CA2243784A1 - Cdc2-related kinase associated with acute leukemia - Google Patents
Cdc2-related kinase associated with acute leukemia Download PDFInfo
- Publication number
- CA2243784A1 CA2243784A1 CA 2243784 CA2243784A CA2243784A1 CA 2243784 A1 CA2243784 A1 CA 2243784A1 CA 2243784 CA2243784 CA 2243784 CA 2243784 A CA2243784 A CA 2243784A CA 2243784 A1 CA2243784 A1 CA 2243784A1
- Authority
- CA
- Canada
- Prior art keywords
- nkiatre
- protein
- gene
- cells
- kinase
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 206010000830 Acute leukaemia Diseases 0.000 title description 17
- 108010040340 CDC2-CDC28 Kinases Proteins 0.000 title description 7
- 102000001840 CDC2-CDC28 Kinases Human genes 0.000 title description 7
- 101100220161 Rattus norvegicus Cdkl3 gene Proteins 0.000 description 222
- 108090000623 proteins and genes Proteins 0.000 description 109
- 210000004027 cell Anatomy 0.000 description 83
- 102000004169 proteins and genes Human genes 0.000 description 81
- 235000018102 proteins Nutrition 0.000 description 76
- 238000000034 method Methods 0.000 description 49
- 108020004414 DNA Proteins 0.000 description 37
- 230000014509 gene expression Effects 0.000 description 36
- 241000282414 Homo sapiens Species 0.000 description 34
- 108091000080 Phosphotransferase Proteins 0.000 description 34
- 102000020233 phosphotransferase Human genes 0.000 description 34
- 239000002299 complementary DNA Substances 0.000 description 31
- 241000700159 Rattus Species 0.000 description 28
- 108090000765 processed proteins & peptides Proteins 0.000 description 28
- 102000043136 MAP kinase family Human genes 0.000 description 26
- 108091054455 MAP kinase family Proteins 0.000 description 26
- 239000012634 fragment Substances 0.000 description 26
- 210000001519 tissue Anatomy 0.000 description 22
- 239000013598 vector Substances 0.000 description 22
- 239000000523 sample Substances 0.000 description 21
- 241001465754 Metazoa Species 0.000 description 20
- 230000000694 effects Effects 0.000 description 20
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 19
- 230000001105 regulatory effect Effects 0.000 description 19
- 150000007523 nucleic acids Chemical class 0.000 description 18
- 239000002773 nucleotide Substances 0.000 description 18
- 125000003729 nucleotide group Chemical group 0.000 description 18
- 230000026731 phosphorylation Effects 0.000 description 18
- 238000006366 phosphorylation reaction Methods 0.000 description 18
- 102000004196 processed proteins & peptides Human genes 0.000 description 18
- 230000027455 binding Effects 0.000 description 17
- 238000009396 hybridization Methods 0.000 description 17
- 102100031685 Cyclin-dependent kinase-like 2 Human genes 0.000 description 16
- 101000777764 Homo sapiens Cyclin-dependent kinase-like 2 Proteins 0.000 description 16
- 108020001507 fusion proteins Proteins 0.000 description 15
- 102000037865 fusion proteins Human genes 0.000 description 15
- 102100031679 Cyclin-dependent kinase-like 1 Human genes 0.000 description 14
- 101000777728 Homo sapiens Cyclin-dependent kinase-like 1 Proteins 0.000 description 14
- 206010028980 Neoplasm Diseases 0.000 description 14
- 238000004458 analytical method Methods 0.000 description 14
- 238000012217 deletion Methods 0.000 description 14
- 230000037430 deletion Effects 0.000 description 14
- 238000003752 polymerase chain reaction Methods 0.000 description 14
- 239000000047 product Substances 0.000 description 14
- 238000012216 screening Methods 0.000 description 14
- 108010024986 Cyclin-Dependent Kinase 2 Proteins 0.000 description 13
- 102000015792 Cyclin-Dependent Kinase 2 Human genes 0.000 description 13
- 241000699666 Mus <mouse, genus> Species 0.000 description 13
- 239000000203 mixture Substances 0.000 description 13
- 102100024193 Mitogen-activated protein kinase 1 Human genes 0.000 description 12
- 108091034117 Oligonucleotide Proteins 0.000 description 12
- 230000004913 activation Effects 0.000 description 12
- 125000003275 alpha amino acid group Chemical group 0.000 description 12
