CA2275177A1 - Tryparedoxin peroxidase - Google Patents

Abstract

The present invention describes a novel enzyme, tryparedoxin peroxidase, its isolation from Crithidia fasciculata, a method for the production thereof in genetically transformed bacteria, and its use as molecular target for the discovery of trypanocidal drugs.

Description

TRYPAREDOXIN PEROXIDASE
Introduction Flagellated protozoan parasites of the family Trypanosomatidae are among the most prevalent human pathogens in tropical and subtropical areas. These organisms have complex life cycles and some of them are the causative agents of debilitating or life-threatening diseases, such as American Chagas' disease (Trypanosoma cruzi), African sleeping sickness (T brucei gambiense and T. b. rhodesiense), oriental sore (Leishmania tropica), kala azar (L. donovani) and mucocutaneous leishmaniasis (L.
brasiliensis). Others infect hosts as diverse as plants (Phytomonas species), insects (Crithidia and Leptomonas species) and livestock (T. congolense, T. b. brucei, T. evansi). Many of the human pathogens are also endemic in wildlife. Worldwide, more than 30 million people are estimated to suffer from trypanosomal and leishmanial infections (World Health Organisation, 1996). Vaccination strategies have so far failed and most of the chemotherapeutic drugs currently used for treatment are unsatisfactory in terms of both efficacy and toxicity {Risse, 1993). Nifurtimox, for instance, a drug widely used in the treatment of Chagas' disease, is an unspecific redox cycler affecting not only the peroxide sensitive parasites but also the host. Accordingly, the defense system against oxidants in CONFIRMATION COPY

the trypanosomatids, which differs substantially from the analogous host metabolism, has been discussed as a potential target area for the development of more specific trypanocidal agents (Fairlamb, 1996; Jacoby et al.) 1996).
EI-Sayed et al. in Mol. Biochem. Parasitology, 73 (1995) 75 - 90 describe cDNAs from Trypanosoma brucei rhodesiense but do not make any suggestion how to cope with the problems mentioned.
As parasites, the trypanosomatids are inevitably exposed to various reactive oxygen species, such as superoxide radicals, hydrogen peroxide and myeloperoxidase products, generated during the host defense reaction. However, their ability to cope with such oxidative stress appears to be surprisingly weak. Although they possess an iron-containing superoxide dismutase to scavenge phagocyte-derived superoxide (LeTrant et al., 1983), they lack both catalase and glutathione peroxidase (Docampo, 1990), the major hydroperoxide metabolising enzymes of the host organisms (Chance et al. , 1979; Flohe, 1989). They also contain conspicuously low concentrations of glutathione (GSH)) the major antioxidant sulphydryl compound in mammalian cells. Instead they form a unique GSH
derivative known as trypanothione (T(SH)2; N1,N8-bis(glutathionyl)spermidine), which is believed to play a central role in their antioxidant defense system (Fairlamb et al., 1985; Fairlamb and Cerami, 1992). T(SH)z can be oxidized by Hz02 to the corresponding cyclic disulphide (TS2) and is regenerated at the expense of NADPH by trypanothione reductase (Bailey et al., 1993; Jacoby et al. , 1996). Whether the reaction of T(SH)2 with H202 is enzymatically catalyzed has, however, been the subject of debate. A T(SH)z-dependent peroxidase activity was repeatedly reported for crude extracts of the trypanosornatids {Penketh and Klein, 1986;
Henderson et al., 1987; Penketh et al., 1987). However, a pertinent enzymatic entity could never be purified (Henderson et al., 1987; Penketh et al., 1987) and doubts about its existence were raised (Penketh and Klein, 1986). A recent systematic investigation of the various developmental stages of T. cruzi even concluded that non-enzymatic oxidation of T(SH)2 by H202 may fully account for the slow hydroperoxide metabolism in this species (Carnieri et al., 1993).
The present invention is based on the discovery that hydroperoxide metabolism in the trypanosomatids is enzymatic in nature) but distinct from any known metabolic pathway of the host organisms (Nogoceke et al., 1997). Apart from the previously known trypanothione reductase, the parasitic pathway comprises two novel proteins, called tryparedoxin and tryparedoxin peroxidase) which together catalyse the reduction of hydroperoxides at the expense of NADPH as depicted in Fig. 1.
The uniqueness of this cascade of oxidoreductases offers the possibility to inhibit the parasitic metabolism without causing adverse effects in the host organism.
Thus, one embodiment of the invention concerns a protein, wick is characterized by its capability of transferring reductive equivalence of trypanothione/trypanothione disulfide via a mediator such as tryparedoxin (trypanothione: peroxiredoxin oxidoreductase), mediating between trypanothione/trypanothione disulfide and the protein, to hydrogen peroxide and/or alkylhydroperoxide.
The protein according the invention can be characterized in that it can be prepared by means of and/or isolated from a species of the family Trypanosomatidae.
Further, the protein according to the invention can be characterized in that the preparation and/or isolation can be carried out by genetic engineering especially by means of an oligonucleotide as probe wherein the sequence of said oligonucleotide codes for a peptide of SEQ ID NO 1:
MP~LAVP~AQSEAVQKLSK NFNyESIPTLIGyDADSGDVVTTR ~ATLV.
Further, the protein according to the invention can be characterized by an oligomeric structure in its native state and by a molecular weight of 20 to 24 kDa in its monomeric state.
Further, the protein according to the invention can be a protein comprising or having the amino acid sequence of SEQ ID NO 1.
Further, the protein according to the invention can be characterized by at least one ValCysPro (VCP) motif and catalyzing the reduction of peroxides by means of tryparedoxin.
Further, the protein according to the invention can be a protein (a) having the amino acid sequence SEQ ID NO 2 (figure 9 positions 1 to I 87):

., . i n n ~, i . " I i ~ - I :l ry : 1 ti: 1 t n.-;. ;', v ._ ~ ;'. 1 ti: I
_' i:!:l I ~1~~ ;.. i . ~/ I tS

M S. C G A A K L N H P A P E E 15 D ~ ~j A L M P N G T F K ~C V S 30 96 GRCl G ACATG GCGCTC ATG CCCAAC GGC ACATT'CAAG AAGGTA AGC

