 7 respectively; or (c) a polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence encoding a polypeptide which has at least 85% identity, preferably at least 90%
identity, more preferably at least 95% identity, even more preferably at least 97-99% or exact identity, to the amino acid sequence of SEQ ID N0:2, 4, 6 or 8.
The BASB009 polypeptides provided in SEQ ID N0:2,4,6 or 8 are the BASB009 polypeptides from Moraxella catarrhalis strains MC2931 (ATCC 43617), MC2912, MC2913 and MC2969,.
?5 The invention also provides an immunogenic fragment of a BASB009 polypeptide, that is, a contiguous portion of the BASB009 polypeptide which has the same or substantially the same immunogenic activity as the polypeptide comprising the amino acid sequence of SEQ ID N0:2,4,6 or 8; That is to say, the fragment (if necessary when coupled to a carrier) is capable of raising an immune response which recognises the BASB009 polypeptide. Such an immunogenic fragment may include, for example, the polypeptide lacking an N-terminal leader sequence, and/or a transmembrane domain and/or a C-terminal anchor domain. In a preferred aspect the immunogenic fragment of BASB009 according to the invention comprises substantially all of the extracellular domain of a polypeptide which has at least 85% identity, preferably at least 90% identity, more preferably at least 95% identity, most preferably at least 97-99%
identity, to that of SEQ ID N0:2,4,6 or 8 over the entire length of SEQ ID N0:2 A fragment is a polypeptide having an amino acid sequence that is entirely the same as part but not all of any amino acid sequence of any polypeptide of the invention. As with BASB009 polypeptides, fragments may be "free-standing," or comprised within a larger polypeptide of which they form a part or region, most preferably as a single continuous region in a single larger poiypeptide.
Preferred fragments include, for example, truncation polypeptides having a portion of an amino acid sequence of SEQ ID N0:2,4,6 or 8 or of variants thereof, such as a continuous series of residues that includes an amino- and/or carboxyl-terminal amino acid sequence.
Degradation forms of the polypeptides of the invention produced by or in a host cell, are also preferred. Further prefen:ed are fragments characterized by structural or functional attributes such as fragments that comprise alpha-helix and alpha-helix forming regions, beta-sheet and beta-sheet-forming regions, turn and turn-forming regions, coil and coil-forming regions, hydrophilic regions, hydrophobic regions, alpha amphipathic regions, beta amphipathic regions, flexible regions, surface-forming regions, substrate binding region, and high antigenic index regions.
Further prefer:ed fragments include an isolated polypeptide comprising an amino acid sequence having at least 15, 20, 30, 40, 50 or 100 contiguous amino acids from the amino acid sequence of SEQ ID N0:2, 4, 6 or 8, or an isolated polypeptide comprising an amino acid sequence having at least 15, 20, 30, 40, 50 or 100 contiguous amino acids truncated or deleted from the amino acid sequence of SEQ ID N0:2, 4, 6 or 8.
Fragments of the polypeptides of the invention may be employed for producing the corresponding full-length polypeptide by peptide synthesis; therefore, these fragments may be employed as intermediates for producing the full-length polypeptides of the invention.
Particularly preferred are variants in which several, S-10, 1-5, I-3, 1-2 or 1 amino acids are substituted, deleted, or added in any combination.
The polypeptides, or immunogenic fragments, of the invention may be in the form of the "mature" protein or may be a part of a larger protein such as a precursor or a fusion 1 S protein. It is often advantageous to include an additional amino acid sequence which contains secretory or leader sequences, pro-sequences, sequences which aid in purification such as multiple histidine residues, or an additional sequence for stability during recombinant production. Furthermore, addition of exogenous polypeptide or lipid tail or polynucleotide sequences to increase the immunogenic potential of the final molecule is also considered.
In one aspect, the invention relates to genetically engineered soluble fusion proteins comprising a polypeptide of the present invention, or a fragment thereof, and various portions of the constant regions of heavy or light chains of immunoglobulins of various ?5 subclasses (IgG, IgM, IgA, IgE). Preferred as an immunoglobulin is the constant part of the heavy chain of human IgG, particularly IgGI, where fusion takes place at the hinge region. In a particular embodiment, the Fc part can be removed simply by incorporation of a cleavage sequence which can be cleaved with blood clotting factor Xa.

Furthermore, this invention relates to processes for the preparation of these fusion proteins by genetic engineering, and to the use thereof for drug screening, diagnosis and therapy. A further aspect of the invention also relates to polynucleotides encoding such fusion proteins. Examples of fusion protein technology can be found in International Patent Application Nos. W094/29458 and W094/22914.
The proteins may be chemically conjugated, or expressed as recombinant fusion proteins allowing increased levels to be produced in an expression system as compared to non-fused protein. The fusion partner may assist in providing T helper epitopes (immunological fusion partner), preferably T helper epitopes recognised by humans, or assist in expressing the protein (expression enhancer) at higher yields than the native recombinant protein. Preferably the fusion partner will be both an immunological fusion partner and expression enhancing partner.
Fusion partners include protein D from Flaemophilus influenzae and the non-structural protein from influenza virus, NS 1 (hemagglutinin). Another fusion partner is the protein known as LytA. Preferably the C terminal portion of the molecule is used. Lyta is derived from Streptococcus pneumoniae which synthesize an N-acetyl-L-alanine amidase LytA, (coded by the lytA gene { Gene, 43 ( 1986) page 265-272 } ) an autolysin that specifically degrades certain bonds in the peptidoglycan backbone. The C-terminal domain of the LytA protein is responsible for the affinity to the choline or to some choline analogues such as DEAE. This property has been exploited for the development of E.coli C-LytA expressing plasmids useful for expression of fusion proteins.
Purification of hybrid proteins containing the C-LytA fragment at its amino terminus has been described {Biotechnology: 10, (1992) page 795-798}. It is possible to use the repeat portion of the LytA molecule found in the C tezminal end starting at residue 178, for example residues 188 - 305.
_g_ The present invention also includes variants of the aforementioned polypeptides, that is polypeptides that vary from the referents by conservative amino acid substitutions, whereby a residue is substituted by another with like characteristics. Typical such substitutions are among Ala, Val, Leu and Ile; among Ser and Thr; among the acidic residues Asp and Glu; among Asn and Gln; and among the basic residues Lys and Arg; or aromatic residues Phe and Tyr.
Polypeptides of the present invention can be prepared in any suitable manner.
Such polypeptides include isolated naturally occurring polypeptides, recombinantly produced polypeptides, synthetically produced polypeptides, or polypeptides produced by a combination of these methods. Means for preparing such polypeptides are well understood in the art.
It is most preferred that a polypeptide of the invention is derived from Moraxella catarrhalis, however, it may preferably be obtained from other organisms of the same taxonomic genus. A polypeptide of the invention may also be obtained, for example, from organisms of the same taxonomic family or order.
Polvnucleotides It is an object of the invention to provide polynucleotides that encode polypeptides, particularly polynucleotides that encode the polypeptide herein designated BASB009.
?5 In a particularly preferred embodiment of the invention the polynucleotide comprises a region encoding BASB009 polypeptides comprising a sequence set out in SEQ ID
N0:1,3,5 or 7 which includes a full length gene, or a variant thereof.
_9_ The BASB009 polynucleotides provided in SEQ ID N0:1,3,5 or 7 are the BASB009 polynucleotides from Moraxella catarrhalis strains MC2931 (ATCC 43617), MC2912, MC2913 and MC2969.
As a further aspect of the invention there are provided isolated nucleic acid molecules encoding and/or expressing BASB009 poiypeptides and polynucleotides, particularly Moraxella catarrhalis BASB009 polypeptides and polynucleotides, including, for example, unprocessed RNAs, ribozyme RNAs, mRNAs, cDNAs, genomic DNAs, B-and Z-DNAs. Further embodiments of the invention include biologically, . diagnostically, prophylactically, clinically or therapeutically useful polynucleotides and polypeptides, and variants thereof, and compositions comprising the same.
Another aspect of the invention relates to isolated polynucleotides, including at least one full length gene, that encodes a BASB009 polypeptide having a deduced amino acid sequence of SEQ ID N0:2,4,6 or 8 and polynucleotides closely related thereto and variants thereof.
In another particularly preferred embodiment of the invention there is a polypeptide from Moraxella catarrhalis comprising or consisting of an amino acid sequence of SEQ ID N0:2,4,6 or 8 or a variant thereof.
Using the information provided herein, such as a polynucleotide sequence set out in SEQ ID
NO:1, 3, 5 or 7, a polynucleotide of the invention encoding BASB009 polypeptide may be obtained using standard cloning and screening methods, such as those for cloning and sequencing chromosomal DNA fragments from bacteria using Moraxella catarrhalis Catlin cells as starting material, followed by obtaining a full length clone. For example, to obtain a polynucleotide sequence of the invention, such as a polynucleotide sequence given in SEQ ID NO:1, 3, 5 or 7, typically a library of clones of chromosomal DNA of Moraxella catarrhalis in E.coli or some other suitable host is probed with a radiolabeled oligonucleotide, preferably a 17-mer or longer, derived from a partial sequence. Clones carrying DNA identical to that of the probe can then be distinguished using stringent hybridization conditions. By sequencing the individual clones thus identified by hybridization with sequencing primers designed from the original polypeptide or polynucleotide sequence it is then possible to extend the polynucleotide sequence in both directions to determine a full length gene sequence. Conveniently, such sequencing is performed, for example, using denatured double stranded DNA prepared from a plasmid clone. Suitable techniques are described by Maniatis, T., Fritsch, E.F. and Sambrook et al., MOLECULAR CLONING, A LABORATORYMANUAL, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York ( 1989). (see in particular Screening By Hybridization 1.90 and Sequencing Denatured Double-Stranded DNA Templates 13.70).
Direct genomic DNA sequencing may also be performed to obtain a full length gene sequence. Illustrative of the invention. each polynucleotide set out in SEQ ID
NO: l, 3, 5 or 7 was discovered in a DNA library derived from Moraxella catarrhalis.
Moreover, each DNA sequence set out in SEQ ID NO:1, 3, 5 or 7 contains an open reading frame encoding a protein having about the number of amino acid residues set forth in SEQ
ID N0:2, 4, 6 or 8 with a deduced molecular weight that can be calculated using amino acid residue molecular weight values well known to those skilled in the art.
The polynucleotide of SEQ ID NO: l, between the start codon at nucleotide number 1 and the stop codon which begins at nucleotide number 1321 of SEQ ID NO:1, encodes the polypeptide of SEQ ID N0:2.
The polynucleotide of SEQ ID N0:3, between the start codon at nucleotide number l and the stop codon which begins at nucleotide number 1321 of SEQ ID N0:3, encodes the polypeptide of SEQ ID N0:4.

The polynucleotide of SEQ ID NO:S, between the start codon at nucleotide number 1 and the stop codon which begins at nucleotide number 1321 of SEQ ID NO:S, encodes the polypeptide of SEQ ID N0:6.
The polynucleotide of SEQ ID N0:7, between the start codon at nucleotide number l and the stop codon which begins at nucleotide number 1321 of SEQ ID N0:7, encodes the polypeptide of SEQ ID N0:8.
In a further aspect, the present invention provides for an isolated polynucleotide comprising or consisting of:
(a) a polynucleotide sequence which has at least 85% identity, preferably at least 90%
identity, more preferably at least 95% identity, even more preferably at least 97-99% or exact identity to SEQ ID NO:1, 3, 5 or 7 over the entire length of SEQ ID
NO:1, 3, 5 or 7 respectively; or (b) a polynucleotide sequence encoding a polypeptide which has at least 85%
identity, 1 ~ preferably at least 90% identity, more preferably at least 95% identity, even more preferably at least 97-99% or 100% exact, to the amino acid sequence of SEQ ID
N0:2, 4, 6 or 8, over the entire length of SEQ ID N0:2, 4, 6 or 8 respectively.
A polynucleotide encoding a polypeptide of the present invention, including homologs and ?0 orthologs from species other than Moraxella catarrhalis, may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions (for example, using a temperature in the range of 45 - 65°C
and an SDS
concentration from 0.1 --1 %) with a labeled or detectable probe consisting of or comprising the sequence of SEQ ID NO:1, 3, 5 or 7 or a fragment thereof; and isolating a full-length ?5 gene and/or genomic clones containing said polynucleotide sequence.
The invention provides a polynucleotide sequence identical over its entire length to a coding sequence (open reading frame) in SEQ ID NO:1, 3, 5 or 7. Also provided by the invention is a coding sequence for a mature polypeptide or a fragment thereof, by itself as well as a coding sequence for a mature polypeptide or a fragment in reading frame with another coding sequence, such as a sequence encoding a leader or secretory sequence, a pre-, or pro-or prepro-protein sequence. The polynucleotide of the invention may also contain at least one non-coding sequence, including for example, but not limited to at least one non-coding 5' and 3' sequence, such as the transcribed but non-translated sequences, termination signals (such as rho-dependent and rho-independent termination signals), ribosome binding sites, Kozak sequences, sequences that stabilize mRNA, introns, and polyadenylation signals.
The polynucleotide sequence may also comprise additional coding sequence encoding additional amino acids. For example, a marker sequence that facilitates purification of the fused polypeptide can be encoded. In certain embodiments of the invention, the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al., Proc. Natl. Acad Sci., USA 86: 821-824 (1989), or an HA peptide tag (Wilson et al., Cell 37: 767 (1984), both of which may be useful in purifying I 5 polypeptide sequence fused to them. Polynucleotides of the invention also include, but are not limited to, polynucleotides comprising a structural gene and its naturally associated sequences that control gene expression.
The nucleotide sequence encoding BASB009 polypeptide of SEQ ID N0:2, 4, 6 or 8 may be identical to the polypeptide encoding sequence contained in nucleotides 1 to 1320 of SEQ ID N0:1,3,S,or 7 respectively. Alternatively it may be a sequence, which as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ
ID N0:2, 4, 6 or 8.
The term "polynucleotide encoding a polypeptide" as used herein encompasses polynucleotides that include a sequence encoding a polypeptide of the invention, particularly a bacterial polypeptide and more particularly a polypeptide of the Moraxella catarrhalis BASB009 having an amino acid sequence set out in SEQ ID N0:2, 4, 6 or 8.

The term also encompasses polynucleotides that include a single continuous region or discontinuous regions encoding the polypeptide (for example, polynucleotides intemipted by integrated phage, an integrated insertion sequence, an integrated vector sequence, an integrated transposon sequence, or due to RNA editing or genomic DNA
reorganisation) together with additional regions, that also may contain coding and/or non-coding sequences.
The invention further relates to variants of the polynucleotides described herein that encode variants of a polypeptide having a deduced amino acid sequence of SEQ ID N0:2, 4, 6 or 8.
Fragments of polynucleotides of the invention may be used, for example, to synthesize full-length polynucleotides of the invention.
Further particularly preferred embodiments are polynucleotides encoding variants, that have the amino acid sequence of BASB009 polypeptide of SEQ ID
N0:2, 4, 6 or 8 in which several, a few, ~ to 10, 1 to 5, I to 3, 2, 1 or no amino acid residues are substituted, modified, deleted andlor added, in any combination. Especially preferred among these are silent substitutions, additions and deletions, that do not alter the properties and activities of BASB009 polypeptide.
Further preferred embodiments of the invention are polynucleotides that are at least 85%
identical over their entire length to a polynucleotide encoding BASB009 polypeptide having an amino acid sequence set out in SEQ ID N0:2, 4, 6 or 8, and polynucleotides that are complementary to such polynucleotides. Alternatively, most highly preferred are polynucleotides that comprise a region that is at least 90% identical over its entire length to a polynucleotide encoding BASB009 polypeptide and polynucleotides complementary thereto. In this regard, polynucleotides at least 95% identical over their entire length to the same are particularly preferred. Furthermore, those with at least 97% are highly preferred among those with at least 95%. and among these those with at least 98% and at least 99%
are particularly highly preferred. with at least 99% being the more preferred.

