CA2256124C

CA2256124C - Chimeric gene formed of the dna sequences that encode the antigenic determinants of four proteins of l. infantum, and protein encoded by said gene, and pharmaceutical composition useful for preventing and/or treating leishmaniosis in animals or humans

Info

Publication number: CA2256124C
Application number: CA2256124A
Authority: CA
Inventors: Carlos Alonso Bedate; Jose Maria Requena Rolania; Manuel Soto Alvarez
Original assignee: CBF Leti SA
Current assignee: CBF Leti SA
Priority date: 1998-12-23
Filing date: 1998-12-23
Publication date: 2015-06-16
Anticipated expiration: 2018-12-23
Also published as: ZA200105994B; YU51601A; BRPI9917863A2; BRPI9917863B1; BRPI9917863B8; JP2002533474A; RS50013B; CA2256124A1; JP4883839B2; BRPI9917863C1

Abstract

Described is a chimeric gene formed by the DNA sequences that encode antigenic determinants of four proteins of L.
infantum useful for preventing or treating canine Leishmaniasis. The protein encoded by the chimeric gene contains one or more of the antigenic determinants of four proteins of L. infantum encoded by the chimeric gene. Also described as pharmaceutical compositions for the prevention and/or treatment of Leishmaniasis.

Description

CHIMERIC GENE FORMED OF THE DNA SEQUENCES THAT ENCODE THE
ANTIGENIC DETERMINANTS OF FOUR PROTEINS OF L. INFANTUM
AND PROTEIN ENCODED BY SAID GENE, AND PHARMACUETICAL
COMPOSITION USEFUL FOR PREVENTING AND/OR TREATING
LEISHMANIASIS, IN ANIMALS OR HUMANS.
DESCRIPTION
OBJECT OF THE INVENTION
The present specification relates to an application for an Invention Patent, regarding a chimeric gene formed of the DNA sequences that encode the antigenic determinants of four proteins of L. infantum, and to proteins encoded by said chimeric gene, useful for the prevention or treatment of Leishmaniasis, in particular canine Leishmaniasis. The obvious purpose of this lies in using the gene sequence or the protein obtained from the chimeric gene for providing pharmaceutical compositions for preventing or treating Leishmaniasis, in particular canine Leishmaniasis, that can be present in the body of a patient, for instance as a vaccine or a monoclonal antibody preparation. This patient does not have to be a dog but can also be a human being who suffers from diseases that involve immuno-depression. T o achieve this, a chimeric gene will be produced that encodes a protein called MSPQ consisting of a chimeric product originating from an "in vitro" synthesis of a chimeric gene constructed "ad hoc", which contains five of the antigenic determinants of four different proteins.
The product is configured as highly sensitive and specific for -for instance - generating a protective immune responds against canine Leishmaniasis, or for preparing antibodies against canine Leishmaniasis FIELD OF THE INVENTION
This invention is of utility within the industry dedicated to the manufacture of pharmaceutical products in general.

2 BACKGROUND OF THE INVENTION
The parasitic protozoa of the Leishmania genus are the aetiological agents that cause Leishmaniasis, a range of diseases that have a world-wide distribution and that are characterised in that they give rise to a wide variety of clinical symptoms.
The main forms of Leishmaniasis are zoonotic in nature and humans are considered as secondary hosts.
The species denoted L. Infantum, widely distributed throughout many Mediterranean areas is the cause of visceral Leishmaniasis (LV) in humans and dogs.
In fact, dogs infected with L. infantum are the main animal reserve of this parasite, particularly during the long incubation period before the clinical symptoms can be observed.
The epidemiological data indicate that there is a direct correlation between the prevalence of canine Leishmaniasis and the transmission of the parasite to humans. Fo/ this reason, it is crucial to detect the disease or infection early on in campaigns undertaken to control the spread of the disease.
The parasite is transmitted to the host vertebrate as a flagellate promastigote, by means of a bite of a fly of the family "Phlebotominae", and the parasite enter the cells of the mononuclear phages where they differentiate and reproduce as amastigotes, within the phago-lisosomal structure.
The infected cells gather in certain tissues, mainly spleen, liver and lymph nodes. It is estimated that around 15 million people are infected with Leishmaniasis, and every year in the world 500,000 new clinical cases appear in the world, mainly in the underdeveloped and developing world.
In the south-western countries of Europe, Visceral Leishmaniasis (VL), is a zoonotic disease caused by the L. Infantum species, as was mentioned earlier. Recent data derived from epidemiological studies indicate that = CA 02256124 2012-10-17

3 there is an alarming incidence of this infection.
In Italy the reported data for incidence of VL
ranges from 14.4% to 37% according to the region.
In Portugal, more particularly in the area around Lisbon, seropositive rates of 8.4% have been found and in the region of the French Maritime Alps different centres of prevalence have been found that vary between 3.2% and 17.1%.
In Spain, the prevalence of Leishmaniasis depends on the zone being studied. In Catalonia an average incidence rate of 9.3% has been observed although in some hot-spots a prevalence of infected dogs of up to 18% has been found.
On the Island of Mallorca, the incidence rate is 14%, and other rates that have been found are: 2.4% in Murcia, 8.8% in Granada, from 10 to 15% in Salamanca, 5.25% in the province of Madrid, and 14% in Caceres.
Although the number of cases of VL in humans caused by L. infantum can be considered relatively low, the high percentage of patients with immuno-depression that become infected by Leishmania could be related to the high level of this illness in dogs.
In fact, in the South of Europe, 50% of adults that are infected by Leishmaniasis are also patients infected by the HIV virus. On the other hand, according to these data of Leishmania-HIV co-infection, it has been estimated that the level of infection (by parasites) can be one or two orders of magnitude higher than this figure due to the existence of a large number of undetected infections.
A common characteristic of the different types of Leishmania infection is that it induces a strong humoral response in the host. Therefore, diagnostic methods based on serological techniques are currently the most widely used.
It has been described that these antibodies are detected even during the asymptomatic phase of the = CA 02256124 2012-10-17

4 disease in natural and experimental infections.
The sensitivity and specificity of these methods depends on the type, source and purity of the antigen used. In immunological processes that are currently commercialised, complete promastigotes and preparations more or less prepared from these are used as a source of antigen. This method normally leads to cross-reactions with serum from patients suffering from leprosy, tuberculosis, African tripanosomiasis, Chagas disease, malaria and other parasitosis.
The sensitivity and specificity of the serologic methods depend on the type, source and purity of the employed antigen. During the last years a great number of Leishmania antigens have been characterised, some of them can be considered as proteins specific to the parasite.
Among these proteins specific to the parasite, the surface protease GP63, the surface glycoprotein gp46 and the lipophosphoglicane associated KMP-11 protein deserve a mention.
An additional group of Leishmania antigens are formed of evolutionarily conserved proteins, such as kinesine, thermal shock proteins, actin and tubulin.
As part of a strategy to develop a specific serological diagnostic system for Leishmaniasis canine, a laboratory based project has been undertaken to identify the antigens of L. infantum, by means of a immuno-detection search of an expression library for genes of L.
infantum using dog serum with active visceral Leishmaniasis.
It has been observed that most of the antigens isolated by this method belong to the family of proteins conserved during the course of evolution. The identification of the B epitopes of these antigens indicate, however, that in all cases the antigenic determinants were localised in regions that were not well conserved.
In particular, the acidic ribosomal proteins LiP2a and LiP2b are recognised by more than 80% of the VL
serums.
It has been confirmed that these proteins contain disease specific antigenic determinants, and that the

5 recombinant proteins LiP2a and LiP2b, from which a fragment had been removed, could be used as a specific instrument able to distinguish between VL and Chages disease.
It has also been shown that the PO ribosomal protein of L. infantum, very highly conserved on the evolutionary scale, is recognised by a high percentage of VL dog serums. Furthermore, the antigenic determinants are found exclusively on the C-terminus of the protein, that is to say, in the region that has been poorly conserved during the course of evolution.
It has been observed that in 78% of the VL dog serums, antigens against H2A protein are also present, and it has been confirmed that despite the sequence identity in all the H2A proteins among eukaryotic organisms, the humoral response to this protein in VL
serums is particularly provoked by determinants specific to the Leishmania protein H2A.
The antigenic determinants recognised by the VL dog serums are found at both termini of the H2A protein.
The obvious solution to the problem currently encountered in this art would be to have an invention that would allow the assembly of a synthetic chimeric gene that contained the DNA regions encoding the antigenic determinants specific to the proteins LiP2a, LiP2b, LiP0, and H2A, with a view to constructing a protein rich in antigenic determinants.
However, as far as the applicant is aware, there is currently no invention that contains the characteristics described as ideal, with a view to reaching the desired aim. This aim is the construction of a protein rich in antigenic determinants, arising from the assembly of a chimeric synthetic gene, that contains the DNA regions

6 encoding the antigenic determinants specific to the aforementioned proteins.
DESCRIPTION OF THE INVENTION
In a first aspect, the invention relates to a chimeric gene formed by the DNA sequences that encode antigenic determinants of four proteins of L.infantum, useful for preventing or treating canine Leishmaniasis In a further aspect, the invention relates to a protein encoded by said chimeric gene, containing one or more of the antigenic determinants of four proteins of L.infantum encoded by the chimeric gene.
The invention further relates to method for preventing and/or treating canine Leishmaniasis in a human being or an animal. In this therapeutic method, the chimeric gene of the invention or the protein encoded by it can be used. Also, antibodies against the protein encoded by the chimeric gene of the invention, or a antigenic part thereof such as an epitope, can be used.
In further aspects, the invention relates to pharmaceutical compositions for the prevention and/oi treatment, in humans and/or animals, of Leishmaniasis comprising an active substance derived from or directed against the chimeric gene of the invention and/or the protein encoded by it, or parts thereof. The active substance is preferably such that it can be used in a pharmaceutical composition for the treatment and/or prevention of Leishmaniasis.
In particular, the pharmaceutical composition will be in a form of a vaccin, containing the protein encoded by the chimeric gene of the invention, or one or more parts thereof, containing one or more of the antigenic determinants of the protein encoded by the chimeric gene of the invention.
In a further embodiment, the pharmaceutical composition of the invention comprises antibodies directed to the protein encoded by the chimeric gene of the invention, or parts thereof.