L' S S Y K G EE Y V V L E' F Y P 45 M D F T E V C P T E I I Q ~' S 60 D G A I~ R F A E I ~t T E V I S 75 K K G G L ~ P M A p M L 105 31a GCC GAC AAG ACC AAG GGC ATC GCG CGC GCC TAC GGC GTG CTG GAC
E D S G V A Y R G V F _r I = 135 361 GAG GAC AGC GGG GTC GCC TAC CGC GGC GTC TTC ATC ATC GlIC CCC
KLROLI TNpM pI~150;-406 AAC GGC AAG CTG CGC CAG ATC ATC ATC AAC GAC ATG CCC ATC GCiC

L~ N V E . Y F R V F~ A L 0 ~ 1 ~ 5 45i CGC AAC GTC GAG GAG GTG ATC CGC CTG GTC GAG GCG CTG CAG TTC
V E E H G E V C ? A A ~~l K K G 18J
996 GTG GAG' GAG CAC GGC GAG GTG TGC CCG GCC AAC TGG AAG AAG GGC
D A K K K E G

cGa cc~ c~r> ccc~ cAyl or (b) having an amino acid sequence which is hamologuous to said according to (a), has the same number ar a smaller or slightly smaller number of amino acids and is encoded by an oligvnucleotide which is hybridazable with an oligonucl.eotide which encodes a protein having the amino acid sequence SE 1D N(~ 2.
Further floe rotein sccordir~~ b haw. an amino acid a uence > p 8 ~( ) ~ g s 9 which is homologous to said according to (a) by at least 70 °~d especially at least 75 °/a.
Another embodiment of the invention concerns a plasmid for the expression of a protein according any cf the preceding claims and comprising a nucleic acid sequence encoding said protein.
The piasmid according to the invention may comprise a DNA sequence encoding tryparedaxin peroxidase especially of Crithidin~'asciculata.
AMEivUEC SHEET

Further, the plasmid according to the invention may comprise a DNA sequence encoding functionally active derivatives of tryparedoxin peroxidase designed for an isolation in a manner known per se.
Further, the plasmid according to the invention may comprise a DNA sequence encoding functionally active derivatives of tryparedoxin peroxidase wherein the tryparedoxin peroxidase is derivated by a His tag.
Still another embodiment of the invention concerns a process for the production of a protein according to the invention characterized in that it is produced by means of a DNA
sequence encoding the amino acid sequence of SEQ ID NO 1 by genetic engineering in a manner known per se.
The process according to the invention can be characterized in that the production is carried out by means of a plasmid according to the invention.
Further, the process according to the invention can be characterized in that the host is selected from the group consisting of bacteria, fungi, yeast, plant cells, mammalian cells and cells cultures (heterologuous expression).
Further, the process according to the invention can be characterized in that Escherichia coli is used as host.
Still another embodiment of the invention concerns a use of a protein according to the invention or obtained according to the process according to the invention for testing and recovering inhibitory substances which inhibit activities of said protein.
Still another embodiment of the invention concerns a test system for testing the catalytic activity of a protein according to the invention or obtained according to the process according to the invention, wherein the testing system contains or comprises trypanothione reductase, trypanothione, a tryparedoxin as mentioned before and; in addition, a hydroperoxide as indicator enzyme, mediator and substrate, respectively.
Finally, another embodiment of the invention concerns a pharmaceutical preparation having a trypanocidal activity and comprising an inhibitory substance inhibiting the catalytic activity of a protein according to the invention or of a protein which can be obtained according to the process according to the invention.
The pharmaceutical preparation according to the invention can be characterized in that it can be obtained by a use according to the invention and by using a test system according to the invention.