Preferred embodiments are polynucleotides encoding polypeptides that retain substantially the same biological function or activity as the mature polypeptide encoded by a DNA of SEQ ID NO:1, 3, 5 or 7.
In accordance with certain preferred embodiments of this invention there are provided polynucleotides that hybridize, particularly under stringent conditions, to polynucleotide sequences, such as those polynucleoddes in SEQ ID NO:I, 3, 5 or 7.
The invention further relates to polynucleotides that hybridize to the polynucleotide sequences provided herein. In this regard, the invention especially relates to polynucleotides that hybridize under stringent conditions to the polynucleotides described herein. As herein used, the terms "stringent conditions" and "stringent hybridization conditions" mean hybridization occurring only if there is at least 95% and preferably at least 97% identity between the sequences. A specific example of stringent hybridization conditions is overnight incubation at 42°C in a solution comprising: 50% formamide, Sx SSC (150mM
NaCI, lSznM trisodium citrate), 50 mM sodium phosphate (pH7.6), Sx Denhardt's solution, 10% dextran sulfate, and 20 micrograms/ml of denatured, sheared salmon sperm DNA, followed by washing the hybridization support in O.lx SSC at about 65°C.
Hybridization and wash conditions are well known and exemplified in Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., ( 1989), particularly Chapter 11 therein. Solution hybridization may also be used with the polynucleotide sequences provided by the invention.
2~ The invention also provides a polynucleotide consisting of or comprising a polynucleotide sequence obtained by screening an appropriate library containing the complete gene for a polynucleotide sequence set forth in SEQ ID NO:1, 3, S or 7 under stringent hybridization conditions with a probe having the sequence of said polynucleotide sequence set forth in SEQ ID NO:1, 3, S or 7 or a fragment thereof; and isolating said poiynucleotide sequence.
Fragments useful for obtaining such a polynucleotide include, for example, probes and primers fully described elsewhere herein.
As discussed elsewhere herein regarding polynucleotide assays of the invention, for instance, the polynucleotides of the invention, may be used as a hybridization probe for RNA, cDNA and genomic DNA to isolate full-length cDNAs and genomic clones encoding BASB009 and to isolate cDNA and genomic clones of other genes that have a high identity, particularly high sequence identity, to the BASB009 gene. Such probes generally will I 0 comprise at least 1 S nucleotide residues or base pairs. Preferably, such probes will have at least 30 nucleotide residues or base pairs and may have at least 50 nucleotide residues or base pairs. Particularly preferred probes will have at least 20 nucleotide residues or base pairs and will have less than 30 nucleotide residues or base pairs.
15 A coding region of a BASB009 gene may be isolated by screening using a DNA
sequence provided in SEQ ID NO:1, 3, 5 or 7 to synthesize an oligonucleodde probe. A
labeled oligonucleotide having a sequence complementary to that of a gene of the invention is then used to screen a library of cDNA, genomic DNA or mRNA to determine which members of the library the probe hybridizes to.
There are several methods available and well known to those skilled in the art to obtain full-length DNAs, or extend short DNAs, for example those based on the method of Rapid Amplification of cDNA ends (RACE) (see, for example, Frohman, et al., PNAS
LISA 85:
8998-9002, 1988). Recent modifications of the technique, exemplified by the MarathonTM
technology (Clontech Laboratories Inc.) for example, have significantly simplified the search for longer cDNAs. In the MarathonTM technology, cDNAs have been prepared from mRNA extracted from a chosen tissue and an 'adaptor' sequence ligated onto each end. Nucleic acid amplification (PCR) is then carried out to amplify the "missing" 5' end of the DNA using a combination of gene specific and adaptor specific oligonucleotide primers. The PCR reaction is then repeated using "nested" primers, that is, primers designed to anneal within the amplified product (typically an adaptor specific primer that anneals further 3' in the adaptor sequence and a gene specific primer that anneals further 5' in the selected gene sequence). The products of this reaction can then be anaiyzed by DNA sequencing and a full-length DNA constructed either by joining the product directly to the existing DNA to give a complete sequence, or carrying out a separate full-length PCR using the new sequence information for the design of the 5' primer.
I 0 The polynucleotides and polypeptides of the invention may be employed, for example, as research reagents and materials for discovery of treatments of and diagnostics for diseases, particularly human diseases, as further discussed herein relating to polynucleotide assays.
The polynucleotides of the invention that are oligonucleotides derived from a sequence of 1 ~ SEQ ID NOS:-1,3,5 or 7 may be used in the processes herein as described, but preferably for PCR, to determine whether or not the polynucleotides identified herein in whole or in part are transcribed in bacteria in infected tissue. It is recognized that such sequences will also have utility in diagnosis of the stage of infection and type of infection the pathogen has attained.
The invention also provides polynucleotides that encode a polypeptide that is the mature protein plus additional amino or carboxyl-terminal amino acids, or amino acids interior to the mature polypeptide (when the mature form has more than one polypeptide chain, for instance). Such sequences may play a role in processing of a protein from precursor to a 5 mature form, may allow protein transport, may lengthen or shorten protein half life or may facilitate manipulation of a protein for assay or production, among other things. As generally is the case in vivo, the additional amino acids may be processed away from the mature protein by cellular enzymes.

For each and every polynucleotide of the invention there is provided a polynucleotide complementary to it. It is preferred that these complementary polynucleotides are fully complementary to each polynucleotide with which they are complementary.
A precursor protein, having a mature form of the polypeptide fused to one or more prosequences may be an inactive form of the polypeptide. When prosequences are removed such inactive precursors generally are activated. Some or all of the prosequences may be removed before activation. Generally, such precursors are called proproteins.
In addition to the standard A, G, C, T/U representations for nucleotides, the term "N" may also be used in describing certain polynucleotides of the invention. "N" means that any of the four DNA or RNA nucleotides may appear at such a designated position in the DNA
or RNA sequence, except it is preferred that N is not a nucleic acid that when taken in 1 S combination with adjacent nucleotide positions, when read in the correct reading frame, would have the effect of generating a premature termination codon in such reading frame.
In sum, a polynucieotide of the invention may encode a mature protein, a mature protein plus a leader sequence (which may be referred to as a preprotein), a precursor of a mature protein having one or more prosequences that are not the leader sequences of a preprotein, or a preproprotein, which is a precursor to a proprotein, having a leader sequence and one or more prosequences, which generally are removed during processing steps that produce active and mature forms of the polypeptide.
In accordance with an aspect of the invention, there is provided the use of a polynucleotide of the invention for therapeutic or prophylactic purposes, in particular genetic immunization.

WO 99/58562 PCT/EP99/fl3262 The use of a polynucleotide of the invention in genetic immunization will preferably employ a suitable delivery method such as direct injection of plasmid DNA into muscles (Wolff et al., Hum Mol Genet (1992) l: 363, Manthorpe et al., Hum. Gene Ther.
(1983) 4:
419), delivery of DNA complexed with specific protein carriers (Wu et al., JBiol Chem.
S (1989) 264: 16985), coprecipitation of DNA with calcium phosphate (Benvenisty &
Reshef, PNAS USA, ( 1986) 83 : 9S S 1 ), encapsulation of DNA in various forms of liposomes (Kaneda et al., Science (1989) 243: 37S), particle bombardment (Tang et al., Nature (1992) 3S6:1S2, Eisenbraun et al., DNA Cell Biol (1993) 12: 791) and in vivo infection using cloned retroviral vectors (Seeger et al., PNAS USA ( 1984) 81:
5849).
Vectors, Host Cells, Expression Systems The invention also relates to vectors that comprise a polynucleotide or polynucleotides of the invention, host cells that are genetically engineered with vectors of the invention and the production of polypeptides of the invention by recombinant techniques. Cell-free translation systems can also be employed to produce such proteins using RNAs derived from the DNA constructs of the invention.
Recombinant polypeptides of the present invention may be prepared by processes wel!
known in those skilled in the art from genetically engineered host cells comprising expression systems. Accordingly, in a further aspect, the present invention relates to expression systems that comprise a polynucleotide or polynucleotides of the present invention, to host cells which are genetically engineered with such expression systems, and to the production of polypeptides of the invention by recombinant techniques.

For recombinant production of the polypeptides of the invention, host cells can be genetically engineered to incorporate expression systems or portions thereof or polynucleotides of the invention. Introduction of a polynucleotide into the host cell can be effected by methods described in many standard laboratory manuals, such as Davis, et al., BASICMETHODSINMOLECULAR BIOLOGY, (1986) and Sambrook, et al., MOLECULAR CLONING: A LABORATORYMANUAL, 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989), such as, calcium phosphate transfection, DEAE-dextran mediated transfection, transvection, microinjection, cationic lipid-mediated transfection, electroporation, transduction, scrape loading, ballistic introduction and infection.
Representative examples of appropriate hosts include bacterial cells, such as cells of I 0 streptococci, staphylococci, enterococci, E. coli, streptomyces, cyanobacteria, Bacillus subtilis, Neisseria meningitides and Moraxella catarrhalis; fungal cells, such as cells of a yeast. Kluveromyces, Saccharomyces, a basidiomycete, Candida. albicans andAspergillus;
insect cells such as cells of Drosophila S2 and Spodoptera Sfi3; animal cells such as CHO, COS, HeLa, C127, 3T3, BHK, 293, CV-1 and Bowes melanoma cells; and plant cells, such I 5 as cells of a gymnosperm or angiosperm.
A great variety of expression systems can be used to produce the polypeptides of the invention. Such vectors include. among others, chromosomal-, episomal- and virus-derived vectors, for example, vectors derived from bacterial plasmids, from bacteriophage, from 20 transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements. from. viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses, picornaviruses, retroviruses, and alphaviruses and vectors derived from combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, such as cosmids and phagemids. The 25 expression system constructs may contain control regions that regulate as well as engender expression. Generally, any system or vector suitable to maintain, propagate or express polynucleotides and/or to express a polypeptide in a host may be used for expression in this regard. The appropriate DNA sequence may be inserted into the expression system by any of a variety of well-known and routine techniques, such as, for example, those set forth in Sambrook et al., MOLECULAR CLONING, A LABORATORYMANUAL, (supra).
In recombinant expression systems in eukaryotes, for secretion of a translated protein into the lumen of the endoplasmic reticulum, into the periplasmic space or into the extracellular environment, appropriate secretion signals may be incorporated into the expressed polypeptide. These signals may be endogenous to the polypeptide or they may be heterologous signals.
Polypeptides of the present invention can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Most preferably, ion metal affinity chromatography (IMAC) is employed for purification. Well known techniques for refolding proteins may be employed to regenerate active confonmation when the polypeptide is denatured during intracellular synthesis, isolation and or purification.
The expression system may also be a recombinant live microorganism, such as a virus or bacterium. The gene of interest can be inserted into the genome of a live recombinant virus or bacterium. Inoculation and in vivo infection with this live vector will lead to in vivo expression of the antigen and induction of immune responses. Viruses and bacteria used for this purpose are for instance: poxviruses (e.g; vaccinia, fowlpox, canarypox), alphaviruses (Sindbis virus, Sernliki Forest Virus, Venezuelian Equine Encephalitis Virus), adenoviruses, adeno-associated virus, picornaviruses (poliovirus, rhinovirus), herpesviruses (varicella zoster virus, etc), Listeria, Salmonella , Shigella, Neisseria, BCG. These viruses and bacteria can be virulent, or attenuated in various ways in order to obtain live vaccines. Such live vaccines also form part of the invention.

Diagnostic, Prognostic, Serotypin~ and Mutation Assays This invention is also related to the use of BASB009 polynucleotides and polypeptides of the invention for use as diagnostic reagents. Detection of BASB009 polynucleotides and/or polypeptides in a eukaryote, particularly a mammal, and especially a human, will provide a diagnostic method for diagnosis of disease, staging of disease or response of an infectious organism to drugs. Eukaryotes, particularly mammals, and especially humans, particularly those infected or suspected to be infected with an organism comprising the BASB009 gene or protein, may be detected at the nucleic acid or amino acid level by a variety of well known techniques as well as by methods provided herein.
Polypeptides and polynucleotides for prognosis, diagnosis or other analysis may be obtained from a putatively infected and/or infected individual's bodily materials.
Polynucleotides from any of these sources, particularly DNA or RNA, may be used directly for detection or may be amplified enzymatically by using PCR or any other amplification technique prior to analysis. RNA, particularly mRNA, cDNA and genomic DNA may also be used in the same ways. Using amplification, characterization of the species and strain of infectious or resident organism present in an individual, may be made by an analysis of the genotype of a selected polynucleotide of the organism. Deletions and insertions can be detected by a change in size of the amplified product in comparison to a genotype of a reference sequence selected from a related organism, preferably a different species of the same genus or a different strain of the same species. Point mutations can be identified by hybridizing amplified DNA to labeled BASB009 polynucleotide sequences. Perfectly or significantly matched sequences can be distinguished from imperfectly or more significantly mismatched duplexes by DNase or RNase digestion, for DNA or RNA respectively, or by detecting differences in melting temperatures or renaturation kinetics. Polynucleotide sequence differences may also be detected by alterations in the electrophoretic mobility of polynucleotide fragments in gels as compared to a reference sequence. This may be carried out with or without denaturing agents. Polynucleotide differences may also be detected by direct DNA or RNA sequencing. See, for example, Myers et aL, Science, 230.
1242 (1985).
Sequence changes at specific locations also may be revealed by nuclease protection assays, such as RNase, V 1 and S 1 protection assay or a chemical cleavage method.
See, for example, Cotton et al., Proc. Natl. Acad. Sci., USA, 85: 4397-4401 (1985).
In another embodiment, an array of oligonucleotides probes comprising BASB009 nucleotide sequence or fragments thereof can be constructed to conduct efficient screening of for example, genetic mutations, serotype, taxonomic classification or identification.
Array technology methods are well known and have general applicability and can be used to address a variety of questions in molecular genetics including gene expression, genetic linkage, and genetic variability (see, for example. Chee et al., Science, 274:
610 ( 1996)).
Thus in another aspect, the present invention relates to a diagnostic kit which comprises:
(a) a polynucleotide of the present invention, preferably the nucleotide sequence of SEQ
ID NO:1, 3, 5 or 7, or a fragment thereof ;
(b) a nucleotide sequence complementary to that of (a);
(c) a polypeptide of the present invention, preferably the polypeptide of SEQ
ID N0:2, 4, 6 or 8 or a fragment thereof; or (d) an antibody to a polypeptide of the present invention, preferably to the polypeptide of SEQ ID NO:2, 4, 6 or 8.
It will be appreciated that in any such kit, (a), (b), {c) or (d) may comprise a substantial component. Such a kit will be of use in diagnosing a disease or susceptibility to a Disease, among others.
This invention also relates to the use of polynucleotides of the present invention as diagnostic reagents. Detection of a mutated form of a polynucleotide of the invention, preferable, SEQ ID NO:1, 3, 5 or 7, which is associated with a disease or pathogenicity will provide a diagnostic tool that can add to, or define, a diagnosis of a disease, a prognosis of a course of disease, a determination of a stage of disease, or a susceptibility to a disease, which results from under-expression, over-expression or altered expression of the polynucieotide. Organisms, particularly infectious organisms, carrying mutations in such polynucleotide may be detected at the polynucleotide level by a variety of techniques, such as those described elsewhere herein.
Cells from an organism carrying mutations or polymorphisms (allelic variations) in a I 0 polynucleotide and/or polypeptide of the invention may also be detected at the polynucleotide or polypeptide level by a variety of techniques, to allow for serotyping, for example. For example, RT-PCR can be used to detect mutations in the RNA. It is particularly preferred to use RT-PCR in conjunction with automated detection systems, such as, for example, GeneScan. RNA, cDNA or genomic DNA may also be used for the same purpose, PCR. As an example, PCR primers complementary to a polynucleotide encoding BASB009 polypeptide can be used to identify and analyze mutations.
The invention further provides primers with 1, 2, 3 or 4 nucleotides removed from the 5' and/or the 3' end. These primers may be used for, among other things, amplifying BASB009 DNA and/or RNA isolated from a sample derived from an individual, such as a bodily material. The primers may be used to amplify a polynucleotide isolated from an infected individual, such that the polynucleotide may then be subject to various techniques for elucidation of the polynucleotide sequence. In this way, mutations in the polynucleotide sequence may be detected and used to diagnose and/or prognose the infection or its stage or course, or to serotype andlor classify the infectious agent.
The invention further provides a process for diagnosing, disease, preferably bacterial infections, more preferably infections caused by Moraxella cararrhalis, comprising determining from a sample derived from an individual, such as a bodily material, an increased level of expression of polynucleotide having a sequence of SEQ ID
NO:I, 3, 5 or 7. Increased or decreased expression of a BASB009 polynucleotide can be measured using any on of the methods well known in the art for the quantitation of polynucleotides, such as, for example, amplification, PCR, RT-PCR, RNase protection, Northern blotting, spectrometry and other hybridization methods.
In addition, a diagnostic assay in accordance with the invention for detecting over-expression of BASB009 polypeptide compared to normal control tissue samples may be used to detect the presence of an infection, for example. Assay techniques that can be used to determine levels of a BASB009 polypeptide, in a sample derived from a host, such as a bodily material, are well-known to those of skill in the art. Such assay methods include radioimmunoassays, competitive-binding assays, Western Blot analysis, antibody sandwich assays, antibody detection and ELISA assays.
l~
The polynucleotides of the invention may be used as components of polynucleotide arrays, preferably high density arrays or grids. These high density arrays are particularly useful for diagnostic and prognostic purposes. For example, a set of spots each comprising a different gene, and further comprising a polynucleotide or polynucieotides of the invention, may be used for probing, such as using hybridization or nucleic acid amplification, using a probes obtained or derived from a bodily sample, to determine the presence of a particular polynucleotide sequence or related sequence in an individual. Such a presence may indicate the presence of a pathogen, particularly Moraxella catarrhalis, and may be useful in diagnosing and/or prognosing disease or a course of disease. A grid comprising a number of variants of the polynucleotide sequence of SEQ ID NO:1, 3, 5 or 7 are preferred. Also preferred is a comprising a number of variants of a polynucleotide sequence encoding the polypeptide sequence of SEQ ID N0:2, 4, 6 or 8.

