CA2305707A1 - Mutants of yeast cdc24p, defective in binding of the g-protein beta subunit - Google Patents

Abstract

The pheromone signal transduction in yeasts involves hormone binding to a G-protein coupled membrane receptor, interaction of Cdc24p with G.beta., and ultimately results in polarized growth towards the hormone source (mating partner), caused by changes in the cytoskeleton. The present invention describes three recessive mutants of Cdc24p, at the amino acids 189 and 190, which do not interact with G.beta., and which cause the cytoskeleton to focus adjacent to the last buding site, rather than towards the hormone gradient. In contrast to previously described Cdc24p mutants, those presented here are not affected in their normal vegetative growth and hormone-induced processes, other than cytoskeleton orientation.

Description

MUTANTS OF YEAST Cdc24p, DEFECTIVE IN BINDING OF THE G-PROTEIN BETA SUBUNIT
The present invention relates to nucleotide sequences and protein sequences.
In particular, the present invention relates to nucleotide sequences and protein sequences that affect interactions of cellular components.
According to Cerione and Zheng (The Dbl family of oncogenes Current Opinion In Cell Biology $, 216-222 ( 1996)), genetic screening and biochemical studies during the past years have led to the discovery of a certain family of cell growth regulatory proteins and oncogene 1 o products for which the Dbl oncoprotein is the prototype. Another review on Dbl is presented by Machesky and Hall (1996 Trends In CeII Biology ~ pp 3-4-310).
Cerione and Zheng {ibicT) say that proto-Dbl is a 1 I S kDa cytoskeleton-associated protein that is found in tissues such as brain. ovary, testis and adrenal glands. Oncogenic activation of proto-I5 Dbl occurs as a result of an amino-terminal truncation of proto-Dbl which leaves residues 498-925 fused with the product of an as yet unidentified gene which is localised on chromosome 3.
Cerione and Zheng also say that a region located between residues 498 and 674 of proto-Dbl -which is retained by oncogenic Dbl - has significant similarities with the Saccharomyces 2o cerevisiae cell division cycle molecule Cdc24p and the breakpoint cluster gene product Bcr (see also Hart et al 1991 Nature ~ 3I I-314; Miyamoto et al 1991 Biochem Biophys Res Commun 1$1604-610; Ron et al 1991 New Biol ~ 372-379). This region - which is referred to as being the DH domain - was later shown to be responsible for the GEF (SDP-GTP
exchange )_actor -otherwise known as a guanine nucleotide e:cchange factor) activity of the Dbl oncoprotein and to 25 be critical for its transforming function (see also Hart et al J Biol Chem ~ 62-65).
Cerione and Zheng also report that since the initial identification of Dbl as a GEF for Rho-type GTP binding proteins, a number of oncogene products and growth regulatory molecules have been shown to contain a DH domain in tandem with another region designated PH
(i.e. a 3o pleckstrin homology domain which is found between residues 703-812 in of proto-Dbl). Many of these products and molecules, such as Bcr, Cdc24, Sos, Vav, ect-2, Ost, Tim, Lbc, Lfc and Dbc, form a family of GEFs which have been implicated in cell growth regulation. Cerione and

2 Zheng provide details on each of these products and molecules. In addition, these and other products and molecules are discussed below.
Cerione and Zheng (ibid) end their Abstract by saying:
''Despite the increasing interest in the Dbl family of proteins, there is still a good deal to learn regarding the biochemical mechanisms that underlie their diverse biological functions."
1o As mentioned above, it is known that proto-Dbl has significant similarities with the S cerevisiae cell division cycle molecule Cdc24p which is a GEF for the Rho-family GTPase molecule Cdc42p (see again Hart et al 1991 Nature ~ 311-314: Miyamoto et al 1991 Biochem Biophys Res Commun ].$L 604-610; Ron et al 1991 New BioI ~ 372-379; Zheng et al 1994 J
Biol Chem ~Q 2369-2372). However, whilst it is known that the Rho-family GTPases and their regulators are essential for cytoskeletal reorganisation and transcriptional activation in response to extracellular signals~~2, little is known about what links these molecules to membrane receptors.
For example, in the budding yeast S. cerevisiae, haploid cells respond to mating pheromone through a G-protein coupled receptor (Ste2p/Ste3p) via G~iy (Ste4p/Stel8p) resulting in cell cycle arrest, transcriptional activation, and polarised growth towards a mating partner4~s.
2o Recently, the Rho-family GTPase Cdc42p and its exchange factor Cdc24p have been implicated in the mating processb'~ but their specific role is unknown.
However, in our studies (which are presented below) on S. cerevisiae we have been able to identify hitherto unrecognised regions that play a key role in the interaction of cellular components. This finding has broad implications - not only for the design of anti-fungal drugs (such as those that could be directed against the yeast Candida) but also in the screening and design of agents that can affect oncogenes such as Dbl, in particular proto-Dbl.
Moreover, in our studies (which are presented below), we have identified novel cdc24 alleles 3o which do not affect vegetative growth but drastically reduce the ability of yeast cells to mate.
When exposed to mating pheromone these mutants arrest growth, activate transcription, and undergo characteristic morphological and actin cytoskeleton polarisation.
However, the mutants

3 PCT/GB98/03033 are unable to orient towards a pheromone gradient and instead position their mating projection adjacent to their previous bud site. Strikingly, these mutants are specifically defective in the binding of Cdc24p to G~3y. This work demonstrates that the association of a GEF and the (3y-subunit of a hetero-trimeric G-protein (G(3y) links receptor-mediated activation to oriented cell growth.
The present invention also demonstrates that Farl, a cyclic dependent kinase inhibitor (CDKI) may also be implicated as being important for orientated cell growth.
to Thus. according to one broad aspect of the present invention there is provided a GEF capable of interacting with a G/i such that the interaction provides a connection between G protein coupled receptor activation and polarised cell growth.
According to another broad aspect of the present invention there is also provided an agent capable of affecting a GEF/G(3 interaction, which interaction provides a connection between G protein coupled receptor activation and polarised cell growth.
These and other aspects of the present invention are set out in the claims.
3o By way of example, in a broad aspect, the present invention provides a nucleotide sequence shown as SEQ LD. No. 1 or a derivative. fragment, variant or homologue thereof, wherein the expression product of the nucleotide sequence has the capability of not substantially affecting the interaction of G~3 with GEF or a homologue thereof that is usually capable of being associated therewith.
The term "expression product of the nucleotide sequence has the capability of not substantially affecting the interaction of G(3 with GEF or a homologue thereof that is usually capable of being associated therewith" means that if the expression product were to be present within GEF and the GEF were to be contacted with G~i then the expression product would not 3o substantially affect the interaction of G(3 with GEF.

4 Thus, alternatively expressed, the present invention covers a nucleotide sequence shown as SEQ LD. No. 1 or a derivative, fragment, variant or homologue thereof, wherein the expression product of the nucleotide sequence has the capability of not substantially affecting the interaction of G(3 with GEF or a homologue thereof that is usually capable of being associated therewith if the expression product were to be present within GEF
and the GEF
were to be contacted with G(3.
With this aspect of the present invention, the expression product need not necessarily be present within GEF and/or the GEF need not necessarily be contacted with G(3.
By way of t o example, the expression product can be part of a truncated GEF and/or part of a fused protein.
However, if the expression product were present within GEF, then preferably the GEF is not in its natural environment. By way of example, the GEF can be in an isolated form - such as in an assay device. Likewise, if the expression product were contacted with G~3 then preferably the G~i is not in its natural environment. By way of example, the G(3 can be in an l5 isolated form - such as in an assay device.
The present invention also covers a mutant of the nucleotide sequence shown as SEQ LD. No. 1 or a derivative, fragment, variant or homologue thereof, wherein the expression product of the mutant nucleotide sequence has the capability of substantially affecting the interaction of G(3 2o with GEF or a homologue thereof that is usually capable of being associated therewith.
The term ''expression product of the mutant nucleotide sequence has the capability of substantially affecting the interaction of G~i with GEF or a homologue thereof that is usually capable of being associated therewith" means that if the expression product were to be present 25 within a GEF like entity (such as GEF bearing that mutation) and that GEF
like entity were to be contacted with G(3 then the expression product would substantially affect the interaction of G(3 with that GEF like entity.
Thus, alternatively expressed, the present invention also covers a mutant of the nucleotide 30 sequence shown as SEQ LD. No. 1 or a derivative, fragment, variant or homologue thereof, wherein the expression product of the mutant nucleotide sequence has the capability of substantially affecting the interaction of G(3 with GEF or a homologue thereof that is usually capable of being associated therewith if the expression product were to be present within GEF
and the GEF were to be contacted with G~i.
With this aspect of the present invention, the expression product need not necessarily be

5 present within the GEF like entity and/or the GEF like entity need not necessarily be contacted with G(3. By way of example, the expression product can be part of a truncated GEF and/or part of a fused protein. The GEF like entity may be in an isolated form - such as in an assay device. Likewise, if the expression product were contacted with G(3 then preferably the G~i is not in its natural environment. By way of example, the G(3 can be in an to isolated form - such as in an assay device.
In one preferred aspect, the GEF is Cdc24p. Other suitable GEFs have been mentioned above.
Thus, the present invention also covers in a broad aspect a nucleotide sequence shown as SEQ
LD. No. 1 or a derivative, fragment, variant or homologue thereof, wherein the expression product of the nucleotide sequence has the capability of not substantially affecting the interaction of G~i with Cdc2:Ip or a homologue thereof that is usually capable of being associated therewith.
The term ''expression product of the nucleotide sequence has the capability of not substantially affecting the interaction of G~3 with Cdc24p or a homologue thereof that is usually capable of being associated therewith" means that if the expression product were to be present within Cdc24p and the Cdc24p were to be contacted with G(3 then the expression product would not substantially affecting the interaction of G(3 with Cdc24p.
Thus, alternatively expressed, the present invention covers in a broad aspect a nucleotide sequence shown as SEQ LD. No. 1 or a derivative, fragment, variant or homologue thereof, wherein the expression product of the nucleotide sequence has the capability of not 3o substantially affecting the interaction of G(3 with Cdc24p or a homologue thereof that is usually capable of being associated therewith if the expression product were to be present within Cdc24p and the Cdc24p were to be contacted with G(3.

6 With this aspect of the present invention, the expression product need not necessarily be present within Cdc24p and/or the Cdc24p need not necessarily be contacted with G(3. By way of example, the expression product can be part of a truncated Cdc24p and/or part of a fused protein. However, if the expression product is present within Cdc24p, then preferably the Cdc24p is not in its natural environment. By way of example, the Cdc24p can be in an isolated form - such as in an assay device. Likewise, if the expression product were contacted with G(3 then preferably the G~i is not in its natural environment. By way of example, the G(3 can be in an isolated form - such as in an assay device.
t o By way of further example, the present invention also covers a mutant ~af the nucleotide sequence shown as SEQ LD. No. 1 or a derivative, fragment, variant or homologue thereof, wherein the expression product of the mutant nucleotide sequence has the capability of substantially affecting the interaction of G~i with Cdc24p or a homologue thereof that is usually capable of being associated therewith.
t5 The term "expression product of the mutant nucleotide sequence has the capability of substantially affecting the interaction of G~ with Cdc24p or a homologue thereof that is usually capable of being associated therewith" means that if the expression product were to be present within a Cdc24p like entity (such as Cdc24p bearing that mutation) and that Cdc24p like 2o entity were to be contacted with G~3 then the expression product would substantially affect the interaction of G(3 with that Cdc24p like entity.
With this aspect of the present invention, the expression product need not necessarily be present within the Cdc24p like entity and/or the Cdc24p like entity need not necessarily be 25 contacted with G~i. By way of example, the expression product can be part of a truncated Cdc24p and/or part of a fused protein. The Cdc24p like entity may be in an isolated form -such as in an assay device. Likewise, if the expression product were contacted with G(3 then preferably the G(3 is not in its natural environment. By way of example, the G~i can be in an isolated form - such as in an assay device.
In a preferred aspect, the present invention covers the sequences of the present invention in isolated form - in other words the sequences are not in their natural environment and when

7 they have been expressed by their natural coding sequences which are under the control of their natural expression regulatory elements (such as the natural promoter etc.). By way of example the sequences may be in an assay device.
s It is to be noted that the nucleotide sequence presented as SEQ ID No. 1 is quite different to the DH domain and the PH domain discussed by Cerione and Zheng (ibic~. It is also to be noted that the nucleotide sequence presented as SEQ ID No. 1 is in a region quite different to the DH
domain and the PH domain.
i o One important aspect of the present invention is that we have found it is possible to affect the interaction of Cdc24p with a ~3 subunit (such as Ste4p) or even a (3y subunit (such as Ste4p/StelBp) of a hetero-trimeric G-protein (hereinafter collectively referred to as ''G(3"). If the interaction is detrimentally affected (such as lost) then this may in turn prevent (or at least reduce) signalling (possibly GEF activity) being passed to the the Rho-family GTPase 15 (Cdc42p). Hence, the present invention also covers the use of any one or more of the aforementioned aspects of the present invention to have an effect on a signal being passed to the Rho-family GTPases.
The term "derivative, fragment, variant or homologue" in relation to the nucleotide Sequence 2o ID No. 1 of the present invention includes any substitution of modification of, replacement of, deletion of or addition of one (or more) nucleic acid from or to the sequence providing the resultant nucleotide sequence or the expression product thereof has the capability of not substantially affecting the interaction of G~i with Cdc24p or a homologue thereof that is usually capable of being associated with the Cdc24p or the homologue thereof. In particular, the term 25 "homologue" covers homology with respect to function. With respect to sequence homology (i.e. similarity), preferably there is at least 75%, more preferably at least 85%, more preferably at least 90% homology to the sequence shown as SEQ ID No.l in the attached sequence listings.
More preferably there is at least 95%, such as at least 98%, homology to the sequence shown as SEQ ID No. 1 in the attached sequence listings.
The term "derivative, fragment, variant or homologue" in relation to the protein Sequence ID
No. 2 of the present invention includes any substitution of, modification of, replacement of,