7 The pharmaceutical preparations of the invention may further contain all known adjuvants, solvents, buffers etc. known per se for pharmaceutical compositions and/or vaccines.
In a further aspect, the invention relates to a method for the treatment or prevention of Leishmaniasis using a pharmaceutical composition or a vaccin according to the invention, or a preparation comprising antibodies directed against the protein encoded by the chimeric gene of the invention.
This method will generally comprise administering an active substance directed against the chimeric gene or the protein to a human being or animal, such as a dog, in a pharmaceutically active amount.
For the prevention of Leishmaniasis, a vaccin comprising the protein encoded by the chimeric gene, or encoding one or more parts of said protein comprising one or more of the antigenic determinants, will be adminstered to a human being to elicit a protective immune response.
Administration of the preparations, antibodies and/or vaccins of the invention may be carried out in a manner known per se, such as orally, intramuscularly, intravenously, subcutaneously, by (drip)infusion etc..
Preferably, the preparation or a vaccin is injected, whereas with an antibody preparation, an infusion can be used.
It should be noted that when herein, reference is made to the chimeric gene of the invention, this term also encompasses nucleic acid sequences that can hybridize with the sequence mentioned below under moderate or stringent hybridizing conditions.
In this context, heterologous hybridisation conditions can be as follows: hybridisation in 6 x SSC
(20xSSC per 1000 ml : 175.3 g NaC1, 107.1 g sodium citrate . 5H20, pH 7.0), 0.1% SDS, 0.05%
sodium pyrophosphate, 5* Denhardt's solution (100 x Denhardt's = CA 02256124 2008-02-06 = , =

8 solution per 500 ml : 10 g Ficoll"-400, 10 g polyvinyl-pyrrolidone, 10 g Bovine Serum Albumin (Pentax Fraction V)) and 20 1g/m1 denatured herring sperm DNA at 56 C for 18-24 hrs followed by two 30 min. washes in 5 x SSC, 0.1 % SDS at 56 C and two 30 min. washes in 2 x SSC, 0.1% SDS
at 56 C.
For instance, sequences that can hybridize with the sequence mentioned below include mutant DNA sequences which encode proteins with the same biological function as the protein encoded by the sequence mentioned hereinbelow. Such mutant sequences can comprise one or more nucleotide deletions, substitutions and/or additions to the sequence mentioned below. Preferably, the mutant sequences still have at least 50%, more preferably at least 70%, even more preferably more than 90 % nucleotide homology with the sequence given hereinbelow.
The term chimeric gene as used herein also encompasses nucleic acid sequences that comprise one or more parts of the sequence mentioned hereinbelow.
Preferably, such sequences comprise at least 10%, more preferably at least 30%, more preferably at least 50% of the nucleotide sequence given hereinbelow. Such sequences may comprise a contiguous fragment of the sequence mentioned hereinbelow, or two or more fragments of the sequence given below that have been combined in and/or incorporated into a single DNA sequence.
It should be noted that when herein, reference is made to a protein encoded by the chimeric gene ofthe invention, this term also includes mutant proteins that still essentially have the same biological function.
Such mutant proteins can comprise one or more amimo acid deletions, substitutions and/or additions compared to the protein encoded by the sequence mentioned below.
Preferably, the mutant proteins still have at least 50%, more preferably at least 70%, even more preferably more than 90 % amino acid homology with the sequence given hereinbelow.

9 The term protein also encompasses fragments of the protein encoded by the chimeric gene of the invention.
Such fragments preferably still show the biological activity of the full protein. Preferably, such proteins comprise at least 30%, more preferably at least 50% of the amino acid sequence of the full protein. Also, two or more fragments of the full protein encoded by the chimeric gene of the invention may be combined to form a single protein.
More specifically, the invention relates to a chimeric gene formed by the DNA sequences that encode antigenic determinants of four proteins of L. infantum, encoding a protein useful for pharmacological purposes, in particular for the prevention and/or treatment of Leishmaniasis, in particular canine Leishmaniasis, and obtaining the final product or the construction of the chimeric gene that encodes a polypeptide that contains all the selected antigenic determinants, characterised in that it uses a cloning strategy in which the clone that expresses the protein rLiPO-Ct-Q is used as an initial vector, and to this vector, by means of the use of suitable restriction sites, fragments Of DNA are sequentially added that encode the proteins LiP2a-Q, LiP2b-Q, LiH2A-Ct-Q, LiH2A-Nt-Q, and after each step of cloning the correct orientation of each one of the inserts is deduced and the size of the expression products, the complete sequence of nucleotides of the final clone pPQV finally being determined and the deduced sequence of amino acids is SGAPRISEFSVKAAAQSGKKRCRLNPRTVMLAARHDDDIGTLLKNVTLSHSGVV

PNISKAMAKKKGGKKGKATPSAPEFGDSSRPMSTKYLAAYALASLSKASPSQAD

, 35 VEAICKAVHIDVDQATLAFVMESVTGRDVATLIAEGAAKMSAMPAASSGAAAGV

TASAAGDAAPAAAAAKKDEPEEEADDDMGPSVRDPMQYLAAYALVALSGKTPSK

STAGAGAGAVAEAKKEEPEEEEADDDMGPVDLOPAAAAPAAPSAAAKAAPEESD

EDDFGMGGLF (SEQ ID NO: 3) 5 Said chimeric gene preferably encodes a polypeptide generated with a molecular weight of 38 kD and an isoelectric point of 7.37.
The invention als relates to a pharmaceutical composition for the prevention and treatment, in humans

10 or animals, of Leishmaniasis formed a- by the protein Chimera Q (SEQ ID NO:1), or a variant of this protein which contains modifications or substitutions of conserved amino acids, administered to a subject (human or animal), either b- in isolated form or together with any physiological adjuvant via the intraperitoneal, subcutaneous or intramuscular routes.
Also, the invention relates to a vaccine capable of stimulating the production of antibodies which recognise the Leishmania parasite, formed a- by the protein Chimera Q or a variant of this protein which differs from protein Q in conserved amino acids administered to a subject (human or animal), either b- in isolated form or together with any physiological adjuvant via the intraperitoneal, subcutaneous or intramuscular routes.
Another aspect of the invention comprises a pharmaceutical composition for the prevention and treatment, in humans or animals, of Leishmaniasis formed =
a- by protein Q, or a variant of this protein which contains, modifications or substitutions of conserved amino acids, bound to protein LiHsp70, complete or fragmented, administered to a subject (human or animal), either b- in isolated form or together with any physiological adjuvant via the intraperitoneal, subvutaneous or

11 intramuscular routes.
A further pharmaceutical composition of tpe invention for the prevention and treatment, in humans ,or animals, of Leishmaniasis can be formed:
a- by any DNA
vector carrying the sequence which encodes the protein Chimera Q (SEQ ID NO:2), or a variant of this sequence which contains modifications or substitutions of nucleotides which code for conserved amino acids,' administered to a subject (human or animal), either b- by the intramuscular or subcutaneous routes.
In yet another aspect, the invention relates to a pharmaceutical composition for the prevention and treatment, in humans or animals, of Leishmaniasis formed a- by any DNA vector carrying 1- the sequence which encodes the protein Chimera Q, or a variant of this sequence which contains modifications or substitutions of nucleotides which code for conserved amino acids, and 2 -the sequence which encodes the protein LiHsp70, or variants of the same which differ in conserved amino acids, administered to a subject (human or animal), either b- by the intramuscular, subcutaneous or intramuscular route.
The invention also relates to a protein useful for pharmacological purposes, in particular for the prevention and/or treatment of Leishmaniasis, in particular canine Leishmaniasis, having the amino acid sequence:

SGAPRISEFSVKAAAQSGKKRCRLNPRTVMLAARHDDDIGTLLKNVTLSHSGVV

PNISKAMAKKKGGKKGKATPSAPEFGDSSRPMSTKYLAAYALASLSKASPSQAD

VEAICKAVHIDVDQATLAFVMESVTGRDVATLIAEGAAKMSAMPAASSGAAAGV

TASAAGDAAPAAAAAKKDEPEEEADDDMGPSVRDPMQYLAAYALVALSGKTPSK

12 STAGAGAGAVAEAKKEEPEEEEADDDMGPVDLOPAAAAPAAPSAAAKAAPEESD

EDDFGMGGLF
or a mutant or fragment thereof that can be used for generating a protective immune response in a human or animal against Leishmaniasis, and to a pharmaceutical composition for the prevention and treatment, in humans or animals, of Leishmaniasis, comprising this protein or a mutant or fragment thereof that can be used for generating a protective immune response in a human or animal against Leishmaniasis.
Also, the invention relates to a vaccine capable of stimulating the production of antibodies which recognise the Leishmania parasite, comprising the protein mentioned above or a mutant or fragment thereof that can be used for generating a protective immune response in a human or animal against Leismaniasis.
A further aspect of the invention encompasses a pharmaceutical composition for the prevention and treatment, in humans or animals, of Leishmaniasis, comprising antibodies directed against the protein mentioned above or a mutant or fragment thereof, preferably containing one or more antigenic determinants such as an epitope.
The invention further relates to a method for the prevention or treatment of Leishmaniasis in a human or animal, comprising administering to the human or animal a pharmaceutical composition as described above, or to a method for preventing Leishmaniasis in a human or animal, comprising administering to the human or animal a vaccine as described above.
The chimeric gene formed of the DNA sequences that encode the antigenic determinants of four proteins of L.
infantum and protein obtained, useful for preventing and/or treating Leishmaniasis, that the invention proposes, in its own right constitutes an obvious novelty

13 within its field of application, as according to the invention, a synthetic chimeric gene is produced that as it is obtained by assembly, containing the DNA region encoding the antigenic determinants specific to the proteins LiP2a, LiP2b, LiP0 and H2A, thus constructing a protein rich in antigenic determinants. The chimeric gene obtained is expressed in Escherichia coli and the product has been analysed with respect to its antigenic properties. The results confirm that this chimeric protein maintains all the antigenic determinants of the parent proteins and that it constitutes a relevant pharmaceutically useful element for canine VL, with a sensibility that oscillates between 80% to 93%, and a specificity of between 96% to 100%.
More particularly, the chimeric gene formed by the DNA sequences that encode the antigenic determinants of four proteins of L. infantum and the protein encoded by at, useful for the prevention and/or treatment of canine Leishmaniasis and protein obtained object of the invention, is produced by means of the following stages, namely:
Construction of the chimeric gene. Methodology.
Cloning strategy.
Cloning of DNA sequences that encode antigenic determinants of the histone protein H2A.
Cloning of the sequences that encode rLiP2a-Q and rLiP2b-Q.
Cloning of the sequence rLiP0-Q.
Cloning of the chimeric gene.
- Construction of the chimeric gene from the construction of intermediate products.
Cloning of epitopes specific to the L. infantum antigens.
- Construction of the final product Construction of the chimeric gene that encodes a polypeptide that contains all the selected antigenic determinants.