Antibodies The polypeptides and polynucleotides of the invention or variants thereof, or cells expressing the same can be used as immunogens to produce antibodies immunospecific for such polypeptides or polynucleotides respectively.
In certain preferred embodiments of the invention there are provided antibodies against BASB009 polypeptides or polynucleotides.
Antibodies generated against the polypeptides or polynucleotides of the invention can be obtained by administering the polypeptides and/or polynucleotides of the invention, or epitope-bearing fragments of either or both, analogues of either or both, or cells expressing either or both, to an animal, preferably a nonhuman, using routine protocols.
For preparation of monoclonal antibodies, any technique known in the art that provides antibodies produced by continuous cell line cultures can be used. Examples include various techniques, such as those in Kohler, G. and Milstein, C., Nature 256: 495-497 (1975);
Kozbor et al., Immunology Todav 4: 72 (1983); Cole et al., pg. 77-96 in MONOCLONAL
ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inca ( 1985).
Techniques for the production of single chain antibodies (U.S. Patent No.
4,946,778) can be adapted to produce single chain antibodies to polypeptides or polynucleotides of this invention. Also, transgenic mice, or other organisms or animals, such as other mammals, may be used to express humanized antibodies immunospecific to the polypeptides or polynucleotides of the invention.
Alternatively, phage display technology may be utilized to select antibody genes with binding activities towards a polypeptide of the invention either from repertoires of PCR
amplified v-genes of lymphocytes from humans screened for possessing anti-BASB009 or from naive libraries (McCafferty, et al., (1990), Nature 348, 552-554; Marks, et. a1, (1992) Biotechnology 10, 779-783). The affnity of these antibodies can also be improved by, for example, chain shuffling (Clackson et al., (1991) Nature 351: 628).
The above-described antibodies may be employed to isolate or to identify clones expressing the polypeptides or polynucleotides of the invention to purify the polypeptides or polynucleotides by, for example, affinity chromatography.
Thus, among others, antibodies against BASB009-polypeptide or BASB009-polynucleotide may be employed to treat infections, particularly bacterial infections.
Polypeptide variants include antigenically, epitopically or immunologically equivalent variants form a particular aspect of this invention.
Preferably, the antibody or variant thereof is modified to make it less immunogenic in the individual. For example, if the individual is human the antibody may most preferably be "humanized," where the complimentarity determining region or regions of the hybridoma-derived antibody has been transplanted into a human monoclonal antibody, for example as described in Jones et al. (1986), Nature 321, 522-525 or Tempest et al., (1991) Biotechnology 9, 266-273.
Antagonists and A~onists - Assavs and Molecules Polypeptides and polynucleotides of the invention may also be used to assess the binding of small molecule substrates and ligands in, for example, cells, cell-free preparations, chemical libraries, and natural product mixtures. These substrates and ligands may be natural substrates and ligands or may be structural or functional mimetics. See, e.g., Coligan et al., Current Protocols in Immunology I (2): Chapter 5 ( 1991 ).

The screening methods may simply measure the binding of a candidate compound to the polypeptide or polynucleotide, or to cells or membranes bearing the polypeptide or polynucleotide, or a fusion protein of the polypeptide by means of a label directly or indirectly associated with the candidate compound. Alternatively, the screening method may involve competition with a labeled competitor. Further, these screening methods may test whether the candidate compound results in a signal generated by activation or inhibition of the polypeptide or polynucleotide, using detection systems appropriate to the cells comprising the polypeptide or polynucleotide. Inhibitors of activation are generally assayed in the presence of a known agonist and the effect on activation by the agonist by the presence of the candidate compound is observed. Constitutively active polypeptide and/or constitutively expressed polypeptides and polynucleotides may be employed in screening methods for inverse agonists or inhibitors, in the absence of an agonist or inhibitor, by testing whether the candidate compound results in inhibition of activation of 1 ~ the polypeptide or polynucleotide, as the case may be. Further, the screening methods may simply comprise the steps of mixing a candidate compound with a solution containing a polypeptide or polynucleotide of the present invention, to form a mixture, measuring BASB009 polypeptide and/or polynucleotide activity in the mixture, and comparing the BASB009 polypeptide and/or polynucleotide activity of the mixture to a standard. Fusion proteins, such as those made from Fc portion and BASB009 polypeptide, as hereinbefore described, can also be used for high-throughput screening assays to identify antagonists of the polypeptide of the present invention, as well as of phylogenetically and and/or functionally related polypeptides (see D. Bennett et al., J Mol Recognition, 8:52-58 (1995); and K. Johanson et al., J Biol Chem, 270(16):9459-( 1995)).
The polynucleotides, polypeptides and antibodies that bind to and/or interact with a polypeptide of the present invention may also be used to configure screening methods for WO 99/58562 PCf/EP99/03262 detecting the effect of added compounds on the production of mRNA and/or polypeptide in cells. For example, an ELISA assay may be constructed for measuring secreted or cell associated levels of polypeptide using monoclonal and polyclonal antibodies by standard methods known in the art. This can be used to discover agents which may inhibit or enhance the production of polypeptide (also called antagonist or agonist, respectively) from suitably manipulated cells or tissues.
The invention also provides a method of screening compounds to identify those which enhance (agonist) or block (antagonist) the action of BASB009 polypeptides or polynucleotides, particularly those compounds that are bacteriostatic and/or bactericidal.
The method of screening may involve high-throughput techniques. For example, to screen for agonists or antagonists, a synthetic reaction mix, a cellular compartment.
such as a membrane, cell envelope or cell wall, or a preparation of any thereof comprising BASB009 polypeptide and a labeled substrate or ligand of such polypeptide is incubated in the absence or the presence of a candidate molecule that may be a BASB009 agonist or antagonist. The ability of the candidate molecule to agonize or antagonize the BASB009 polypeptide is reflected in decreased binding of the labeled ligand or decreased production of product from such substrate. Molecules that bind gratuitously, i.e., without inducing the effects of BASB009 polypeptide are most likely to be good antagonists. Molecules that bind well and, as the case may be. increase the rate of product production from substrate, increase signal transduction, or increase chemical channel activity are agonists.
Detection of the rate or level of, as the case may be, production of product from substrate, signal transduction, or chemical channel activity may be enhanced by using a reporter system. Reporter systems that may be useful in this regard include but are not limited to colorimetric, labeled substrate converted into product, a reporter gene that is responsive to changes in polynucleotide or polypeptide activity, and binding assays known in the art.

Another example of an assay for BASB009 agonists is a competitive assay that combines BASB009 and a potential agonist with BASB009-binding molecules, recombinant BASB009 binding molecules, natural substrates or ligands, or substrate or ligand mimetics, under appropriate conditions for a competitive inhibition assay. BASB009 can be labeled, such as by radioactivity or a colorimetric compound, such that the number of molecules bound to a binding molecule or converted to product can be determined accurately to assess the effectiveness of the potential antagonist.
Potential antagonists include, among others, small organic molecules, peptides, polypeptides and antibodies that bind to a polynucleotide and/or polypeptide of the invention and thereby inhibit or extinguish its activity or expression. Potential antagonists also may be small organic molecules, a peptide, a polypeptide such as a closely related protein or antibody that binds the same sites on a binding molecule, such as a binding molecule, without inducing BASB009-induced activities, thereby preventing the action or expression of I ~ polypeptides and/or polynucleotides by excluding BASB009 polypeptides and/or polynucleotides from binding.
Potential antagonists include a small molecule that binds to and occupies the binding site of the polypeptide thereby preventing binding to cellular binding molecules, such that normal biological activity is prevented. Examples of small molecules include but are not limited to small organic molecules, peptides or peptide-like molecules. Other potential antagonists include antisense molecules (see Okano, J. Neurochem. S6: 560 (1991 );
OLIGODEOXYNUCLEOTIDES AS ANTISENSE INHIBITORS OF GENE EXPRESSION, CRC Press, Boca Raton, FL (1988), for a description of these molecules).
Preferred potential antagonists include compounds related to and variants of BASB009.
In a further aspect, the present invention relates to genetically engineered soluble fusion proteins comprising a polypeptide of the present invention, or a fragment thereof, and various portions of the constant regions of heavy or light chains of immunoglobulins of various subclasses (IgG, IgM, IgA, IgE). Preferred as an immunoglobulin is the constant part of the heavy chain of human IgG, particularly IgGl, where fusion takes place at the hinge region. In a particular embodiment, the Fc part can be removed simply by incorporation of a cleavage sequence which can be cleaved with blood clotting factor Xa.
Furthermore, this invention relates to processes for the preparation of these fusion proteins by genetic engineering, and to the use thereof for drug screening, diagnosis and therapy. A further aspect of the invention also relates to polynucleotides encoding such fusion proteins. Examples of fusion protein technology can be found in International Patent Application Nos. W094/29458 and W094/22914.
Each of the polynucleotide sequences provided herein may be used in the discovery and development of antibacterial compounds. The encoded protein, upon expression, can be used as a target for the screening of antibacterial drugs. Additionally, the polynucleotide sequences encoding the amino terminal regions of the encoded protein or Shine-Delgarno or other translation facilitating sequences of the respective mRNA can be used to construct antisense sequences to control the expression of the coding sequence of interest.
The invention also provides the use of the polypeptide, polynucleotide, agonist or antagonist of the invention to interfere with the initial physical interaction between a pathogen or pathogens and a eukaryotic, preferably mammalian, host responsible for sequelae of infection. In particular, the molecules of the invention may be used: in the prevention of adhesion of bacteria, in particular gram positive and/or gram negative bacteria, to eukaryotic, preferably mammalian, extracellular matrix proteins on in-dwelling devices or to extracellular matrix proteins in wounds; to block bacterial adhesion between eukaryotic, preferably mammalian, extracellular matrix proteins and bacterial BASB009 proteins that mediate tissue damage and/or; to block the normal progression of pathogenesis in infections initiated other than by the implantation of in-dwelling devices or by other surgical techniques.
In accordance with yet another aspect of the invention, there are provided agonists and antagonists, preferably bacteristatic or bactericidal agonists and antagonists.
The antagonists and agonists of the invention may be employed, for instance, to prevent, inhibit and/or treat diseases.
I 0 In a further aspect, the present invention relates to mimotopes of the polypeptide of the invention. A mimotope is a peptide sequence, sufficiently similar to the native peptide (sequentially or structurally), which is capable of being recognised by antibodies which recognise the native peptide; or is capable of raising antibodies which recognise the native peptide when coupled to a suitable carrier.
Peptide mimotopes may be designed for a particular purpose by addition, deletion or substitution of elected amino acids. Thus, the peptides may be modified for the purposes of ease of conjugation to a protein carrier. For example, it may be desirable for some chemical conjugation methods to include a terminal cysteine. In addition it may be desirable for peptides conjugated to a protein carrier to include a hydrophobic terminus distal from the conjugated terminus of the peptide, such that the free unconjugated end of the peptide remains associated with the surface of the carrier protein.
Thereby presenting the peptide in a conformation which most closely resembles that of the peptide as found in the context of the whole native molecule. For example, the peptides may be altered to have an N-terminal cysteine and a C-terminal hydrophobic amidated tail. Alternatively, the addition or substitution of a D-stereoisomer form of one or more of the amino acids may be performed to create a beneficial derivative, for example to enhance stability of the peptide.

Alternatively, peptide mimotopes may be identified using antibodies which are capable themselves of binding to the polypeptides of the present invention using techniques such as phage display technology (EP 0 552 267 B 1 ). This technique, generates a large number of peptide sequences which mimic the structure of the native peptides and are, therefore, capable of binding to anti-native peptide antibodies, but may not necessarily themselves share significant sequence homology to the native polypeptide.
Vaccines Another aspect of the invention relates to a method for inducing an immunological response in an individual, particularly a mammal, preferably humans, which comprises inoculating the individual with BASB009 polynucleotide and/or polypeptide, or a fragment or variant thereof, adequate to produce antibody and/ or T cell immune response to protect said individual from infection, particularly bacterial infection and most particularly Moraxella catarrhalis infection. Also provided are methods whereby such immunological response slows bacterial replication. Yet another aspect of the invention relates to a method of inducing immunological response in an individual which comprises delivering to such individual a nucleic acid vector, sequence or ribozyme to direct expression of BASB009 polynucleotide andlor polypeptide, or a fragment or a variant thereof. for expressing BASB009 polynucleotide andlor polypeptide, or a fragment or a variant thereof in vivo in order to induce an immunological response, such as, to produce antibody andl or T cell immune response, including, for example, cytokine-producing T
cells or cytotoxic T cells, to protect said individual, preferably a human, from disease, whether that disease is already established within the individual or not. One example of administering the gene is by accelerating it into the desired cells as a coating on particles or otherwise. Such nucleic acid vector may comprise DNA, RNA, a ribozyme, a modified nucleic acid, a DNA/RNA hybrid. a DNA-protein complex or an RNA-protein complex.

A further aspect of the invention relates to an immunological composition that when introduced into an individual, preferably a human, capable of having induced within it an immunological response, induces an immunological response in such individual to a BASB009 polynucleotide and/or polypeptide encoded therefrom, wherein the composition comprises a recombinant BASB009 polynucleotide and/or polypeptide encoded therefrom and/or comprises DNA and/or RNA which encodes and expresses an antigen of said BASB009 polynucleotide, polypeptide encoded therefrom, or other polypeptide of the invention. The immunological response may be used therapeutically or prophylactically and may take the form of antibody immunity and/or cellular immunity, such as cellular immunity arising from CT'L or CD4+ T cells.
A BASB009 polypeptide or a fragment thereof may be fused with co-protein or chemical moiety which may or may not by itself produce antibodies, but which is capable of stabilizing the first protein and producing a fused or modified protein which will have antigenic andlor immunogenic properties, and preferably protective properties.
Thus fused recombinant protein, preferably further comprises an antigenic co-protein, such as lipoprotein D from Haemophilus inJluenzae, Glutathione-S-transferase (GST) or beta-galactosidase, or any other relatively large co-protein which solubilizes the protein and facilitates production and purification thereof. Moreover, the co-protein may act as an adjuvant in the sense of providing a generalized stimulation of the immune system of the organism receiving the protein. The co-protein may be attached to either the amino- or carboxy-terminus of the first protein.
Provided by this invention are compositions, particularly vaccine compositions, and 2~ methods comprising the polypeptides and/or polynucleotides of the invention and immunostimulatory DNA sequences, such as those described in Sato, Y. et al.
Science 273 : 3 52 ( 1996).