8 deletion of or addition of one (or more) amino acid from or to the sequence providing the resultant amino acid sequence has the capability of not substantially affecting the interaction of G~3 with Cdc24p or a homologue thereof that is'usually capable of being associated with the Cdc24p or the homologue thereof. In particular, the term "homologue" covers homology with s respect to function. With respect to sequence homology (i.e. similarity), preferably there is at least 75%, more preferably at least 8~%, more preferably at least 90% homology to the sequence shown as SEQ ID No.2 in the attached sequence listings. More preferably there is at least 95%, such as at least 98%, homology to the sequence shown as SEQ ID No. 2 in the attached sequence listings.
l0 An example of a fragment of the expression product of SEQ ID No. 1 that has the capability of not substantially affecting the interaction of G(3 with Cdc24p or a homologue thereof that is usually capable of being associated with the Cdc24p or the homologue thereof is the amino acid sequence presented as SEQ ID No. 15 or SEQ ID No. 16. The present invention also 15 covers nucleotide sequences coding for such sequences.
With respect to the mutated sequences then, in a preferred aspect, the mutated sequence comprises one or more mutations in the region presented as SEQ ID No. 1 ~ or SEQ ID No. 16.
2o An example of a fra~ment of the expression product of a mutant SEQ ID No. 1 that has the capaloilit~~ of substantially affecting the interaction of G(3 with Cdc24p or a homologue thereof that is usually capable of being associated with the Cdc24p or the homologue thereof is the amino acid sequence presented as SEQ ID No. 17 or SEQ ID No. 18 or SEQ ID No.
19. The present invention also covers nucleotide sequences coding for such sequences.
In particular, the term "homology" as used herein may be equated with the term "identity".
Relative sequence homology (i.e. sequence identity) can be determined by commercially available computer programs that can calculate % homology between two or more sequences.
Typical examples of such computer programs are BLAST and CLUSTAL.
Sequence homology (or identity) may moreover be determined using any suitable homology algorithm, using for example default parameters. Advantageously, the BLAST
algorithm is

9 employed, with parameters set to default values. The BLAST algorithm is described in detail at http://www.ncbi.nih.govlBLAST/biast help.html, which is incorporated herein by reference. The search parameters are defined as follows, and are advantageously set to the defined default parameters.
Advantageously, "substantial homology" when assessed by BLAST equates to sequences which match with an EXPECT value of at least about 7, preferably at least about 9 and most preferably 10 or more. The default threshold for EXPECT in BLAST
searching is usually 10.
~o BLAST (Basic Local Alignment Search Tool) is the heuristic search algorithm employed by the programs blastp, blastn, blastx, tblastn, and tblastx; these programs ascribe significance to their findings using the statistical methods of Karlin and Altschul (see http://www.ncbi.nih.gov/BLAST/blast help.html) with a few enhancements. The BLAST
~5 programs were tailored for sequence similarity searching, for example to identify homologues to a query sequence. The programs are not generally useful for motif-style searching. For a discussion of basic issues in similarity searching of sequence databases, see Altschul et al (1994) Nature Genetics 6:119-129.
3o The five BLAST programs available at http://www.ncbi.nlm.nih.gov perform the following tasks:
blastp compares an amino acid query sequence against a protein sequence database;
25 blastn compares a nucleotide query sequence against a nucleotide sequence database;
blastx compares the six-frame conceptual translation products of a nucleotide query sequence (both strands) against a protein sequence database;
3o tblastn compares a protein query sequence against a nucleotide sequence database dynamically translated in all six reading frames (both strands).

tblastx compares the six-frame translations of a nucleotide query sequence against the six-frame translations of a nucleotide sequence database.
BLAST uses the following search parameters:
s HISTOGRAM Display a histogram of scores for each search; default is yes. (See parameter H in the BLAST Manual).
DESCRIPTIOnucleotide sequence Restricts the number of short descriptions of matching to sequences reported to the number specified; default limit is 100 descriptions. (See parameter V in the manual page). See also EXPECT and CUTOFF.
ALIGNMENTS Restricts database sequences to the number specified for which high-scoring segment pairs (HSPs) are reported; the default limit is 50. If more database I S sequences than this happen to satisfy the statistical significance threshold for reporting (see EXPECT and CUTOFF below), only the matches ascribed the greatest statistical significance are reported. (See parameter B in the BLAST Manual).
EXPECT The statistical significance threshold for reporting matches against database ?o sequences; the default value is 10, such that 10 matches are expected to be found merely by chance, according to the stochastic model of Karlin and Altschul (1990). If the statistical significance ascribed to a match is greater than the EXPECT threshold, the match will not be reported. Lower EXPECT thresholds are more stringent, leading to fewer chance matches being reported. Fractional values are acceptable. (See parameter E in the BLAST
25 Manual).
CUTOFF Cutoff score for reporting high-scoring segment pairs. The default value is calculated from the EXPECT value (see above). HSPs are reported for a database sequence only if the statistical significance ascribed to them is at least as high as would be ascribed to 3o a lone HSP having a score equal to the CUTOFF value. Higher CUTOFF values are more stringent, leading to fewer chance matches being reported. (See parameter S in the BLAST

Manual). Typically, significance thresholds can be more intuitively managed using EXPECT.
MATRIX Specify an alternate scoring matrix for BLASTP, BLASTX, TBLASTN and s TBLASTX. The default matrix is BLOSUM62 {Henikoff & Henikoff, 1992). The valid alternative choices include: PAM40, PAM120, PAM250 and IDENTITY. No alternate scoring matrices are available for BLASTN; specifying the MATRIX directive in BLASTN
requests returns an error response.
t o STRAND Restrict a TBLASTN search to just the top or bottom strand of the database sequences; or restrict a BLASTN, BLASTX or TBLASTX search to just reading frames on the top or bottom strand of the query sequence.
FILTER Mask off segments of the query sequence that have low compositional 15 complexity, as determined by the SEG program of Wootton & Federhen (1993) Computers and Chemistry 17:149-163, or segments consisting of short-periodicity internal repeats, as determined by the XNU program of Claverie & States (1993) Computers and Chemistry 17:191-201, or, for BLASTN, by the DUST program of Tatusov and Lipman (see http://www.ncbi.nlm.nih.gov). Filtering can eliminate statistically significant but 2o biologically uninteresting reports from the blast output (e.g., hits against common acidic-, basic- or proline-rich regions), leaving the more biologically interesting regions of the query sequence available for specific matching against database sequences.
Low complexity sequence found by a filter program is substituted using the letter "N" in 25 nucleotide sequence (e.g., "NNNNNNNNNNNNN") and the letter "X" in protein sequences (e.g., "XXXXXXx:XX").
Filtering is only applied to the query sequence (or its translation products), not to database sequences. Default filtering is DUST for BLASTN, SEG for other programs.
It is not unusual for nothing at all to be masked by SEG, XNU, or both, when applied to sequences in SWISS-PROT, so filtering should not be expected to always yield an effect.

Furthermore, in some cases, sequences are masked in their entirety, indicating that the statistical significance of any matches reported against the unfiltered query sequence should be suspect.
s NCBI-gi Causes NCBI gi identifiers to be shown in the output, in addition to the accession and/or locus name.
Most preferably, sequence comparisons are conducted using the simple BLAST
search algorithm provided at http://www.ncbi.nlm.nih.gov/BLAST.
Other computer program methods to determine identify and similarity between the two sequences include but are not limited to the GCG program package (Devereux et al 1984 Nucleic Acids Research 12: 387and FASTA (Atschul et al 1990 J Molec Biol 403-410).
t 5 The term "variant" also encompasses sequences that are complementary to sequences that are capable of hydridising to the nucleotide sequences presented herein.
Preferably, the term "variant" encompasses sequences that are complementary to sequences that are capable of hydridising under stringent conditions (eg. 65°C
and O.IxSSC {lxSSC =
20 0.15 M NaCI, 0.015 Na3 citrate pH 7.0}) to the nucleotide sequences presented herein.
The present invention also relates to nucleotide sequences that can hybridise to the nucleotide sequences of the present invention (including complementary sequences of those presented herein).
The present invention also relates to nucleotide sequences that are complementary to sequences that can hybridise to the nucleotide sequences of the present invention (including complementary sequences of those presented herein).
3o The term "hybridization" as used herein shall include "the process by which a strand of nucleic acid joins with a complementary strand through base pairing" (Coombs J
(1994) Dictionary of Biotechnology, Stockton Press, New York NY) as well as the process of amplification as carried out in polymerase chain reaction technologies as described in Dieffenbach CW and GS Dveksler (1995, PCR Primer, a Laboratory Manual, Cold Spring Harbor Press, Plainview NY).
Also included within the scope of the present invention are polynucleotide sequences that are capable of hybridizing to the nucleotide sequence of the present invention or other nucleotide sequences coding for the protein sequence of the present invention under conditions of intermediate to maximal stringency. Hybridization conditions are based on the melting temperature (Tm) of the nucleic acid binding complex, as taught in Berger and t o Kimmel ( 1987, Guide to Molecular Cloning Techniques, Methods in Enzymology, Vol 152, Academic Press, San Diego CA), and confer a defined "stringency" as explained below.
Maximum stringency typically occurs at about Tm-5°C (5°C below the Tm of the probe);
high stringency at about 5°C to 10°C below Tm; intermediate stringency at about 10°C to 20°C below Tm; and low stringency at about 20°C to 25°C
below Tm. As will be understood by those of skill in the art, a maximum stringency hybridization can be used to identify or detect identical polynucleotide sequences while an intermediate (or low) stringency hybridization can be used to identify or detect similar or related polynucleotide 2o sequences.
In a preferred aspect, the present invention covers nucleotide sequences that can hybridise to the nucleotide sequence of the present invention under stringent conditions (e.g. 65°C and 0. lxSSC).
Examples of homologues of Cdc24p include but are not limited to any one or more of the homologues listed above or below, such as proto-Dbl, Bcr, Sos, Vav, ect-2, Ost, Tim, Lbc, Lfc and Dbc.
3o The term ''mutant" in relation to the nucleotide sequence of the present invention means a variant of SEQ ID No. 1 but wherein that variant or the expression product thereof has the capability of substantially affecting the interaction of G~3 with Cdc24p or a homologue thereof that is usually capable of being associated with the Cdc24p or the homologue thereof.
Preferred mutants of the nucleotide sequence of the present invention include any one or more of the nucleotide sequences presented as SEQ ID No. 3, SEQ ID No. 5 or SEQ ID
No. 7.
The term "mutant" in relation to the protein sequence of the present invention means a variant of SEQ ID No. 2 but wherein that variant has the capability of substantially affecting the interaction of G(3 with Cdc24p or a homologue thereof that is usually capable of being to associated with the Cdc24p or the homologue thereof.
Preferred mutants of the protein sequence of the present invention include any one or more of the protein sequences presented as SEQ ID No. 4, SEQ ID No. 6 or SEQ ID No. 8.
The term "growth behaviour" includes growth per se (but not vegetative growth of yeast), growth control and growth orientation of cells. In some aspects, it includes at least growth orientation of cells. The term may also include the mating pattern (e.g.
mating per se or mating behaviour) of cells.
For a preferred aspect of the present invention, any one or more of the nucleotide sequence of the present invention or the expression product thereof, or the mutant nucleotide sequence of the present invention or the expression product thereof, or the protein of the present invention, or the mutant protein of the present invention may be within a transgenic organism or cell (such as being an integral part thereof) - that is an organism or cell that is not a naturally occurring organism or cell and wherein the organism or cell has been prepared by use of recombinant DNA techniques. The transgenic cell may be part of or contained within tissue.
Preferably, the transgenic organism or cell is a yeast, an animal (such as a mammal) or an animal cell (such as a mammalian cell).
In preferred embodiments, the transgenic organism is a transgenic yeast or a transgenic mouse.

WO 99/I8213 PCTlGB98/03033 Transgenic yeast may be prepared by appropriately adapting the teachings of Ito et al Journal of Bacteriology ~ 163-168; Rose et al 1991 Methods in yeast genetics: a laboratory course manual Cold Spring Harbor, N.Y.: Cold Spring Harbor Press) .