14 - optionally expression of the sequence thus obtained.
- Evaluation of the final product.
Serums.
Purification of proteins Electrophoresis of proteins and immuno-analysis.
Measurements by Fast-ELISA
- Evaluation of the final product.
Antigenic properties.
Sensitivity and specificity of the chimeric protein CP in the serum diagnosis of canine VL.
The strategy followed by the cloning of DNA
sequences that encode each one of the selected antigenic determinants is the same in all cases, and in a first step, the sequence of interest is amplified by means of a PCR and the use of specific oligonucleotides that contain targets for restriction enzymes at the extremes.
For the cloning step, the amplified product is directed by means of the appropriate restriction enzyme and it is inserted in the corresponding restriction site of the plasmid pUC18.
After sequencing the DNA, the insert is recovered and sub-cloned to the corresponding restriction site of the modified plasmid denominated pMAL-c2. The modification is made by inserting a termination codon downstream of the target HindIII in the polylinker of pMal-c2, denominating the resulting plasmid pMAL-c2'.
Regarding the cloning of the DNA sequence that encodes the antigenic determinants of the histone protein H2A, it should be pointed out that the cDNA of the clone cL71, that encodes the histone H2A of L. infantum, is used as a template for the PCR reactions, and for the DNA
amplification, that encodes the N-terminal region of the histone H2A, more exactly rLiH2A-Nt-Q, the following oligonucleotides are used: sense 5' -= CCTTIAGCTACTCCTCGCAGCGCCAAG-3' (SEQIIDNK):4) (position 84-104 of the sequence cL71); antisense 5'CCTGGGGGCGCCAGAGGCACCGATGCG-3' (SEQ ID NO:5) (inverse and complimentary to position 204-224 of the sequence cL71) .
The sequences that are included in the oligonucleotides for the cloning and that are not present in the parent sequence cL-71 are marked in boldface type.
5 The amplified DNA fragment is cloned directly from the restriction site XmnI of pMAI-c2*.
The fragment is sequenced by means of the initiator #1234 malE and the antigenic C-terminal region of histone H2A, in particular rLiH2A-Ct-Q, is amplified with the 10 following oligonucleotides. These are:
Sense, 5'-GAATTCTCCGTAAGGCGGCCGCGCAG-3' (SEQ ID NO: 6) (position 276-296 of the sequence cL71).
Antisense, 5'-GAATTCGGGCGCGCTCGGTGTCGCCTTGCC (SEQ ID NO:?) (inverse and complimentary to the positions 456-476 of

15 the plasmid cL71).
A triplet that encodes proline (indicated as GGG
after the underlined letters) is included in the anti-sense oligonucleotide, the restriction site EccRI that is included in both oligonucleotides for cloning is indicated by underlining.
Regarding the cloning of the sequences that encode rLiP2a-Q, it should be pointed out that the regions of interest are amplified by PCR from cDNAs encoding LiP2a and LiP2b.
The oligonucleotides that are used for constructing the expression clone LiP2a-Q, are the following.
Sense, 5'-GTCGACCCCATGCAGTACCTCGCCGCGTAC-3' (SEQ ID NO:8).
Anti-sense, GTCGACGGGGCCCATGTCATCATCGGCCTC-3' (SEQ ID NO: 9).
it should be pointed out that the Sail restriction sites added to the 5' extremes of the oligonucleotides have been underlined.
When constructing the expression clone LiP2b-Q, the oligonucleotides used were:
Sense, 5'-TCTAGACCCGCCATGTCGTCGTCTTCCTCGCC-3' (SEQ ID NO: 10).
Anti-sense, TCTAGAGGGGCCATGTCGTCGTCGGCCTC-3' (SEQ ID NO: 11).
At the 5' extremes of the oligonucleotides the restrictions sites are included for the enzyme XbaI
_

16 (underlined), and due to the cloning needs, an additional triplet, encoding a proline residue, is included downstream of the restriction site.
Regarding the cloning of the sequence rLiP0-Q, it should be pointed out that the cloning of the DNA
sequence of the C-terminal region of the protein PO of L.
infantum is carried out by amplifying a clone of cDNA
called L27 and the following oligonucleotides:
Sense, 5'-IODGCAGCCCGCCGCTGCCGCGCCGGCCGCC-3' (SEQIIIDNO:11) (positions 1-24 of the L27 cDNA) and the initiator of the pUC18 sequence (#1211), the amplified DNA is directed by the enzymes PstI+HindIII, with later insertion into the plasmid pMAL-c2.
The resulting clone is denominated pPQI and it should be noted that the restriction site PstI is included in the nucleotide with sense (underlined sequence) and that the restriction target HindIII is present in the cDNA L27.
Regarding the cloning of the chimeric gene, it should be pointed out that the DNA sequences that encode the five antigenic determinants are assembled into a chimeric gene, and this assembly is carried out on the clone pPQI, to which the codifying regions for the antigenic regions LiP2a-Q are added sequentially in the 3' direction (naming the results of cloning pPQ2), LiP2b-Q (clone pPQ3), LiH2a-Ct-Q (clone pPQ4) and LiH2A-Nt-Q
(clone pPQ5).
Finally, the insert obtained after the SacI+HindIII
digestion of the final clone pPQ5 is inserted into the pQE31 expression plasmid, naming the resulting clone pPQ.
DESCRIPTION OF THE DRAWINGS
To complete the description that is being made and with the aim of aiding the understanding of the characteristics of the invention, the present disclosure is accompanied, as an integral part thereof, by a set of plans of illustrative nature that are not limiting. The following is represented:

17 Figure number 1.
Corresponds to a graphic representation of each one of the recombinant proteins fused to the maltose binding protein. These will be purified by affinity chromatography on an amylose column as is represented in Figure number 4.
Figure number 2. Sample of the different vectors considered to obtain the chimeric gene object of the invention, from which the pertinent protein destined to carry out an accurate diagnostic on animals or human beings that show symptoms of Leishmaniasis will be extracted.
Figure number 3. Corresponds to the identification of the protein obtained from the chimeric gene, the preparation of which is represented in Figure number 2.
Figure number 4. Corresponds to a chromatographic representation of affinity chromatography on an amylose column, and after the purification process' the recombinant proteins submitted to electrophoresis.
Figure number 5. Shows finally a synthesised graphical representation of the reactivity of a wide variety of canine serums, divided into three groups. The first group contain animals with real infection by L.
infantum. The second group includes serum obtained from dogs with various clinical symptoms but that are not infected with Leishmania, and a third group is made up of fifteen control serums from healthy dogs. This figure demonstrates the value of the invention for carrying out serological diagnosis of VL.
Figure numberd 6a and 6b show the immunological response in 4 hamsters injected intraperitoneally with 5 micrograms of protein Q and 5 micrograms of protein LiHsp70. The graph shows the humoral response (weeks vs optical density). These figures show that all the animals respond immunologically to protein Q, and that starting from the second week after immunisation the response against protein Q was very high and this response increased after the second immunisation (week 4), whereas

18 the response against protein LiHsp70 was lower than that observed against Q.
PREFERRED EMBODIMENT OF THE INVENTION
The chimeric gene formed from the DNA sequences that encode the antigenic determinants of four proteins of L. infantum, useful for the serological diagnosis of canine Leishmaniasis and the protein obtained that is being proposed are constituted from the construction of intermediate products. In a first instance, cloning of epitopes specific to the antigens of L. infantum is carried out, which is configured on the basis of earlier studies on the antigenic properties of four protein antigens of L. infantum (LiP2a, PiP0, LiP2b, LiH2a), which allow the existence of B epitopes to be defined for these proteins, and which are specifically recognised by the canine serums of VL.
With a view to improving the antigenic specificity of these antigens with respect to the proteins of L.
infantum, the specific antigenic determinants are cloned from these proteins. After deleting certain regions of these proteins these can be recognised by serums from animals that are carriers of VL and other different diseases.
By using the specific oligonucleotides and amplification by PCR of regions specific to the genes LiP2a, LiP2b, PO and H2A, several clones are constructed that express the recombinant proteins rLiPO-Ct-Q, rLiP2a-Q, rLiP2b-Q, rL1H2A-Ct-Q and rLiH2A-Nt-Q, just has been detailed in the description of the invention relating to the methodology, where the cloning details are described.
The recombinant proteins used are the following:
- rLiPO-Ct-Q, which corresponds to the 30 C-terminal residues of the ribosomal protein LIP .
- rLiP2a-Q and rLiP2b-Q, that are derived from the ribosomal proteins LiP2a and LiP2b respectively.
- Two sub-regions of the histone H2A, that correspond to the 46 N-terminus residues (xLiH2A-Nt-Q),

19 and to the 67 C-terminus residues (residues (xLiH2A-Ct-Q).
Each one of the recombinant proteins fused to the maltose binding protein (MBP) is expressed in E. Coll, as represented in Figure number 1, and they were purified by affinity chromatography on a amylose column. After the process of purification the electrophoresis was carried out on the recombinant proteins (lanes 1 to 5) in Figure number 3.
With the aim of analysing whether the recombinant proteins were recognised by VL canine serums, a Western blot was incubated, containing the recombinant proteins in a mixture of three VL canine serums. Given that all these proteins are recognised by the serums, it is concluded that the antigenic determinants present in the parent proteins are maintained in the recombinant proteins.
The antigenic properties of the recombinant proteins are compared with the antigenic determinants of the parent antigens by means of a FAST ELISA, testing against a collection of 26 VL canine serums, just as is shown in the section of Figure number 1, and the fact that the serums showed a similar reactivity value, both against the selected antigenic regions and the corresponding complete proteins, demonstrates that no alteration to the antigenic epitope has occurred during the cloning procedure.
In regard to the construction of the final product, more exactly of the chimeric gene that encodes a polypeptide that contains all the selected antigenic determinants, it should be pointed out that the cloning strategy is indicated following Figure number 2 section A. The intermediate products generated during the process are shown.
A clone that expresses the proteins rLiPO-Ct-Q
(pPQI) is used as the initial vector, and the fragments of DNA that encode the proteins rLiPO-Ct-Q, rLiP2a-Q, rLiP2b-Q, rLiH2A-Ct-Q and rLiH2A-Nt-Q are added sequentially using appropriate restriction sites.
After each cloning step, the correct orientation of each one of the inserts is deduced from the size of the 5 expression products, and finally the complete nucleotide sequence of the final clone pPQV is determined and the amino acid sequence deduced from the sequence represented in Figure number 3.
The polypeptide generated has a molecular mass of 10 38 kD, with an isoelectric point of 7.37, including spacer sequences encoding proline, underlined in Figure number 3. The aim of doing this is to efficiently separate the antigenic domains and avoid possible tertiary conformations that could interfere with the 15 stability and antigenicity of the final product.
The expression and recovery of each of the intermediate products is shown in figure number 4, boxes A and B. As was expected, after each addition, the size of the expression product in the vector pMAL gradually