Also, provided by this invention are methods using the described polynucleotide or particular fragments thereof, which have been shown to encode non-variable regions of bacterial cell surface proteins, in polynucleotide constructs used in such genetic immunization experiments in animal models of infection with Moraxella catarrhalis.
Such experiments will be particularly useful for identifying protein epitopes able to provoke a prophylactic or therapeutic immune response. It is believed that this approach will allow for the subsequent preparation of monoclonal antibodies of particular value, derived from the requisite organ of the animal successfully resisting or clearing infection, for the development of prophylactic agents or therapeutic treatments of bacterial infection, particularly Moraxella catarrhalis infection, in mammals, particularly humans.
The invention also includes a vaccine fonmuiation which comprises an immunogenic recombinant polypeptide and/or polynucleotide of the invention together with a suitable carrier, such as a pharmaceutically acceptable carrier. Since the polypeptides and polynucleotides may be broken down in the stomach, each is preferably administered parenterally, including, for example, administration that is subcutaneous, intramuscular, intravenous, or intradermal. Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostatic compounds and solutes which render the formulation isotonic with the bodily fluid, preferably the blood, of the individual; and aqueous and non-aqueous sterile suspensions which may include suspending agents or thickening agents.
The formulations may be presented in unit-dose or mufti-dose containers, for example, sealed ampoules and vials and may be stored in a freeze-dried condition requiring only the addition of the sterile liquid carrier immediately prior to use.
The vaccine formulation of the invention may also include adjuvant systems for enhancing the immunogenicity of the formulation. Preferably the adjuvant system raises preferentially a TH 1 type of response.

An immune response may be broadly distinguished into two extreme categories, being a htunoral or cell mediated immune responses (traditionally characterised by antibody and cellular effector mechanisms of protection respectively). These categories of response have been termed TH1-type responses (cell-mediated response), and TH2-type immune responses (humoral response).
Extreme THl-type immune responses may be characterised by the generation of antigen specific, haplotype restricted cytotoxic T lymphocytes, and natural killer cell responses.
In mice TH 1-type responses are often characterised by the generation of antibodies of the IgG2a subtype, whilst in the human these correspond to IgGI type antibodies. TH2-type immune responses are characterised by the generation of a broad range of immunoglobulin isotypes including in mice IgGl, IgA, and IgM.
It can be considered that the driving force behind the development of these two types of immune responses are cytokines. High levels of THI-type cytokines tend to favour the induction of cell mediated immune responses to the given antigen, whilst high levels of TH2-type cytokines tend to favour the induction of humoral immune responses to the antigen.
The distinction of TH1 and TH2-type immune responses is not absolute. In reality an individual will support an immune response which is described as being predominantly TH1 or predominantly TH2. However, it is often convenient to consider the families of cytokines in terms of that described in marine CD4 +ve T cell clones by Mosmann and Coffman (Mosmann, T.R. and Coffman, R.L. (1989) THI and TH2 cells: different patterns of lymphokine secretion lead to different functional properties.
Annual Review of Immunology, 7, p145-173). Traditionally, TH 1-type responses are associated with the production of the INF-y and IL-2 cytokines by T-lymphocytes. Other cytokines often directly associated with the induction of TH1-type immune responses are not produced by T-cells, such as IL-12. In contrast, TH2- type responses are associated with the secretion of IL-4, IL-5, IL-6 and IL-13.
It is known that certain vaccine adjuvants are particularly suited to the stimulation of either TH 1 or TH2 - type cytokine responses. Traditionally the best indicators of the TH i :TH2 balance of the immune response after a vaccination or infection includes direct measurement of the production of TH1 or TH2 cytokines by T lymphocytes in vitro after restimulation with antigen, and/or the measurement of the IgG1:IgG2a ratio of antigen specific antibody responses.
Thus, a THI-type adjuvant is one which preferentially stimulates isolated T-cell populations to produce high levels of TH1-type cytokines when re-stimulated with antigen in vitro, and promotes development of both CD8+ cytotoxic T
lymphocytes and antigen specific immunoglobulin responses associated with TH1-type isotype.
Adjuvants which are capable of preferential stimulation of the TH1 cell response are described in International Patent Application No. WO 94/00153 and WO 95/17209.
3 De-O-acylated monophosphoryl lipid A (3D-MPL) is one such adjuvant. This is known from GB 2220211 (Ribi). Chemically it is a mixture of 3 De-O-acyiated monophosphoryl lipid A with 4, 5 or 6 acylated chains and is manufactured by Ribi Immunochem, Montana. A preferred form of 3 De-O-acyiated monophosphoryl lipid A is disclosed in European Patent 0 689 454 B 1 (SmithKline Beecham Bioiogicals SA).
Preferably, the particles of 3D-MPL are small enough to be sterile filtered through a 0.22micron membrane (European Patent number 0 689 454).

WO 99/58562 PCT/EP99l03262 3D-MPL will be present in the range of l Op,g - 100pg preferably 25-50p.g per dose wherein the antigen will typically be present in a range 2-SOUg per dose.
Another preferred adjuvant comprises QS21, an Hplc purified non-toxic fraction derived from the bark of Quillaja Saponaria Molina. Optionally this may be admixed with 3 De-O-acylated monophosphoryl lipid A (3D-MPL), optionally together with an carrier.
The method of production of QS21 is disclosed in US patent No. 5,057,540.
Non-reactogenic adjuvant formulations containing QS21 have been described previously (WO 96/33739). Such formulations comprising QS21 and cholesterol have been shown to be successful TH1 stimulating adjuvants when formulated together with an antigen.
Further adjuvants which are preferential stimulators of TH1 cell response include immunomodulatory oligonucleotides, for example unmethylated CpG sequences as disclosed in WO 96/02555.
Combinations of different TH 1 stimulating adjuvants, such as those mentioned ?0 hereinabove, are also contemplated as providing an adjuvant which is a preferential stimulator of TH 1 cell response. For example, QS21 can be formulated together with 3D-MPL. The ratio of QS21 : 3D-MPL will typically be in the order of 1 : 10 to 10 : 1;
preferably 1:5 to 5 : 1 and often substantially 1 : 1. The preferred range for optimal synergy is 2.5 : 1 to 1 : 1 3D-MPL: QS21.
Preferably a carrier is also present in the vaccine composition according to the invention. The carrier may be an oil in water emulsion, or an aluminium salt, such as aluminium phosphate or aluminium hydroxide.
_38_ A preferred oil-in-water emulsion comprises a metabolisible oil, such as squalene, alpha tocopherol and Tween 80. In a particularly preferred aspect the antigens in the vaccine composition according to the invention are combined with QS21 and 3D-MPL in such an emulsion. Additionally the oil in water emulsion may contain span 85 and/or lecithin and/or tricaprylin.
Typically for human administration QS21 and 3D-MPL will be present in a vaccine in the range of 1 p,g - 200pg, such as 10-100p,g, preferably 1 Opg - 50~tg per dose.
Typically the oil in water will comprise from 2 to 10% squalene, from 2 to 10%
alpha tocopherol and from 0.3 to 3% tween 80. Preferably the ratio of squalene:
alpha tocopherol is equal to or less than 1 as this provides a more stable emulsion.
Span 85 may also be present at a level of 1 %. In some cases it may be advantageous that the vaccines of the present invention will further contain a stabiliser.
Non-toxic oil in water emulsions preferably contain a non-toxic oil, e.g.
squalane or squalene, an emulsifier, e.g. Tween 80, in an aqueous carrier. The aqueous Garner may be, for example, phosphate buffered saline.
A particularly potent adjuvant formulation involving QS21, 3D-MPL and tocopherol in an oil in water emulsion is described in WO 95/17210.
The present invention also provides a polyvalent vaccine composition comprising a vaccine formulation of the invention in combination with other antigens, in particular ?5 antigens useful for treating cancers, autoimmune diseases and related conditions. Such a polyvalent vaccine composition may include a TH-1 inducing adjuvant as hereinbefore described.

While the invention has been described with reference to certain BASB009 polypeptides and polynucleotides, it is to be understood that this covers fragments of the naturally occurring polypeptides and polynucleotides, and similar polypeptides and polynucleotides with additions, deletions or substitutions which do not substantially affect the immunogenic properties of the recombinant polypeptides or polynucleotides.
Compositions, kits and administration In a further aspect of the invention there are provided compositions comprising a BAS8009 polynucleotide and/or a BASB009 polypeptide for administration to a cell or to a multicellular organism.
The invention also relates to compositions comprising a polynucleotide and/or a polypeptides discussed herein or their agonists or antagonists. The polypeptides and poiynucleotides of the invention may be employed in combination with a non-sterile or sterile carrier or carriers for use with cells, tissues or organisms, such as a pharmaceutical carrier suitable for administration to an individual. Such compositions comprise, for instance, a media additive or a therapeutically effective amount of a polypeptide and/or polynucleotide of the invention and a pharmaceutically acceptable carrier or excipient. Such carriers may include, but are not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol and combinations thereof. The formulation should suit the mode of administration.
The invention further relates to diagnostic and pharmaceutical packs and kits comprising one or more containers filled with one or more of the ingredients of the aforementioned compositions of the invention.
?5 Polypeptides, polynucleotides and other compounds of the invention may be employed alone or in conjunction with other compounds, such as therapeutic compounds.

The pharmaceutical compositions may be administered in any effective, convenient manner including, for instance, administration by topical, oral, anal, vaginal, intravenous, intraperitoneal, intramuscular, subcutaneous, intranasal or intradermal routes among others.
In therapy or as a prophylactic, the active agent may be administered to an individual as an injectable composition, for example as a sterile aqueous dispersion, preferably isotonic.
In a further aspect, the present invention provides for pharmaceutical compositions comprising a therapeutically effective amount of a polypeptide and/or polynucleotide, such as the soluble form of a polypeptide and/or polynucleotide of the present invention, agonist or antagonist peptide or small molecule compound, in combination with a pharmaceutically acceptable carrier or excipient. Such carriers include, but are not limited to, saline, buffered saline, dextrose, water, glycerol. ethanol, and combinations thereof. The invention further 1 S relates to pharmaceutical packs and kits comprising one yr more containers filled with one or more of the ingredients of the aforementioned compositions of the invention.
Polypeptides, polynucleotides and other compounds of the present invention may be employed alone or in conjunction with other compounds, such as therapeutic compounds.
The composition will be adapted to the route of administration, for instance by a systemic or an oral route. Preferred forms of systemic administration include injection, typically by intravenous injection. Other injection routes, such as subcutaneous, intramuscular, or intraperitoneal, can be used. Alternative means for systemic administration include transmucosal and transdermal administration using penetrants such as bile salts or fusidic 2~ acids or other detergents. In addition, if a polypeptide or other compounds of the present invention can be formulated in an enteric or an encapsulated formulation, oral administration may also be possible. Administration of these compounds may also be topical and/or localized, in the form of salves, pastes, gels, solutions, powders and the like.

For administration to mammals, and particularly humans, it is expected that the daily dosage level of the active agent will be from 0.01 mg/kg to 10 mg/kg, typically around 1 mglkg. The physician in any event will determine the actual dosage which will be most suitable for an individual and will vary with the age, weight and response of the particular individual. The above dosages are exemplary of the average case. There can, of course, be individual instances where higher or lower dosage ranges are merited, and such are within the scope of this invention.
The dosage range required depends on the choice of peptide, the route of administration, the nature of the formulation, the nature of the subject's condition, and the judgment of the attending practitioner. Suitable dosages, however, are in the range of 0.1-100 wg/kg of subject.
I ~ A vaccine composition is conveniently in injectable form. Conventional adjuvants may be employed to enhance the immune response. A suitable unit dose for vaccination is 0.5-5 microgram/kg of antigen, and such dose is preferably administered I-3 times and with an interval of I-3 weeks. With the indicated dose range, no adverse toxicological effects will be observed with the compounds of the invention which would preclude their administration to suitable individuals.
Wide variations in the needed dosage, however, are to be expected in view of the variety of compounds available and the differing efficiencies of various routes of administration. For example, oral administration would be expected to require higher dosages than administration by intravenous injection. Variations in these dosage levels can be adjusted using standard empirical routines for optimization, as is well understood in the art.

Seguence Databases, Sequences in a Tangible Medium, and Algorithms Polynucleotide and polypeptide sequences form a valuable information resource with which to determine their 2- and 3-dimensional structures as well as to identify further sequences of similar homology. These approaches are most easily facilitated by storing the sequence in a computer readable medium and then using the stored data in a known macromolecular structure program or to search a sequence database using well known searching tools, such as the GCG program package.
Also provided by the invention are methods for the analysis of character sequences or strings, particularly genetic sequences or encoded protein sequences.
Preferred methods of sequence analysis include, for example, methods of sequence homology analysis, such as identity and similarity analysis, DNA, RNA and protein structure analysis, sequence assembly, cladistic analysis, sequence motif analysis, open reading frame determination, nucleic acid base calling, codon usage analysis, nucleic acid base trimming, and sequencing chromatogram peak analysis.
A computer based method is provided for performing homology identification.
This method comprises the steps of: providing a first polynucleotide sequence comprising the sequence of a polynucleotide of the invention in a computer readable medium;
and comparing said first polynucleotide sequence to at least one second polynucleotide or polypeptide sequence to identify homology.
A computer based method is also provided for performing homology identification, said method comprising the steps of: providing a first polypeptide sequence comprising the sequence of a polypeptide of the invention in a computer readable medium; and comparing said first polypeptide sequence to at least one second polynucleotide or polypeptide sequence to identify homology.