Transgenic mammals or mammalian cells may be prepared by appropriately adapting the teachings of Ausubel et al 1992 Short Protocols in Molecular Biology 2nd Ed.
New York:
John Wiley and Sons) .
to The transgenic organism or transgenic cell of the present invention therefore provides a simple assay system that can be used to determine whether one or more agents (e.g.
compounds or compositions) have one or more beneficial properties. By way of example, the assay system of the present invention may utilise a mating phenotype and/or the assay system may be a two-hybrid interaction assay.
By way of example, if the transgenic organism is a transgenic yeast which comprises the nucleotide sequence presented as SEQ ID No. 1 or the expression product thereof (namely the protein sequence presented as SEQ ID No. 2) then the yeast could be used to screen for agents that bind to this nucleotide sequence or the expression product thereof and in doing so affect the growth behaviour of the yeast. If an agent produces such a detrimental effect (such as drastically reducing the ability of the yeast to mate), then that agent may also affect the interaction of Gp with Cdc24p or another Cdc24p entity that is usually capable of being associated therewith. This aspect of the present invention could allow workers to screen for anti-fungal agents, such as agents that could be used to treat or combat Candida.
By way of further example, if the transgenic organism is a transgenic yeast which comprises the nucleotide sequence presented as SEQ ID No. 1 or the expression product thereof then the yeast could be used to screen for agents that bind to this nucleotide sequence or expression product thereof and in doing so affect the growth behaviour of the yeast. If an agent produces 3o a detrimental affect (such as drastically reducing the ability of the yeast to mate), then that agent is likely to detrimentally affect the interaction of G(3 with a homologue of Cdc24p with which it is usually capable of being associated. This could allow workers to screen for compounds or compositions that could for example influence the in vivo expression or behaviour of effect of proto-oncogenes and the like - such as proto-Dbl.
By way of further example, if the transgenic organism is a transgenic yeast which comprises a mutant of the nucleotide sequence in accordance with the present invention then the yeast could be used to screen for agents that affect the growth behaviour of the yeast. If an agent produces a marked affect - such as restoration to a normal growth behaviour or a further detrimental growth behaviour - then workers could screen for compounds or compositions that could for example influence the in vivo expression or behaviour or effect or activity of a to Cdc24 homologue, such as, but not limited to proto-oncogenes such as Dbl and/or Vav.
By way of further example, if the transgenic organism is a transgenic yeast which comprises a homologue (e.g. Dbl) of the nucleotide sequence shown as SEQ ID No. 1 or an expression product thereof then workers could see if that homologue or the expression product thereof t5 had an effect on the growth behaviour of yeast, and thus also to see if it had an effect on the interaction of G~3 with a homologue of Cdc24p. In addition, workers could use those transgenic yeast to screen for agents that modified the effect - such as enhance the growth behaviour or detrimentally affect the growth behaviour. In this aspect, agents that affect the growth behaviour may also influence the activity of oncogenes (or even parts thereof) and 2o therefore have potential as therapeutic agents.
The assays of the present invention may also be used to screen for agents that affect the interaction of Cdc24p or a Cdc24p homologue with G~i to determine whether that effect has a downstream effect on a Rho-family GTPase.
For example, with the present invention - such as by use of the assays of the present invention -it is possible to devise and/or to screen for peptide inhibitors which block GEF/G~i interaction.
In this regard, peptides and peptidyl derivatives based regions encompassing mutants may be used to block and/or antagonise GEF (such as the proto-oncogenes Dbl or Vav) G(3 interaction.
3o Derivatives of these peptides (including peptide mimics) which bind with higher affinity may also be used. The perturbation of these interactions may be of therapeutic value for example in treatment of cancers.

In addition, by use of the present invention it is possible to devise simple yeast based assay systems (utilising mating function and interaction reporters). These assay systems will be extremely useful for high through-put screening to identify molecules perturbing the GEF/G~i interaction.
In addition, it is possible to devise and/or screen for agents that can modulate (e.g. interact), preferably selectively modulate (interact), with and affect Cdc24p/G~i interactions. Hence, it would be possible to devise and/or to screen for anti-fungal agents directed at invasive and/or l0 pathogenic yeasts such as. but not limited to Candida albicans and/or Cryptococcus neoformans.
If the assay of the present invention utilises a transgenic organism according to the present invention then transgenic organism may comprise nucleotide sequences etc. that are additional to the nucleotide sequences of the present invention in order to maintain the viability of the transgenic organism.
In the assays of the present invention, the agent can be any suitable compound, compostion as well as being (or even including) a nucleotide sequence of interest or the expression product 2o thereof. Hence. if any one of the nucleotide sequences of the present invention are contained within a transgenic organism - such as a transgenic yeast - then that transgenic organism may also contain that nucleotide sequence of interest. If the agent is a nucleotide sequence, then the agent may be, for example, nucleotide sequences from organisms (e.g. higher organisms - such as eukaryotes) that restore or increase the growth behaviour. Agents which affect the growth behaviour may also influence the activity of homologous oncogenes and may therefore be potential therapeutic agents.

WO 99/18213 PC'T/GB98/03033 The following samples were deposited in accordance with the Budapest Treaty at the recognised depositary of The National Collections of Industrial and Marine Bacteria Limited (NCIMB) at 23 St. Machar Drive, Aberdeen, Scotland, United Kingdom, AB2 1 RY on 3 October 1997:
E.coli CMK603 PRS414CDC24 (WT) - Deposit Number NCIMB 40898 E.coli CMK603 PRS414CDC24 (M1) - Deposit Number NCIMB 40899 E. coli CMK603 PRS414CDC24 (M2) - Deposit Number NCIMB 40900 E. coli CMK603 PRS414CDC24 (M3) - Deposit Number NCIMB 40901 Deposit NCIMB 40898 is in respect of cdc2=l (wt); Deposit NCIMB 40899 is in respect of cdc2=l-ml; Deposit NCIMB 40900 is in respect of cdc24-m2; Deposit NCIMB 40901 is in respect of cdc2:l-m3.
In accordance with a preferred aspect of the present invention, the nucleotide sequence is obtainable from, or the protein is expressable from the nucleotide sequence contained within, the respective deposit. By way of example, the respective nucleotide sequence may be isolated from 2o the respective deposit by use of appropriate restriction enzymes or by use of PCR techniques.
The present invention will now be described only by way of example, in which reference is made to the following Figures:
Figure 1 which presents some photographs and a graph;
Figure 2 which presents some images and graphs;
Figure 3 which presents some photographs, a sequence, and a pictorial representation of Cdc24 3o and DBD Cdc24; and Figure 4 which presents a pictorial representation of a cellular interaction.

The Figures are discussed in more detail later on.
Materials and Methods General techniques Strains were constructed using standard techniques2~. All constructs were verified by DNA dye terminator cycle sequencing (ABI377 sequencer).
Strains pRS414CDC24 contains the CDC24 ORF including 258 by upstream of ATG.
Oligonucleotide-directed mutagenesis was used to introduce silent base changes that resulted in the following ten new restriction sites in CDC24: NheI (bp -12), KasI (bp 283), AatII (bp 681), PstI (bp 1207), RsrII (bp 1369), BstEII (bp 1426), XhoI (bp 1758), NIIuI (bp 1963), SaII (bp 2061 ), BamHi {bp 2485). RAY410 (MATa, leu2, CDC24::LEU2, ade2, lys2, his3, trp 1, ura3, pEG(KT)CDC24) was derived from the diploid YOC380z2 which was transformed with 2o pEG{KT)CDC242' and sporulated. RAY9~0 is isogenic to RAY410 but has pRS416Ga1His6CDC24 as a rescuing plasmid. RAY928 (MATa, leu2-3, 112, ura3-52, his3-D200, trill-D901, lys2-801, suc2-D9, CDC24::HISS pEG[KT]CDC24) and RAY931 (same as RAY928 but ~LlATa, ade2, LYS2) were made by transformation of SEY6210 and 6211 with pEG(KT)CDC24 followed by PCR-based gene disruption of CDC24. The CDC24 ORF was replaced with S. pombe HIS.i2'~, flanked by LoxP sites. Replacement of CDC24 in SEY6211 with a PCR-generated integration cassette consisting of TRPI fused to 343 by of CDC24 promoter followed by 1704 by of CDC24 or cdc24-ml ORF was used to construct RAY1034 or RAY1035, respectively.

IDENTIFICATION OF cdc24 MUTANTS WITH SPECIFIC DEFECTS IN CELL
MATING:
s A) Construction of a library of cdc24 random mutants Error-prone PCR was used to generate a library of cdc2=1 mutants in a plasmid vector suitable for phenotypic screening in yeast.
1 ) Plasmid:
pRS414 CDC2~ with upstream region and new restriction sites (referred to as pRS414CDC24).
2) Mutagenic PCRs:
is Conditions from Fromant, M., Blanquet, S. & Plateau, P. Direct random mutagenesis of gene-sized DNA fragments using polymerase chain-reaction. Analytical Biochemistry 224, 347-353 (1995).
2o Different PCR-conditions were tested and the error-rate was determined by DNA sequencing.
The following conditions were used for constructing the library used in the screen.
Composition of PCR-reactions (25 pl each):
DNA pRS414CDC24 600pM
dATP 0.23 mM

dCTP 0.20 mM

dTTP 2.9 mM

3o dGTP 0.42 mM

Buffer PCR Buffer supplied with Taq-polymerase MgCl2 4 mM
MnCl2 O.S mM
Taq (Ampli-Taq) 2 U per reaction Primer: ~ 0.5 mM
PCR-cycles:
1 o step 1 94 C S min step 2 91 C 1 min step 3 S 1 C 1 min step 4 72 C 3 min step S 72 C 5 min step 6 4 C pause 16 cycles (steps 2-4) 3) Library construction:
The PCR products were digested with AatII and NheI (680 by corresponding to amino acid 1 -227) were mutagenised and the resulting fragment ligated into pRS414CDC24 (cut with the same enzymes). Ligations were transformed into E. coli by electroporation and > 50,000 transformants pooled for plasmid isolation.
B) Phenotypic screening for cell-mating specific cdc24 alleles Rationale:
To identify mutant cdc2~ alleles which cause defects in cell mating but allow vegetative growth.
Yeast strain RAY9S0, in which expression of CDC24 is repressed in glucose medium, was used.

1 ) Library plasmids were transformed into RAY950 and transformants selected on SC -trp plates which contained 2% glucose. As RAY950 does not grow on glucose plates this procedure eliminated all non-functional cdc24 mutants.
2) Transformants were replica-plated onto a lawn of WT (screen 1 ) or OfuslOfus2 (screen 2) tester cells, incubated at 30°C for 3 hrs and replica-plated onto plates selecting for diploids or RAY950 derived haploids. Mating defective mutants were identified by comparing the pattern of colonies on the two sets of plates and candidate mutants were picked from the original transformation plates for retesting.
1o 3) Plasmids from mutants were isolated by transformation into E. coli.
Isolated plasmids were retransformed into RAY950, RAY928 and RAY931 for independent confirmation of phenotype and retested for defects in cell mating.
4) Mutations of confirmed mutants were identified by DNA sequencing. Multiple mutations were separated by subcloning and the mutation responsible for the phenotype identified by mating tests in RAY950.
5) A total of ~ x,000 yeast transformants were tested in each screen.
- Screen 1 identified two mutants {cdc24-ml, cdc24-m2).
- Screen 2 identified one mutant (cdc24-m3).
Phenotypic analyses Quantitative matings~°, matings in the presence of saturating pheromonel3, halo-assays26 using sstl::URA3 strains, and FusllacZ measurements with pSG23111 were carried out as described.
Halo assays showed MATa and MATa cdc24-ml cells secreted a-factor and a-factor, respectively. Actin was visualised with rhodamine phalloidin2~ on a Biorad-MRC-600 confocal microscope and pictures are projections of 4-6 0.5 mm z-series steps. For a-factor treatment, cells were incubated with 5 mM a-factor for 2 hr. RAY1034 and RAY1035 cells were used to determine bud scar positions on zygotes~4 visualised with Calcoflour28.
Similar results were observed with the position of the bud scar on shmoos. Direct measurement of cell orientation in a pheromone gradient was carried out essentially as describedl2. A pheromone gradient was generated using a micropipet filled with 80 mM a-factor injected at 105 kPa into lml of YEPD
media layered on top of cells embedded in 2% Low Melting Point (LMP) agarose.
Cells shape was recorded by video microscopy on a heated stage at 35° for 4 - 7 hr and data analysis was from traced cell outlines~4. Mating projections were formed at the same pheromone concentrations and budding, that is non-responding cells were seen at similar distances from the micropipet in both strains.
t o Two-Hybrid methods STE=l, BEM/ (372 - 5~1 aa), CDC-t2[C178S], and CDC2-l Icdc2=l-ml (1-288, 1-160, and 170-245 aa) were cloned by PCR into pGAD424 (AD, GAL; activation domain) or pAS 1 (DBD, GAL:/ DNA binding domain). Plasmids were transformed into HF7c. For determination of t5 STE18 requirement, PCR-based gene disruption was carned out in PJ69-4A
(MATa, trill-901, leu2-3,112, ura3-52, his3-200, gal4D, ga180D, GAL2-ADE2, LYS2::GAL1-HIS3, met2::GAL7-lacZ)29, replacing the entire STEl8 ORF with K. Lactis URA33°. For all two-hybrid experiments, equal amounts of transformants were spotted on SC-leu-trp and SC-leu-trp-his plates, identical results were obtained with at least four transformants, and for Dstel8 two 2o independent deletion strains. All strains for two-hybrid analyses expressed similar amounts of AD- and DBD- fusion proteins of the expected sizes, as determined by SDS-PAGE
and immuno-blotting. None of the DBD fizsions showed any self activation using two different non-interacting AD fusions.
25 In vitro binding studies A fragment of CDC24 (1-472 aa) in pGEX-2T (Pharmacia) and His6Ste4p (pTrcSte4) were expressed in E. coli. Cells were resuspended in buffer A (PBS, 0.1% TX-100, Phenyl Methyl Sulfonyl Fluoride (PMSF), leupeptin, chymostatin, pepstatin, aprotinin) and lysed by snap 3o freezing in liquid nitrogen followed by sonication. Insoluble material was removed by centrifugation ( 10,000g). Mixed supernatants (denoted cell extracts) containing His6Ste4 and GSTCdc24 fusions were incubated with GSH-agarose (Sigma Chemical Co.) at 4° for 1 hr.