- 210000004556 brain Anatomy 0.000 description 12
- 239000000243 solution Substances 0.000 description 12
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 11
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 11
- 102000001253 Protein Kinase Human genes 0.000 description 11
- 150000001875 compounds Chemical class 0.000 description 11
- 238000004519 manufacturing process Methods 0.000 description 11
- 108020004999 messenger RNA Proteins 0.000 description 11
- 102000039446 nucleic acids Human genes 0.000 description 11
- 108020004707 nucleic acids Proteins 0.000 description 11
- 108060006633 protein kinase Proteins 0.000 description 11
- 108091007914 CDKs Proteins 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 10
- 108091028043 Nucleic acid sequence Proteins 0.000 description 10
- 230000018199 S phase Effects 0.000 description 10
- 235000001014 amino acid Nutrition 0.000 description 10
- 239000013612 plasmid Substances 0.000 description 10
- 102000003903 Cyclin-dependent kinases Human genes 0.000 description 9
- 108090000266 Cyclin-dependent kinases Proteins 0.000 description 9
- 101000876610 Dictyostelium discoideum Extracellular signal-regulated kinase 2 Proteins 0.000 description 9
- 101001052493 Homo sapiens Mitogen-activated protein kinase 1 Proteins 0.000 description 9
- 101000950669 Homo sapiens Mitogen-activated protein kinase 9 Proteins 0.000 description 9
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 9
- 102100037809 Mitogen-activated protein kinase 9 Human genes 0.000 description 9
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 9
- 239000004473 Threonine Substances 0.000 description 9
- 230000035772 mutation Effects 0.000 description 9
- 108091033319 polynucleotide Proteins 0.000 description 9
- 102000040430 polynucleotide Human genes 0.000 description 9
- 239000002157 polynucleotide Substances 0.000 description 9
- 239000011780 sodium chloride Substances 0.000 description 9
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 9
- 101710085461 Alpha-tubulin N-acetyltransferase 1 Proteins 0.000 description 8
- 108010021466 Mutant Proteins Proteins 0.000 description 8
- 102000008300 Mutant Proteins Human genes 0.000 description 8
- 229940024606 amino acid Drugs 0.000 description 8
- 238000010171 animal model Methods 0.000 description 8
- 108091007433 antigens Proteins 0.000 description 8
- 102000036639 antigens Human genes 0.000 description 8
- 238000013459 approach Methods 0.000 description 8
- 230000010261 cell growth Effects 0.000 description 8
- 108010068338 p38 Mitogen-Activated Protein Kinases Proteins 0.000 description 8
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 7
- 150000001413 amino acids Chemical class 0.000 description 7
- 239000000427 antigen Substances 0.000 description 7
- 230000000890 antigenic effect Effects 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 230000033228 biological regulation Effects 0.000 description 7
- 210000000349 chromosome Anatomy 0.000 description 7
- 230000004927 fusion Effects 0.000 description 7
- 230000006801 homologous recombination Effects 0.000 description 7
- 238000002744 homologous recombination Methods 0.000 description 7
- 238000011534 incubation Methods 0.000 description 7
- 230000036210 malignancy Effects 0.000 description 7
- 238000012546 transfer Methods 0.000 description 7
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 7
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 7
- 102400001368 Epidermal growth factor Human genes 0.000 description 6
- 101800003838 Epidermal growth factor Proteins 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 6
- 239000004471 Glycine Substances 0.000 description 6
- 108091034057 RNA (poly(A)) Proteins 0.000 description 6
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 239000007983 Tris buffer Substances 0.000 description 6
- 230000000692 anti-sense effect Effects 0.000 description 6
- 201000011510 cancer Diseases 0.000 description 6
- 230000022131 cell cycle Effects 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- 238000013461 design Methods 0.000 description 6