20 increases until reaching a molecular weight of 80 kDa.
Included in this are the sizes of the proteins rLiH2A-Ct and rLiH2A-Ct, observing a certain degree of rupture during purification.
The chimeric gene was also cloned in the plasmid pQE, a vector that allows the expression of proteins with a fragment of 6 histidines at the extreme N-terminus.
The resulting clone and the recombinant proteins are denominated pPQ and PQ respectively.
The level of expression of the protein in bacteria transformed with the pPQ plasmid and the purified proteins are shown in Figure number 4, referred to in particular with a D, with the protein PQ, purified by affinity chromatography in denaturising conditions is more stable that the recombinant protein pPQV represented in Figure number 4, in box E.
In order to evaluate the final product a series of materials were used, and obviously some techniques, as is

21 described below.
Serums of VL obtained from dogs of different origins are used. The animals are evaluated clinically and analytically in the pertinent laboratory, generally in a Department of Parasitology, and all the positive serums are assayed for indirect immuno-fluoresence (IIF).
The presence of amastigotes of the parasites of these animals is confirmed by direct observation of the popliteal and pleescapular lymph nodes, and a second group of 33 serums of VL originating from other regions, were given a positive diagnosis in the ELISA against total protein extracts of the parasite and/or by IIF.
The serums of dogs affected by different diseases that were not VL are obtained from different origins.
Within this group serums from the following infections are found:
Mesocestoides spp.
Dyphylidium caninum Uncinaria stenocephala Toxocara canis Dipetalonema dranunculoides Demodex canis Babesia canis Ehrlichia cannis Ricketsia ricketsiae.
The rest of the serums were obtained from dogs that exhibited various clinical symptoms that were not related to any infective process, and the serum controls were obtained from fifteen carefully controlled healthy animals.
Purification of the recombinant proteins expressed by the clones pMA1-c2 is carried out by affinity chromatography on amylose columns, and the purification of the recombinant protein expressed by the clone pPQ was performed on Ni-NTA resin columns in denaturising conditions (Qiagen).
For analysing the proteins electrophoresis on 10%

22 polyacrimide gels in the presence of SDS was carried out under standard conditions. Immunological analysis of the proteins separated by electrophoresis was carried out on nitrocellulose membranes to which the proteins had been transferred. The transferred proteins were blocked with dried 5% skimmed milk in a PBS buffer with 0.5% Tween"20.
The filters were sequentially brought into contact with primary and secondary anti-serum in blocking solutions and an immuno-conjugate labelled with peroxidase was used as second antibody, visualising the specific binding by means of an ECL system.
The Fast-ELISA was used instead of the classic ELISA, and the sensitisation of the antigen was carried out for 12 hours at room temperature.
The plates were sensitised with 100 pl of antigen whose concentration in all cases was 2 Ag/ml.
After sensitising the wells the plates were incubated for 1 hour with blocking solution (0.5%
powdered skimmed milk dissolved in PBS - 0.5% Tween"20 and the serums were diluted three hundred fold in blocking solution).
The wells were incubated with serum for 2 hours at room temperature, and after exposure to the antibody the wells were washed with PBS-Tween"20.
Antibodies labelled with peroxidase were used as second antibodies at a dilution of 1:2000 and the colour of the reaction was developed using the substrate ortho-phenylenediamine, measuring the absorption at 450 rim.
In regard to evaluation of the final product, it should be pointed out that the antigenic properties were determined by means of the pertinent study of the reactivity of the VL canine serums against the chimeric protein and against each one of the intermediate products in a "Western blot" assay. All the intermediate products maintained their antigenicity as well as did the final pPQV product, throughout the whole of the cloning

23 process.
It should also be pointed out that the recombinant protein expressed by the pPQ plasmid was recognised by the VL serums. With a view to analysing with greater precision the antigenic properties of the chimeric protein and the intermediate products, an analysis of the reactivity of a wide variety of VL canine serums was performed by means of a fast-ELISA against the recombinant proteins, as is shown in the section F of Figure number 4. It can be highlighted that the absorption values and the sensitivity of the different intermediate products of cloning increases after each addition stop. It should also be pointed out that the protein pQI is recognised by most of the VL serums and the protein PQII equally by most of the serums. This proportion is greater for the protein PQIII, and the proteins PQIV, PQV and PQ are recognised by practically all the serums.
According to what has been discussed above, the percentage of recognition shown by the serums was similar both in the case of assaying the chimeric proteins PQV
and PQ, and of assaying a mixture of recombinant proteins rLiPO-Ct-Q, rLiP2a, rLiP2b and rLiH2A. It was seen that the antigenic properties of each one of the 5 selected antigenic regions are present in the PQ expression product, and therefore this product can be used for diagnosis instead of a mixture of the antigens expressed individually.
With a view to determining whether the chimeric protein can be used for canine VL serum diagnosis, and according to the pertinent analysis of a wide variety of canine serums against this protein, bearing in mind that according to the clinical characteristics of the animals, the canine serums have been classified into three groups.
A first group consisted of serum of dogs with a real L.
infantum infection. A second group was composed of serums of dogs that had various clinical symptoms without being

24 infected with Leishmania, including dogs infected with parasites different to Leishmania incorporated into this group. The rest of the serums originated from dogs that exhibit clinical symptoms that could be confused with those observed during Leishmaniasis, The third group was made up of control serums, originated from serums of healthy dogs.
In figure number 5 the average values of reactivity are shown for each group of serums, the reactivity of the VL serums reaching an average reactivity value of 0.8 (S.D. = 0.4).
Within this group the reactivity of 12 serums is less than 0.35, while the reactivity of 10 serums reaches values of between 0.35 and 0.5. It is observed that the reactivity over 23 serums varies between 0.5 and 1.0, with 14 serums showing a reactivity greater than 1Ø
The average absorption value of the serums of the second group, that is to say, the group in which animals infected with Leishmania parasites and parasites different to Leishmania parasites, is 0.2 (S.D. = 0.05) and the reactivity of the control serums, that is to say, the third group, is 0.1 (S.D. = 0.003).
The data presented above indicate that the chimeric protein PQ in the FAST ELISA has a sensitivity of 80% for the VL diagnosis, if the cut-off value is defined as the average reactivity value of the serums of group 2 plus three S.D.'s (that is to say 0.35).
The sensitivity of the assayed group reaches 93%, if the cut-off value is defined by the reactivity values of the control group, and the data indicate that the protein CP has a specificity of 96% for the VL diagnosis, when the cut-off value is defined by the aforementioned serums of group 2, and only two serums from group 2 showed reactivity between 0.35 and 0.40.
100%
specificity in the assay was reached when the reactivity values of healthy dogs were considered.
The process to be used is the following:

1.- The microtitre plates are covered with .antibodies by incubated 100 Al of a solution that contains 1 Ag/m1 of antigen dissolved in a buffer PBS -0.5% Tween 20 - 5% skimmed milk (Buffer A).
5 The incubation is performed for 12 hours at room temperature, and then the plates are washed three times with the same buffer containing no antigen. The dry antigenated plates could be maintained at room temperature.
10 2.- A first incubation of the wells was carried out with the serum of animal at a dilution of 1/200 in buffer A. The incubation lasts for 1 hour.
3.- The wells are washed with buffer A, as described in point 1, three times with a wash flask.
15 4.- They are incubated with a second antibody (IgG
labelled with peroxide) diluted 1:2000 in buffer A, carrying out the incubation for 1 hour.
5.- The wells are washed once again with buffer A
three times, as was indicated in the third section, that 20 is to say with a wash flask.
6.- The reactivity is revealed using the substrate = ortho-phenylenediamine and the absorption measured at 450 nm.
The protein used for the diagnosis extracted from

25 the chimeric gene is identified as follows:

SGAPRISEFSVKAAAQSGKKRCRLNPRTVMLAARHDDDIGTLLKNVTLSHSGVV

PNISKAMAKKKGGKKGKATPSAPEFGDSSRPMSTKYLAAYALASLSKASPSQAD

VEAICKAVHIDVDQATLAFVMESVTGRDVATLIAEGAAKMSAMPAASSGAAAGV

TASAAGDAAPAAAAAKKDEPEEEADDDMGPSVRDPMQYLAAYALVALSGKTPSK
265 t-STAGAGAGAVAEAKKEEPEEEEADDDMGPVDLQPAAAAPAAPSAAAKAAPEESD

EDDFGMGGLF

26 It is not considered necessary to extend this description in order that someone skilled in the art can understand the scope of the invention and the advantages that it confers.
The materials, form, size and disposition of the elements are susceptible to change, provided it does not suppose a change in the essence of the invention.
=
The terms in which this disclosure has been written should always be considered as broad in nature and not limiting.
Experimental The protozoan parasites of the genus Leishmania are responsible for causing leishmaniasis, a symptomatically complex disease which essentially affects men and animals in tropical and subtropical regions. It is estimated that the number of new cases of human visceral leishmaniasis can reach the number of 500,000, there being a minimum of several tens of millions of persons affected.
Additionally the number of cutaneous and mucocutaneous leishmaniasis can be of the order of 2.000.000 per year (Modabber F., Development of vaccines against leishmaniasis.
Scand J Infect Dis Suppl. 1990; 76:72-8).
Although the persons at risk of contracting the different types of leishmaniasis can be estimated in about 350 million, the number of persons with real infection can be much higher, due to the fact that there are no clear estimations of the real cases of asymptomatic infections and because of the existence of cryptic infections (Alvar et al., 1996).
In fact, leishmaniasis can be considered within the global context as an infection/ disease of endemic nature, situated between the 4th and 5th place in the ranking of parasitic diseases with world-wide repercussion.
Three main forms of leishmaniasis can be distinguished: cutaneous, mucocutaneous and visceral, the characteristics of which mostly depend upon the localisation of the parasite, the species to which it belongs and the clinical manifestations it produces.

27 (Coutinho et al., 1987; Cuba et al., 1988). The species distributed along Asia and certain regions in the Mediterranean area bring about the presence of the cutaneous form, with localised ulceration which, in many cases, heal spontaneously. These manifestations are caused by L. major and L. tropica. L. aethiopica (Mediterranean, Asia, Africa) also induces the cutaneous form of leishmaniasis, although its manifestation is more diffuse. In America, the species L. mexicana produces the cutaneous form with a generalised localisation that does not usually heal spontaneously. The mucocutaneous form of the disease in humans is caused by L. brasiliensis and is characterised by the presence of cutaneous lesions in oronasal and pharyngeal regions, bringing about the destruction of the mucosae. In America, Europe, Africa and Asia, the most frequent form of leishmaniasis is the visceral form, caused by L. chagasi, L. donovani and L.
infantum. This form of leishmaniasis is characterised by clinical symptoms associated to fever, anaemia and an intense hepato/splenomegalia, which is lethal if it is not treated suitably at the right time. In the advanced form of the disease, the host is incapable of developing an effective immune response. All of these forms of leishmaniasis are also detected in canids and some rodents which, in fact, constitute the main reservoirs of the parasite (Liew & O'Donnell., 1993). The health problem generated by L. infantum in the Mediterranean basin is serious because there is a high incidence of the infection / disease in dogs, and the vector insect is very extended (Abranches et al., 1991). It is calculated that between 7% and 20% of all canids are infected by Leishmania, reaching 30%, in some areas of Spain where it is endemic (Garcia Alonso., 1994). This fact constitutes a serious veterinary problem which additionally increases the risk of contagion, fundamentally by immunodepressed persons (Acedo et al., 1996). In Europe, there are some 11 million dogs at risk of infection by Leishmania.