Resin was washed 3 times with buffer A. Resin samples (referred to as eluates) and extracts were analyzed by SDS-PAGE, immuno-blotting probed with Omni-probe anti-sera (Santa Cruz), and visualised with enhanced chemiluminescence (Amersham). GSTCdc24p (1-127 aa), similar to GST, did not bind His6Ste4p. Similar results were observed in 5 independent experiments.
C) Ste4p mutants Ste4p is the ~i-subunit of the heterodimeric G protein that can usually associate with Cdc24p exemplified by nucleotide SEQ ID No. 9 and amino acid SEQ ID No. 10. A
mutation in STE4 exemplified by nucleotide SEQ ID No. 11 and SEQ ID No. 13 and amino acid SEQ ID
No. 12 and SEQ ID No. 14 prevented the interaction of the mutant G protein (3 subuttit with Cdc24p. Thus, it is possible to devise assays based on this mutation to screen for agents capable of modifying the non-interactive behaviour of the mutant G protein (3 subunit with t5 Cdc24p. In addition, the assay could be used to study Cdc24p homologues or even Cdc24p derivatives or homologues to see if those derivatives or homologues affect the non-interactive behaviour of the mutant G protein ~i subunit.
The Ste4p mutants are also aspects of the present invention.
In this regard, the present invention also covers an STE4 mutant.
The present invention also covers a mutation of the ~3-subunit of the heterodimeric G protein that can usually associate with GEF (preferably Cdc24p) that is capable of preventing the interaction of the mutant G protein subunit with GEF (preferably Cdc24p).
Hence, a further aspect of the present invention is a mutation in STE4 - i.e.
on the (3-subunit of the heterodimeric G protein that can usually associate with Cdc24p. This mutation prevents the interaction of the mutant G protein subunit with Cdc24p. Thus, likewise, it is 3o possible to devise similar assays based on this mutation to screen for agents that modify the non-interactive behaviour of the mutant G protein with Cdc24p. In addition, the assay could be used to study Cdc24p homologues or even Cdc24p derivatives or variants to see if those derivatives or variants affect the non-interactive behaviour of the mutant G
protein. The sequences associated with this aspect of the present invention are shown as SEQ ID No. 9 etc.
The present invention also covers variants or derivatives of such sequences -wherein the variants or derivatives of the wildtype sequences do not substantially affect Cdc24 interaction;
5 and wherein the variants or derivatives of the mutant sequences do substantially affect Cdc24 interaction.
D) Assay system to monitor the effects of two human oncogenic agents on an S.
cerevisiae yeast mutant with a mating defect.
l0 An assay system was devised to establish whether two different proto-oncogenes could complement the S. cerevisiae yeast phenotype (cdc24-ml ) mating defect as described above and in Nern and Arkowitz (Nature ( 1998) 391: 195-198). The two oncogenic agents used were the human proto-oncogene, proto-Dbl and the mouse C4 protein which is almost 1s identical to the human sequence, C5 Vav, and which is referred to hereafter as Vav. The S.
cerevisiae cell division cycle molecule, Cdc24p, which is a protein with similiarities to proto-Dbl was used as a positive control in addition to the Cdc24p of the related yeast K. lactis.
Transgenic yeast organisms which co-expressed the nucleotide sequence (SEQ ID
No. 3) for 3o the cdc2:l-ml mating defect and the nucleotide sequence of interest (NOI) encoding either proto-Dbl, Vav or two related Cdc24p's were used.
The expression levels of the proto-oncogene, proto-Dbl, in S. cerevisiae were relatively low compared with the expression levels of the Cde24p protein from either S.
cerevisiae or K
25 lactis.
Qualitatively, both proto-Dbl and K. lactis Cdc24 proteins partially complemented the mating defect in the cdc2~t-ml mutant. This result is in contrast to that obtained with the oncogenic form of Dbl alone which, although expressed, did not complement the cdc24-ml mating defect. The Vav protein, did not display any effect on the mating defect. This lack of effect may be due to either insufficient expression of the Vav protein or to the fact that Vav function requires a phosphorylation of the Lck kinase which must be co-expressed with the Vav protein before an effect can be observed.
E) Assays to determine FART interaction with Cdc24p and G(3 Studies have shown that FARI may play an important role both for pheromone mediated growth arrest and growth orientation during mating (Valtz, N., Peter, M. &
Herskowitz, I. J.
Cell Biol. 131, 863-73 ( 1995); Chang, F. & Herskowitz, I. Cell 63, 999-1011 ( 1990); Peter, M., Gartner, A., Horecka, J., Ammerer, G. & Herskowitz, I. Cell 73, 747-60 ( 1993)). The to orientation function, which is specifically disrupted in a farl-H7 mutant, is required for the Cdc24 G~3 interaction suggesting that Farl might interact with Cdc24. Two-hybrid analyses show that indeed Farl interacts with Cdc24.
While the Cdc24 G~3 interaction requires the presence of FARI, the Farl Cdc24 interaction is independent of G~i, suggesting that Farl might bind Cdc24 directly whereas Cdc24 G(3 are part of a complex which include Farl. Farl also interacts by two-hybrid assays with G(3, consistent with the notion that Cdc24, Farl, and G(3 form a complex. In a diploid two-hybrid strain, in which a number of pheromone response genes are not expressed, we are unable to detect the Cdc24 G(i interaction. However, overexpression of Farl results in an interaction 2o and further overexpression of Cry results in a maximal interaction, indicating that a complex comprised of Cdc24, G~3~r, and Farl forms even in diploid cells.
Although cdc2=t-m and farl-s mutants result in similar defects in growth orientation during mating, we set out to determine if these genes function in the same orientation process.
Generation of a cdc24-ml mutation in a Marl strain did not result in a substantial decrease in mating efficiency, suggesting these two genes function in the same process. In contrast, results from double mutants of cdc24-ml with ~,rpa2, ~.ste20, or ~beml suggest that these three genes do not function in the same orientation process as Cdc24 and Farl.
Cdc24 and Farl were epitope tagged in order to determine whether these proteins interact in yeast cells.
3o The chromosomal copy of Cdc24 was replaced with a 3xmyc tagged Cdc24 and the chromosomal copy of Farl was replaced with Farl protein A fusion. Both of these fusion proteins are fully functional. Isolation of Farl-protein A from yeast extracts using IgG-Sepharose co-precipitated 3xmyc-Cdc24. In contrast, the 3xmyc-Cdc24-ml mutant was defective in binding Farl in similar immunoprecipitation assays. These results indicate that Cdc24 and Farl bind one-another and this interaction may be essential for growth orientation during mating.
Farl binds Cdc24 and G[3 The binding relationships between Cdc24, Farl, and G~i were examined in vitro using proteins purified from bacteria and yeast. G(3y was purified from yeast cells using a to chromosomal copy of the gene which has HA epitope (Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala) fused to the amino-terminus and protein A fused to the carboxyl-terminus.
A Iobacco etch virus (TEV) protease cleavage site (recognition site Glu-Asn-Leu-Tyr-Phe-Gln-Gly with cleavage occurring between Gln and Gly) was placed between G(iand the protein A domain so that material isolated from yeast using IgG-Sepharose can be specifically eluted with commercially available recombinant TEV protease. Maltose binding protein (MBP) Farl fusions have been expressed and purified from E. coli. Similarly, a glutathione-S-transferase (GST) Cdc24 fusion (residues 1 - 472) has been expressed and purified from E.
coli. MBP-Farl binds GST-Cdc24 specifically. The removal of the 7~ carboxyl-terminal residues of Farl (H7) prevents Cdc24 binding. Furthermore GST alone is unable to bind MBP-Farl.
These results show that Cdc24 can directly bind Farl in the absence of any other yeast proteins. Farl fragments containing either the amino-terminal Lim domain (a domain implicated in protein-protein interactions) or the carboxyl-terminus were tested for their ability to bind GST-Cdc24. Both fragments showed very little binding to GST-Cdc24 indicating that although the Farl carboxyl-terminus is necessary, it is not sufficient for Cdc24 binding. Using MBP-Farl we have been able to observe binding to G(3 purified from yeast.
Binding of G~i is reduced using amino-terminal or carboxy-terminal MBP-Farl fragments, yet G~i binds FarlH7 as well as Farl.
3o In one preferred asepct of the present invention the assay also includes the presence of Farl.

Table 1 cdc24-ml is defective in cell mating Strain Tester % Mating efficiency 1 o CDC24 MATa MATa WT 100 (21 ) cdc2-~-ml MATa lLIATa WT 0.5 (0.2) CDC24 MATa MATa WT 100 (20) cdc24-ml MATa MATa WT 3.8 (1.6) CDC2-I MATa MATa Ofusl Ofus2 100{17) cdcZ4-ml MATa MATa ~fusl ~fus2 <_ 0.02 CDC24 ~t~lATa CDC24 MATa 100( 18) 2o cdc24-ml MATa cdc24-ml ~LIATa <_ 0.0006 Mating efficiencies are the number of diploid cells divided by the total cells with CDC24 WT
set to 100%. The values are means of 4 determinations with standard deviation n. Absolute mating e~ciency was 14-15% with MATa and MATa testers, 1.8% with ~fusl Ofus2 tester, and 3.4% with CDC24 tester.
Some of the results are also shown in the accompanying Figures. These Figures are now discussed in more detail.

FIGURE. 1 cdc2=!-ml phenotypes. a, Actin cytoskeleton of cdc2;t-ml cells shows polarised distribution.
Bar equals 5 mm. b, Pheromone-induced growth arrest is similar in cdc2=l-ml with WT cells.
Sterile filter disks spotted with a-factor (1, 0.5, 0.2, 0.1, 0.05, and 0.012 mg) were placed onto cells in agarose. c, MAP-kinase pathway signalling is unaffected in cdc2.~-ml.
LacZ activities are the average of 2 experiments (2-3 determinations per experiment) with standard deviation.
WT maximum (29.6 Miller Units) was set to 100%.
t o FIGURE. 2 cdc2:l-ml cells are unable to orient in a pheromone gradient. a, Excess pheromone has a negligible effect on cdc2-~-ml mating. :LIATa cells were mated with a WT
tester and mating efficiency for CDC2;l (2.8%) was set to 100%. Values are means (n=2). b, cdc2:l-ml cells are 1 s unable to orient in a pheromone gradient. A trace of cell shapes after 6-7 hr in a pheromone gradient is shown with arrowheads indicating orientation. Quantitation of cell projection angle relative to the micropipet (needle) from 4-7 separate experiments (n=112 CDC24 and 167 cdc24-ml cells). The average cosine of the angle of cell projection relative to the micropipet was 0.52 for CDC2=l and -0.02 for cdc2-!-ml cells (a cosine of 1 represents perfect orientation 2o and 0. random orientation). c, cdc2=l-ml cells position their shmoos adjacent their bud scar. The position of the bud scar on zygotes was determined for approximately 120 cells.
FIGURE. 3 25 cdc24-m mutants are defective in mating and Ste4p (G~i) binding. a, Location of Cdc24p mating mutations. Mating patches show diploids from mating with MATa WT tester. Ste4 2-H patch growth on -leu-trp-his indicates an interaction of Cdc24p (I-288 aa) with Ste4p. Similar results were obtained using a LacZ reporter in strain YI87 (relative Miller Units I00 for Cdc24/Ste4 and 3 for Cdc24-ml/Ste4). b, Two hybrid interactions of Cdc24p. For interactions with Ste4p, 30 a fragment of Cdc24p (1-288 aa) was used, however, full length Cdc24p also interacts with Ste4p. c, Region of Cdc24p necessary for Ste4p interaction. Numbers refer to Cdc24p as fused to DBD. d, Cdc24p binds to Ste4p in the absence of other yeast proteins. Mixed bacterial cell extracts (1 eq) containing either His6Ste4p and GST or GSTCdc24p (1-472 aa), and GSH-agarose eluates (800 eq) were separated by SDS-PAGE, immuno-blotted and probed with anti-sera to His6Ste4p. Anti-GST sera showed similar amounts of GST and GSTCdc24p in eluates.
Due to proteolysis, His6Ste4p migrates as a doublet.