All publications and references, including but not limited to patents and patent applications, cited in this specification are herein incorporated by reference in their entirety as if each individual publication or reference were specifically and individually indicated to be incorporated by reference herein as being fully set forth. Any patent application to which this application claims priority is also incorporated by reference herein in its entirety in the manner described above for publications and references.
DEFINITIONS
"Identity," as known in the art, is a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as the case may be, as determined by comparing the sequences. In the art, "identity" also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as detenmined by the match between strings of such sequences. "Identity" can be readily calculated by known 1 ~ methods, including but not limited to those described in (Computational Molecular Biology, Lesk, A.M., ed., Oxford University Press, New York, 198$;
Biocomputing:
Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993;
Computer Analysis of Sequence Data, Part I, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heine, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM
J.
Applied Math., 48.~ 1073 (1988). Methods to determine identity are designed to give the largest match between the sequences tested. Moreover, methods to determine identity are codified in publicly available computer programs. Computer program methods to ?5 determine identity between two sequences include, but are not limited to, the GAP
program in the GCG program package (Devereux, J., et al., Nucleic Acids Research 12(1):
387 (1984)), BLASTP, BLASTN (Altschul, S.F. et al., J. Molec. Biol. 215: 403-( 1990), and FASTA( Pearson and Lipman Proc. Natl. Acad. Sci. USA 85; 2444-( 1988). The BLAST family of programs is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, MD 20894;
Altschul, S., et al., J. Mol. Biol. 215: 403-410 (1990). The well known Smith Waterman algorithm may also be used to determine identity.
Parameters for polypeptide sequence comparison include the following:
Algorithm: Needleman and Wunsch, J. Mol Biol. 48: 443-453 (I970) Comparison matrix: BLOSSUM62 from Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA. 89:10915-10919 (1992) Gap Penalty: 8 Gap Length Penalty: 2 A program useful with these parameters is publicly available as the "gap"
program from Genetics Computer Group, Madison WI. The aforementioned parameters are the default parameters for peptide comparisons (along with no penalty for end gaps).
Parameters for polynucleotide comparison include the following:
Algorithm: Needleman and Wunsch, J. Mol Biol. 48: 443-453 ( 1970) Comparison matrix: matches = +10, mismatch = 0 Gap Penalty: ~0 Gap Length Penalty: 3 Available as: The "gap" program from Genetics Computer Group, Madison WI.
These are the default parameters for nucleic acid comparisons.
A preferred meaning for "identity" for polynucleotides and polypeptides, as the case may ?5 be, are provided in (1) and (2) below.
( 1 ) Polynucleotide embodiments further include an isolated polynucleotide comprising a polynucleotide sequence having at least a 50, 60, 70, 80, 85, 90, 95, 97 or 100% identity to the reference sequence of SEQ ID NO:1, wherein said polynucleotide sequence may be identical to the reference sequence of SEQ ID NO:1 or may include up to a certain integer number of nucleotide alterations as compared to the reference sequence, wherein said alterations are selected from the group consisting of at least one S nucleotide deletion, substitution, including transition and transversion, or insertion, and wherein said alterations may occur at the S' or 3' terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among the nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence, and wherein said number of nucleotide alterations is determined by multiplying the total number of nucleotides in SEQ ID NO:1 by the integer defining the percent identity divided by 100 and then subtracting that product from said total number of nucleotides in SEQ ID NO:1, or:
nn ~ xn ' ~xn' Y) wherein nn is the number of nucleotide alterations, xn is the total number of nucleotides in SEQ ID NO:1, y is O.SO for SO%, 0.60 for 60%, 0.70 for 70%, 0.80 for 80%, 0.85 for 8S%, 0.90 for 90%, 0.95 for 9S%, 0.97 for 97% or 1.00 for 100%, and ~ is the symbol for the multiplication operator. and wherein any non-integer product of xn and y is rounded down to the nearest integer prior to subtracting it from xn. Alterations of a polynucleotide sequence encoding the polypeptide of SEQ ID N0:2 may create nonsense, missense or frameshift mutations in this coding sequence and thereby alter the polypeptide encoded by the polynucleotide following such alterations.
2S By way of example, a polynucleotide sequence of the present invention may be identical to the reference sequence of SEQ ID NO:1, that is it may be 100% identical, or it may include up to a certain integer number of nucleic acid alterations as compared to the reference sequence such that the percent identity is less than 100% identity.
Such alterations are selected from the group consisting of at least one nucleic acid deletion, substitution, including transition and transversion, or insertion, and wherein said alterations may occur at the 5' or 3' terminal positions of the reference polynucleotide sequence or anywhere between those terminal positions, interspersed either individually among the nucleic acids in the reference sequence or in one or more contiguous groups within the reference sequence. The number of nucleic acid alterations for a given percent identity is determined by multiplying the total number of nucleic acids in SEQ
ID NO:1 by the integer defining the percent identity divided by 100 and then subtracting that product from said total number of nucleic acids in SEQ ID NO:1, or:
nn ~ xn ' (xn' Y) wherein nn is the number of nucleic acid alterations, xn is the total number of nucleic acids in SEQ ID NO:1, y is, for instance 0.70 for 70%, 0.80 for 80%, 0.85 for 85% etc., 1 ~ is the symbol for the multiplication operator, and wherein any non-integer product of xn and y is rounded down to the nearest integer prior to subtracting it from xn.
(2) Polypeptide embodiments further include an isolated polypeptide comprising a polypeptide having at least a 50,60, 70, 80, 85, 90, 95, 97 or 100% identity to a polypeptide reference sequence of SEQ ID N0:2, wherein said polypeptide sequence may be identical to the reference sequence of SEQ ID N0:2 or may include up to a certain integer number of amino acid alterations as compared to the reference sequence, wherein said alterations are selected from the group consisting of at least one amino acid deletion, substitution, including conservative and non-conservative substitution, or insertion, and ?5 wherein said alterations may occur at the amino- or carboxy-terminal positions of the reference polypeptide sequence or anywhere between those terminal positions, interspersed either individually among the arriino acids in the reference sequence or in one or more contiguous groups within the reference sequence, and wherein said number of amino acid alterations is determined by multiplying the total number of amino acids in SEQ ID N0:2 by the integer defining the percent identity divided by 100 and then subtracting that product from said total number of amino acids in SEQ ID N0:2, or:
na ~ xa - ~xa ~ Y) wherein na is the number of amino acid alterations, xa is the total number of amino acids in SEQ ID N0:2, y is 0.50 for 50%, 0.60 for 60%, 0.70 for 70%, 0.80 for 80%, 0.85 for 85%, 0.90 for 90%, 0.95 for 95%, 0.97 for 97% or 1.00 for 100%, and ~ is the symbol for the multiplication opexator, and wherein any non-integer product of xa and y is rounded down to the nearest integer prior to subtracting it from xa.
By way of example, a polypeptide sequence of the present invention may be identical to the reference sequence of SEQ ID N0:2, that is it may be 100% identical, or it may include up to a certain integer number of amino acid alterations as compared to the reference sequence such that the percent identity is less than 100% identity.
Such alterations are selected from the group consisting of at least one amino acid deletion, substitution, including conservative and non-conservative substitution, or insertion, and wherein said alterations may occur at the amino- or carboxy-terminal positions of the reference polypeptide sequence or anywhere between those terminal positions, interspersed either individually among the amino acids in the reference sequence or in one or more contiguous groups within the reference sequence. The number of amino acid alterations for a given % identity is determined by multiplying the total number of amino acids in SEQ ID N0:2 by the integer defining the percent identity divided by 100 and 3~ then subtracting that product from said total number of amino acids in SEQ
ID N0:2, or:
na ~ xa - ~xa ~ Y) wherein na is the number of amino acid alterations, xa is the total number of amino acids in SEQ ID N0:2, y is, for instance 0.70 for 70%, 0.80 for 80%, 0.85 for 85%
etc., and ~ is the symbol for the multiplication operator, and wherein any non-integer product of xa and y is rounded down to the nearest integer prior to subtracting it from xa.
"Individual{s)," when used herein with reference to an organism, means a multicellular eukaryote, including, but not limited to a metazoan, a mammal, an ovid, a bovid, a simian, a primate, and a human.
"Isolated" means altered "by the hand of man" from its natural state, i.e., if it occurs in nature, it has been changed or removed from its original environment, or both.
For example, a polynucleotide or a polypeptide naturally present in a living organism is not "isolated," but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is "isolated", as the term is employed herein. Moreover, a polynucleotide or polypeptide that is introduced into an organism by transformation, genetic manipulation or by any other recombinant method is "isolated" even if it is still present in said organism, which organism may be living or non-living.
"Polynucleotide(s)" generally refers to any polyribonucleotide or polydeoxyribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA including single and double-stranded regions.
"Variant" refers to a polynucleotide or polypeptide that differs from a reference polynucleotide or polypeptide, but retains essential properties. A typical variant of a polynucleotide differs in nucleotide sequence from another, reference polynucleotide.
Changes in the nucleotide sequence of the variant may or may not alter the amino acid sequence of a polypeptide encoded by the reference polynucleotide. Nucleotide changes may result in amino acid substitutions, additions, deletions, fusions and truncations in the polypeptide encoded by the reference sequence, as discussed below. A
typical variant of a polypeptide differs in amino acid sequence from another, reference polypeptide. Generally, differences are limited so that the sequences of the reference polypeptide and the variant are closely similar overall and, in many regions, identical.
A variant and reference polypeptide may differ in amino acid sequence by one or more substitutions, additions, deletions in any combination. A substituted or inserted amino acid residue may or may not be one encoded by the genetic code. A variant of a polynucleotide or polypeptide may be a naturally occurring such as an allelic variant, or it may be a variant that is not known to occur naturally. Non-naturally occurring I 0 variants of polynucleotides and polypeptides may be made by mutagenesis techniques or by direct synthesis.
"Disease(s)" means any disease caused by or related to infection by a bacteria, including, for example, otitis media in infants and children, pneumonia in elderlies, sinusitis, 15 nosocomial infections and invasive diseases, chronic otitis media with hearing loss, fluid accumulation in the middle ear, auditive nerve damage, delayed speech learning, infection of the upper respiratory tract and inflammation of the middle ear.

EXAMPLES:
The examples below are carried out using standard techniques, which are well known and routine to those of skill in the art, except where otherwise described in detail. The examples are illustrative, but do not limit the invention.
Example 1:
Discovery and confirmatory DNA sequencing of the BASB009 gene from Moraxella catarrhalis strain ATCC 43617.
The BASB009 gene of SEQ ID NO:1 was first discovered in the Incyte PathoSeq data base containing unfinished genomic DNA sequences of the Moraxella catarrhalis strain ATCC 43617 (also referred to as strain Mc2931 ). The translation of the polynucleotide sequence, shown in SEQ ID N0:2, showed significant similarity (27 identity in a 237 amino acids overlap) to the TIyC hemolysin protein of Serpulina hyodysenteriae.
The sequence of the BASB009 gene was further confirmed experimentally. For this purpose, genomic DNA was extracted from 10'° cells of the M.
catarrhalis cells (strain ATCC 43617) using the QIAGEN genomic DNA extraction kit (Qiagen Gmbh), and 1 pg of this material was submitted to Polymerase Chain Reaction DNA
amplification using primers E475777a (5'-GCC TGA GGA TAT CAT GCC AG-3') [SEQ ID N0:9]
and E475778a (5'-GTG TAT TTG ATG CCA TAC AGG-3') [SEQ ID NO:10]. This PCR product was purified on a Biorobot 9600 (Qiagen Gmbh) apparatus and subjected to DNA sequencing using the Big Dye Cycle Sequencing kit (Perkin-Elmer) and an ABI
377/PRISM DNA sequencer. DNA sequencing was performed on both strands with a redundancy of 2 and the full-length sequence was assembled using the SequencherTM
software (Applied Biosytems). The resulting DNA sequence turned out to be 100 identical to SEQ ID NO:1.

Example 2:
Variability analysis of the BASB009 gene among several Moraxella catarrhalis strains.
2A: Restriction Fragment Length Analysis (RFLP).
Genomic DNA was extracted from 16 M. catarrhalis strains (presented in table 1) as described below. M. catarrhalis was streaked for single colonies on BHI agar plates and grown overnight at 37°C. Three or four single colonies were picked and used to inoculate a ~l.Sml BHi (Brain-heart infusion) broth seed culture which was grown overnight in a shaking incubator, ~300rpm, at 37°C. A SOOmI erlenmeyer flask containing ~150m1 of BHI broth was inoculated with the seed culture and grown for ~12-16 hours at 37°C in a shaking incubator, 175 rpm, to generate cell mass for DNA
isolation. Cells were collected by centrifugation in a Sorvall GSA rotor at ~2000xg for 15 minutes at room temperature. The supernatant was removed and the cell pellet suspended in ~S.OmI of sterile water. An equal volume of lysis buffer (200mM
NaCI, 20mM EDTA, 40mM Tris-Hcl, pH 8.0, 0.5% (w/v) SDS, 0.5% (vlv) 2-mercaptoethanol, and 250pg/ml of proteinase K) was added and the cells suspended by gentle agitation and trituration. The cell suspension was then incubated ~12 hours at 50°C to lyse the bacteria and liberate chromosomal DNA. Proteinaceous material was precipitated by the addition of S.OmI of saturated NaCI (~6.0 M, in sterile water) and centrifugation at ~S,SOOxg in a Sorvall SS34 rotor at room temperature.
Chromosomal DNA was precipitated from the cleared supernatant by the addition of two volumes of 100% ethanol. Aggregated DNA was collected and washed using gentle agitation in a 2~ small volume of a 70% ethanol solution. Purified chromosomal DNA was suspended in sterile water and allowed to dissolve/.disburse overnight at 4°C by gentle rocking. The concentration of dissolved DNA was determined spectrophotometrically at 260nm using an extinction coe~cient of 1.0 O.D. unit ~SOpg/ml.
This material was next submitted to PCR amplification using the MC-Hlyl-BamF
(5' AAG GGC CCA ATT ACG CAG AGG GGA TCC GAA ATT GCT TTG GCA GGT
TCA AGA AAA ATC AAA C-3') [SEQ ID NO:11] and MC-Hlyl-SaIRC (5'-AAG
GGC CCA ATT ACG CAG AGG GTC GAC TTA TTA GTC TTC GTG CTT GGG
CAG TTG CTC TAG GCG-3') [SEQ ID N0:12] oligonucleotides. The corresponding BASB009 gene amplicons were then subjected independantly to hydrolysis using restriction enzymes (Alul, Maelll, Msel, Nlalll, Rsal, Sau3AlJ and restriction products were separated by agarose or polyacrylamide gel electrophoresis using standard molecular biology procedures as described in "Molecular Cloning, a Laboratory Manual, Second Edition, Eds: Sambrook, Fritsch & Maniatis, Cold Spring Harbor press 1989". The photographs of the resulting electrophoresis gels are displayed in Figure I .
For each strain, RFLP patterns corresponding to the 6 restriction enzymes were scored and combined. Groups of strains sharing identical combination of RFLP patterns were then defined. Using this methodology, the strains tested in this study fell into 4 genomic groups (Group I: Mc2912; Group 2: Mc2904, Mc2905, Mc2906, Mc2907, Mc2908, Mc2909, Mc2913, Mc2926, Mc2931; Group 3; Mc2911; Group 4: Mc2910, Mc2912).
These RFLP data support that all the Moraxella catarrhalis strains used in this study display limited nucleotide sequence diversity for the BASB009 gene.
2B: DNA sequencing in other strains.
Using the experimental procedure described in Example 1, the sequence of the BASB009 gene was also determined for three additional Moraxella catarrhalis strains.
The nucleotide sequences of the BASB009 gene of the strains Mc2912 and Mc2913 and Mc2969 are shown in SEQ ID N0:3, 5 and 7, respectively. These nucleotide sequences were translated into amino acid sequences, which are shown in SEQ ID N0:4, 6 and 8, respectively. Using the MegAlign program from the DNASTAR Lasergene package, a multiple alignment of the nucleotide sequences of SEQ ID NO:1, 3, 5 and 7 was performed, and is displayed in Figure 2. A pairwise comparison of identities is summarized in Table 2, showing that the four BASB009 nucleotide gene sequences are all similar at a identity level greater than 99% . Using the same program, a multiple alignment of the protein sequences of SEQ ID N0:2, 4, 6 and 8 was performed, and is displayed in Figure 3. A pairwise comparison of identities is summarized in Table 3, showing that the four BASB009 protein sequences are all similar at a identity level greater than 99 %. Taken together, these data indicate very strong sequence conservation of the BASB009 gene among Moraxella catarrhalis strains.
Table 1: Features of the Moraxella catarrhalis strains used in this study Strain Isolated from:
in:

_ Mc2904 USA Tympanocentesis Mc2905 USA Tympanocentesis Mc2906 USA Tympanocentesis Mc2907 USA Tympanocentesis Mc2908 USA ACUte otitis Tympanocentesis Mc2909 USA Tympanocentesis Mc2910 USA Tympanocentesis Mc2911 USA ACUte OtitlS Tympanocentesis Mc2912 USA Acute OtltiS Tympanocentesis Mc2913 USA Acute otitis Tympanocentesis Mc2926 USA ATCC49143 Mc2931 USA Transtracheal aspirate /ATCC

Mc2956 Finland Middle ear fluid Mc2960 Finland Middle ear fluid Mc2969 Norway Nasopharynx(Pharyngitis-Rhinitis) Mc2975 Norwav Nasopharynx (Rhinitis) Table 2: Pairwise identities of the BASB009 polynucleotide sequences ( in % ) SeqID No:3SeqID No:SSeqID No:7 SeqID No:l99.5 99.9 99.5 SeqID No:3 99.4 99.9 SeqID No:S 99.5 Table 3. Pairwise identities of the BASB009 polypeptide sequences ( in % ) SeqID No:4SeqID No:6SeqID No:8 SeqID No:299.8 100. 100.

SeqID No:4 99.8 99.8 SeqID No:6 100.