The invention is now described in greater detail by means of figures and examples.
Fig. 1 Flux of reducing equivalents from NADPH to hydroperoxide in C.
fasciculata. TR =
trypanothione reductase; T(SH)2 = trypanothione; TS2 = trypanothione disulphide; TXN =
tryparedoxin; TXNPx = tryparedoxin peroxidase; ROOH = hydroperoxide.
Fig. 2 Components of the trypanothione-mediated hydroperoxidase metabolising sytem from C. fasciculata in silver-stained SDS-PAGE (8 - 25 %). Lane 2, extract of disrupted cells; lane 3, trypanothione reductase; lane 4, tryparedoxin peroxidase and lane 5, tryparodoxin. Lanes 1 and 6, molecular weight standards.
Fig. 3 Molecular mass determination by MALDI-TOF-MS of pure tryparedoxin peroxidase from C. fasciculata. The peaks at 20880 and 41829 correspond to the apparent molecular masses of the monorneric and dimeric forms of tryparedoxin peroxidase, respectively.
Fig. 4 Gel permeation chromatography of pure tryparedoxin peroxidase from C.
fasciculata.
Pure tryparedoxin peroxidase was chromatographed on a Superdex 200 HR 10/30 column in 0.2 M NH4HC03 buffer, pH 7.8. The peak eluting at 11.8 ml corresponds to the homo-oligomeric form of tryparedoxin peroxidase with a molecular mass of more than 250000. The molecular mass of the second peak, eluting at 15.2 ml and corresponding to the dimeric form of tryparedoxin peroxidase, is approximately 42000. The monomeric form was not detected.
Fig. 5 NADPH -dependent hydroperoxide metabolism reconstituted from components isolated from C. _fascicz~lata. Peroxidase activity depends on both isolated proteins, tryparedoxin (TXN) (A) and tryparedoxin peroxidase (TXNPx) (B), as well as T(SH)2 (E) and trypanothione reductase (TR) (F). The comparatively high activity in (F) observed immediately after the addition of TR is due to the accumulation of its substrate, TS2. Note that the reaction is comparably fast with H202 (D) and t-bOOH (C). The tests were performed at 27 °C with 0.1 mM NADPH, 16.5. pg/ml tryparedoxin peroxidase, 12 pg/ml _...~ ~__.._._~.._.~__T_ , tryparedoxin, 45 pM T(SH)2, 45 ~M hydroperoxide and 0.4 U/ml TR. NADPH
consumption was measured photometrically at 340 nm.
Fig. 6 Sequence alignment of the peptide fragments of tryparedoxin peroxidase with thiolspecific antioxidant protein from yeast (TSA/YEAST). Tryparedoxin peroxidase was digested with trypsin (Tryp) or endoproteinase Glu-C (Glu-C). The yeast TSA
sequence was obtained from the SwissProt Data Bank (accession no. P34760). Asterisks denote conserved residues.
Fig. 7 Nucleotide and deduced amino acid sequences of the tryparedoxin peroxidase gene from C. fasciculata. The arrows delimit the PCR product used to screen the genomic library. The start and stop codons are in bold, as is the asparagine residue which was replaced by a threonine residue in direct peptide sequencing. Sequences confirmed by protein sequence analysis are underlined. The position of the Sac I site in the 1.1.
kb fragment is heavily underlined. The differences in the coding region between the 1.5 kb and 11 kb fragments, and in the 5' flanking region between the 1.5 kb and 1.1 kb fragments are shown in brackets. The AG consensus splice leader sites and the polypyrirnidine rich tract are double underlined.
Fig. 8 Tryparedoxin peroxidase specific activity determined in supernatants of sonicated E.
coli BL21(DE3) pET/Tpod cells (~), E. coli BL21(DE3)pET/TpodH6 cells (~) and E. coli BL 21 (DE3) pET 24 a cells (1). Gene expression induction, by IPTG addition is indicated by an arrow.
Fig. 9 Western blot analysis of expressed tryparedoxin peroxidase. SDS-PAGE
was done under reducing conditions in 8-25 % gradient gels and the samples were electroblotted onto a PVDF membrane using a Pharrnacia Phast System. Whole rabbit serum (1:250 dilution) containing antibodies raised against pure C. fasciculata tryparedoxin peroxidase was used as first antibody and anti-rabbit goat antibodies (Sigma) as second antibody.
Lane 1, supernatant of E. coli BL21 (DE3) pET/Tpod cells 5 h after induction; lane 2, supernatant of E. coli BL21 (DE3)pET/TpodH6 cells 5 h after induction; lane 3 authentic tryparedoxin peroxidase from C. fasciculata Fig. 10 SDS-PAGE of expressed tryparedoxin peroxidase. SDS-PAGE was done under reducing conditions in 8-2S % gradient gels on a Pharmacia Phast System and the gels were stained for protein with silver according to the manufacturers' recommendations. Lane 2, supernatant of E. coli BL21(DE3)pET/TpodH6 cells before induction; lane 4, supernatant of E. coli BL21(DE3)pET/TpodH6 cells S h after induction; lane 4, purified recombinant tryparedoxin peroxidase and lane S, authentic tryparedoxin peroxidase from C.
fasciculata.
Lanes 1 and 6, molecular weight standards.
Fig. 11 Molecular mass determination by MALDI-TOF-MS of pure recombinant tryparedoxin peroxidase. The peaks at 21884 and 43 766 correspond to the apparent molecular masses of the monomeric and dimeric forms of tryparedoxin peroxidase, respectively.
Example 1: Isolation of tryparedoxin peroxidase from C. fasciculata.
C. fasciculata was cultivated in a 100 1 fermenter as described (Shim and Fairlamb, 1988). The cells were harvested in the late log phase, suspended in 50 mM
sodium phosphate pH S.8 (buffer B) containing 0.1 mM PMSF, then frozen and thawed twice to complete cell disruption. Cell debris was removed by centrifugation at 25,000 g for 30 min and the supernatant was applied on an S-Sepharose column pre-equilibrated with buffer B.
Tryparedoxin peroxidase eluted at 1 SO mM NaCI in buffer B and was directly loaded on a hydroxyapatite (BioRad, USA) column pre-equilibrated with 10 mM sodium phosphate pH
6.8. Tryparedoxin peroxidase was eluted stepwise with 0.4 M potassium phosphate pH 6.8.
The protein was extensively dialyzed against 20 mM Tris pH 7.6 {buffer C) and purified to homogeneity on a Resource Q column, eluting at 0.1 M NaCI in buffer C. The flow-through of the S-Sepharose column containing trypanothione reductase and tryparedoxin can be used to measure the enzymatic activity of tryparedoxin peroxidase (see example 2) or separated further to yield purified tryparedoxin and trypanothione reductase (Fig. 2) as described by Nogoceke et al. (1997).
MALDI-TOF-MS was performed with a Bruker Reflex-MALDI-TOF mass spectrometer in linear modus with an acceleration voltage of 30 kV after desalting the samples on Sephadex G-2S columns. SDS-PAGE was done under reducing conditions in 8-25% gradient gels on a _ _ .. T.~.__.