FIGURE. 4 Model for signal transduction pathway required for cell orientation. For clarity we have omitted components of MAP-kinase cascade. The role of Cdc42p (a Rho-family GTPase) in cell

10 orientation is speculative. Pheromone binds the pheromone receptor (Ste2p on Ste3p) resulting in the dissociation of Ga (Gpalp) from G(3y (Ste4p/Stel8p). Direct binding of Cdc24p to G(3y (in the vicinity of the receptor) activates or recruits Cdc42p which is necessary for oriented growth towards a mating partner.
15 .~F.~LJFNCE ANALYS.I~
The DH and PH sequences were analysed by a Blast homology search. In addition, an analysis of the amino acid identity over the entire protein to S. cerevisiae Cdc24p was conducted. DH
refers to the Dbl homology region (GEF region) - see Hart et al 1991 Nature ,~
311-314;
2o Miyamoto et al 1991 Biochem Biophys Res Commun ~ 604-610; Ron et al 1991 New Biol ~
372-379. PH refers to the Pleckstrin homology region - see Musacchio et al Trends Biochem Sci 1$ 343-348.
The results are as follows:
A. Blast homology search using Cdc24 DH and PH region TBLASTN 1.4.9 MP
Query= yeast Cdc24p DH PH (392 aa):
3o K,IIKEFVATERKYVHDLEILDKYRQQLLDSNLITSEELYMLFPNLGDAIDFQRRFLISLEI
NALVEPSKQRIGALFMHSKHFFKLYEPWSIGQNAAIEFLSSTLHKMRVDESQRFIINNKL
ELQSFLYKPVQRLCRYPLLVKELLAESSDDNNTKELEAALDISKNIARSINENQRRTEN

WO 99/18213 PCTlGB98/03033 HQVVKKLYGRVVNWKGYRISKFGELLYFDKVFISTTNSSSEPEREFEVYLFEKIIILFSE
VVT'KKSASSLILKKKSSTSASISASNITDNNGSPHHSYHKRHSNSSSSNNIHLSSSSAAAII
HSSTNSSDNNSNNSSSSSLFKLSANEPKLDLRGRIMIMNLNQIIPQNNRSLNITWESIKEQ
GNFLLKFKNEETRDNWSSCLQQLIHDLKN
Database: Non-redundant Genbank+EMBL+DDBJ+PDB sequences 349,525 sequences; 540,957,745 total letters Reference: Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers, and David J.
to Lipman (1990). Basic local alignment search tool. J. Mol.Biol. 215:403-410.
Reading High SmallestSmallest Frame ScoreSum ProbSum Prob ability ability P(N) N

gb~U12538~SPU12538 Schizosaccharomyces+3 171 l.Oe-51 6 pombe scdl embiX57298~MM1VICF2P0Ivt.musculus +1 128 8.3e-10 3 Mcf2 proto-oncogene (Mc~ is Dbl) gb~U 16296~HSU 16296Human T-lymphoma+3 88 2.3e-09 3 invasion and metastasis inducing TIAM1 gb~U05245~MMU0.i245Mus musculus +3 88 S.Se-09 3 BALB/c invasion inducing protein (Tiam-1) gbJ036391HUMDBLTP Human DBL oncogene+2 121 2.1e-07 3 encoding a transforming protein gb~S76992~576992 VAV2=VAV oncogene+3 125 2.6e-07 2 homolog human dbjjD86547~D86547 Fruitfly still+2 76 5.4e-07 5 life type gb~U37017~MMU37017 Mus musculus +1 126 6.4e-07 2 Vav2 oncogene dbj~D86546~D86546 Fruitfly still+I 76 l.Oe-06 5 life type gb[U39476~RNU39476 Rattus norvegicus+3 116 6.3e-06 1 p95 Vav proto-oncogene gb~S76838~S76838 Dbs (Dbl guanine+3 112 4.4e-OS 2 nucleotide exchange factor homology marine dbjjAB002360~AB002360Human ICIAA0362+2 I 4.5e-05 2 emb~Z35654~RNOSTOG Rnorvegicus +I 112 4.9e-OS 2 Ost -oncogene embIX83931~HSVAVONCOH.sapiens VAV +1 109 S.Se-05 1 oncogene gb~AF0U3147~CELC11D9Caenorhabditis+3 81 0.0070 3 elegans gb~U96634~MMU96634 Mus musculus +2 62 0.016 3 p85SPR

embjY10159jDDY10159D.discoideum +1 71 0.025 3 racGAP

gb~U58203~MMU58203htus musculus +2 75 0.044 2 Lsc oncogene embjY09160~HSSUB15H.sapiens Subl.S+1 80 0.063 2 gb~AF003740~CELC41Caenorhabditis +2 81 0.064 4 D 11 elegans gbjU02081~HSU02081Human guanine +1 77 0.12 2 nucleotide regulatory protein (NET1) gb~U00055~CELR02F2Caenorhabditis +1 85 O.13 1 elegans gbjU64lOS~HSU64105Human guanine +I 77 0.14 1 nucleotide exchange factor p I 15-lthoGEF

gbjU42390jHSU42390Homo sapiens +I 74 0.33 3 Trio gbjM24603/HUMBCRD Human bcr protein+1 58 0.91 3 ~

amino end embiX02596~HSBCRR Human bcr (breakpoint+3 58 0.996 3 cluster region) in Philadelphia chromosome gbjU 11690~I-iSU Human faciogenitat+2 73 0.999 1 dvsplasia (FGD1) gbjU22325jMMU22325Mus musculus +3 73 0.9997 2 faciogenital dysplasia (Fgdl) gbjM1~025jHUMBCRABLHuman BCR/ABL +3 58 0.999955 product of the translocation of t(222q11; 9q34) B. Amino acid identity over entire protein to S. cerevisiae Cdc24p Organism gene protein % identity size (aa) (aa) ______~____~___~____~~_~_______~____~__~__~___~________ Schizosaccharomyces Scdl 834 21.9 pombe Mouse Fgdl 960 16.7 Human Fgd 1 961 16.5 t Mouse Vav2 868 16.5 o Mouse Ect2 768 16.2 Human Vav2 878 15.8 Worm Q I 8479 860 15.4 Mouse V av 844 14.6 t Rat Vav 843 14.5 Human V av 846 14.4 Mouse Dbs 1150 14.3 Human Tim 519 14.0 Human proto-Dbl 925 13.4 2o Human p 11 ~RhoGEF 912 13.4 Mouse Lfc 572 13.4 Rat Ost 872 12.9 Worm Q22354 862 12.9 Mouse Lsc 919 12.5 2s Human Lbc 424 12.4 Human Net 1 460 12.3 Human BCR 1271 11.9 Mouse Tiam 1 1591 11.2 Human Tiaml 1591 10.9 3o Mouse proto-Dbl 320 (partial)9.7 Drosophila Still Life 1 2064 9.0 Drosophila Still Life 2 2044 8.4 Scdl: Schizosaccharomyce pombe Cdc24plo~.
Fgdi Faciogenital Dysplasia Protein. FGD also known as Aarskog-Scott syndrome, is an X-linked developmental disorders°2.
Vav/Vav2 A oncogene derived from hematopoietic cells'°3.
Q I 8479 (similar to Vav) Q22354 (similar to Vav) Ect2 Oncogene e~cpressed in epithelial cells and possessing transforming potential~°~.
to Tim Mammary epithelial oncogene~°s.
Dbl/Dbs Diffuse b-cell lymphoma (dbl) oncogenelo6, ioy pl ISRhoGEF Regulates cell proliferation. induces the transformation of cells'°g.
Lfc Hematopoietic oncogene~°9.
Ost Osteosarcoma derived proto-oncogene. Truncation is oncogenic and highly tumorigenic in micel~o.
Lsc Oncoprotein~ ~ ~.
Lbc Oncogene involved in chronic myeloid leukemias~~2.
Netl Neuroepithelioma transforming oncogene~ 13.
BCR bcr (breakpoint cluster region), an oncogene which is the translocation 2o breakpoint in chronic myeloid leukemias (CML) ~ ~4~ ~ ~ s.
Tiam 1 Human invasion- and metastasis-inducing tiam 1 gene and is e~cpressed in tumor-cell lines of different tissue origin"6.
Still Life I/2 A synaptic terminal protein~~~.

CDC42 and its GDP/GTP exchange factor (GEF) CDC24 are required for vegetative growthg'9 and cell mating6'~'l0. The precise function of these proteins in cell mating has been difficult to 5 study because they are essential for viability. In accordance with the present invention, we reasoned that if CDC24 has a specific function in the mating pathway, cdc24 alleles should exist which affect cell mating but not vegetative growth. To identify such alleles, a collection of CDC24 random mutants was screened and three recessive mating mutants, cdc24-ml-3 were isolated (Figure 3A). This screen required isolated cdc24 mutants to be able to support t o vegetative growth. Further characterisation of cdc24-m cells revealed normal growth between 18° and 37° and cell morphology, bud site selection, and actin distribution were similar to WT
cells (see below and Figure 1 A). The specificity of the cdc24-m phenotype is in contrast to that of all other described cdc24 mutants which have strong defects in vegetative growth8'~°.
is To elucidate the role of CDC24 in mating, we examined cdc24-ml cells for defects in the mating pathway. The mating e~ciency of cdc24-ml cells with a WT partner was reduced approximately 100-fold compared to WT (Table 1 ), and this effect was essentially independent of mating type. When cdc24-ml or an enfeebled mater defective in cell fusion were used as mating partners. significantly stronger defects were observed. Such bilateral mating defects 3o suggest impairment in a process such as shmoo (mating projection) formation. orientation. or fusion in which a WT mating partner can partially compensate for the mutant strain.
Pheromone activation results in a number of responses including cell cycle arrest, MAP-kinase cascade mediated induction of mating specific genes, and changes in cell morphology '~'S.
25 Pheromone-induced growth arrest determined by halo-assays showed both cdc24-ml and WT
cells responded similarly (Figure 1 B). Furthermore, overexpression of the ~i-subunit of the yeast hetero-trimeric G-protein, Ste4p, from an inducible promoter arrested growth of both cdc24-ml and WT cells (data not shown). Microscopic examination revealed identical numbers of WT
and cdc24-ml cells (78%, n=1600) formed shmoos after 4 hr exposure to 10 mM
pheromone.
3o The actin distribution of cdc24-ml budding and shmooing cells was also similar to that of WT
cells (Figure 1 A), demonstrating that the mating defect was not due to an inability to polarise the actin cytoskeleton. The level of pheromone induced FUS1-lacZ expression, a reporter used to measure induction of mating specific genes~~, was similar in cdc2:l-ml and WT
cells (Figure 1 C). However, examination of mating mixtures of cdc2=1-ml and WT tester cells showed a greater than ten-fold decrease in the number of zygotes, indicating that the cdc2=~-ml defect occurs prior to cell fusion. Thus cdcZ.l-m cells appear normal for cell cycle arrest, shmoo formation, actin cytoskeleton polarisation, and MAP-kinase signalling, yet are defective at a step prior to cell fusion.
During mating, polarised growth towards a mating partner requires a pheromone gradient''' and saturation with pheromone during mating results in random orientation of growth and mating 1o partner selection, and hence a decrease in mating efficiency~3'~4. WT cells showed a 16-fold decrease in mating e~ciency in the presence of saturating pheromone (20 rtWt), whereas only 10% reduction was observed with cdc2,l-ml cells (Figure 2A), suggesting that this mutant is unable to orientate towards a pheromone gradient during mating. Similar results were observed with cdc2~t-m2 and cdc2~-m3 cells. To test directly whether cdc2~-ml cells are defective in mating projection orientation their response to an artificial pheromone gradient created by a micropipet was examined. While CDC2;~ cells oriented growth towards the pheromone source (greater than 70% of cells oriented within 60° angle of micropipet), cdc24-ml cells did not show a preferred orientation (Figure 2B). No difference in the sensitivity of WT or mutant cells to pheromone was observed.
Although cdc2~-ml cells oriented randomly in a pheromone gradient, the choice of shmoo site could be dictated by an internal cue, such as the previous bud site. To examine this possibility, the location of the bud scar (in cells with a single bud scar) relative to the neck of the zygote was determined. While WT cells showed a random position of their bud scar on the zygotes, 86% of cdc2.l-ml zygotes had formed a shmoo adjacent to their previous bud site (Figure 2C). Together these results establish a specific role for Cdc24p in orientation towards a mating partner.
Sequencing of cdc2~-m alleles revealed mutations that changed one of two adjacent amino acid residues (Figure 3A). cdc24-ml and cdcl=l-m3 both have a single amino acid change from Ser 189 to either a Phe or Pro. cdc24-m2 had two amino acid substitutions and subcloning demonstrated that the mutation responsible for the mating defect is Asp to Gly at residue 190.

The grouping of these mutations suggests that this region of Cdc24p is important for an interaction required for oriented growth.
Previous two-hybrid studies have suggested that the amino-terminus of Cdc24p might interact with Ste4p', however, the in vivo significance of this association was unclear. We determined whether Cdc24p mating mutants could interact with Ste4p (Figure 3A). In contrast to the wild-rype Cdc24p, the mutants did not show a detectable interaction with Ste4p. In agreement with the clustering of the cdc2.l-m mutations, amino acid residues 170 to 245 of Cdc24p were sufficient for the Ste4p interaction (Figure 3C), while an amino-terminal fragment consisting of to the first 160 amino acid residues. although expressed, failed to interact.
Consistent with a functional significance of the Cdc24p Ste4p interaction. we have isolated mutants in STE=t, (exemplified by SEQ ID No. 9 and SEQ ID No. 10), using a two-hybrid screen, which are unable to interact with Cdc24p and are phenorypically similar to cdc2-~-m mutants.
To assess the specificity of the defect in the interaction between Ste4p and Cdc24-mlp, interactions with Cdc42p and Bemlp, two proteins known to bind to Cdc24p~''16 were investigated. Bemlp is an SH3 domain protein involved in bud formation and mating".
Cde24-mlp was able to interact with both Cdc42p and Bemlp (Figure 3B) consistent with the absence of an effect of cdc?.l-ml on vegetative growth.
While the cdc2-~-ml phenotype along with the two-hybrid results indicates that the interaction between Cdc2=lp and G(3 is central to cell orientation, these results do not address whether this interaction is direct or indirect. G~i typically functions as a complex with the third subunit of a hetero-trimeric G-protein, Cry. We therefore determined whether the yeast Gy, Stel8p, was required for the Cdc24p Ste4p interaction. Deletion of STE18 abolished the Cdc24p Ste4p two-hybrid interaction (data not shown), suggesting that Cdc24p interacts with the G[3~y-complex. To determine if Cdc24p could directly bind Ste4p, these proteins were expressed in bacteria.
Hexahistidine-tagged Ste4p specifically bound to GSTCdc24p (Figure 3D). These results demonstrate that Cdc24p can directly bind G(3 in the absence of any other yeast proteins. We 3o attribute the requirement for Gy in the two-hybrid assays to its stabilisation of G(3~8.