Example 3: Efficacy of BASB09 vaccine: enhancement of lung clearance of M.
catarrhalis in mice.
Recombinant BASB09 protein was expressed in E. toll as a 6xHis tag fusion protein and was purified by Ni2+ -loaded Hitrap affinity chromatography (Pharmacia Biotech).
The protective capacity of the purified recombinant BASB09 protein can be evaluated 1 ~ in a mouse model.
This mouse model is based on the analysis of the lung invasion by M.
catarrhalis following a standard intranasal challenge to vaccinated mice.
Groups of 6 BALB/c mice (females, 6 weeks old) are immunized subcutaneously with 100.1 of vaccine corresponding to a l Opg dose and are boosted 2 weeks later.
One week after the booster, the mice are challenged by instillation of 50 ~l of bacterial suspension (+/-10° CFU/50 ~,1) into the left nostril under anaesthesia (mice are anaesthetised with a combination of ketamine and xylazine anaesthetics, 0.24 mg xylazine (Rompun) and 0.8 mg ketamine (Imalgene)/100 ~l). Mice are killed 4 hours after challenge and the lungs are removed aseptically and homogenized individually. The log 10 weighted mean number of CFU/lung is determined by counting the colonies grown on Mueller-Hinton agar plates after plating of 20 pl of 5 serial dilutions of the homogenate.
The arithmetic mean of the 1og10 weighted mean number of CFU/lung and the standard deviations are calculated for each group.
Results are analysed statistically by applying 1-way ANOVA after assuming equality of variance (checked by Brown and Forsythe's test) and normality (checked using the Shapiro-Wilk test). Differences between groups were analysed using the Dunnet test, Tukey's studentised range test (HSD) and Student-Newman-Keuls test.

Deposited materials A deposit containing a Mcraxella catarrhalis Catlin strain has been deposited with the American Type Culture Collection (herein "ATCC") on June 21, 1997 and assigned deposit number 43617.
The deposit was described as Branhamella catarrhalis (Frosch and Kolle) and is a freeze-dried, 1.5-2.9 kb insert library constructed from M. catanrhalis isolate obtained from a transtracheal aspirate of a coal miner with chronic bronchitits. The deposit is described in Antimicrob.
Agents Chemother.
21: 506-508 ( 1982).
The Moraxella catarrhali.s strain deposit is referred to herein as "the deposited strain" or as "the DNA of the deposited strain."
The deposited strain contains a full lengthBASB009 gene.
A deposit of the vector pMC-Hlyl consisting ofMoraxella catarrhalis DNA
inserted in pQE30 has been deposited with the American Type Culture Collection (ATCC) on February 12 1999 and assigned deposit number 207104.
The sequence of the polynucleotides contained in the deposited strain / clone, as well as the amino acid sequence of any polypeptide encoded thereby, are controlling in the event of any conflict with any description of sequences herein.
The deposit of the deposited strains have been made under the terms of the Budapest Treaty on the lntemational Recognition of the Deposit of Micro-organisms for Purposes of Patent Procedure. The deposited strains will be irrevocably and without restriction or condition released to the public upon the issuance of a patent. The deposited strains are provided merely as convenience to those of skill in the art and are not an admission that a deposit is required for enablement, such as that required under 35 U.S.C. ~ 112.

SEQUENCE LISTING
<110> SmithKline Heecham Biologicals S.A.
<120> Novel Compounds <130> BM45317 <160> 12 <170> FastSEQ for Windows Version 3.0 <210> 1 <211> 1323 <212> DNA
<213> Bacteria <400> 1 atgggtgttactgtgagtttgtttcaaaactttatgattattcttgtactgattttgaca60 tcgagttttttctcgatttcagaaattgctttggcaggttcaagaaaaatcaaacttaaa120 ttactggcagaatcaggcgatgaccgtgccgagaaagtcttaaaattgcaagaaaattca180 gctgatttttttgccacttcacaaattggcctaaatgctgtcgccattttgggcggttcg240 gttggtgaaagtgccttgcgtccttatttttccgaatggattggcttggtatatcaaggg300 atttggcttgacagcatcgcttttttttcgtcgtttgttttggtaacactgctatttatt360 ttatatgctgacctgattcccaaacgcattgcaatgattaatcctgagcgagtggctttg420 gtggtcatcaatccgattttatggacaattcgtgtggtcaagcccttggcatggatcatc480 aataccatcgcagatgtgacttttcggctttttaaatttgatacggctcgtgatgacagt540 atcacctttgatgatatttctgccattgttgatgctggggcagaggctggcgttttgatg600 gaacaagaacagcactttatcgaaaatgtttttgaacttgaagaacgcaccgtgccatca660 tcgatgacggctcgtgaggatgtggtatattttgcactcagtgaaagcgaggagagtatt720 cgtcaaaagattgccgattatccttattctaaatttttggtctgtaatgagcatatcgac780 caagtcatcggttatgtcgataccaaggatattttggtacgaattttaagcgaacagcca840 atttttcagctgaatgaatctaccattcgtaatgtactgattattccagatacactcact900 ttatccgagcttttggataaatttcgtgccagtaatgaaaaaatggcggtagtcattaat960 gaatatgcattggttgttgggctaattacactatcagatattatgatgactgtcatgggc1020 gattgggcagccgctgagcctgaagatttacaaatcattcgccgtgatgaaaattcatgg1080 WO 99/58562 PC'T/EP99/83262 ctgattgatgggattacgccgattgatgatgttaaacatgcccttgatattaatgagttt1140 cctgattgggatcactatgagacgctggcgggctttattatgtatcgcctgcgtaagatt1200 ccacgccctgcagactgggtagagcatgagggctttaaatttgaggtggtagatatcgac1260 cattataagattgaccaacttttggtaactcgcctagagcaactgcccaagcacgaagac1320 taa 1323 c210> 2 <211> 440 <212> PRT
<213> Bacteria <400> 2 Met Gly Val Thr Val Ser Leu Phe Gln Asn Phe Met Ile Ile Leu Val Leu Ile Leu Thr Ser Ser Phe Phe Ser Ile Ser Glu Ile Ala Leu Ala Gly Ser Arg Lys Ile Lys Leu Lys Leu Leu Ala Glu Ser Gly Asp Asp Arg Ala Glu Lys Val Leu Lys Leu Gln Glu Asn Ser Ala Asp Phe Phe Ala Thr Ser Gln Ile Gly Leu Asn Ala Val Ala Ile Leu Gly Gly Ser Val Gly Glu Ser Ala Leu Arg Pro Tyr Phe Ser Glu Trp Ile Gly Leu Val Tyr Gln Gly Ile Trp Leu Asp Ser Ile Ala Phe Phe Ser Ser Phe Val Leu Val Thr Leu Leu Phe Ile Leu Tyr Ala Asp Leu Ile Pro Lys Arg Ile Ala Met Ile Asn Pro Glu Arg Val Ala Leu Val Val Ile Asn Pro Ile Leu Trp Thr Ile Arg Val Val Lys Pro Leu Ala Trp Ile Ile Asn Thr Ile Ala Asp Val Thr Phe Arg Leu Phe Lys Phe Asp Thr Ala Arg Asp Asp Ser Ile Thr Phe Asp Asp Ile Ser Ala Ile Val Asp Ala Gly Ala Glu Ala Gly Val Leu Met Glu Gln Glu Gln His Phe Ile Glu Asn Val Phe Glu Leu Glu Glu Arg Thr Val Pro Ser Ser Met Thr Ala Arg Glu Asp Val Val Tyr Phe Ala Leu Ser Glu Ser Glu Glu Ser Ile Arg Gln Lys Ile Ala Asp Tyr Pro Tyr Ser Lys Phe Leu Val Cys Asn Glu His Ile Asp Gln Val Ile Gly Tyr Val Asp Thr Lys Asp Ile Leu Val Arg Ile Leu Ser Glu Gln Pro Ile Phe Gln Leu Asn Glu Ser Thr Ile Arg Asn Val Leu Ile Ile Pro Asp Thr Leu Thr Leu Ser Glu Leu Leu Asp Lys Phe Arg Ala Ser Asn Glu Lys Met Ala Val Val Ile Asn Glu Tyr Ala Leu Val Val Gly Leu Ile Thr Leu Ser Asp Ile Met Met Thr Val Met Gly Asp Trp Ala Ala Ala Glu Pro Glu Asp Leu Gln Ile Ile Arg Arg Asp Glu Asn Ser Trp Leu Ile Asp Gly Ile Thr Pro Ile Asp Asp Val Lys His Ala Leu Asp Ile Asn Glu Phe Pro Asp Trp Asp His Tyr Glu Thr Leu Ala Gly Phe Ile Met Tyr Arg Leu Arg Lys Ile Pro Arg Pro Ala Asp Trp Val Glu His Glu Gly Phe Lys Phe Glu Val Val Asp Ile Asp His Tyr Lys Ile Asp Gln Leu Leu Val Thr Arg Leu Glu Gln Leu Pro Lys His Glu Asp <210> 3 <211> 1323 <212> DNA
<213> Bacteria <400> 3 atgggtgtta ctgtgagttt gtttcaaaac tttatgatta ttcttgtact gattttgaca 60 tcgagttttt tctcgatttc agaaattgct ttggcaggtt caagaaaaat caaacttaaa 120 ttactggcag aatcaggcga tgaccgtgcc gagaaagtct tgaaattgca agaaaattca 180 gctgatttttttgccacttcacaaattggcctaaatgctgtcgccattttgggcggttcg240 gttggtgaaagtgccttgcgtccttattttCccgaatggattggcttggtatatcaaggg300 atttggcttgacagcatcgcttttttttcgtcgtttgttttggtaacactgctatttatt360 ttatatgctgacctgattcccaaacgcattgcaatgattaatcctgagcgagtggctttg420 gtggtcatcaatccgattttgtggacaattcgtgtggtcaagcccttggcatggattatc480 aataccatcgcagatgtgacttttcggttttttaaatttgatacggctcgtgatgacagt540 atcacctttgatgatatttctgccattgttgatgctggggcagaggctggcgttctgatg600 gaacaagaacaacattttatcgaaaatgtttttgaacttgaagaacgcaccgtgccatca660 tcgatgacggctcgtgaggatgtggtatattttgcactcagtgaaagcgaggagagtatt720 cgtcaaaagattgccgattatccttattctaaatttttggtctgtaatgagcatatcgac780 caagtcatcggttatgtcgataccaaggatattttggtacgaattttaagcgaacagcca840 atttttcagctgaatgaatctaccattcgtaatgtactgattattccagatacactcact900 ttatccgagcttttggataaatttcgtgccagtaatgaaaaaatggcggtagtcattaat960 gaatatgcattggttgttgggctaattacactatcagatattatgatgactgtcatgggc1020 gattgggcagccgctgagcctgaagatttacaaatcattcgccgtgatgaaaattcatgg1080 ctgattgatgggattacgccgattgatgatgttaaacatgcccttgatattaatgagttt1140 cctgattgggatcactatgagacgctggcgggctttattatgtatcgcctgcgtaagatt1200 ccacgccctgcagactgggtagagcatgagggctttaaatttgaggtggtagatatcgac1260 cattataagattgaccaacttttggtaactcgcctagagcaactgcccaagcacgaagac1320 taa <210> 4 <211> 440 <212> PRT
<213> Bacteria <400> 4 Met Gly Val Thr Val Ser Leu Phe Gln Asn Phe Met Ile Ile Leu Val Leu Ile Leu Thr Ser Ser Phe Phe Ser Ile Ser Glu Ile Ala Leu Ala Gly Ser Arg Lys Ile Lys Leu Lys Leu Leu Ala Glu Ser Gly Asp Asp Arg Ala Glu Lys Val Leu Lys Leu Gln Glu Asn Ser Ala Asp Phe Phe Ala Thr Ser Gln Ile Gly Leu Asn Ala Val Ala Ile Leu Gly Gly Ser Val Gly Glu Ser Ala Leu Arg Pro Tyr Phe Ser Glu Trp Ile Gly Leu WO 99/58562 PC1'/EP99/032b2 Val Tyr Gln Gly Ile Trp Leu Asp Ser Ile Ala Phe Phe Ser Ser Phe Val Leu Val Thr Leu Leu Phe Ile Leu Tyr Ala Asp Leu Ile Pro Lys Arg Ile Ala Met Ile Asn Pro Glu Arg Val Ala Leu Val Val Ile Asn Pro Ile Leu Trp Thr Ile Arg Val Val Lys Pro Leu Ala Trp Ile Ile Asn Thr Ile Ala Asp Val Thr Phe Arg Phe Phe Lys Phe Asp Thr Ala Arg Asp Asp Ser Ile Thr Phe Asp Asp Ile Ser Ala Ile Val Asp Ala Gly Ala Glu Ala Gly Val Leu Met Glu Gln Glu Gln His Phe Ile Glu Asn Val Phe Glu Leu Glu Glu Arg Thr Val Pro Ser Ser Met Thr Ala Arg Glu Asp Val Val Tyr Phe Ala Leu Ser Glu Ser Glu Glu Ser Ile Arg Gln Lys Ile Ala Asp Tyr Pro Tyr Ser Lys Phe Leu Val Cys Asn Glu His Ile Asp Gln Val Ile Gly Tyr Val Asp Thr Lys Asp Ile Leu Val Arg ile Leu Ser Glu Gln Pro Ile Phe Gln Leu Asn Glu Ser Thr Ile Arg Asn Val Leu Ile Ile Pro Asp Thr Leu Thr Leu Ser Glu Leu Leu Asp Lys Phe Arg Ala Ser Asn Glu Lys Met Ala Val Val Ile Asn Glu Tyr Ala Leu Val Val Gly Leu Ile Thr Leu Ser Asp Ile Met Met Thr Val Met Gly Asp Trp Ala Ala Ala Glu Pro Glu Asp Leu Gln Ile Ile Arg Arg Asp Glu Asn Ser Trp Leu Ile Asp Gly Ile Thr Pro Ile Asp Asp Val Lys His Ala Leu Asp Ile Asn Glu Phe Pro Asp Trp Asp His Tyr Glu Thr Leu Ala Gly Phe Ile Met Tyr Arg Leu Arg Lys Ile Pro Arg Pro Ala Asp Trp Val Glu His Glu Gly Phe Lys Phe Glu Val Val Asp Ile Asp His Tyr Lys Ile Asp Gln Leu Leu Val Thr Arg Leu Glu Gln Leu Pro Lys His Glu Asp <210> 5 <211> 1323 <212> DNA
<213> Bacteria <400> 5 atgggtgttactgtgagtttgtttcaaaactttatgattattcttgtactgattttgaca60 tcgagttttttctcgatttcagaaattgctttggcaggttcaagaaaaatcaaacttaaa120 ttactggcagaatcaggcgatgaccgtgccgagaaagtcttaaaattgcaagaaaattca180 gctgatttttttgccacttcacaaattggcctaaatgctgtcgccattttgggcggttcg240 ' gttggtgaaagtgccttgcgtccttatttttccgaatggattggcttggtatatcaaggg300 atttggcttgacagcatcgcttttttttcgtcgtttgttttggtaacactgctatttatt360 ttatatgctgacctgattcccaaacgcattgcaatgattaatcctgagcgagtggctttg420 gtggtcatcaatccgattttatggacaattcgtgtggtcaagcccttggcatggatcatc480 aataccatcgcagatgtgacttttcggctttttaaatttgatacggctcgtgatgacagt540 atcacctttgatgatatttctgccattgttgatgctggggcagaggctggcgttttgatg600 gaacaagaacagcactttatcgaaaatgtttttgaacttgaagaacgcaccgtgccatca660 tcgatgacggctcgtgaggatgtggtatattttgcactcagtgaaagcgaggagagtatt720 cgtcaaaagattgccgattatccttattctaaatttttggtctgtaatgagcatatcgac780 caagtcatcggttatgtcgataccaaggatattttggtacgaattttaagcgaacagcca840 atttttcagctgaatgaatctaccattcgaaatgtactgattattccagatacactcact900 ttatccgagcttttggataaatttcgtgccagtaatgaaaaaatggcggtagtcattaat960 gaatatgcattggttgttgggctaattacactatcagatattatgatgactgtcatgggc1020 gattgggcagccgctgagcctgaagatttacaaatcattcgccgtgatgaaaattcatgg1080 ctgattgatgggattacgccgattgatgatgttaaacatgcccttgatattaatgagttt1140 cctgattgggatcactatgagacgctggcgggctttattatgtatcgcctgcgtaagatt1200 ccacgccctgcagactgggtagagcatgagggctttaaatttgaggtggtagatatcgac1260 cattataagattgaccaacttttggtaactcgcctagagcaactgcccaagcacgaagac1320 taa <210> 6 <211> 439 <212> PRT