Pharmacia Phast System and the gels were stained for protein with silver according to the manufacturer's recommendations. Gel filtration was performed on a Superdex 200 column in 0.2 M NH4HC03 buffer pH 7.8.
Table 1 Yields and purification factors during the isolation of tryparedoxin peroxidase.
Volume ActivityProtein U/mg Yield Purification (ml) (U) (mg) (%) factor Cell extract 180 1268 3 322 0.3 ( 100) ( 1.0) S-Sepharose 600 685 557 1.23 54 3.2 Hydroxyapatite400 503 87 5.78 40 15.1 Resource Q 54 373 64 5.83 29 15.3 The overall yields of the final purification scheme are shown in Table 1.
Based on the purification factors yielding homogeneous products the minimum concentrations of tryparedoxin and tryparedoxin peroxidase in the starting material were estimated to amount to % and 6 %o of the total soluble protein, respectively. The homogeneity and approximate molecular masses of the purified proteins are shown in Figure 1. The apparent subunit masses deduced by SDS-PAGE (about 21000) were compatible with those obtained by MALDI, 20880 ~ 120 (Fig. 3). Freshly prepared tryparedoxin peroxidase was partially dimerised and contained higher molecular mass oligomeric species according to MALDI-MS.
Rechromatography of purified tryparedoxin peroxidase on Superdex 200 revealed the enzymatically active protein to be homo-oligorneric with an approximate molecular mass beyond 250,000 (Fig. 4). The monomeric species was not detected and a trace of the dimeric form obtained by gel permeation was enzymatically inactive. Analyses of the spectral properties of the two proteins confirmed the absence of any chromophoric cofactors absorbing in the visible region.
Example 2: Determination of tryparedoxin peroxidase activity.
In essence, the activity of tryparedoxin peroxidase activity is measured by coupling the catalytic reduction of hydroperoxide by tryparedoxin to NADPH consumption by means of trypanothione and trypanothione reductase. For example, an assay sample may contain 0.1 mM NADPH in 50 mM Hepes pH 7.6, 1 mM EDTA, 50 M H202 or t-butyl hydroperoxide (t-bOOH), 45 M T(SH)2, 0.6 ~.M tryparedoxin, and 0.34 U trypanothione reductase. Unless otherwise stated, the reaction is started with the addition of the hydroperoxide. Dihydro-trypanothione is obtained by chemical reduction of TSZ (Bachem, Switzerland) as described (Fairlamb et al. , 1986). In the specificity studies, T(SH), and trypanothione reductase were replaced by GSH and glutathione reductase. t-BOOH may be replaced by other hydroperoxides such as H202, linoleic acid hydroperoxide or phosphatidylcholine hydroperoxide. Phosphatidylcholine hydroperoxide is prepared from phosphatidylcholine by oxidation with soybean lipoxygenase (both Sigma, Germany) as described (Maiorino et al., 1990). Accordingly, linoleic acid hydroperoxide is prepared by enzymatic oxidation, extracted with ether at pH 4 and identified as 13-linoleic acid hydropero~ide by HPLC
(Thomas and Jackson, 1991 ).
Figure 5 demonstrates that trypanothione reductase, T(SH)~, tryparedoxin and tryparedoxin peroxidase are indispensable for the efficient reduction of HZOZ
or alkyl hydroperoxides by NADPH The T(SH}2-mediated "NADPH peroxidase activity" of C.
fasciculata is thus achieved by the concerted action of three distinct proteins; the well characterized trypanothione reductase (Bailey et al., 1993 ), tryparedoxin and tryparedoxin peroxidase. A "trypanothione peroxidase" as a single enzymatic entity does not exist but is an enzymatic system composed of the two distinct proteins, tryparedoxin and tryparedoxin peroxidase.
Example 3: Characterisation of tryparedoxin peroxidase by partial proteins sequencing.
Since the N-terminus of tryparedoxin peroxidase was blocked, the protein was digested with bovine trypsin or endoproteinase Glu-C from Stnphylococcus aureus (both sequencing grade, Promega) according to Stone and Williams (1993). The peptides were separated by HPLC (Applied Biosystems I72A) on an Aquapore OD-300 RP-18 column.
Automated Edman degradation was performed with an Applied Biosystems, Inc.
sequencer with an on-line C-I8 reverse phase HPLC. Database searches were performed with the BLAST and FASTA programs. Peptides were aligned with the Bestfit program, Genetics Computer Group (GCG), Madison, Wisconsin, USA.
Eight fragments could be sequenced and could be aligned to a thiol-specific antioxidant protein (TSA) of yeast first described by Kim et al. ( 1988) (Fig.
6). TSA, in turn, belongs to the peroxiredoxin family of proteins, which comprises thioredoxin peroxidases, alkyl hydroperoxide reductase of bacteria, and a large number of proteins of undefined function (Chae et al., 1994) including a deduced protein sequence of Trypanosoma brucei rhodesiense (EI-Sayed et al., 1995).
_ ._____.__._. _._. ..._.__ __. w_ _ Example 4: Use of sequenced fragments of tryparedoxin peroxidase to elucidate the encoding DNA.
Cells culture and DNA extraction: C. fasciculata (HS6) was grown as described by Shim and Fairlamb (1988). The cells were harvested by centrifugation for 15 min at 7000 rpm, washed twice with saline solution (0.9% NaCI) and resuspended in 5 ml buffer (SO mM TrisCl, 100 mM EDTA, 15 mM NaCI, 0.5% SDS, 100 pg ml-~ Proteinase K, pH 8.0). Resuspended cells were preincubated at 50°C for 40 min. The genomic DNA was extracted twice with equivalent volumes of phenol (incubation: 60 °C
for 45 min;
centrifugation: 20 min, 4500 rpm) followed by phenol:chloroform:isoamyl alcohol (25:24:1 ) and chloroform:isoamyl alcohol extraction (24:1). Genornic DNA was precipitated with sodium acetate and ethanol.
Primers, hybridization probes and sequence analysis: Based on the peptide sequences of tryparedoxin peroxidase (Nogoceke et al., 1997) degenerate oligodeoxyribonucleotides 5'-TCGAATTCGAYATGGCSCTIATGC-3' and 5'-CTGGATCCCRATIGGCATRTC-3' were synthesized. Polyrnerase chain reaction (PCR) amplification was performed using the GeneAmp PCR Core kit (Perkin Elmer) using 0.8 qg of C. fasciculata genomic DNA as template, l O g l of l Ox reaction buffer, 8 ~125mM MgCl2, 2q1 of each I OpM dNTP, 100 pmol of each primer and O.SU Taq polymerase. An annealing temperature of SO°C was used. The PCR product was analysed by agarose gels and purified using the QIAquick PCR purification kit (QIAGEN Inc.). Sequencing was performed on a 373A DNA Sequencer (Applied Biosystems) using the PRISM Ready Reaction DyeDeoxy Terminator Sequencing Kit (1550V, 19 mA, 30 W, 42°C). When used as a hybridization probe the PCR product was labelled with digoxigenin using the DIG DNA Labeling Kit (Boehringer Mannheim) according to the instructions provided by the supplier.
Library construction and screening procedure:The genomic DNA was partially digested for 5 - 30 min with a ratio unit Sau3A / ug DNA of 0.005. The efficiency of the digestion was monitored by electrophoresis on agarose gels. Proteins were removed from the DNA using StrataClean Resin (Stratagene). The Sau3A sites were partially refilled with dATP and dGTP and Klenow fragment. The genomic DNA was ligated into Lambda GEM-11 Xho I half site arms (Promega) at a molar ratio of DNA to genomic DNA
(average size 1 S kb) of 1:0.7. The ligated DNA was packaged using the Packagene Lambda DNA
Packaging System (Promega) according to the suppliers' instructions. The phages were used to infect the E. toll host strain LE392 (Promega) according to the standard protocol. S.1 X 103 ,., ~ . , ,. ". i,. . ~ m.r ;:.7 r", ,.n _ 1.7 ,i11 _:1:7:)~i l~~ i:'/ I:i - IZ
pfu of the genomic library gave positive PCR signals for tryparedoxin peroxidase and were plated on agar. The plaques were transferred to 9 cm diameter Biodyne-A nylon membranes and screened ~z~ith the DIG-labelled PCR probes following the instructions provided by the supplier but using a hybridization temperature of 58 C. DIG labelled nucleic acids were detected colorimetrically with the DIG Nuc:~ie Acid De'.tECtlOn Kit (E3aeciringcr hTannheim), Positive caones t~~ere rescreened. amplified and Suspended in SM lfuffer, The ph.ages were precipitated by PEG 5000 at:d purified in CsCI gradients. The isola:ed DNA was used for ratzictian analyses (San I, Sac Il or as template for rCR reactions. The digestion products were eluted from agarose gels and l:nated into pBluescript II k:S (+h) phagemids (Stratagene}. 'fhe lioated L7N~ was used fo ~ransform E. coli LE39~.
Transformed veils were selecte3 by ampicillin resistance, plasn:ids were p uriiied usine QLlprep Spin Plusmid i~it (Qiagen In;:.l and analyzed by restriction enayma digestion :end seqt~e.zcing.
)<solation and sequencing of the tr~yareda:xin lreroxidase gene from C.
jcr~~c:culatu~~SequenLed p~piide fragments ot~tained from isolated trypar~doxin pa:oxidas~~f C. fast:iculata . ", aligned along the established deduced amine acid seque~:~~e of the thin'.-specine antioxidant protei:~ of. yeast~(Chae et ai., 1953). This enabled appropriate degenerate PCP, primea to be designed for the generation of a PCR
I;c~oduct rrom t~:e C. ,,rasciculrxta genorrFic DNA. This PCR prcduet was subs=quently used to screen a ganomic library fen inserts coa;aioina the full length DNA. encoding the tryparedoxin pe:oYidase. A clcnc containing a i 5 icb insert wi th the presumed t_ryparedoxin paroxidase gene was isolated and sequenced. This. however, Ied to the detection of eqj.~al quantitites of different nucleotides at several positions towards the 3' end or the gene.
inplying the presence of similar buc not identical genes i.n the insert. This observation was not un;,xpected sit:c~ the genorre ;;f the TryPunr;sornut:dae is known :o contain repetitive structural genes sepa..Tated 6y intergenic sequences (Tschtrdi ct aL, 1935;
Wong et al.) ? 993;
Field and Field, 1997. The DNA was consequently digested with the restriction enzyme Sac i to separate the phage arms from the insert. A southern blot was performed and tl-~ree frag.tnen;s i 1.1 kb) I . ' kb and 11 kb) were h;~i.~ridized with the labelled PCR product. Each of the three fraamertts was subcion~d i:ac pBi;tescript II KS (-~-,r-) .phagemids and sequenced.
Sequencing of the 11 kb fragment rcvPal~d an open reading frame containing coding sequences for the prenicusly sequenced peptides o: tryparedosin peroxidase (rig. 3).
Nevertheless. as with the 15 kb iraert, tile bases at positions 542, 548, 551, 556, 557, 550, 563, 564 and 5~~5 could rot be unequivocally identified. The nucl4otide sequence of thz I.5 kb fragment contained a largely identical open reading frame to the ono of the 1 1 kb AMENDED SHEET