28 L. infantum, like the rest of the species in the genus has a dimorphic biological cycle. The intermediate hosts are insects of the Psychodidae family, genus Phlebotomus. In the Mediterranean area of Europe, it has been demonstrated that the species P. arias and P.
perniciosus (Sanchia Marin et al., 1991); Alves at al., 1991; Alves and Riveiro, 1991; Maroli et al., 1994) are the main vectors, although the vectors P. papatosi, P.
longicuspis and P. sergenti are also present (Sanchis Mann et al., 1986; Martinez Ortega, 1986; Morillas Marquez et al., 1991; Rosado et al., 1995a, 1995b). When the parasite is ingested by the vector together with the blood of a vertebrate host, it places itself in the gut in an extracellular form, it transforms into a promastigote and it divides. The infective forms migrate towards the pharynx and the proboscis, from where they will be inoculated into a new vertebrate host (Chang et al., 1985). The promastigotes are characterised in that they have a flagellum and an elongated shape of some 15 to 20 Am in length, with a rounded posterior end and a sharp anterior end. The nucleus is situated in central position and the kinetoplast at the anterior end (Zuckerman and Lainson, 1977). In culture media, the parasites exhibit a certain degree of morphological variability (Chang and Hendricks, 1985). After the inoculation of the promastigotes in the skin of the vertebrate host, the establishment, or not, of the infection depends essentially upon two factors: the existence of a suitable cell population -macrophages- and other cells of the phagocytic mononuclear system, and the ability of the parasite to survive and multiply itself in the interior of these cells.
The first step in the penetration of Leishmania into macrophages is the approximation and adherence to the plasma membrane of the target cell. In vitro studies seem to indicate that there is no direct chemotactic

29 attraction of the promastigotes over the macrophages (Bray, 1983). Within the environment of tissues, free promastigotes activate complement by the alternative pathway, bringing about the formation of a concentration gradient of fraction C5a, which attracts macrophages and other inflammatory cells towards the site of inoculation (Bray and Alexander, 1987). Once the promastigote is within a parasitophorous vacuole, the lysosomes fuse to it forming a phagolysosome. In infections caused by other micro-organisms, the phagolysosome is the organelle responsible for the lysis and elimination by means of several mechanisms such as the production of toxic oxygen radicals, by an oxidative metabolic process (Keblanoff, 1980), the action of hydrolytic lysosomal enzymes, cationic proteins and low pH (Bray and Alexander, 1987).
The survival of the parasite in the phagolysosome is a function of its ability to resist and avoid said mechanisms.
The existence of an immune response against parasitisation by Leishmania which is both humoral and cellular was discovered from the first moments in which the disease was studied, and has been revised in numerous occasions (Maael and Behin, 1981; Pearson et al., 1983;
Behin and Louis, 1984; Howard, 1985; Liew and O'Donnell, 1993). The type of humoral response depends upon the form of leishmaniasis. In the cutaneous form, the humoral response is very weak, whereas in the visceral type a high antibody response is observed (Liew and O'Donnell, 1993). In the cutaneous affections there is a remarkable cell-mediated response, detectable both in vivo by means of delayed type hypersensitivity tests (DTH), as well as in vitro by means of lymphoblastic transformation tests and macrophage migration inhibition tests. In these cases the titre of serum antibodies is normally low and directly related to the seriousness of the process (Howard, 1985; Liew and O'Donnell, 1993). Once the amastigotes are within the macrophages, the resolution of the infection depends essentially upon the cell-mediated immune mechanisms (Pearson et al., 1983; Coutinho et al., 1987; Kubbs et al., 1988). The cellular response is determined by the joint action of macrophages, B cells, 5 several sub-populations of T-cells, and the different lymphokines secreted by all of them. The parasitised macrophage processes the Leishmania antigens and expresses them on its surface by a process mediated by the class II Major Histocompatibility Complex (MHC-II).
10 Additionally, the macrophage secretes IL-1, which acts as a second activating signal for the T-lymphocyte (Antezac and Gorman, 1989). In humans, visceral leishmaniasis or kala-azar is characterised by a weakened or absent cellular response, detectable both by the absence of 15 delayed hypersensitivity (DTH) (Turk and Bryceson, 1971) and by cell proliferation methods (Haldar et al., 1983;
Ghose at al., 1979; Howard, 1985). Absence of proliferation of T-cells is detected even in the presence of mitogens such as concanavelin A or phytohaemagglutinin 20 (Reiner and Finke, 1983; NTriez-Moreno, 1991) and inhibition in the production of IL-2 by stimulated T-cells (Reiner and Finke, 1983; Carvalho et al, 1985).
In mice, the population of T-lymphocytes (CD4 phenotype) is heterogeneous and can be divided into at 25 least two sub-populations according to the lymphokines they produce (Mosmann and Coffman, 1987). These cells are essential in the development of protective immunity against cutaneous leishmaniasis (sub-population Th-1) and are at the same time involved in the suppression of the

30 protective immune response (sub-population Th-2) (Liew and O'Donnell, 1993), T cells induced in resistant mice C57BL/6 or cured BALB/c mice are predominantly of the Th-1 type, whereas the cells in uncured BALB/c mice are of the Th-2 type (Lockaley et al., 1987; Sadick et al., 1987; Heinzel et al, 1989, 1991). In general, the lymphokines secreted by these cells favour the development of the cell line which produces them and has

31 an antagonic effect on the development of the other sub-population (Reiner and Lockaley, 1993). Thus, IL-4 and IL-10 produced by Th-2 cells contribute to the progression of the infection, favouring the development of this line. Additionally, they can act directly on the macrophage, not permitting its activation. However, in mice susceptible of infection by Leishmania, deficient in the gene which encodes IL-4, contradictory results have been obtained. In some cases it has been observed that the absence of this cytokine redirects the response and increases the resistance to the infection (Satoskat et al., 1995) whereas in others no differences are observed in the level of infection of the mice (Noben et al, 1996). In genetically resistant mice it has been observed that the absence of expression of the genes of IFN-y or its receptor (Swihart et al., 1995), CD40 or the ligand of 0D40, increases the susceptibility to the infection (Campbell et al., 1996; Kamanaka et al, 1996;
Soong et al., 1996). The interaction of CD40 and its ligand is necessary for the production of the cytokine IFN-y necessary to direct the response towards Th-1. Mice with a resistant genetic base, which develop a Th-1 type response, become susceptible if they are deficient in the expression of IL-12., developing a Th-2 type response (Mattner et al., 1996). Recent data suggests that the production of IL-12 is important to direct the response towards Th-1, and that the absence of IL-4 can avoid the Th-2 response (Guier at al., 1996).
There are a large number of Leishmania proteins which have an antigenic character (Jaffe et al., 1990;
Rolland-Burger et al., 1991; Mary et al., 1992) essentially characterised by "Western Blot" methods. In the serum of patients and dogs infected by Leishmania it has been possible to detect the presence of antibodies against membrane proteins such as gp63 (Shreffler et al., 1993; Morales et al., 1997) gp 46 (Burns et al., 1991), PSA (Kahl and McMahon-Pratt, 1987; Jimenez-Ruiz et al.,

32 1998) and KPM-11 (Berberich et al., 1997). Additionally several antigens of cytoplasmatic intracellular localisation have been characterised such as: Hsp70 (Macfarlane et al., 1990; Wallace et al., 1992; Quijada et al., 1996a; Quijada et al., 1996b); Hsp83 (Angel et al., 1996); LIP2a, LIP2b, LILIPO, H2A, H3 (Soto et al., 1993; Soto, 1994; Soto et al., 1995a; Soto et al., 1995b;
Soto et al., 1995c; Soto et al., 1996) and a protein related to kinesin, K39 of L. chagasi (Burns et al., 1993). The reactivity of the antibodies, which recognise conserved proteins present in the serum of dogs infected by L. infantum is directed towards the least conserved areas of these proteins (Wallace et al., 1992; Soto et al., 1995a). Some of the membrane proteins are very antigenic in natural infections (Berberich et al., 1997;
Jimenez-Ruiz et al., 1998). In all the cases of natural infection there is a great restriction in the humoral response against the proteins because the antibodies developed during the infective process recognise very restricted areas of the same ( Soto, 1994; Soto et al., 1993; Soto et al., 1995a; Soto et al., 1995b; Quijada et al., 1996a; Quijada et al., 1996b ; Soto et al., 1996).
The levels of IgG normally correspond to the intensity of the infection (Moray et al., 1987; Mimori et al., 1987) and according to Howard (1985), reflect the degree and the duration of antigenic stimulation determined by the parasitic load. A Leishmania antigen homologous to the type C kinase receptors (LACK) has recently been described which produces an early response of the Th-2 type (Mougneau et al., 1995; Julia et al., 1996). In mice transgenic for the LACK antigen and with a genetic background susceptible to the infection, the induction of tolerance to this antigen protects against the infection by Leishmania major. The anti-Leishmania antibodies can destroy the promastigotes in vitro in the presence of complement (Pearson and Steibigel., 1980; Mosser and Edelson., 1984), promote phagocytosis (Herman., 1980) and

33 induce the adherence of several particles to the surface of promastigotes and amastigotes (Dwyer, 1976).
The pathologic reaction seems to go in parallel with the density of parasitised macrophages. In visceral leishmaniasis the macrophages generally distribute themselves in a diffuse manner throughout the different organic tissues (Andrade and Andrade, 1966; Oliveira et al., 1985). The type of inflammation is is constituted by an important cellular infiltrate with a predominance of lymphocytes and plamatic cells together with hyperplasia of phagocytic cells (Veress et al., 1977; Carvalho et al., 1985; Hassan et al., 1986). The inflammation brings about alterations in the physiology of the affected organs producing serious systemic alterations (Ridley, 1987). In some occasions local granulomatous inflammation occurs, with appearance of granulomae and microgranulomae in the different organs. These granulomae are constituted by macrophages and histiocytes (affected by parasites or not) surrounded by plasmatic cells and lymphocytes and, in some cases, by fibroblasts (McElrath et al., 1988).
This inflammatory process is accompanied by an organic reaction with the appearance of characteristic lesions in the affected organs. Some authors have found deposits of amyloid substance in virtually the totality of the organs (Martinez-Gomez et al., 1980). Some authors have formulated the hypothesis that the damages produced by the disease are not directly attributable to the aethiologic agent but to the organic reaction triggered.
Vaccine against Leishmania The intense immunity which follows the recovery from cutaneous leishmaniasis has given a great impulse to the development of prophylactic vaccines against this disease. This immunity is derived from the induction of a T response which has associated to it the production of inflammatory cytokines which activate macrophages and destroy the parasites. The immunological memory in the