<213> Bacteria <400> 6 Met Gly Val Thr Val Ser Leu Phe Gln Asn Phe Met Ile Ile Leu Val Leu Ile Leu Thr Ser Ser Phe Phe Ser Ile Ser Glu Ile Ala Leu Ala Gly Ser Arg Lys Ile Lys Leu Lys Leu Leu Ala Glu Ser Gly Asp Asp Arg Ala Glu Lys Val Leu Lys Leu Gln Glu Asn Ser Ala Asp Phe Phe Ala Thr Ser Gln Ile Gly Leu Asn Ala Val Ala Ile Leu Gly Gly Ser Val Gly Glu Ser Ala Leu Arg Pro Tyr Phe Ser Glu Trp Ile Gly Leu Val Tyr Gln Gly Ile Trp Leu Asp Ser Ile Ala Phe Phe Ser Ser Phe Val Leu Val Thr Leu Leu Phe Ile Leu Tyr Ala Asp Leu Ile Pro Lys Arg Ile Ala Met Ile Asn Pro Glu Arg Val Ala Leu Val Val Ile Asn Pro Ile Leu Trp Thr Ile Arg Val Val Lys Pro Leu Ala Trp Ile Ile Asn Thr Ile Ala Asp Val Thr Phe Arg Leu Phe Lys Phe Asp Thr Ala Arg Asp Asp Ser Ile Thr Phe Asp Asp Ile Ser Ala Ile Val Asp Ala Gly Ala Glu Ala Gly Val Leu Met Glu Gln Glu Gln His Phe Ile Glu Asn Val Phe Glu Leu Glu Glu Arg Thr Val Pro Ser Ser Met Thr Ala Arg GIu Asp Val Val Tyr Phe Ala Leu Ser Glu Ser Glu Glu Ser Ile Arg Gln Lys Ile Ala Asp Tyr Pro Tyr Ser Lys Phe Leu Val Cys Asn Glu His Ile Asp Gln Val Ile Gly Tyr Val Asp Thr Lys Asp Ile Leu Val Arg Ile Leu Ser Glu Gln Ile Phe Gln Leu Asn Glu Ser Thr Ile WO 99158562 PCT/EP99l03262 Arg Asn Val Leu Ile Ile Pro Asp Thr Leu Thr Leu Ser Glu Leu Leu Asp Lys Phe Arg Ala Ser Asn Glu Lys Met Ala Val Val Ile Asn Glu Tyr Ala Leu Val Val Gly Leu Ile Thr Leu Ser Asp Ile Met Met Thr Val Met Gly Asp Trp Ala Ala Ala Glu Pro Glu Asp Leu Gln Ile Ile Arg Arg Asp Glu Asn Ser Trp Leu Ile Asp Gly Ile Thr Pro Ile Asp Asp Val Lys His Ala Leu Asp Ile Asn Glu Phe Pro Asp Trp Asp His Tyr Glu Thr Leu Ala Gly Phe Ile Met Tyr Arg Leu Arg Lys Ile Pro Arg Pro Ala Asp Trp Val Glu His Glu Gly Phe Lys Phe Glu Val Val Asp Ile Asp His Tyr Lys Ile Asp Gln Leu Leu Val Thr Arg Leu Glu Gln Leu Pro Lys His Glu Asp <210> 7 <211> 1323 <212> DNA
<213> Bacteria <400>

atgggtgttactgtgagtttgtttcaaaactttatgattattcttgtactgattttgaca60 tcgagttttttctcgatttcagaaattgctttggcaggttcaagaaaaatcaaacttaaa120 ttactggcagaatcaggcgatgaccgtgccgagaaagtcttgaaattgcaagaaaattca180 gctgatttttttgccacttcacaaattggcctaaatgctgtcgccattttgggcggttcg240 gttggtgaaagtgccttgcgtccttatttttccgaatggattggcttggtatatcaaggg300 atttggcttgacagcatcgcttttttttcgtcgtttgttttggtaacactgctatttatt360 ttatatgctgacctgattcccaaacgcattgcaatgattaatcctgagcgagtggctttg420 gtggtcatcaatccgattttgtggacaattcgtgtggtcaagcccttggcatggattatc480 aataccatcgcagatgtgacttttcggctttttaaatttgatacggctcgtgatgacagt540 atcacctttgatgatatttctgccattgttgatgctggggcagaggctggcgttctgatg600 gaacaagaacaacattttatcgaaaatgtttttgaacttgaagaacgcaccgtgccatca660 tcgatgacggctcgtgaggatgtggtatattttgcactcagtgaaagcgaggagagtatt720 g WO 99/58562 PCT/EP99/032b2 cgtcaaaagattgccgattatccttattctaaatttttggtctgtaatgagcatatcgac780 caagtcatcggttatgtcgataccaaggatattttggtacgaattttaagcgaacagcca840 atttttcagctgaatgaatctaccattcgtaatgtactgattattccagatacactcact900 ttatccgagcttttggataaatttcgtgccagtaatgaaaaaatggcggtagtcattaat960 gaatatgcattggttgttgggctaattacactatcagatattatgatgactgtcatgggc1020 gattgggcagccgctgagcctgaagatttacaaatcattcgccgtgatgaaaattcatgg1080 ctgattgatgggattacgccgattgatgatgttaaacatgcccttgatattaatgagttt1140 cctgattgggatcactatgagacgctggcgggctttattatgtatcgcctgcgtaagatt1200 ccacgccctgcagactgggtagagcatgagggctttaaatttgaggtggtagatatcgac1260 cattataagattgaccaacttttggtaactcgcctagagcaactgcccaagcacgaagac1320 taa <210> 8 <211> 439 <212> PRT
<213> Bacteria <400> 8 Met Gly Val Thr Val Ser Leu Phe Gln Asn Phe Met Ile Ile Leu Val Leu Ile Leu Thr Ser Ser Phe Phe Ser Ile Ser Glu Ile Ala Leu Ala Gly Ser Arg Lys Ile Lys Leu Lys Leu Leu Ala Glu Ser Gly Asp Asp Arg Ala Glu Lys Val Leu Lys Leu Gln Glu Asn Ser Ala Asp Phe Phe Ala Thr Ser Gln Ile Gly Leu Asn Ala Val Ala Ile Leu Gly Gly Ser 65 70 75 gp Val Gly Glu Ser Ala Leu Arg Pro Tyr~Phe Ser Glu Trp Ile Gly Leu Val Tyr Gln Gly Ile Trp Leu Asp Ser Ile Ala Phe Phe Ser Ser Phe Val Leu Val Thr Leu Leu Phe Ile Leu Tyr Ala Asp Leu Ile Pro Lys Arg Ile Ala Met Ile Asn Pro Glu Arg Val Ala Leu Val Val Ile Asn Pro Ile Leu Trp Thr Ile Arg Val Val Lys Pro Leu Ala Trp Ile Ile Asn Thr Ile Ala Asp Val Thr Phe Arg Leu Phe Lys Phe Asp Thr Ala WO 99/58562 PCf/EP99/03262 Arg Asp Asp Ser Ile Thr Phe Asp Asp Ile Ser Ala Ile Val Asp Ala Gly Ala Glu Ala Gly Val Leu Met Glu Gln Glu Gln His Phe Ile Glu Asn Val Phe Glu Leu Glu Glu Arg Thr Val Pro Ser Ser Met Thr Ala Arg Glu Asp Val Val Tyr Phe Ala Leu Ser Glu Ser Glu Glu Ser Ile Arg Gln Lys Ile Ala Asp Tyr Pro Tyr Ser Lys Phe Leu Val Cys Asn Glu His Ile Asp Gln Val Ile Gly Tyr Val Asp Thr Lys Asp Ile Leu Val Arg Ile Leu Ser Glu Gln Pro Ile Phe Gln Leu Asn Glu Ser Thr Ile Arg Asn Val Leu Ile Ile Pro Asp Thr Leu Thr Leu Ser Glu Leu Leu Asp Lys Phe Arg Ala Ser Asn Glu Lys Met Ala Val Val Ile Asn Glu Tyr Ala Leu Val Val Gly Leu Ile Thr Leu Ser Asp Ile Met Met Thr Val Met Gly Asp Trp Ala Ala Ala Glu Pro Glu Asp Gln Ile Ile Arg Arg Asp Glu Asn Ser Trp Leu Ile Asp Gly Ile Thr Pro Ile Asp Asp Val Lys His Ala Leu Asp Ile Asn Glu Phe Pro Asp Trp Asp His Tyr Glu Thr Leu Ala Gly Phe Ile Met Tyr Arg Leu Arg Lys Ile Pro Arg Pro Ala Asp Trp Val Glu His Glu Gly Phe Lys Phc Glu Val Val Asp Ile Asp His Tyr Lys Ile Asp Gln Leu Leu Val Thr Arg Leu Glu Gln Leu Pro Lys His Glu Asp <210> 9 <211> 20 <212> DNA

<213> Artificial Sequence <220>
c223> Oligonucleotide <400> 9 gcctgaggat atcatgccag 20 <210> 10 <211> 21 <212> DNA
<213> Artificial Sequence <220>
c223> Oligonucleotide <400> 10 gtgtatttga tgccatacag g 21 <210> 11 <211> 61 <212> DNA
<213> Artificial Sequence <220>
c223> Oligonucleotide <400> 11 aagggcccaa ttacgcagag gggatccgaa attgctttgg caggttcaag aaaaatcaaa 60 c 61 <210> 12 <211> 63 <212> DNA
<213> Artificial Sequence <220>
<223> oligonucleotide <400> 12 aagggcccaa ttacgcagag ggtcgactta ttagtcttcg tgcttgggca gttgctctag 60 gcg 63 SEQUENCE INFORMATION
BASB009 Polynucleotide and Polypeptide Sequences SEQ ID NO:1 Moraxella catarrhalis BASB009 polynucleotide sequence from strain MC2931 ATGGGTGTTACTGTGAGTTTGTTTCAAAACTTTATGATTATTCTTGTACTGATTTTGACA
TCGAGTTTTTTCTCGATTTCAGAAATTGCTTTGGCAGGTTCAAGAAAAATCAAACTTAAA
TTACTGGCAGAATCAGGCGATGACCGTGCCGAGAAAGTCTTAAAATTGCAAGAAAATTCA
GCTGATTTTTTTGCCACTTCACAAATTGGCCTAAATGCTGTCGCCATTTTGGGCGGTTCG
GTTGGTGAAAGTGCCTTGCGTCCTTATTTTTCCGAATGGATTGGCTTGGTATATCAAGGG
ATTTGGCTTGACAGCATCGCTTTTTTTTCGTCGTTTGTTTTGGTAACACTGCTATTTATT
TTATATGCTGACCTGATTCCCAAACGCATTGCAATGATTAATCCTGAGCGAGTGGCTTTG
GTGGTCATCAATCCGATTTTATGGACAATTCGTGTGGTCAAGCCCTTGGCATGGATCATC
AATACCATCGCAGATGTGACTTTTCGGCTTTTTAAATTTGATACGGCTCGTGATGACAGT
ATCACCTTTGATGATATTTCTGCCATTGTTGATGCTGGGGCAGAGGCTGGCGTTTTGATG
GAACAAGAACAGCACTTTATCGAAAATGTTTTTGAACTTGAAGAACGCACCGTGCCATCA
TCGATGACGGCTCGTGAGGATGTGGTATATTTTGCACTCAGTGAAAGCGAGGAGAGTATT
CGTCAAAAGATTGCCGATTATCCTTATTCTAAATTTTTGGTCTGTAATGAGCATATCGAC
CAAGTCATCGGTTATGTCGATACCAAGGATATTTTGGTACGAATTTTAAGCGAACAGCCA
ATTTTTCAGCTGAATGAATCTACCATTCGTAATGTACTGATTATTCCAGATACACTCACT
TTATCCGAGCTTTTGGATAAATTTCGTGCCAGTAATGAAAAAATGGCGGTAGTCATTAAT
GAATATGCATTGGTTGTTGGGCTAATTACACTATCAGATATTATGATGACTGTCATGGGC
GATTGGGCAGCCGCTGAGCCTGAAGATTTACAAATCATTCGCCGTGATGAAAATTCATGG
CTGATTGATGGGATTACGCCGATTGATGATGTTAAACATGCCCTTGATATTAATGAGTTT
CCTGATTGGGATCACTATGAGACGCTGGCGGGCTTTATTATGTATCGCCTGCGTAAGATT
CCACGCCCTGCAGACTGGGTAGAGCATGAGGGCT~"TAAATTTGAGGTGGTAGATATCGAC
CATTATAAGATTGACCAACTTTTGGTAACTCGCCTAGAGCAACTGCCCAAGCACGAAGAC
TAA
SEQ ID N0:2 Moraxella catarrhalis BASB009 polypeptide sequence from strain MC2931 MGVTVSLFQNFMIILVLILTSSFFSISEIALAGSRKIKLKLLAESGDDRAEKVLKLQENS
ADFFATSQIGLNAVAILGGSVGESALRPYFSEWIGLWQGIWLDSIAFFSSFVLVTLLFI
LYADLIPKRIAMINPERVALWINPILWTIRVVKPLAWIINTIADVTFRLFKFDTARDDS
ITFDDISAIVDAGAEAGVLMEQEQHFIENVFELEERTVPSSMTAREDWYFALSESEESI
RQKIADYPYSKFLVCNEHIDQVIGYVDTKDILVRILSEQPIFQLNESTIRNVLIIPDTLT
LSELLDKFRASNEKMAWINEYALWGLITLSDIMMTVMGDWAAAEPEDLQIIRRDENSW
LIDGITPIDDVKHALDINEFPDWDHYETLAGFIMYRLRKIPRPADWVEHEGFKFEWDID
HYKIDQLLVTRLEQLPKHED
SEQ ID N0:3 Moraxella catarrhalis BASB009 polynucleotide sequence from strain Mcat 2912 ATGGGTGTTACTGTGAGTTTGTTTCAAAACTTTATGATTATTCTTGTACTGATTTTGACATCGAGTTTTT
TCTCGATTTCAGAAATTGCTTTGGCAGGTTCAAGAAAAATCAAACTTAAATTACTGGCAGAATCAGGCGA
TGACCGTGCCGAGAAAGTCTTGAAATTGCAAGAAAATTCAGCTGATTTTTTTGCCACTTCACAAATTGGC
CTAAATGCTGTCGCCATTTTGGGCGGTTCGGTTGGTGAAAGTGCCTTGCGTCCTTATTTTTCCGAATGGA
TTGGCTTGGTATATCAAGGGATTTGGCTTGACAGCATCGCTTTTTTTTCGTCGTTTGTTTTGGTAACACT
GCTATTTATTTTATATGCTGACCTGATTCCCAAACGCATTGCAATGATTAATCCTGAGCGAGTGGCTTTG
GTGGTCATCAATCCGATTTTGTGGACAATTCGTGTGGTCAAGCCCTTGGCATGGATTATCAATACCATCG
CAGATGTGACTTTTCGGTTTTTTAAATTTGATACGGCTCGTGATGACAGTATCACCTTTGATGATATTTC
TGCCATTGTTGATGCTGGGGCAGAGGCTGGCGTTCTGATGGAACAAGAACAACATTTTATCGAAAATGTT
TTTGAACTTGAAGAACGCACCGTGCCATCATCGATGACGGCTCGTGAGGATGTGGTATATTTTGCACTCA
GTGAAAGCGAGGAGAGTATTCGTCAAAAGATTGCCGATTATCCTTATTCTAAATTTTTGGTCTGTAATGA
GCATATCGACCAAGTCATCGGTTATGTCGATACCAAGGATATTTTGGTACGAATTTTAAGCGAACAGCCA
ATTTTTCAGCTGAATGAATCTACCATTCGTAATGTACTGATTATTCCAGATACACTCACTTTATCCGAGC
TTTTGGATAAATTTCGTGCCAGTAATGAAAAAATGGCGGTAGTCATTAATGAATATGCATTGGTTGTTGG
GCTAATTACACTATCAGATATTATGATGACTGTCATGGGCGATTGGGCAGCCGCTGAGCCTGAAGATTTA
CAAATCATTCGCCGTGATGAAAATTCATGGCTGATTGATGGGATTACGCCGATTGATGATGTTAAACATG
CCCTTGATATTAATGAGTTTCCTGATTGGGATCACTATGAGACGCTGGCGGGCTTTATTATGTATCGCCTGC
GTAAGATTCCACGCCCTGCAGACTGGGTAGAGCATGAGGGCTTTAAATTTGAGGTGGTAGATATCGACCATT
ATAAGATTGACCAACTTTTGGTAACTCGCCTAGAGCAACTGCCCAAGCACGAAGACTAA
SEQ ID N0:4 Moraxella catarrhalis BASB009 polypeptide sequence from strain Mcat 2912 MGVTVSLFQNFMIILVLILTSSFFSISEIALAGSRKIKLKLLAESGDDRAEKVLKLQENSADFFATSQIG
LNAVAILGGSVGESALRPYFSEWIGLWQGIWLDSIAFFSSFVLVTLLFILYADLIPKRIAMINPERVAL
WINPILWTIRVVKPLAWIINTIADVTFRFFKFDTARDDSITFDDISAIVDAGAEAGVLMEQEQHFIENV
FELEERTVPSSMTAREDVVYFALSESEESIRQKIADYPYSKFLVCNEHIDQVIGYVDTKDILVRILSEQP
IFQLNESTIRNVLIIPDTLTLSELLDKFRASNEKMAWINEYALWGLITLSDINllHTVMGDWAAAEPEDL
QIIRRDENSWLIDGITPIDDVKHALDINEFPDWDHYETLAGFIMYRLRKIPRPADWVEHEGFKFEVVDID
HYKIDQLLVTRLEQLPKHED
SEQ ID NO:S
Moraxella catarrhalis BASB009 polynucleotide sequence from strain Mcat 2913 ATGGGTGTTACTGTGAGTTTGTTTCAAAACTTTATGATTATTCTTGTACTGATTTTGAC
ATCGAGTTTTTTCTCGATTTCAGAAATTGCTTTGGCAGGTTCAAGAAAAATCAAACTTA
AATTACTGGCAGAATCAGGCGATGACCGTGCCGAGAAAGTCTTAAAATTGCAAGAAAAT
TCAGCTGATTTTTTTGCCACTTCACAAATTGGCCTAAATGCTGTCGCCATTTTGGGCGG
TTCGGTTGGTGAAAGTGCCTTGCGTCCTTATTTTTCCGAATGGATTGGCTTGGTATATC
AAGGGATTTGGCTTGACAGCATCGCTTTTTTTTCGTCGTTTGTTTTGGTAACACTGCTA
TTTATTTTATATGCTGACCTGATTCCCAAACGCATTGCAATGATTAATCCTGAGCGAGT
GGCTTTGGTGGTCATCAATCCGATTTTATGGACAATTCGTGTGGTCAAGCCCTTGGCAT
GGATCATCAATACCATCGCAGATGTGACTTTTCGGCTTTTTAAATTTGATACGGCTCGT
GATGACAGTATCACCTTTGATGATATTTCTGCCATTGTTGATGCTGGGGCAGAGGCTGG
CGTTTTGATGGAACAAGAACAGCACTTTATCGAAAATGTTTTTGAACTTGAAGAACGCA