fragment, except for the presence of an additional cytosine at position 30. As a consequence of the resulting frameshift, the deduced amino acid sequence no longer complied with the established peptide sequences. Hence, the 1.5 kb fragment contained a pseudogene. The 1.1 kb fragment also contained an open reading frame but encoded only part of the tryparedoxin peroxidase since a Sac I restriction site was present at position 472 - 477.
This reading frame was therefore not sequenced to completion.
The full length encoding DNA and the deduced amino acid sequence is shown in Fig.
7.
example 5: Heterologous expression of tryparedoxin peroxidase in Escherichia coli.
The tryparedoxin peroxidase gene contained in the cloned 1.5 kb fragment was amplified by PCR with a forward primer A (5'-CCACCACTTGGCGCACATATGTCCTGCGGTGCC GCC-3') that contains an Nde I site and overlaps the 5' end of the coding sequence, and a reverse deletion primer a (5'-CGCGGGGTGGTTCAACTTGGCGGCACCGCAGGAC-3') to delete the extra cytosine base at position 30. Amplification was also performed with a forward deletion primer b (5'-CAAGTTGAACCACCCCGCGCCTGAGTTCGACGAC-3') and a reverse primer B (5'-GCCACGCCTGCTTCTCTCCTCGAGGCCCTCCTTCTTCTTGG-3') which overlaps the 3' end of the coding sequence and contains an Xho I site. Consequently the last coded amino acid is changed to a leucine, a glutamate residue is added, the stop codon is deleted and the protein will contain 6 histidine residues at its carboxyl-terminal end.
Consequently amplification was performed as above but using the Expand High Fidelity polymerase mixture and buffer (Boehringer Mannheim) at an annealing temperature of 58°C with the extension temperature being increased in 10 sec increments per cycle during cycles 10 - 20.
PCR products of the expected size were obtained and used as template for a second PCR
amplification with the forward primer A and the reverse primer B. The amplified coding region was digested with Nde I and Xho I and ligated to a pET24a(+) vector (Novagen) treated with the same enzymes and dephosphorylated. The resulting plasmid (pET/TpodH6) was used to transform E. col i BL21 (DE3 ). Transformed cells were selected by kanamycin resistance, the plasmids purified and sequenced. The same procedure, but using a reverse primer C (5'- GGCCACGCCTGTCGACT TACTAGTGGCCCTCCTTCTTCTTGG-3') instead of reverse primer B was used to express tryparedoxin peroxidase with no changes at the carboxyl-terminal end. In this case the reverse primer contained an extra stop codon and a Sal I site at the 5'-end of the extra stop codon, with the digestions for the cloning step being performed with Nde I and Sal I. The resulting plasmid was called pET/Tpod.
E. coli BL21 (DE3) pET/Tpod and E. coli BL21 (DE3) pET/TpodH6 were grown to A6oo of 0.9 - 1.0 at 36°C and 180 rpm in LB medium with 30pg kanamycin/ml, then expression of the tryparedoxin peroxidase gene was induced with 1 mM isopropyl--D-thiogalactopyranoside. E coli BL21(DE3) containing the pET24a plasmid was grown in the same way. Samples taken at different times were centrifuged, resuspended in 50 mM Tris-HC1 pH 8.0, 1 mM EDTA buffer, sonicated and centrifuged. Enzyme activity was determined as in Nogoceke et al. ( 1997); protein concentration was determined using Coomassie Brilliant Blue-G reagent (BioRad) with bovine serum albumin as standard. After induction of the transformed bacteria, tryparedoxin peroxidase activity was detected in supernatants of sonicated cells. Activity increased to a maximum after 5 hours induction and no activity was found in the control (Fig. 8). Induction resulted in the accumulation of a new protein with an apparent molecular mass of 21000, which was recognised by the anti-tryparedoxin peroxidase antibodies raised against pure C. fasciculata tryparedoxin peroxidase (Fig. 9).
Example 6: Purification and characterization of recombinant tryparedoxin peroxidase.
E. coli BL21(DE3) pET/TpodH6 was grown at 36°C and 180 rpm in LB
medium with 30pg kanamycin/ml to Aboo of 0.9 - 1.0, then expression of the tryparedoxin peroxidase gene was induced with 1 mM isopropyl- -D-thiogalactopyranoside. E. coli BL21(DE3) containing the pET24a plasmid was grown in the same way. Samples taken at different times were centrifuged, resuspended in 50 mM Tris-HCI pH 8.0, 1 mM EDTA buffer, sonicated and centrifuged. After 5 h the culture was centrifuged and either stored at -20°C or the cells were resuspended in 0.05 culture volume of binding buffer (SmM imidazole, 500 mM
NaCI and 20 mM Tris-HC1 pH 7.9). The cell suspension was sonicated on ice and centrifuged for 40 min at 4°C, 35000g. The supernatant was applied to a His Bind resin (Novagen) column charged with Ni2+ and equilibrated with binding buffer, at a flow rate of about 10 column volumes per hour. The column was washed with 10 volumes of binding buffer, 6 volumes of 500 mM
NaCI, 20 mM Tris-HCl pH 7.9 buffer containing 60 mM imidazole and 6 volumes of the same buffer with 100 mM irnidazole. Tryparedoxin peroxidase eluted in the buffer containing 500 mM imidazole. Active fractions were pooled and immediately dialysed against 50 mM
Tris-HCl pH 7.6 buffer containing 100 mM NaCI and I mM EDTA.Tryparedoxin peroxidase eluted at 500 mM imidazole and was shown by SDS-PAGE and subsequent silver staining to be pure (Fig. 10). N-terminal sequencing of this protein showed the initial methionine to be ._._~_... _. ~T...___.