Pheromone receptor activation results in dissociation of G(iy from Ga at the receptor. Our results indicate that the orientation defect in cdc2=~-m cells is due to a specific defect in the Cdc24p G~iy interaction. This suggests a model in which direct binding of Cdc24p to G(3y results in recruitment (to the vicinity of the receptor) or activation of Cdc42p and that this local concentration of activated Cdc42p is responsible for oriented growth towards a pheromone gradient (Figure 4). In the absence of this recruitment or activation a site adjacent to the previous bud site appears to function as a default site for shmoo formation.
Our results together with previous studies implicating Cdc24p in bud site selections, suggest that Cdc24p acts as a crucial component required both for bud and shmoo site selection, perhaps functioning as a kind of molecular selector switch between internal signals for bud site selection and external signals for shmoo site selection. It is likely that local activation of Cdc24p recruits and activates the Rho GTPase Cdc42p, which could then interact with downstream targets required for orientation of the cytoskeleton. Cdc42p interactions with the protein kinase Ste20p~9'2° are not necessary for cell orientation2°, suggesting that novel targets of Cdc42p are required for oriented growth towards a mating partner.
Cdc24p belongs to a diverse family of GEFs which include many mammalian proto-oncogenes2.
This group of proteins shares a conserved region consisting of a Dbl-domain (named after the human proto-oncogene Dbl) followed by a plecktstrin-homology domain (PH).
Sequence 2o comparison revealed similarity between a small stretch of amino acids flanking the cdc24 mating mutations and Dbl (Figure 3A). Our results indicate that an association between Cdc24p and G~3y links pheromone receptor activation to shmoo orientation. We propose that other GEFs, such as the proto-oncogene Dbl, provide a similar connection between G-protein coupled receptor activation and polarised cell growth.
Hence, in accordance with the present invention there are provided the following uses and utilities of Cdc24p/Ste4 interaction and cdc24-m mutants 1 ) Peptide inhibitors which block GEF/G~3 interaction. Peptides and peptidyl derivatives based regions encompassing mutants will be used to block and/or antagonise GEF (such as the proto-oncogenes Dbl or Vav) G(3 interaction. Derivatives of these peptides (including peptide mimics) which bind with higher affinity will also be used. The perturbation of these interactions will be of therapeutic value for example in treatment of cancers.
2) Simple yeast based assays systems (utilising mating function and interaction reporters) will be extremely useful for high through-put screening to identify molecules perturbing this GEF/G(3 interaction. In particular, the qualitative effect on mating observed with the proto-oncogene, proto-Dbl, even at low levels of expression, indicates that this type of assay is amenable to large scale screening for the effect of agents, such as proto-oncogenes, on induced defects in yeast and other host cells.
t0 3) Similar Cdc24p/G~3 interactions will be ideal targets for anti-fungal drugs directed at the pathogenic yeast Candida.
1) We have identified an important interaction between two general cellular components, Cdc24p and G(3 which provides a connection between G protein coupled receptor activation and polarised cell growth. This work has been exemplified by work done with yeast genes/proteins, however, both cellular components involved have homologues in humans.
2) We show the physiological consequence of this interaction and from these data extrapolate to the general role of this interaction in human cells.
3) In addition, we have identified sequences required for this interaction.
Specifically, we have identified a short stretch of one protein (Cdc24p) encompassing 7~ as sufficient for this interaction and three amino acid changes (within this stretch) which block the interaction and have physiological consequences. These amino acid changes fall within a I9 amino acid piece with similarity to the human proto-oncogene Dbl. Indeed, removal of this region from proto-Dbl (when the amino terminus is removed) results in oncogenicity in tissue culture cells.
4) We have also identified specific mutants in the (3-subunit of the heterodimeric G protein (Ste4p) which appear to block its interaction with Cdc24p. We believe that several of these mutations will fall in conserved retions of G~3. Thus, it is possible to devise assays based on this mutation to screen for agents capable of modifying the non-interactive behaviour of the mutant G protein (3 subunit with Cdc24p. In addition, the assay could be used to study Cdc24p homologues or even Cdc24p derivatives or homologues to see if those derivatives or s homologues affect the non-interactive behaviour of the mutant G protein.
5) There is a wealth of information on human G(3's, human GEF's (~DP/GTP
exchange Factors), such as Cdc24p homologues and the rho family of GTP-binding-proteins (such as rho like Cdc42p) which the GEFs work on. Most human GEF's are oncogenes such as Dbl, Vav, 1o and Ect and are involved in some way in growth control. Furthermore G(3's are involved in linking signals from receptors to intracellular responses. The present invention has shown that that a GEF from yeast, Cdc24p, can directly bind G(3 in the absence of any other yeast proteins.
Although unproven, it is likely that interactions between human GEF's and G~3's are also crucial in erowth control and chemotaxis.
l5 6) We propose the interaction we have identified will have broad cellular ramifications and manipulation of these interactions (such as peptidic inhibitors and peptides mimicking activated species) will be of therapeutic value.
20 7) In addition, simple yeast based assays systems could be extremely useful for high through-put screening to identify molecules perturbing this interaction. In particular, a qualitative assay using a yeast mutant with a mating defect could prove useful in the design of agents, such as anti-cancer agents, that can affect the function of oncogenes such as proto-Dbl, in terms of its ability to complement a yeast mutant mating defect and/or its function in 25 mammalian tissue culture cells.
8) We also believe similar interactions will be ideal targets for anti-fungal drugs directed at invasive and pathogenic yeasts such as Candida albicans and Cryptococcus neoformans.
3o All publications mentioned in the above specification are herein incorporated by reference.
Various modifications and variations of the described methods and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in molecular biology or related fields are intended to be within the scope of the following claims.

RFERRFNCES
1. Machesky, L.M. & Hall, A. Rho: a connection between membrane receptor signaling and the cytoskeleton. Trends In Cell Biology ~, 304-310 {1996).
2. Cerione, R.A. & Zheng, Y. The Dbl family of oncogenes. Ca~rrent Opinion In Cell Biology $, 216-222 ( 1996).
3. Whiteway, M., et al. The STEM and STE18 genes of yeast encode potential b-subunits and y-to subunits of the mating factor receptor-coupled G protein. Cell $~, 467-477 (1989).
4. Sprague, G.F.J. & Thorner, J.W. Pheromone response and signal transduction during the mating process of Saccharomyces cerevisiae. In The molecular and cellular biology of the yeast Saccharomyces (eds. Jones, E.W., Pringle, J.R. & Broach, J.R.) 657-744 (Cold Spring Harbor t5 Press, Cold Spring Harbor, N.Y., 1992).
5. Leberer, E., Thomas, D.Y. & Whiteway, M. Pheromone signalling and polarized morphogenesis in yeast. Current Opinion in Genetics & Development Z, 59-66 (1997).
20 6. Simon, M.-N., et al. Role for the Rho-family GTPase Cdc42 in yeast mating pheromone signal pathway. Nature ~, 702-705 (1995).
7. Zhao, Z.S., Leung, T., Manser, E. & Lim, L. Pheromone signalling in Saccharomyces cerevisiae requires the small GTP-binding protein Cdc42p and its activator CDC24. Nlol Cell 25 Biol ~, 5246-57 (1995).
8. Sloat, B.F., Adams, A. & Pringle, J.R. Roles of the CDC24 gene product in ceiluiar morphogenesis during the Saccharomyces cerevisiae cell cycle. JCell Biol $~, 395-405 (1981).
30 9. Adams, A.E., Johnson, D.L, Longnecker, R.M., Sloat, B.F. & Pringle, J.R.
CDC42 and CDC43, two additional genes involved in budding and the establishment of cell polarity in the yeast Saccharomyces cerevisiae. JCell Biol llh 131-42 (1990).

10. Chenevert, J., Valtz, N. & Herskowitz, I. Identification of genes required for normal pheromone-induced cell polarization in Saccharomyces cerevisiae. Genetics ~, ( i 994).

11. Trueheart, J., Boeke, J.D. & Fink, G.R. Two genes required for cell fusion during yeast conjugation: evidence for a pheromone-induced surface protein. Mol Cell Biol Z, 2316-2328 (1987).

12. Segall, J.E. Polarization of yeast cells in spatial gradients of a mating factor. Proc Natl Acad Sci USA ~( , 8332-6 (1993).

13. Dorer, R., Pryciak, P.M. & Hartwell, L.H. Saccharomyces cerevisiae cells execute a default pathway to select a mate in the absence of pheromone gradients. JCell Biol ]~, 845-61 (1995).

14. Valtz, N., Peter, M. & Herskowitz, I. FARI is required for oriented polarization of yeast cells in response to mating pheromones. J Cell Biol ~, 863-73 ( I 995).

15. Zheng, Y., Cerione, R. & Bender, A. Control of the yeast bud-site assembly GTPase Cdc42.
Catalysis of guanine nucleotide exchange by Cdc24 and stimulation of GTPase activity by Bem3. JBiol Chem ~Q, 2369-72 (1994).

16. Zheng, Y., Bender, A. & Cerione, R.A. Interactions among proteins involved in bud-site selection and bud-site assembly in Saccharomyces cerevisiae. JBiol Chem Z7~, 626-30 (1995).

17. Chenevert, J., Corrado, K., Bender, A., Pringle, J. & . Herskowitz, I. A
yeast gene (BEMl ) necessary for cell polarization whose product contains two SH3 domains. Nature ~, 77-9 ( 1992).

18. Hirschman, J.E., DeZutter, G.S., Simonds, W.F. & Jenness, D.D. The G~3~y complex of the yeast pheromone response pathway - subcellular fractionation and protein-protein interactions. J
Biol Chem ~, 240-248 (1997).

19. Peter, M., Neiman, A.M., Park, H.O., Van Lohuizen, M. & Herskowitz, I.
Functional analysis of the interaction between the small GTP binding protein Cdc42 and the Ste20 protein kinase in yeast. Embo Journal ~, 7046-7059 (1996).

20. Leberer, E., et al. Functional characterization of the Cdc42p binding domain of yeast Ste20p protein kinase. Embo Journal j,~, 83-97 (1997).

21. Rose, M.D., Winston, F. & Hieter, P. Methods in yeast genetics: a laboratory course manual (Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1991).
to

22. Miyamoto, S., et al. A DBL-homologous region of the yeast CLS4/CDC2;t gene product is important for Ca(2+)-modulated bud assembly. Biochem Biophys Res Common ~, _ (1991).

23. Mitchell, D.A., Marshall, T.K. & Deschenes, R.J. Vectors for the inducible overexpression of glutathione-S-transferase fusion proteins in yeast. Yeast ~, 715-722 (1993).

24. Wach, A., Brachat, A., Alberti-Segui, C., Rebischung, C. & Philippsen, P.
Heterologous HISS marker and GFP reporter modules for PCR-targeting in Saccharomyces cerevisiae. Yeast ~, 1065-1075 (1997).

25. Fromant, M., Blanquet, S. & Plateau, P. Direct random mutagenesis of gene-sized DNA
fragments using polymerise chain-reaction. Analytical Biochemistry ~, 347-353 (1995).

26. Sprague, G.F. Assay of yeast mating reaction. Methods In Enzymol ~, 77-93 ( 1991 ).

27. Adams, A.E. & Pringle, J.R. Staining of actin with fluorochrome-conjugated phalloidin.
Methods Enrymol ,1~, 729-31 ( 1991 ).

28. Pringle, J.R. Staining of bud scars and other cell wall chitin with calcofluor. Methods Enrymol ~, 732-5 (1991).

29. Langle-Ronault, F. & Jacobs, E. A method for perfoming precise alterations in the yeast genome using a recyclable selectable marker. Nucleic Acids Research ~, 3079-3081 (1995).