34 cases of infection is probably maintained by the persistent presence of the parasite in the host in a process known as concomitant immunity (Aebischer et al., 1993).
The first studies regarding vaccination against Leishmania in the decade of the 40's used live parasites as immunogens. These studies led to the production of vaccines which produced significant protection against subsequent re-infection. However, the knowledge of the possibility that live organisms could produce real infections led to such vaccination programmes not to take place for very long and, on the contrary, interest focused upon vaccines based upon dead parasites. These studies provided the first evidence on the possibility of producing effective vaccines by inoculation of parasites.
The clinical trials which used immunisation with dead Leishmania promastigotes also began in the decade of the 40's. These vaccines yielded remarkable successes as a certain degree of protection was observed, which could oscillate between 0 and 82% (Grimaldi, 1995) depending on the population. These vaccines had a smaller effect than live parasite vaccines. The isolation of avirulent clones of L. major which protect mice against infection has also demonstrated that an attenuated vaccine is possible (Handmann and McConville., 1990). However, the ignorance of the mutations which lead to the loss of virulence and the risk of production of virulent revertants make this type of vaccination currently unacceptable.
Recently there has been an important progress towards the identification of molecularly defined candidate vaccines, such as gp63 ( ), gp46/M2 ( ), the surface antigen related to the latter antigen known as PSA-2 (Xu et al., 1995; Handmann et al., 1995) and the proteins dp72 and gp70-2 (Rachamin and Jaffe, 1993), the LACK protein ( ) and Kmpll ( ).
Specifically, the T
epitopes present in protein gp63 have been identified, _ resulting in that only some of them are capable of inducing a T response, both of Th-1 as of Th-2 (Russo et al., 1993b). These antigens induce significant protection in model animals when they are administered with 5 adjuvants. ?rotein PSA-2 of Leishmania is capable of protecting against infection by L. major by inducing a Th-1 response. To evaluate the mechanism of protection of this protein as a vaccine against Leishmania in humans, its ability to induce T-cell proliferation was studied, 10 in patients which had suffered leishmaniasis and had recovered from it. It was observed that the protein is capable of bringing about a strong proliferation of the T-cells of these individuals, but not of controls with no prior history of infection. The response was of the Th-1 15 type, as was demonstrated by the cytokine induction pattern (Kemp et al., 1998).
Sub-unit vaccines have focused strongly on protein antigens because they are easy to identify, isolate and clone. However, it is necessary to take into account that 20 not all potential vaccine molecules have to be proteins.
In fact, lipophosphoglycan (LPG) plays an essential role in the establishment of infection. Vaccination with LPG
can protect against infection with L. major. In spite of the existence of a dogma which states that T-cells do not 25 recognise non-proteinaceous antigens, the LPG molecule seems to be presented to T-cells by Langerhans cells of the skin. (Moll, H. 1989; Moll et al., 1995).
Additionally, there is evidence which has demonstrated that microbial glycolipids and other non-proteinaceous 30 molecules can recognise T-cells when they are presented via the CD-1 route (Procelli, 1996). Although there is no clear evidence that protein KMP11 associated to LPG
induces a protective response, it has been proved that the proteinaceous fraction associated to LPG is capable

35 of inducing a T response and IFN-T, whereas the LPG
fraction without protein is not (Jardim et al., 1991).
It is normally accepted that sub-unit vaccines

36 although protective, only induce a short term immunity.
This problem may not be important in endemic areas, where the individuals can be periodically boosted by cause of natural infections. A major problem in the use of sub-units may arise from the fact that there may not be a response to a single antigen in a genetically diverse population. A cocktail of antigens containing B and T
inducers may overcome this drawback. It has recently been published that an extract of membrane proteins of Leishmania infantum, when injected intraperitoneally, is capable of conferring protection against the virulent promastigote forms of this parasite, and that this protection is greater when the proteins are encapsulated in positively charged liposomes (Afrin and Ali., 1997) Adjuvanticity and protective immunity elicited by Leishmania donovani antigens encapsulated in positively charged liposomes. Infection and Immunity p 2371-2377.
Vaccination with nucleic acids carrying genes which encode Leishmania proteins involves the administration of genetic material of the parasite to the host. This DNA is taken up by the cells and is introduced into the nucleus where it is transcribed and subsequently translated in the cytoplasm. The advantage of this type of vaccination is that it is possible to direct the immune response by means of the MHC-I or the MHC-II route (Wahren., 1996).
The antigens produced intracellularly are processed in the cell and the peptides generated are presented on the cell surface in association with MHC-I molecules. The consequence would be that these molecules would give rise to the induction of cytotoxic T-cells. The antigens produced in an extracellular environment would be specially taken up by specialised antigen-presenting cells, processed and presented on their surface bound to MHC-II molecules, resulting in the induction and activation of CD4+ cells which secrete cytokines which regulate the effector mechanisms of other cells of the immune system.

37 The first DNA vector to be administered as a vaccine contained the gp63 gene (Xu and Liew., 1995).
Also, the PSA-2 gene has been introduced into a plasmid and it has been observed that it generates a Th-1 response and induction of protection. Vaccination with DNA plasmids which contain Ag-2 induce a Th-1 response and protect against infection with L. major, while Ag-2 in stimulatory immune complexes elicits a combined Th-1 and Th-2 response and does not protect despite the fact that IFN-1, is induced (Sjolander et al., 1998). Equally, the gene encoding the LACK protein has been administered subcutaneously to BALB/c mice, in an expression vector which expresses the protein under the control of the cytomegalovirus promoter, and protection against infection with L. major has been observed (Gurunathan et al., 1997). In almost all cases in which DNA has been administered, the route has been intramuscular, although intradermal injection of particulate DNA must also be explored, as it requires a smaller amount of DNA . Other immunisation systems use vectors such as Salmonella, BCG
or Vaccinia virus. It is interesting to remark that the inclusion of the gp63 gene in BCG is capable of inducing protection against L. major (Connell et al., 1993).
The gene which encodes protein gp63 has also been introduced into gene delta araC under the control of the rac promotor in an attenuated Salmonella typhimurium.
Oral administration of lx109 colonies of the transformed bacterium induces a T response within the scope of both Th-1 and of cytotoxic cells against mastocytoma cells which express gp63 (Gonzalez et al., 1998). Protein gp63 in the form of gp63-ISCOM5 complex induces protection in mice, evidenced by the reduction in inflammation and suppression of lesions. In serum, there are antibodies of the IgG2a type and, additionally, it is possible to observe a Tb-1 response by induction of IL-2, IFN-1, and IL-10. No DTH response was observed (Papadopoulou, G. et al., 1998). Salmonella typhi Nramp 1 transformed with

38 gp63 elicits a Th-1 response with induction of IL-2 and IFN-y, and a strong resolution of the lesions is detected (Soo et al., 1998). A protein of L. pifanoi known as P-4 induces significant protection against infection by Leishmania. Recent studies in humans with cutaneous leishmaniasis indicate that this protein or the peptides derived from it are capable of making T cells proliferate. There is no induction of IL-4, whereas IFN-y is induced (Haberer et al., 1996). Aro-A and aro-D
mutants of Salmonella typhi transformed with IL-2, IFN-y and TNF-ci administered orally may serve as therapeutic systems against infection by L. major. It is interesting to observe that in these patients there is a greater induction of iNOS (Xu, D. et al., 1998). The gp&3 gene has also been cloned in Aro-A and Aro-D mutants, and it has been observed that after oral administration, the protein encoded is capable of inducing significant protection against infection with L. major (Xu, D. et al., 1995). This same protein is capable of inducing protection when it is administered fused to several promoters in specific varieties (GID105 and GID106) of Salmonella (McSorley et al., 1997).
An artificial protein denominated Q has recently been described by our group, which is composed of several antigenic fragments from 4 proteins of Leishmania infantum (more specifically, Lip2a, Lip2b, PO and H2A), which, after being used as antigen, has proven to have an important value for the diagnosis of canine leishmaniasis, with a 93% sensitivity and a 100%
specificity when compared with sera of control animals which are not infected (Soto et al., 1998). Equally, our group has demonstrated that protein hsp70 of Leishmania infantum is an important target of the immune response in infections caused by infection with this parasite (Quijada et al., 1996a; Quijada et al., 1996b).
With the object of exploring the possibility that protein Q may be used to design protection systems