CCGTGCCATCATCGATGACGGCTCGTGAGGATGTGGTATATTTTGCACTCAGTGAAAGC
GAGGAGAGTATTCGTCAAAAGATTGCCGATTATCCTTATTCTAAATTTTTGGTCTGTAA
TGAGCATATCGACCAAGTCATCGGTTATGTCGATACCAAGGATATTTTGGTACGAATTT
TAAGCGAACAGCCAATTTTTCAGCTGAATGAATCTACCATTCGAAATGTACTGATTATT
CCAGATACACTCACTTTATCCGAGCTTTTGGATAAATTTCGTGCCAGTAATGAAAAAAT
GGCGGTAGTCATTAATGAATATGCATTGGTTGTTGGGCTAATTACACTATCAGATATTA
TGATGACTGTCATG,GGCGATTGGGCAGCCGCTGAGCCTGAAGATTTACAAATCATTCGC
CGTGATGAAAATTCATGGCTGATTGATGGGATTACGCCGATTGATGATGTTAAACATGC
CCTTGATATTAATGAGTTTCCTGATTGGGATCACTATGAGACGCTGGCGGGCTTTATTA
TGTATCGCCTGCGTAAGATTCCACGCCCTGCAGACTGGGTAGAGCATGAGGGCTTTAAA
TTTGAGGTGGTAGATATCGACCATTATAAGATTGACCAACTTTTGGTAACTCGCCTAGA
GCAACTGCCCAAGCACGAAGACTAA
SEQ ID N0:6 Moraxella catarrhalis BASB009 polypeptide sequence from strain Mcat 2913 MGVTVSLFQNFMIILVLILTSSFFSISEIALAGSRKIKLKLLAESGDDRAEKVLKLQENSADFFATSQIG
LNAVAILGGSVGESALRPYFSEWIGLVYQGIWLDSIAFFSSFVI~VTLLFILYADLIPKRIAMINPERVAL
WINPILWTIRWKPLAWIINTIADVTFRLFKFDTARDDSITFDDISAIVDAGAEAGVLMEQEQHFIENV
FELEERTVPSSMTAREDWYFALSESEESIRQKIADYPYSKFLVCNEHIDQVIGYVDTKDILVRILSEQI
FQLNESTIRNVLIIPDTLTLSELLDKFRASNEKMAWINEYALWGLITLSDIMMTVMGDWAAAEPEDLQ
IIRRDENSWLIDGITPIDDVKHALDINEFPDWDHYETLAGFIMYRLRKIPRPADWVEHEGFKFEVVDIDH
YKIDQLLVTRLEQLPKHED
SEQ ID NO:'7 Moraxella catarrhalis BASB009 polynucleotide sequence from strain Mcat 2969 ATGGGTGTTACTGTGAGTTTGTTTCAAAACTTTATGATTATTCTTGTACTGATTTTGAC
ATCGAGTTTTTTCTCGATTTCAGAAATTGCTTTGGCAGGTTCAAGAAAAATCAAACTTA
AATTACTGGCAGAATCAGGCGATGACCGTGCCGAGAAAGTCTTGAAATTGCAAGAAA.AT
TCAGCTGATTTTTTTGCCACTTCACAAATTGGCCTAAATGCTGTCGCCATTTTGGGCGG
TTCGGTTGGTGAAAGTGCCTTGCGTCCTTATTTTTCCGAATGGATTGGCTTGGTATATC
AAGGGATTTGGCTTGACAGCATCGCTTTTTTTTCGTCGTTTGTTTTGGTAACACTGCTA
TTTATTTTATATGCTGACCTGATTCCCAAACGCATTGCAATGATTAATCCTGAGCGAGT
GGCTTTGGTGGTCATCAATCCGATTTTGTGGACAATTCGTGTGGTCAAGCCCTTGGCAT
GGATTATCAATACCATCGCAGATGTGACTTTTCGGCTTTTTAAATTTGATACGGCTCGT
GATGACAGTATCACCTTTGATGATATTTCTGCCATTGTTGATGCTGGGGCAGAGGCTGG
CGTTCTGATGGAACAAGAACAACATTTTATCGAAAATGTTTTTGAACTTGAAGAACGCA
CCGTGCCATCATCGATGACGGCTCGTGAGGATGTGGTATATTTTGCACTCAGTGAAAGC
GAGGAGAGTATTCGTCAAAAGATTGCCGATTATCCTTATTCTAAATTTTTGGTCTGTAA
TGAGCATATCGACCAAGTCATCGGTTATGTCGATACCAAGGATATTTTGGTACGAATTT
TAAGCGAACAGCCAATTTTTCAGCTGAATGAATCTACCATTCGTAATGTACTGATTATT
CCAGATACACTCACTTTATCCGAGCTTTTGGATAAATTTCGTGCCAGTAATGAAAAP.AT
GGCGGTAGTCATTAATGAATATGCATTGGTTGTTGGGCTAATTACACTATCAGATATTA
TGATGACTGTCATGGGCGATTGGGCAGCCGCTGAGCCTGAAGATTTACAAATCATTCGC
CGTGATGAAAATTCATGGCTGATTGATGGGATTACGCCGATTGATGATGTTAAACATG

CCCTTGATATTAATGAGTTTCCTGATTGGGATCACTATGAGACGCTGGCGGGCTTTATT
ATGTATCGCCTGCGTAAGATTCCACGCCCTGCAGACTGGGTAGAGCATGAGGGCTTTAA
ATTTGAGGTGGTAGATATCGACCATTATAAGATTGACCAACTTTTGGTAACTCGCCTAG
AGCAACTGCCCAAGCACGAAGACTAA
SEQ ID N0:8 Moraxella catarrhalis BASB009 polypeptide sequence from strain Mcat 2969 MGVTVSLFQNFMIILVLILTSSFFSISEIALAGSRKIKLKLLAESGDDRAEKVLKLQENSADFFATSQIGLN
AVAILGGSVGESALRPYFSEWIGLVYQGIWLDSIAFFSSFVLVTLLFILYADLIPKRIAMINPERVALWIN
PILWTIRWKPLAWIINTIADVTFRLFKFDTARDDSITFDDISAIVDAGAEAGVLMEQEQHFIENVFELEER
TVPSSMTAREDWYFALSESEESIRQKIADYPYSKFLVCNEHIDQVIGYVDTKDILVRILSEQPIFQLNEST
IRNVLIIPDTLTLSELLDKFRASNEKMAWINEYALWGLITLSDIMMTVMGDWAAAEPEDQIIRRDENSWL
IDGITPIDDVKHALDINEFPDWDHYETLAGFIMYRLRKIPRPADWVEHEGFKFEWDIDHYKIDQLLVTRLE
QLPKHED
S8Q ID N0:9 GCC TGA GGA TAT CAT GCC AG
SEQ ID NO:10 GTG TAT TTG ATG CCA TAC AGG
SEQ ID NO:11 AAG GGC CCA ATT ACG CAG AGG GGA TCC GAA ATT GCT TTG GCA GGT TCA AGA
AAA ATC AAA C
$EQ ID N0:12 AAG GGC CCA ATT ACG CAG AGG GTC GAC TTA TTA GTC TTC GTG CTT GGG CAG
TTG CTC TAG GCG

Claims

CLAIMS:

1. An isolated polypeptide useful as a vaccine against Moraxella catarrhalis infection comprising an amino acid sequence which has at least 85% identity to the amino acid sequence selected from the group consisting of: SEQ ID NO:2, SEQ ID NO:4, SEQ
ID
NO:6 and SEQ ID NO:8 over the entire length of SEQ ID NO:2, SEQ ID NO:4, SEQ
ID
NO:6 or SEQ ID NO:8 respectively.
2. An isolated polypeptide as claimed in claim 1 ire which the amino acid sequence; has at least 95% identity to the amino acid sequence selected from the group consisting of: SEQ
ID NO:2, SEQ ID NO:4, SEQ ID NO:6 and SEQ ID NO:8, aver the entire length of SEQ
ID NO:2, SEQ ID NO:4, SEQ ID NO:6 or SEQ ID NO:8 respectively.
3. The polypeptide as claimed in claim 1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6 and SEQ ID
NO:8.
4. An isolated polypeptide having the amino acid sequence selected from the group consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6 and SEQ ID NO:8.
5. An immunogenic fragment of the polypeptide as claimed in any one of claims 1 to 4 in which the immunogenic fragment is capable of raising an immune response (if necessary when coupled to a carrier) which recognises the polypeptide of SEQ ID NO:2, SEQ ID
NO:4, SEQ ID NO:6 or SEQ ID NO:8.
5. A polypeptide as claimed in nay of claims 1 to 5 wherein said polypeptide is part of a larger fusion protein.
7. An isolated polynucleotide encoding a polypeptide as claimed in any of claims 1 to 6.

8. An isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide that has at least 85% identity to the amino acid sequence of SEQ ID NO:2, SEQ
ID NO:4, SEQ ID NO:6 or SEQ ID NO:8 over the entire length of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6 or SEQ ID NO:8 respectively.
9. 4n isolated polynucleotide comprising a nucleotide sequence that has at least 85%
identity to a nucleotide sequence encoding a polypeptide of SEQ ID NO:2, SEQ
ID NO:4, SEQ ID NO:6 or SEQ ID NO:8 over the entire coding region; or a nucleotide sequence complementary to said isolated polynucleotide.
10. An isolated polynucleotide which comprises a nucleotide sequence which has at least 85% identity to that of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5 or SEQ ID NO:7 over the entire length of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5 or SEQ ID NO:7 respectively; or a nucleotide sequence complementary to said isolated polynucleotide.
11. The isolated polynucleotide as claimed in any one of claims 7 to 10 in which the identity is at least 95% to SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5 or SEQ ID
NO:7.
12. An isolated polynucleotide comprising a nucleotide sequence encoding the polypeptide of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6 or SEQ ID NO:8.
13. An isolated polynucleotide comprising the polynucleotide of SEQ ID NO:1, SEQ ID
NO:3, SEQ ID NO:5 or SEQ ID NO:7.
14. An isolated polynucleotide comprising a nucleotide sequence encoding the polypeptide of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6 or SEQ ID NO:8, obtainable by screening an appropriate library under stringent hybridization conditions with a labeled probe having the sequence of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5 or SEQ ID NO:7 or a fragment thereof.

15. An expression vector or a recombinant live microorganism comprising an isolated polynucleotide according to any one of claims 7-14.
16. A host cell comprising the expression vector of claim 15 expressing an isolated polypeptide comprising an amino acid sequence that has at least 85% identity to the amino acid sequence selected from the group consisting of SEQ ID NO:2, SEQ ID
NO:4, SEQ ID NO:6 or SEQ ID NO:8, or a membrane of the host cell containing the expressed polypeptide.
17. A process for producing a polypeptide of claims 1 to 6 comprising culturing a host cell of claim 16 under conditions sufficient for the production of said polypeptide and recovering the polypeptide from the culture medium.
18. A process for expressing a polynucleotide of any one of claims 7-14 comprising transforming a host cell with the expression vector comprising at least one of said polynucleotides and culturing said host cell under conditions sufficient for expression of any one of said polynucleotides.
19. A vaccine composition comprising an effective amount of the polypeptide of any one of claims 1 to 6 and a pharmaceutically acceptable carrier.
20. A vaccine composition comprising an effective amount of the polynucleotide of any one of claims 7 to 14 and a pharmaceutically effective carrier.
21. The vaccine composition according to either one of claims 19 or 20 wherein said composition comprises at least one other Moraxella catarthalis antigen.

22. An antibody immunospecific for the polypeptide or immunological fragment as claimed in any one of claims 1 to 6.
23. A method of diagnosing a Moraxella catarrhalis infection, comprising identifying a polypeptide as claimed in any one of claims 1 - 6, or an antibody that is immunospecific for said polypeptide, present within a biological sample from an animal suspected of having such an infection.
24. Use of a composition comprising an immunologically effective amount of a polypeptide as claimed in any one of claims 1 - 6 in the preparation of a medicament for use in generating an immune response in an animal.
25. Use of a composition comprising an immunologically effective amount of a polynucleotide as claimed in any one of claims 7 - 14 in the preparation of a medicament for use in generating an immune response in an animal.
26. A therapeutic composition useful in treating humans with Moraxella catarrhalis disease comprising at least one antibody directed against the polypeptide of claims 1 - 6 and a suitable pharmaceutical carrier.