30. James, P., Halladay, J. & Craig, E.A. Genomic libraries and a host strain designed for 5 highly efficient two-hybrid selection in yeast. Genetics ~, 1425-1436 (1996).
101. Chang, E.C., Barr, M., Wang, Y., Jung, V., Xu, H.P., and Wigler, M.H.
1994. Cooperative interaction of S. pombe proteins required for mating and morphogenesis. Cell.
~: 131-41.
l0 102. Pasteris, N.G., Cadle, A., Logie, L.J., Porteous, M., Schwartz, C.E., Stevenson, R.E., Glover, T.W., Wilroy, R.S., and Gorski, J.L. 1994. Isolation and characterization of the faciogenital dysplasia (aarskog-scoff syndrome) gene - a putative Rho/rac guanine-nucleotide exchange factor. Cell. 7Q: 669-678.
is 103. Katzav, S., Martinzanca, D., and Barbacid, M. 1989. Vav, a novel human oncogene derived from a locus ubiquitously expressed in hematopoietic-cells. Embo Journal. $: 2283-2290.
104. Miki, T., Smith, C.L., Long, J.E., Eva, A., and Fleming, T.P. 1993.
Oncogene ect2 is 2o related to regulators of small GTP-binding proteins. Nature. 462-465.
105. Chan, A.M., McGovern, E.S., Catalano, G., Fleming, T.P., and Miki, T.
1994. Expression cDNA cloning of a novel oncogene with sequence similarity to regulators of small GTP-binding proteins. Oncogene. Q: 1057-63.
106. Eva, A. and Aaronson, S.A. 1985. Isolation of a new human oncogene from a diffuse B-cell lymphoma. :Vature. 3~: 273-275.
107. Ron, D., Tronick, S.R., Aaronson, S.A., and Eva, A. 1988. Molecular-cloning and 3o characterization of the human dbl proto- oncogene - evidence that its overexpression is sufficient to transform nih/3t3 cells. Embo Journal. Z: 2465-2473.

108. Hart, M.J., Sharma, S., Elmasry, N., Qiu, R.G., Mccabe, P., Polakis, P., and Bollag, G.
1996. identification of a novel guanine-nucleotide exchange factor for the Rho-gtpase. Journal Of Biological Chemistry. ?~7~.: 25452-25458.
109. Whitehead, L, Kirk, H., Tognon, C., Trigo-Gonzalez, G., and Kay, R. 1995.
Expression cloning of lfc, a novel oncogene with structural similarities to guanine nucleotide exchange factors and to the regulatory region of protein kinase C. J Biol Chem. ~Q:
18388-95.
110. Horii, Y., Beeler, J.F., Sakaguchi, K., Tachibana, M., and Miki, T. 1994.
A novel oncogene, ost, encodes a guanine nucleotide exchange factor that potentially links Rho and Rac signaling pathways. Embo J. .~.,~: 4776-86.
111. Glaven, J.A., Whitehead, LP., Nomanbhoy, T., Kay, R., and Cerione, R.A.
1996. Lfc and lsc oncoproteins represent 2 new guanine-nucleotide exchange factors for the Rho-gtp-binding protein. Journal Of Biological Chemistry. ~: 27374-27381.
112. Toksoz, D. and Williams, D.A. 1994. Novel human oncogene ibc detected by transfection with distinct homology regions to signal-transduction products. Oncogene. 621-628.
113. Chan, A., Takai, S., Yamada, K., and Miki, T. 1996. Isolation of a novel oncogene, netl, from neuroepithelioma cells by expression cdna cloning. Oncogene. ~: 1259-1266.
114. Hariharan, LK. and Adams, J.M. 1987. Cdna sequence for human-bcr, the gene that translocates to the abl- oncogene in chronic myeloid-leukemia. Embo Journal.
~: 115-119.
115. Diekmann, D., Brill, S., Garrett, M.D., Totty, N., Hsuan, J., Monfries, C., Hall, C., Lim, L., and Hall, A. 1991. Bcr encodes a gtpase-activating protein for p2lrac. Nature.
651: 400-402.
116. Habets, G., Vanderkammen, R.A., Stam, J.C., Michiels, F., and Collard, J.G. 1995.
Sequence of the human invasion-inducing tiaml gene, its conservation in evolution and its 3o expression in tumor-cell lines of different tissue origin. Oncogene. 1371-1376.

117. Sone, M., Hoshino, M., Suzuki, E., Kuroda, S., Kaibuchi, K., Nakagoshi, H., Saigo, K., Nabeshima, Y., and Hama, C. 1997. Still life, a protein in synaptic terminals of Drosophila homologous to GDP-GTP exchangers. Science. ~: 543-5~7.

~'Qt 1RNCE LISTINGS
A. cdc24 (wt) SEQ ID NO. 1 s DNA:
cccctctgtatacmtcaactctgtgaagccgcaatttaaattaccggtaatagcatctgacgamgaaagtctgtaaaaa atccatttatgactt tatattgggctgcaagaaacacmgcamaacgatgaggagctmcactatatccgacgtttttgccaactcgacgtcccag ctggtcaaag tgctagaagtagtagaaacgctaatgaattccagc io SEQ ID NO. 2 Protein:
PLCILFNSVKPQFKLPVIASDDLKVCKKSIYDFILGCKKHFAFNDEELFTISDVFA~'~'STSQ
LVKVLEVVETLivINSS
B. cdc24-ml SEQ ID NO. 3 DNA:
2o cccctctgtatactmcaactctgtgaagccgcaatttaaattaccggtaatagcamgacgamgaaagtctgtaaaaaat ccatttatgactt tatattgggctgcaagaaacacmgcamaacgatgaggagcmtcactatatccgacgtrittgccaactcgacgtcccag ctggtcaaag tgctagaagtagtagaaacgctaatgaattccagc SEQ ID NO. 4 Protein:
PLCILFNSVKPQFKLPVIAFDDLKVCKKSIYDFILGCKKHFAFNDEELFTISDVFANSTSQ
LVKVLEWETLMNSS

C. cdc24-m2 SEQ ID NO. S
DNA:
S
cccctctgtatacttttcaactctgtgaagccgcaatttaaattaccggtaatagcatctggcgatttgaaagtctgta aaaaatccatttatgactt tatattgggctgcaagaaacactttgcatttaacgatgaggagcttttcactatatccgacgtttttgccaactcgacg tcccagctggtcaaag tgctagaagtagtagaaacgctaatgaattccagc 1o SEQ ID NO. 6 Protein:
PLCILFNSVKPQFKLPVLASGDLKVCKKSIYDFILGCKKHFAFiV'DEELFTISDVF A.~1STSQ
LVKVLEV~'ETLivINSS
is D. cdc24-m3 SEQ ID NO. 7 DNA:
cccctctgtatacttttcaactctgtgaagccgcaatttaaattaccggtaatagcacctgacgatttgaaagtctgta aaaaatccatttatgact ttatattaggctgcaagaaacactttgcatttaacgatgaggagcttttcactatatccgacgtttttgccaactcgac gtcccagctggtcaaa gtgctagaagtagtagaaacgctaatgaattccagc 2, SEQ ID NO. 8 Protein:
PLCILFNSVKPQFKLPVIAPDDLKVCKKSIYDFILGCKKHFAFNDEELFTISDVFA.~1STSQ
LVKVLEWETLMNSS
SEQ ID NO. 9 STE4 DNA sequence (wild-type) SUBSTITUTE SHEET (RULE 26~

AT~~-.GCACATCnG=s':GG:CTCGATnACGTnTTCT.'-.i:Tr'~='.'::~TCCCCnACr'1GTATe-._'=:CA.'ACC.'-..~_==.AGTCi.'-:CAGGi-.
TATCTCTGCA~'GGAGGi~~GP.AATTCAP.AATAF_=.::TAGi:GGCCGCCAGACAAG=G=GTA.3A'CnGC'~'TC
A?'GC"_'CP.ai TP_3 Ai=.nAGCP_~IAi:CnCAeyG=.TACPAGATGCAAGCT='ATTCCAGATGGCCP.ACP.AAG='°_nC':' :Ca_C CCe"in= =-.':A~:Gi:TC
P.F:CTTAAAGCC:.e~.ATATCG'i'GTTGAAAGGCCAT~-.ATAn:e'~Ar~.P.TCTCAGATTTTC:~GTGGAGTC =:~GATTCisi,AACGTAT
Tm_'"GAGTGCAniCAAGATGGCTTTATGCTTnT=.TGGGACAGTGCTTCAGGTTTr~
=u:CAGP.FC=CTATTCCP.TTP-GnTT
CTCAATGGGTTCT.TTCCTGCGCTATTTCGCCATCGAGTnCTTTGGTAGCAAGCGCnGGATTP.P.ACe~ATAACTGTA
CCATT
TnCAGAGTTT W: P ~.AGi~.AP.e'~CAGAGTAGCGCAAt-.ACGTT GCGT. CAAT. TTTCAAAGGACATAC
T'i G CT. r'1T. ATT : CTGACAT
TG~-.nTTTACAGi==~-.nCt:CACi:Ti-~T_F~TTGACAGC.r.GTGGGGAT.ATGi-.CATGTGCC::'GiGGGn- :P:CCGi:.z=.GCr'1AAG:y GGGTGAGAGir='.CAT'T_'CiGr~CCi:TTTAGGTGATG'='TTTGGCATTnGCT:,TT_CCTG
~~GF.GCCAr=.C'_"TAGr".F ~ '"TC'FTCG
P.~.~.nCATTCGC'_:1GCLVTGGH~il~.A~GACGGGTATACTTnCA'iATGS.-.GnT~.GCi:Gi=TCTCCGiC:..CTGTnCi:== GCTi"~...
'"L '"" _._..C=.C,TTC~~:mT._-_...__._..____.._____.._ __._.._.__._._._....._._~___......
..__. r~..~Jr:_...._...._.._...
T ~~.-11~TVTC:.J_.. _T:1.".VVTVVVC:CTVTTCTI:.TGV.T:1W~~........r v . T..v:-:VGTT.__ _.~.Vtl.'...VT :..w.V.T~\.~.r.
ym ~ r..I=~~n~n~r.", Tm T /"' .....ACrW ~~'''.t' Tl.:~'v~GI.TV.:IV~.TATCT
:._? LT..TA_...:..r~.,...~ .W':_GGAGTACAA.=CCGC::..r.:_'=~..»-.-IS .._ :v.til'.L.l. JJ..VT':v'/aTT~.T1~i~GATITmP.VTVC :T...TG'.:!"_'~'-7~
Vt:l~%TY-~..~'v~': ~.:.._.._~vAGr.L:lT~V'J~~~1V
.__TGTGGG=C__.._.. ~~.nGGAGAGATT.GiTG~AA~nTTi-i=='..W:'_"CA'-'GG'-GG~nGe:G'-C-_~:'~GTG:va.~CTCGi:~'-C~., AT.- ~~T°-_G~TG""T '"" A
GTTCATGGGACi:.i'==_C_..CGri'~,.~"'P.':'G.:T..T~~:'.V4'T-.:._"CAAT=:~
.._ J 1VVV ._ .r-V:l'1C V
2o SEQ ID No. 10 Ste4 Protein sequence (wild-type) h~ _::QMDSITY S:WVTQQYIQPQSLQDISAVEEc.IQNKIEAi-iRQES:CQLiii-~QINiC~
K:'.KT_QDe:S=°QMANK'.'=SLTK:iKIh1 L K?h1I'v i,KGH":~;KIS'JF RWSRDSKRILSASQDG F MLIidCSi:SGLKQNA = cLDSQ:~J~i LSCe:I S?SSTLVAS.'-:G=.NhINC i I''' 2~ i<..'SKEhiRVAQ:~-~=.SI:~CGii"'~YISDIEFTDNA::ILTASGDN'TCALWDiPKr'1KR'iREYSDH:.G~'.~n~AT:._._?N=.V
SS::
_ ~' SCG S CG'_ _ _ - ~: uS=cS?S~:VQS :'YVNDS DI:vnLRF : KDG:~iS -VAGS
Dt3Ga.T_ cl~'.': DLRS D C.. _. . _' c S :. F.... _ .._.. _ - -. ::~:PAhIh!EY\:
P.QSPQ='_::~jTSSSYLDNQGVVSLDFSASGRLMYSCYTDiGCV'v:°:DVLKGe.T_'i G=CT~EGHG~:~ ITGVRSS°
.,GLAVCTGS::DSTMKI'tISPGYQ
SEQ ID No. 11 sre4-o1.5 DI~~ sequence (mutant) . -GGChCAT.C.'-.GATGG C'ICGATAACGTATTC'_'AATe"-sr'?TS:TCF-~CCCP.ACAGTA':i:'FACAFCC=...P.iz.~GTC_.-'-.Ci-sGG=.
". ,. ,., r. _. .-3~ ..._..T..iV~. _.:':'VV~-xGVrie:Gr-~A': TCAAAATri-r.ATi:VrVGv,CGCCAGAC?.e-:GnVr?VTrsAr:Cr.:..: m.n_.:..-.-._....._.
~'v~1_ ~~~w - wT ~.~ I' ~~ Tmr~r._i.., y ~.I~m-T m /~~~' .._..... ....
.._. ~.V ...~~...tl.:V.'y.I.:a.Cl.'.J :'GCCY1V',..-:C1 1..V.~V:SLVVC'v.A!'ICCIt~':J m :C:1 _ :.:1'..'..'~ :~'~~'-._:CTTe~GCC:.i'ii'_'=s':CC'-.T.GTTGAAAGGCCATAATF~ITt'1~'~P_~,'TCTCAGi,T':TTCGGTGGAG'~ CGAG::T'-'C=W
~CGT~:C
SUBSTITUTE SHEET (RULE 26~