39 against infection by Leishmania infantum, both on its own as in combination with Hsp70, three series of experiments were designed using the hamster as a model. An experiment was designed to check whether immunisation with Protein Q
protected the animals against infection on the short term, another to check whether immunisation protected them on the long term and the third was to check this protective effect after immunisation with the two proteins together. It was thereafter observed both from the short term analysis as well as from the long term analysis, that protein Q was capable of eliciting an immune response which reduces the parasitic load both in the Liver and in the Spleen after infection by Leishmania infantum in most of the immunised animals, and that immunisation with the proteins Q+Hsp70 also induced a significant response against both proteins and lead to a significant reduction of the parasitic load in most of the immunised animals.
Immunisation with Protein Q
Example 1 4 animals were immunised with 5 micrograms of protein Q dissolved in 40 microlitres of Freund's adjuvant, and another 4 animals were immunised with the same amount of adjuvant emulsified with 40 microlitres of PBS saline solution without the protein. In the first immunisation, Freund's complete adjuvant was employed combined with the protein, while in the two subsequent immunisations, incomplete Freund's adjuvant was used mixed with the protein in the same proportion of protein/adjuvant. Three intraperitoneal immunisations were carried out at 15 day intervals. Starting from the second week after each immunisation and throughout the whole period of immunisation, blood samples were extracted to measure the humoral response against protein Q in ELISA assays. It was observed that already in the second week after the first immunisation there is a positive IgG response against protein Q, and that this response was high after the second week after infection, and increased with time of immunisation until reaching a titre of 1/100.000. Equally, it was observed that immune response against protein Q was not modified significantly 5 after the infection with the parasite Fig. 1.
Fifteen days after the third immunisation, the animals were infected with a dose of 105 promastigote parasites, differentiated from infective amastigotes 10 originating from an infected hamster. It had been previously checked that the inoculum was capable of inducing a strong parasitemia together with the disease four months after having administered the parasites, in 100% of the animals infected. Table 1 indicates the level 15 of parasitemia per mg of tissue both in liver and in the spleen of the control and the vaccinated animals. It is possible to observe that in all of the vaccinated animals the parasitic load in the liver decreases with respect to the controls, and that this happens in a very significant 20 manner in 75% of them. When the parasitic load in the spleen is examined, it possible to observe that also in 75% of the animals this load was significantly lower than that of the controls, the RPL reaching 83%-86%. The animal in which the RPL was 20% in the liver, had a 48%
25 one in the spleen.
Table 1. Parasitic load in the liver and spleen of hamsters vaccinated with protein Q via the intraperitoneal route. After four weeks of 30 infection, the parasitic load was measured by the method of limit dilutions. The parasitic load is expressed as parasites per milligram of tissue. RPL
= reduction in parasitic load in %.
35 MouseLiver(RPL)Spleen(RPL) 1 4 + 1(71%)49 + 3(83%) 2 3 + 2(78%)39 + 2(86%) 3 5 + 1(64%)50 + 4(83%) 4 11 + 3(20%)153 + 10(48%) Controls 4 animals. Mean.14 + 5295 + 30 Example 2 In order to verify the effect of vaccination with protein Q on the reduction of the parasitic load on the long term, using another route of inoculation, 4 animals were injected subcutaneously with 5 micrograms of protein Q dissolved in 40 microlitres of PBS and mixed with 40 microlitres of Freund's adjuvant. In the first immunisation, Freund's complete adjuvant was employed, while in the two subsequent ones, incomplete Freund's adjuvant was used as indicated above. Vaccination was administered in three doses spaced at 15 day intervals.
Fifteen days after the third immunisation they were administered an inoculum of 10 infective parasites.
During all of the immunisation period and throughout the whole of the infection (five months) blood was extracted to determine the kind of humoral response against protein Q and against the total proteins of the parasite. Figure 2 shows that already after the second week of immunisation, the response against protein Q was positive, as in the previous case, in three of the mice, and that the response against the protein was very high after two weeks of the first immunisation. The response kept on being very high after the remaining immunisations, reaching a titre of 1/75.000 on the week following the third immunisation. In one of the animals the response against protein Q was slower in relation to time, although the response reached the level of that in the other animals by the end of the experiment.
Consequently, from the data derived both from example 1 and from example 2, it is possible to conclude that the degree of the immune response against the protein, by both routes, intraperitoneal and subcutaneous, is very rapid, although the response via the intraperitoneal route attained higher titres in the same times (1/75.000 versus 1/30.000). Figure 3 indicates the response against protein Q in the control animals. It is possible to observe that reactivity against this protein is detected on the 14th week after infection, which is when the first symptoms attributable to a potential leishmaniasis begin to be detected in the animals infected. Table 2 shows the levels of parasitemia in the liver and spleen of the control and vaccinated animals. It can be seen that 50%
of the animals were protected at the level of the liver, in the sense that the reduction in the level of parasitemia was very high (87-89%). One of the animals was not protected, whereas in another of the animals the reduction of the parasitic load was of 22%. On the contrary, the reduction of the parasitic load was of 98-99% in 100% of the animals at the level of the spleen. It was observed that there is no relation between the degree of protection and the reduction of the parasitic load.
Table 2. Parasitic load in the liver and spleen of hamsters vaccinated with protein Q by the subcutaneous route. After 20 weeks of infection, the parasitic load was measured by the method of limit dilutions. The parasitic load is expressed as parasites per milligram of tissue. RPL = reduction in parasitic load in %.
MouseLiver(RPL)Spleen(RPL) 5 1.4 x 106(22%)1.0 x 107(98%) 6 2.0 x 105(89%)4.9 x 105(99.9%) 7 2.4 x 106(87%)3.3 x 105(99.9%) 8 1.9 x 106(0%)6.3 x 106(99.9%) _ .

Controls 4 animals. Mean. 1.8x108 + 1.2x105 5.2 x1 08 2.6x107 With the object of testing if protein Q could be used to design protection systems in formulations which contained protein LiHsp70 of Leishmania infantum, an experiment was carried out in Balb/c mice. It was observed that after immunisation, the parasitic load both in the liver as in the spleen was reduced significantly, being in some of the animals, four orders of magnitude lower.

Immunisations with protein Q + protein Hsp70 in Freund's Adjuvant.
Example 3 Each one of 4 hamsters were injected intraperitoneally with 5 micrograms of protein Q and 5 micrograms cf protein LiHsp70 dissolved in 40 microlitres of PBS and emulsified in 40 microlitres of Freund's adjuvant. In the first immunisation, Freund's complete adjuvant was employed, while in the two subsequent ones, incomplete Freund's adjuvant was used as indicated above.
Vaccination was administered in three doses spaced at 15 day intervals.
Fifteen days after the third immunisation they were administered an inoculum of 10 infective parasites.
Every two weeks, for all of the immunisation period and throughout the whole of the infection, blood was extracted from them to determine the degree of humoral response against protein Q and against protein LiHsp70.
45 days after the third dose they were administered 10' parasites via the intracardiac route and were sacrificed at week 22. Figure 6a shows that all the animals respond immunologically to protein Q, and that starting from the second week after immunisation the response against protein Q was very high and this response increased after the second immunisation (week 4). The response against protein LiHsp70 throughout the whole time of the experiment was also positive, although lower than that observed against Q, vide Fig 6b. The difference between the parasitLc load in the spleen of control and immunised animals was of 3 orders of magnitude, measured in parasites per milligram of tissue.

SEQUENCE LISTING
(1) GENERAL INFORMATION:
(i) APPLICANT: C.B.F. Leti S.A.
(ii) TITLE OF INVENTION: Chimeric Gene Formed of the DNA Sequence that Encode the Antigenic Determinants of Four Proteins of L. Infantum, and Protein Encoded by Said Gene, and Pharamaceutical Composition Useful for ...
(iii) NUMBER OF SEQUENCES: 12 (iv) CORRESPONDENCE ADDRESS:
(A) ADDRESSEE: BERESKIN & PARR
(B) STREET: 40 King Street West (C) CITY: Toronto (D) STATE: Ontario (E) COUNTRY: Canada (F) ZIP: M5H 3Y2 (v) COMPUTER READABLE FORM:
(A) MEDIUM TYPE: Floppy disk (B) COMPUTER: IBM PC compatible (C) OPERATING SYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: PatentIn Release #1.0, Version #1.30 (vi) CURRENT APPLICATION DATA:
(A) APPLICATION NUMBER: CA 2,256,124 (B) FILING DATE: 23-DEC-1998 (C) CLASSIFICATION:
(viii) ATTORNEY/AGENT INFORMATION:
(A) NAME: Gravelle, Micheline (B) REGISTRATION NUMBER: 4189 (C) REFERENCE/DOCKET NUMBER: 444-153 (ix) TELECOMMUNICATION INFORMATION:
(A) TELEPHONE: (416) 364-7311 (B) TELEFAX: (416) 361-1398 (2) INFORMATION FOR SEQ ID NO:1:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 412 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO:1:
Met Arg Gly Ser His His His His His His Thr Asp Pro His Ala Ser Ser Asn Asn Asn Asn Asn Asn Asn Asn Asn Asn Leu Gly Ile Glu Gly Arg Pro Leu Ala Thr Pro Arg Ser Ala Lys Lys Ala Val Arg Lys Ser , . , Gly Ser Lys Ser Ala Lys Cys Gly Leu Ile Phe Pro Val Gly Arg Val Gly Gly Met Met Arg Arg Gly Gln Tyr Ala Arg Arg Ile Gly Ala Ser Gly Ala Pro Arg Ile Ser Glu Phe Ser Val Lys Ala Ala Ala Gln Ser Gly Lys Lys Arg Cys Arg Leu Asn Pro Arg Thr Val Met Leu Ala Ala Arg His Asp Asp Asp Ile Gly Thr Leu Leu Lys Asn Val Thr Leu Ser His Ser Gly Val Val Pro Asn Ile Ser Lys Ala Met Ala Lys Lys Lys Gly Gly Lys Lys Gly Lys Ala Thr Pro Ser Ala Pro Glu Phe Gly Ser Ser Arg Pro Met Ser Thr Lys Tyr Leu Ala Ala Tyr Ala Leu Ala Ser Leu Ser Lys Ala Ser Pro Ser Gln Ala Asp Val Glu Ala Ile Cys Lys Ala Val His Ile Asp Val Asp Gln Ala Thr Leu Ala Phe Val Met Glu Ser Val Thr Gly Arg Asp Val Ala Thr Leu Ile Ala Glu Gly Ala Ala Lys Met Ser Ala Met Pro Ala Ala Ser Ser Gly Ala Ala Ala Gly Val Thr Ala Ser Ala Ala Gly Asp Ala Ala Pro Ala Ala Ala Ala Ala Lys Lys Asp Glu Pro Glu Glu Glu Ala Asp Asp Asp Met Gly Pro Ser Arg Val Asp Pro Met Gln Tyr Leu Ala Ala Tyr Ala Leu Val Ala Leu Ser Gly Lys Thr Pro Ser Lys Ala Asp Val Gln Ala Val Leu Lys Ala Ala Gly Val Ala Val Asp Ala Ser Arg Val Asp Ala Val Phe Gln Glu Val Glu Gly Lys Ser Phe Asp Ala Leu Val Ala Glu Gly Arg Thr Lys Leu Val Gly Ser Gly Ser Ala Ala Pro Ala Gly Ala Val Ser Thr Ala Gly Ala Gly Ala Gly Ala Val Ala Glu Ala Lys Lys Glu Glu Pro Glu Glu ' CA 02256124 2008-02-06 , .
, . .