missing and allowed us to confirm the first 30 amino acids. The expressed tryparedoxin peroxidase showed nearly the same molecular mass of about 21000 as the authentic tryparedoxin peroxidase in SDS-PAGE (Fig. 12). MALDI-MS analysis demonstrated the molecular mass of the recombinant tryparedoxin peroxidase to be 21884122 (Fig.
11). The difference in the molecular mass between the recombinant and authentic tryparedoxin peroxidase corresponded to the additional amino acids (leucine, glutamate and 6 histidine residues) added at the C-terminal end of the recombinant enzyme.
Whereas tryparedoxin peroxidase purified from C. jasciculata contained several isoforms ranging from pI 4.9 to S .8, the recombinant protein showed two bands of pI 6.2 and 6.3. The higher alkalinity may be attributed to the additional histidines residues.
The purified recombinant enzyme had a specific activity of 2.51 U/mg compared to 5.83 U/mg for the authentic enzyme. This difference may be attributed to the additional amino acids at the caboxyl-terminal end of the recombinant tryparedoxin peroxidase. The kinetic pattern was essentially identical to that observed with the authentic tryparedoxin peroxidase. The numerical values of the kinetic parameters of the pure recombinant tryparedoxin peroxidase are shown in Table 2.
Table 2. Dalziel coefficients ( , and 2) and apparent second order rate constants (k 1 and k Z) for the reaction of recombinant tryparedoxin peroxidase with t-butyl hydroperoxide (t-bOOH) and tryparedoxin (TXN). Data are the means of two independent measurements.
All k ~
values are calculated per subunit concentration.
acceptor TXN ~ k , 2 k 2 substrateM [ 10'6 M [ 105 M-~ sec-I 0-' M [ 1 Ob M'' sec] ] sec sec's ]

t-bOOH 0.607 12.710.1 0.810.0 1.210.0 0.80.0 0.303 10.210.0 0.10.0 1.010.0 1.00.1 0.200 13.510.5 0.810.0 I.OtO.I 1.00.0 Example 7: Inhibition studies.
The test system described in example 2 is easily adapted to screen compunds for specific inhibition of tryparedoxin peroxidase. As an example the inhibition of tryparedoxin peroxidase by S-alkylating agents such as N-ethylmaleimide (NEM) is described (Table 3).
Tryparedoxin peroxidase was preincubated in 50 mM Hepes, 1 mM EDTA, pH 7.6 with or without presumed reducing substrate (T(SH)2), then reacted with NEM and activity was checked at 22°C essentially as described in example 2, but using 1 mM
T(SH)~ with 1.0 ~M
tryparedoxin peroxidase and 0.6 ~M tryparedoxin. Changes in molecular mass were determined my MALDI-TOF-MS. The large standard deviation of tryparedoxin peroxidase masses is explained by polymerisation equilibria resulting in a broadening of mass peaks.
Table 3 Derivatisation scheme of tryparedoxin peroxidase (TXNPx).
Protein Pretreatment Derivatisationmass incrementresidual activity [%]