WO 99118213 " PCT/GB98/03033 TTTGAGTGC.~AGTCAAGATGGCTTTATGCTTATATGGGACAGTGCTTCAGG'=TTAAAACAGArCG::ATTCCATTAG
ATT
CTCAATGGG':T.CTTTCCTGCGCTATTTCGCCATCGAGTACTTTGGTAGCAr~iCGCAGGAT. TFF.F.i:~~-.nTAACTGTACCATT
TATAGAG""_"T~GAAAGAP.AACAGAGTAGCGCAAAACGTTGCGTCAATTTTCF.AAGGACATri~'""'G~T~TATT
TCTGACAT
TGAA T TTe=.Ci:GA TAACGCACA TATATTGACAGCAAGTGGGGA T ATGA CATG : GCCTTGTGGG~:Te :T ~:CCGAAnG CAAAG'?.
GGGTGAGAGGATATTCTGACCATTTAGGTGATGTTTTGGCATTAGCTATTCCTGAAGAGCCt~.AC'TAGAAAAT.TCT
TCG
AACACATTCGCTAGCTG T GGATCAGACGGGTATACTTFiCA TiiTGGGiITAGC~GA'=C T CCC:TCCGC':
G iACAAAGC':'T. T'TA
CGTTAACGATAGTGATATTAATGCACTTCGTTTTTTCAAAGACGGGATGTCGATTGTTGCAGGArGTGACAATGGTGCG
A
TAAATATGTATGATTTAAGGTCGGACTGTTCTATTGCTr'1CTTTTTCTCTTTI'TCGAGGTTATGAA~vAiaCGTACC
CCTACC
CCTACTTATATGGCAGCTAACATGGAGTACAATACCGCGCAATCGCCACAArCTTTAAA~'.TCnF.CF~
GCTCAAGCTATCT
AGACAACC:ie=:GGCGTTGTTTCTTTAGATTTTAGTGCATCTGv~AAGATTGATGTACTCATGCTnTi:~.nGACATT
GGTTGTG
TTGTGTGGG:.TGTATTAAAAGGAGAGATTGTTGGAAAAT
TnGAAGGTCATGGTGGCr~.GAGTCnC'='G('.~TGTGCGCTCGAGT
..v.:lv.~.T'v'v.:.:~Tf=VU.~VTI:T'.:':W.~GVTmV..I:~'JGG~.v.ll.C :v..... '.:r'-."-.......7G_~..M.~.v. .-..__...-:'~~1~:..
SEQ ID No. 12 Ste4-o15 Protein sequence {mutant) MA:IQMDST_ T YSNNVTQQYIQPQSLQDISAVEEEIQNKIEAARQESKQLHAQ;NKAKHKIQDi":ST_=
,~~:~IANKVTSLTKNKIN
LKPNIVLKG.'~'.NNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCA_S?SS'"LVASAGLN
NNCTIY
RVSKENR6'AQNVASI FKGHTCYISDIEF
TDNAHIi~TASGDMTCALTnTDIPK.:CRVRGYSDH:..G:~V=:~LAIPEEPNLENSSN
TFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRF FKDG:~.SIVAGSDh~.INMYDLRSD'.:.'ST_A':'F
SLFRGYF.ERTPTP
TYMAANM~YNTAQSPQTLKSTSSSYLDNQGVVSLDFSASGRi.MYSCYTD=G:VVWDVLKGF.IVG:CEGHGGRVTGVR
SSP
DGLAVCTGSWDSTMKIWSPGYQ
SEQ ID NO. 13 ste4-ol7 DNA sequence (mutant) ATGGCACF:T CAGATGGACT. CGATAACGTi-s'-'TCTAATAATGTCACCCe':ACi'iG :
ATATACAACCACAnAGTCTACAGu~a TA?'CTCTWAGTGGAGGAAGAAATTCAA.~r1' TAAAATAGAGGCCGCCnGAC.~'-u=~GAGAGTAAACAGC'ITCATGCTC~r=~ATAA
ATAAAGCA.=AP.CACAAGATACAAGATGCAAGCTTAT T C CAGATGGC C ~ri :CF .nAGTTACTTCG':' T anC CAAAn.= :'f.AGATC
AACT TAP.F-.GCCAAATATCGTGTTGAAAGGCCATAATAATAAAATCTCAG."-.':
TTTCGGTGGAGTCGe,GATTCAF.AACGTAT
TTTGAGTGCAAGTCAAGATGGCTTTATGCTTATATGGGACAGTGCTTCAG~'i'TTAAP.ACAGAF.CGCTATTCC~:T
.TAGATT
CTCP.ATGGGTTCTTTCCTGCGCTATTTCGCCATCGAGTACTTTGGTAGCF.l:GCGCAGGATTAAF.CrrITAACTGT
ACCATT
. C. _-. ~ ~~i. ~,GACr.Te":.. _ : C a A T. . .. T ~:nCe°:~:
_. ::.Gn-="_'.~.v~"'i."-..'~G«isil?CAGF,GT=.G:GCAA.-~u°-.CGTTGCG'"
~"_°.-_ ~~ " "'"'"G
TGF~':'""' :C=.G~T~CGCACATATATTG:~CF:GCAAGTGGGGATA
TGF,CA'_"GTGCCTTGTGGGATFTACCG:-..?.AGCP.AAGA
GGG'"Ge'~GnGP.ATATTCTGACCATTTAGGTGATGTTTTGGCATTAGCTAT_"_'CCTGAAGAGCCAF.AC'_'TAG
P.AAATTCTTCG
AACACAT : ~GCTAGCTGTGGATCAGACGGGTATACTTACATATGGGF TAG~:AGATC T CCG : CCGC
T'GT:'iW-.AnGC': TTTA
CGTTAACGaTAGTGaTATTAATGCACTTCGTTTTTTCAAAGACGGGATGTCGATTGTTGCAGGAF:GTGACAnTC:"TG
CGA
SUBSTITUTE SHEET tR(lLE 2B1 TAAATATGTATGATTTAAGGTCGGACTGTTCTATTGCTACTTTTTCTCTTTTTCGAGGTTATGAAG?.ACGTACCCC':
'rCC
CCTACTTATATGGCAGCTAACATGGAGTACAATACCGCGCAATCGCCACAAACTTTAAAATCAACAAGCTCAAGCTATC
T
AGACP.ACCAAGGCGCTGTTTCTTTAGATTTTAGTGCATCTGGAAGATTGATGTACTCATGCTATACF:GACATTGGiT
GTG
TTGTGTGGGATGTATTAAAAGGAGAGATTGTTGGAAAATTAGAAGG~_'CATGGTGGCAGAGTCACT.GGTGTGCGCTC
GAGT
CCAGATGGGTTAGCTGTATGTACAGGTTCATGGGACTCAACCATGAe'~AATATGGTCTCCAGGTTnTCAATAG
SEQ ID No. 14 Ste4-ol7 Protein sequence (mutant) MAHQMDSITYSNNVTQQYIQPQSLQDISAVEEEIQNitIEAARQESKQLHAQINKAKHKIQDASLFQi~IANKVTSLTK
NKIN
LKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSS':LVASAGLNNNCT
IY
RVSK= NRVAQNJASIF KGHTCYISDIEF
TDNAHILTASGDMTCrI~.::_=P:~~:CRVREYSDHLGDV_r:.nI?F.EP:i:..F:;SS'i TFASCGSDGYTYIWDSRSPSAVQSFYVNDSDIIVALRFFKDGMSIVi-nGSDN~VAINMYDLRSDCST_A=:jLFRGYE'.~TPTP
TYMAANMEYNTAQSPQTLKSTSSSYLDNQGA'!
'SLDFSASGRLMYS~'_'TDIVCVVWDVLhGtIVG:C:.~GHGGRV~GVR.SSn 1~ DGLAVCTGSWDSTMKIWSPGYQ
SEQ ID No. 15 is presentedFigure 3A as in Dbl Hu.

SEQ ID No. 16 is presentedFigure 3A as in Cdc24 Sc.

SEQ ID No. 17 is presentedFigure 3A as in Cdc24-ml .

2o SEQ ID No. 18 is Figure 3A as presented in Cdc24-m2.

SEQ ID No. 19 is presentedFigure 3A as in Cdc24-m3.

SUBSTITUTE SHEET (RULE 261

Claims (28)

1. A nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof, wherein the expression product of the nucleotide sequence has the capability of not substantially affecting the interaction of G.beta. with Cdc24p or a homologue thereof that is usually capable of being associated therewith.

2. A mutant of the nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof, wherein the expression product of the mutant nucleotide sequence has the capability of substantially affecting the interaction of G.beta. with Cdc24p or a homologue thereof that is usually capable of being associated therewith.

3. A nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment.
variant or homologue thereof or the expression product thereof for use in medicine.

4. A mutant of the nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof or the expression product thereof for use in medicine.

5. Use of a nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof or the expression product thereof in the manufacture of a medicament to affect the growth behaviour of cells.

6. Use of a mutant of a nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof or the expression product thereof in the manufacture of a medicament to affect the growth behaviour of cells.

7. Use of a nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof or the expression product thereof in a screen to identify one or more agents that are capable of affecting the interaction of Cdc24p or a homologue thereof with a G.beta. or an associated Rho-family GTPase.

8. Use of a mutant of a nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof or the expression product thereof in a screen to identify one or more agents that are capable of affecting the interaction of Cdc24p or a homologue thereof with a G.beta. or an associated Rho-family GTPase.

9. An assay comprising contacting an agent with a nucleotide sequence shown as SEQ I.D.
No. 1 or a derivative, fragment, variant or homologue thereof or the expression product thereof in the presence of a G.beta. capable of being associated with Cdc24p or a homologue thereof; and determining whether the agent is capable of affecting the interaction of the nucleotide sequence or the expression product with the G.beta..

10. An assay comprising contacting an agent with a mutant of a nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof or the expression product thereof in the presence of a G.beta. capable of being associated with Cdc24p or a homologue thereof; and determining whether the agent is capable of affecting the interaction of the mutant nucleotide sequence or the expression product with the G.beta..

11. A kit comprising a nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof or the expression product thereof; and a G.beta.
capable of being associated with Cdc24p or a homologue thereof.

12. A kit comprising a mutant of a nucleotide sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof or the expression product thereof; and a G.beta. capable of being associated with Cdc24p or a homologue thereof.

13. A protein sequence shown as SEQ I.D. No. 2 or a derivative, fragment, variant or homologue thereof, wherein the protein has the capability of not substantially affecting the interaction of G.beta. with Cdc24p or a homologue thereof that is usually capable of being associated with the Cdc24p or the homologue thereof.

14. A mutant of the protein sequence shown as SEQ I.D. No. 1 or a derivative, fragment, variant or homologue thereof; wherein the mutant protein has the capability of substantially affecting the interaction of G.beta. with Cdc24p or a homologue thereof that is usually capable of being associated with the Cdc24p or the homologue thereof.

15. A protein sequence shown as SEQ I.D. No. 2 or a derivative, fragment, variant or homologue thereof for use in medicine.

16. A mutant of the protein sequence shown as SEQ I.D. No. 2 or a derivative, fragment, variant or homologue thereof for use in medicine.

17. Use of a protein sequence show as SEQ I.D. No. 2 or a derivative, fragment, variant or homologue thereof in the manufacture of a medicament to affect the growth behaviour of cells.

18. Use of a mutant of a protein sequence shown as SEQ I.D. No. 2 or a derivative, fragment, variant or homologue thereof in the manufacture of a medicament to affect the growth behaviour of cells.

19. Use of a protein sequence shown as SEQ I.D. No. 2 or a derivative, fragment, variant or homologue thereof in a screen to identify one or more agents that are capable of affecting the interaction of Cdc24p or a homologue thereof thereof with a G.beta. or an associated Rho-family GTPase.

20. Use of a mutant of a protein sequence shown as SEQ I.D. No. 2 or a derivative, fragment, variant or homologue thereof in a screen to identify one or more agents that are capable of affecting the interaction of Cdc24p or a homologue thereof with a G.beta. or an associated Rho-family GTPase.

21. An assay comprising contacting an agent with a protein sequence shown as SEQ I.D. No.
2 or a derivative, fragment, variant or homologue thereof in the presence of a G.beta. capable of being associated with Cdc24p or a homologue thereof; and determining whether the agent is capable of affecting the interaction of the protein sequence with the G.beta.
or the Rho-family GTPase.

22. An assay comprising contacting an agent with a mutant of a protein sequence shown as SEQ I.D. No. 2 or a derivative, fragment, variant or homologue thereof in the presence of G.beta.
capable of being associated with Cdc24p or a homologue thereof; and determining whether the agent is capable of affecting the interaction of the mutant protein sequence with the G.beta. or the Rho-family GTPase.

23. A kit comprising a protein sequence shown as SEQ I.D. No. 2 or a derivative, fragment, variant or homologue thereof; and a G.beta. capable of being associated with Cdc24p or a homologue thereof.

24. A kit comprising a mutant of a protein sequence shown as SEQ I.D. No. 3 or a derivative, fragment, variant or homologue thereof; and a G.beta. capable of being associated with Cdc24p or a homologue thereof.

25. A GEF capable of interacting with a G.beta. such that the interaction provides a connection between G protein coupled receptor activation and polarised cell growth.

26. An agent capable of affecting a GEF/G.beta. interaction, which interaction provides a connection between G protein coupled receptor activation and polarised cell growth.
37. A sequence selected from: SEQ ID No. 15 or SEQ ID No. 16 or SEQ ID No. 17 or SEQ

ID No. 18 or SEQ ID No. 19.
28. An assay method comprising the use of the sequence presented in claim 28 or a nucleotide sequence coding for same.
29.Use of an agent identified by the assay of claim 9 or claim 10 or claim 21 or claim 22 or

claim 28 in the manufacture of a medicament which affects cell growth.