Glu Glu Ala Asp Asp Asp Met Gly Pro Val Asp Leu Gin Pro Ala Ala Ala Ala Pro Ala Ala Pro Ser Ala Ala Ala Lys Glu Glu Pro Glu Glu Ser Asp Glu Asp Asp Phe Gly Met Gly Gly Leu Phe (2) INFORMATION FOR SEQ ID NO:2:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 1436 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: other nucleic acid (xi) SEQUENCE DESCRIPTION: SEQ ID NO:2:
atgagaggat ctcaccacca ccaccaccac acggatccgc atgcgagctc gaacaacaac 60 aacaataaca ataacaacaa cctcgggatc gagggaaggc ctttagctac tcctcgcagc 120 gccaagaagg ccgtccgcaa gagcggctcc aagtccgcga aatgtggtct gatcttcccg 180 gtgggccgcg tcggcgggat gatgcgccgc ggccagtacg ctcgccgcat cggtgcctct 240 ggcgccccca ggatttcaga attctccgtg aaggcggccg cgcagagcgg gaagaagcgg 300 tgccgcctga acccgcgcac cgtgatgctg gccgcgcgcc acgacgacga catcggcacg 360 cttctgaaga acgtgacctt gtctcacagc ggcgttgtgc cgaacatcag caaggcgatg 420 gcaaagaaga agggcggcaa gaagggcaag gcgacaccga gcgcgcccga attcggatcc 480 tctagaccca tgtccaccaa gtacctcgcc gcgtacgctc tggcctccct gagcaaggcg 540 tccccgtctc aggcggacgt ggaggctatc tgcaaggccg tccacatcga cgtcgaccag 600 gccaccctcg cctttgtgat ggagagcgtt acgggacgcg acgtggccac cctgatcgcg 660 gagggcgccg cgaagatgag cgcgatgccg gcggccagct ctggtgccgc tgctggcgtc 720 actgcttccg ctgcgggtga tgcggctccg gctgccgccg ccgcgaagaa ggacgagccc 780 gaggaggagg ccgacgacga catgggcccc tctagagtcg accccatgca gtacctcgcc 840 gcgtacgccc tcgtggcgct gtctggcaag acgccgtcga aggcggacgt tcaggctgtc 900 ctgaaggccg ccggcgttgc cgtggatgcc tcccgcgtgg atgccgtctt ccaggaggtg 960 gagggcaaga gcttcgatgc gctggtggcc gagggccgca cgaagctggt gggctctggc 1020 tctgccgctc ctgctggcgc tgtctccact gctggtgccg gcgctggcgc ggtggccgag 1080 gcgaagaagg aggagcccga ggaggaggag gccgatgatg acatgggccc cgtcgacctg 1140 cagcccgccg ctgccgcgcc ggccgcccct agcgccgctg ccaaggagga gccggaggag 1200 agcgacgagg acgacttcgg catgggcggt ctcttctaag cgactcgcca tctcttagcc 1260 tccttgtggt gcgcttgagg tgctctcgct ctgcttctcc ttgcagtgtt ggctgactct 1320 ggcgggtatg tgccgtcgca ttacacccac ctctcccacc cctttgccct acgcgctcgc 1380 atgcgcaatc cgtgaatcat cgagggaagt ctctctgggt ggcagtgggt aagctt 1436 (2) INFORMATION FOR SEQ ID NO:3:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 328 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO:3:
Ile Glu Gly Arg Pro Leu Thr Pro Arg Ser Ala Lys Lys Ala Val Arg Lys Ser Gly Ser Lys Ser Ala Lys Cys Gly Leu Ile Phe Pro Val Gly Arg Val Gly Gly Met Met Arg Arg Gly Tyr Ala Arg Arg Ile Gly Ala Ser Gly Ala Pro Arg Ile Ser Glu Phe Ser Val Lys Ala Ala Ala Gln Ser Gly Lys Lys Arg Cys Arg Leu Asn Pro Arg Thr Val Met Leu Ala Ala Arg His Asp Asp Asp Ile Gly Thr Leu Leu Lys Asn Val Thr Leu Ser His Ser Gly Val Val Pro Asn Ile Ser Lys Ala Met Ala Lys Lys Lys Gly Gly Lys Lys Gly Lys Ala Thr Pro Ser Ala Pro Glu Phe Gly Asp Ser Ser Arg Pro Met Ser Thr Lys Tyr Leu Ala Ala Tyr Ala Leu Ala Ser Leu Ser Lys Ala Ser Pro Ser Gln Ala Asp Val Glu Ala Ile Cys Lys Ala Val His Ile Asp Val Asp Gln Ala Thr Leu Ala Phe Val Met Glu Ser Val Thr Gly Arg Asp Val Ala Thr Leu Ile Ala Glu Gly Ala Ala Lys Met Ser Ala Met Pro Ala Ala Ser Ser Gly Ala Ala Ala Gly Val Thr Ala Ser Ala Ala Gly Asp Ala Ala Pro Ala Ala Ala Ala Ala Lys Lys Asp Glu Pro Glu Glu Glu Ala Asp Asp Asp Met Gly Pro Ser Val Arg Asp Pro Met Gin Tyr Leu Ala Ala Tyr Ala Leu Val Ala Leu Ser Gly Lys Thr Pro Ser Lys Ser Thr Ala Gly Ala Gly Ala Gly Ala Val Ala Glu Ala Lys Lys Glu Glu Pro Glu Glu Glu Glu Ala Asp Asp Asp Met Gly Pro Val Asp Leu Gln Pro Ala Ala Ala Ala Pro Ala Ala Pro Ser Ala Ala Ala Lys Ala Ala Pro Glu Glu Ser Asp Glu Asp Asp Phe Gly Met Gly Gly Leu Phe (2) INFORMATION FOR SEQ ID NO:4:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 27 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: other nucleic acid (xi) SEQUENCE DESCRIPTION: SEQ ID NO:4:

(2) INFORMATION FOR SEQ ID NO:5:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 27 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: other nucleic acid (xi) SEQUENCE DESCRIPTION: SEQ ID NO:5:

(2) INFORMATION FOR SEQ ID NO:6:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 26 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: other nucleic acid (xi) SEQUENCE DESCRIPTION: SEQ ID NO:6:

(2) INFORMATION FOR SEQ ID NO:7:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 30 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: other nucleic acid (xi) SEQUENCE DESCRIPTION: SEQ ID NO:7:

(2) INFORMATION FOR SEQ ID NO:8:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 30 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: other nucleic acid (xi) SEQUENCE DESCRIPTION: SEQ ID NO:8:

(2) INFORMATION FOR SEQ ID NO:9:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 30 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: other nucleic acid (xi) SEQUENCE DESCRIPTION: SEQ ID NO:9:

(2) INFORMATION FOR SEQ ID NO:10:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 32 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: other nucleic acid (xi) SEQUENCE DESCRIPTION: SEQ ID NO:10:

(2) INFORMATION FOR SEQ ID NO:11:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 29 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: other nucleic acid (xi) SEQUENCE DESCRIPTION: SEQ ID NO:11:

(2) INFORMATION FOR SEQ ID NO:12:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 30 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: other nucleic acid (xi) SEQUENCE DESCRIPTION: SEQ ID NO:12:

Claims

1. A pharmaceutical composition for the prevention or treatment, in humans and animals, of leishmaniasis, comprising a chimeric protein comprising antigenic determinants of each of LiP2a, LiP2b, LiP0 and LiH2A of L. infantum, said chimeric protein comprising:
(a) the amino acid sequence as shown in SEQ ID NO: 1 or (b) at least 90% amino acid identity with the full length amino acid sequence of SEQ ID NO: 1 and which generates an immune response against leishmaniasis in a human or animal, and a pharmaceutically acceptable adjuvant, solvent or buffer.

2. The pharmaceutical composition according to claim 1, wherein the adjuvant is a physiological adjuvant suitable for use intra-peritoneally, subcutaneously or intramuscularly.

3. The pharmaceutical composition according to claim 1 or 2, further comprising the protein LiHsp70, complete or fragmented.

4. A pharmaceutical composition for the prevention or treatment, in humans and animals, of leishmaniasis, comprising a polynucleotide encoding a chimeric protein comprising antigenic determinants of each of LiP2a, LiP2b, LiP0 and LiH2A of L. infantum, said chimeric protein comprising:

(a) the amino acid sequence as shown in SEQ ID NO:
1 or (b) at least 90% amino acid identity with the full length amino acid sequence of SEQ ID NO: 1 and which generates an immune response against leishmaniasis in a human or animal; and a pharmaceutically acceptable adjuvant, solvent or buffer.

5. The pharmaceutical composition according to claim 4, wherein the polynucleotide comprises the nucleotide sequence of SEQ ID NO: 2.

6. The pharmaceutical composition according to any one of claims 1-3, wherein the composition is a vaccine.

7. A chimeric protein comprising antigenic determinants of each of LiP2a, LiP2b, LiP0 and LiH2A of L. infantum, said chimeric protein comprising:
(a) the amino acid sequence as shown in SEQ ID NO:
1 or (b) at least 90% amino acid identity with the full length amino acid sequence of SEQ ID NO: 1 and which generates an immune response against leishmaniasis in a human or animal, for use in the prevention or treatment of leishmaniasis in a human or animal subject.

8. A polynucleotide encoding a chimeric protein comprising antigenic determinants of each of LiP2a, LiP2b, LiP0 and LiH2A of L. infantum, said chimeric protein comprising:
(a) the amino acid sequence as shown in SEQ ID NO:
1 or (b) at least 90% amino acid identity with the full length amino acid sequence of SEQ ID NO: 1 and which generates an immune response against leishmaniasis in a human or animal, for use in the prevention or treatment of leishmaniasis in a human or animal subject.

9. The polynucleotide of claim 8, wherein the polynucleotide comprises the nucleotide sequence of SEQ
ID NO: 2.

10. A chimeric protein comprising antigenic determinants of each of LiP2a, LiP2b, LiP0 and LiH2A of L. infantum, said chimeric protein comprising:
(a) the amino acid sequence as shown in SEQ ID NO:
1 or (b) at least 90% amino acid identity with the full length amino acid sequence of SEQ ID NO: 1 and which generates an immune response against leishmaniasis in a human or animal for use in generating an immune response.

11. A pharmaceutical composition according to any one of claims 1-3 and 6 for use in generating an immune response.

12. An antibody specific to a chimeric protein comprising antigenic determinants of each of LiP2a, LiP2b, LiP0 and L1H2A of L. infantum, said chimeric protein comprising:
(a) the amino acid sequence as shown in SEQ ID
NO: 1 or (b) at least 90% amino acid identity with the full length amino acid sequence of SEQ ID NO: 1 and which generates an immune response against leishmaniasis in a human or animal.

13. A pharmaceutical composition comprising an antibody specific to a chimeric protein comprising antigenic determinants of each of LiP2a, LiP2b, LiP0 and LiH2A of L. infantum, said chimeric protein comprising:
(a) the amino acid sequence as shown in SEQ ID
NO: 1 or (b) at least 90% amino acid identity with the full length amino acid sequence of SEQ ID NO: 1 and which generates an immune response against leishmaniasis in a human or animal, and a pharmaceutically acceptable adjuvant, solvent or buffer.

14. Use of the pharmaceutical composition according to any one of claims 1-6, 11 and 13 for the preparation of a medicament for the prevention or treatment of leishmaniasis in a human or animal.

15. Use of the pharmaceutical composition according to any one of claims 1-6 and 11 for the preparation of a vaccine for the prevention or treatment of leishmaniasis in a human or animal.

16. Use of the pharmaceutical composition according to any one of claims 1-6, 11 and 13 for the prevention or treatment of leishmaniasis in a human or animal.