TXNPx 725 uM T(SH)2; -- -- (100) (5.7 ~.M)30 sec at 4C

725 ~.M T(SH)2; -- -- 1325 8.3 ~M TXN; 30 sec at 4C

none 1.9 mM NEM; n. d. 935 30 min at 4C

725 pM T(SH)2; 1.9 mM NEM; 7120 (0) 815 30 sec at 4C 150 sec at 725 pM T(SH)2; 1.9 mM NEM; 232120 (250) 3t~
8.3 ~M TXN; 30 sec 150 sec at at 4C 4C

apparent increase of activity due to reduction of tryparedoxin peroxidase.
___.._..~w..__ ..__._ _~._~.~__.._ REFERENCES
Bailey, S., Smith, K., Fairlamb, A.H. and Hunter, W.H. (1993) Substrate interactions between trypanothione reductase and N~-glutathionylspermidine disulphide at 0.28-nm resolution. Eur. J. Biochem. 213, 67-75.
Carnieri, E.G.S., Moreno, S.N.J. and Docampo, R. (1993) Trypanothione-dependent peroxide metabolism in Trypanosoma crzrzi different stages. Mol. Biochem.
Parasitol. 61, 79-86.
Chae, H.Z., Kim I, Kim K and Rhee, S.G. (1993) Cloning) sequencing, and mutation of thiol-specific antioxidant gene of Saccharomyces cerevisae. J . B iol . Chem 268, 16815-16821. Chae, H.Z., Robinson, K., Poole, L.B., Church, G., Storz, G. and Rhee, S.G. (1994) Cloning and sequencing of thiol-specific antioxidant from mammalian brain:
Alkyl hydroperoxide reductase and thiol-specific antioxidant define a large family of antioxidant enzymes. Proc. Natl. Acad. Sci. USA 9l, 7017-7021.
Chance, B., Sies, H. and Boveris, A. ( 1979) Hydroperoxide metabolism in mammalian organs. Physiol. Rev. 59, 527-605.
Dalziel, K. ( 1957) Initial steady state velocities in the evaluation of enzyme-coenzyme-substrate reaction mechanisms. Acta Chem. Scand. 1 I , 1706-1723.
Docampo, R. ( 1990) Sensitivity of parasites to free radical damage by antiparasitic drugs.
Chem. Biol. Interactions 73, 1-27.
El-Sayed, N.M.A., Alarcon, C.M., Beck, J.C., Sheffield, V.C. and Donelson, J.E. (1995) cDNA expressed sequence tags of Trypanosoma brucei rhodesiense provide new insights into the biology of the parasite. Mol. Biochern. Parasitol. 73, 75-90.
Fairlamb, A.H. (1996) Pathways to drug discovery. The Biochemist 18 (FeblMar), 11-16.
Fairlamb, A.H. , Blackburn, P. , Ulrich, P. , Chait, B. T. and Cerami, A. ( 1985) Trypanothione: A novel bis (glutathionyl) spermidine cofactor for glutathione reductase in trypanosomatids. Science 227, 1485-1487.
Fairlamb, A.H. and Cerami, A. (1992) Metabolism and functions of trypanothione in the kinetoplastida. Annu. Rev. Microbiol. 46, 695-729.
Fairlamb, A.H., Henderson, G.B. and Cerami, A. (1986) The biosynthesis of trypanothione and N 1-glutathionylsperrnidine in Crithidia fasciculata. Mol .
Biochem.
Parasitol. 21, 247-257.

Field, H. and Field, M.C. (1997) Tandem duplication of rab genes followed by sequence divergence and acquisition of distinct functions in Trypanosome brucei. J.
Biol. Chem. 272, 10498-10505.
Flohe, L. (1989) The selenoprotein glutathione peroxidase. In: Glutathione -chemical, biochemical, and medical aspects. D. Dolphin, R. Poulson, and O. Avramovic, eds. (New York, USA: J. Wiley and Sons, Inc.) pp. 643-731.
Flohe, L., Loschen, G., Giinzler, W.A. and Eichele, E. ( 1972) Glutathione peroxidase. V.
The kinetic mechanism. Hoppe-Seyler's Z. Physiol. Chem. 353, 987-999.
Forstrom, J. W., Stults, F.H., and Tappel, A.L. ( 1979) Rat liver cytosolic glutathione peroxidase: reactivity with linoleic acid hydroperoxide and cumene hydroperoxide. Arch.
Biochem. Biophys.193, 51-S5.
Henderson, G.B., Fairlamb, A.H. and Cerarni, A. ( 1987) Trypanothione dependent peroxide metabolism in Crithidia fasciculata and Trypanosome brucei. Mol. Biochem.
Parasitol. 24, 39-45.
Jacoby, E.M., Schlichting, L, Lantwin, C.B., Kabsch, W., and Krauth-Siegel, R.L. (1996) Crystal structure of the Trypanosome cruzi trypanothione reductase-rnepacrine complex.
Proteins 24, 73-80.
Kim, K., Kim, LH., Lee, K.-Y., Rhee, S.G. and Stadtman, E.R. ( 1988) The isolation and purification of a thiol-specific protector protein which inhibits enzyme inactivation by a thioi Fe (III)/Oz mixed-function oxidation system. J. Biol. Chem. 263, 4704-4711.
LeTrant, N., Meshnick, S.R., Kitchener, K., Eaton, J.W. and Cerami, A. (1983) Iron-containing superoxide dismutase from Crithidia fasciculata. J. Biol. Chem.
258, 125-130.
Maiorino, M., Gregolin, C., and Ursini, F. ( I 990) Phospholipid hydroperoxide glutathione peroxidase. Methods Enzymol. 186, 448-457.
Nogoceke, E. Gommel, D. U., Kief3, M., Kalisz) H. M. and Flohe, L. (1997) A
unique cascade of oxidoreductases catalyses trypanothione-dependent peroxide metabolism in Crithidia fasciculata. Biol. Chem., 378, in press.
Penketh, P.G., Kennedy, W.P.K., Patton, C.L. and Sartorelli, A.C. (1987) Trypanosomatid hydrogen peroxidase metabolism. FEBS Lett. 221, 427-431.
Penketh, P.G. and Klein, R.A. ( 1986) Hydrogen peroxide metabolism in Trypanosome brucei. Mol. Biochem. Parasitol. 20, 111-121.
Risse, H.J. (1993) Afrikanische Trypanosomen - Meister im Austricksen des Imrnun-systems. In: Extremophile. K. Hausmann, and B.P. Kremer, eds. (Weinheim, Germany:
VCH) pp. 361-380.
_______.__..~_. ____..__ ~.__._ __..___r..,.._.....~,__.__d..~__........_..._..._ Shim, H. and Fairlamb, A.H. (1988) Levels of polyamines, glutathione, and glutathione-spermidine conjugates during growth of the insect trypanosomatid C.
fasciculata. J. Gen.
Microbiol. 134, 807-817.
Stone, K.L. and Williams, K.R. (1993) Enzymatic digestion of proteins and HPLC
peptide isolation. In: A practical guide to protein and peptide purification for microsequencing, 2nd ed. P. Matsudaira, ed. (London, England: Academic Press Inc.) pp. 45-69.
Thomas, C.E. and Jackson, R.L. ( 1991 ) Lipid hydroperoxide involvement in copper-dependent and independent oxidation of low-density lipoproteins. J.
Pharmacology Exp.
Ther. 256, 1182-1188.
Tschudi, C., Young A.S., Ruben, L., Patton, C.L. and Richards F.F. (1985) Proc. Nat.
Acad.Sci.USA 82, 3998-4002 Ursini, F., Maiorino, M., Brigelius-Flohe, R., Aumann, K.D., Roveri, A., Schomburg, D. and Flohe, L. ( 1995) The diversity of glutathione peroxidase. Methods Enzymol.
252, 38-53.
along, S., Morales, T.H., Neigel, J.E. and Campbell D.A. (1993) Mol. Cell Biol. 13, 207-216 World Health Organization ( 1996) Fighting disease, fostering development.
World Health Report 1996 (Geneva, Switzerland: WHO).

Claims (19)

Claims

1. A protein (tryparedoxin peraxidase), characterized by its capability of transferring reductive equivalents of trypanothione/trypanothione disulfide via a mediator (such as tryparedoxin [trypanothione: peroxiredoxin oxidoreductase]), mediating between trypanothione/trypanothione disulfide and the protein, to hydrogen peroxide and/or alkylhydroperoxide.

2. A protein according to claim 1, characterized in that it can be isolated from a species of the family Trypanosomatidae.

3. A protein according to claims 1 or 2, characterized in that the preparation and/or isolation can be carried out by genetic engineering especially by means of sequenced peptide fragments .OMEGA.

obtained from isolated tryparedoxin peraxidase of C.
fasciculata, aligned along the established deduced amino acid sequence of the thiol-specific antioxidant protein of yeast, especially QIIINDMPIGRNVEEVIRLVEALQFVEEHGEVCPANWK and/or SEQ ID NO 16 VCPANWKKGDAA. SEQ ID NO 17

4. A protein according to any of the preceding claims, characterized by an oligomeric structure in its native state and by a molecular weight of 20 to 24 kDa. in its monomeric state.

5. A protein according to any of the preceding claims, characterized by at least one ValCysPro (VCP) motif and catalyzing the reduction of peroxides by means of trycaredoxin.

6. A protein (a) having the amino acid sequence SEQ ID NO 8 (figure 7 positions 1 to 187):

or (b) having an amino acid sequence which is homologuous to said according to (a) by at least 70%.

7. A protein according to claim 6 (b) having an amino acid sequence which is homologous to said according to claim 6 (a) by at least 75%.

8. A plasmid for the expression of a protein according any of the preceding claims and comprising a nucleic acid sequence encoding said protein.

9. A plasmid,according to claim 8, comprising a DNA sequence encoding a protein according to claim 1 (tryparedoxin peroxidase) especially of Crithidia fasciculata.

10. A plasmid according to claim 8, comprising a DNA sequence encoding functionally active derivatives of a protein according to any of claims 1 to 7 (tryparedoxin peroxidase) capable of transforming reductive equivalents of trypanothione/trypanothione disulfide via a mediator, mediating between trypanothione/trypanothione disulfide and the protein, to hydrogen peroxide and/or alkylhydroperoxide, designed for an isolation in a manner known per se.

11. A plasmid according to claim 10, comprising a DNA sequence encoding functionally active derivatives of a protein according to any of claim 1 to 7 (tryparedoxin peroxidase) capable of transforming reductive equivalents of trypanothione/trypanothione a disulfide via a mediator, mediating between trypanothione/trypanothione disulfide and the protein, to hydrogen peroxide and/or alkylhydroperoxide, wherein the protein (tryparedoxin peroxidase) is derivated by a His tag.

12. A process for the production of a protein according to any of claims 1 to 7, characterized in that it is produced by means of a DNA sequence encoding an amino acid sequence of SEQ ID NO
11 to 17 according to claim 3 by genetic engineering in a manner known per se.

13. A process for the production of a protein according to any of claims 1 to 7, characterized in that the production is carried out by means of a plasmid according to any of claims 8 to 11.

14. A process according to claim 13, characterized in that the host is selected from the group consisting of bacteria, Fungi, yeast, pant cells and mammalian cells (heterologuous expression).

15. A process according to claim 14, characterized in that Escherichia coli is used as host.

16. Use of a protein according to any of claims 1 to 7 or obtained according to the process according to any of the claims 12 to 15 for testing and recovering inhibitory substances which inhibit activities of said protein.

17. A test system for testing the catalytic activity of a protein according to any of claims 1 to 7 or obtained according to the process according to any of claims 12 to 15, wherein the testing system contains or comprises trypanothione reductase, trypanothione, a mediator (tryparedoxin) according to claim 1 and, in addition, a hydroperoxide.

18. A pharmaceutical preparation having a trypanocidal activity and comprising an inhibitory substance inhibiting the catalytic activity of a protein according to any of claims 1 to 7 or of a protein which can be obtained according to the process according to any of claims 12 to 15.

19. A pharmaceutical preparation according to claim 16, characterized in that it can be obtained by a use according to claim 16 and by using a test system according to claim 17.