- 238000002405 diagnostic procedure Methods 0.000 description 6
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 6
- 229940116977 epidermal growth factor Drugs 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 230000012010 growth Effects 0.000 description 6
- 210000002216 heart Anatomy 0.000 description 6
- 238000003780 insertion Methods 0.000 description 6
- 230000037431 insertion Effects 0.000 description 6
- 239000002502 liposome Substances 0.000 description 6
- 210000003205 muscle Anatomy 0.000 description 6
- 239000002953 phosphate buffered saline Substances 0.000 description 6
- 241000894007 species Species 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 238000002560 therapeutic procedure Methods 0.000 description 6
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 5
- 108050006400 Cyclin Proteins 0.000 description 5
- 102000016736 Cyclin Human genes 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 102000019149 MAP kinase activity proteins Human genes 0.000 description 5
- 108040008097 MAP kinase activity proteins Proteins 0.000 description 5
- 229920002684 Sepharose Polymers 0.000 description 5
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 5
- 238000002105 Southern blotting Methods 0.000 description 5
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 5
- 230000003213 activating effect Effects 0.000 description 5
- 230000003321 amplification Effects 0.000 description 5
- 239000000074 antisense oligonucleotide Substances 0.000 description 5
- 238000012230 antisense oligonucleotides Methods 0.000 description 5
- 239000001913 cellulose Substances 0.000 description 5
- 229920002678 cellulose Polymers 0.000 description 5
- 235000010980 cellulose Nutrition 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 238000003199 nucleic acid amplification method Methods 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 210000002966 serum Anatomy 0.000 description 5
- 230000011664 signaling Effects 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- 230000009261 transgenic effect Effects 0.000 description 5
- 108700028369 Alleles Proteins 0.000 description 4
- 230000006820 DNA synthesis Effects 0.000 description 4
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 4
- 108700025695 Suppressor Genes Proteins 0.000 description 4
- 241000700618 Vaccinia virus Species 0.000 description 4
- 235000003704 aspartic acid Nutrition 0.000 description 4
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 238000003745 diagnosis Methods 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- 230000009977 dual effect Effects 0.000 description 4
- 238000001962 electrophoresis Methods 0.000 description 4
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 4
- 210000004602 germ cell Anatomy 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 210000001630 jejunum Anatomy 0.000 description 4
- 210000004185 liver Anatomy 0.000 description 4
- 210000004072 lung Anatomy 0.000 description 4
- 239000003550 marker Substances 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 210000000287 oocyte Anatomy 0.000 description 4
- 230000002018 overexpression Effects 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- 229920001184 polypeptide Polymers 0.000 description 4
- 108091008146 restriction endonucleases Proteins 0.000 description 4
- 230000001177 retroviral effect Effects 0.000 description 4
- 238000012552 review Methods 0.000 description 4
- 238000012163 sequencing technique Methods 0.000 description 4
- 230000019491 signal transduction Effects 0.000 description 4
- 210000000952 spleen Anatomy 0.000 description 4
- 230000000638 stimulation Effects 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 238000011282 treatment Methods 0.000 description 4
- KISWVXRQTGLFGD-UHFFFAOYSA-N 2-[[2-[[6-amino-2-[[2-[[2-[[5-amino-2-[[2-[[1-[2-[[6-amino-2-[(2,5-diamino-5-oxopentanoyl)amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]-5-(diaminomethylideneamino)p Chemical compound C1CCN(C(=O)C(CCCN=C(N)N)NC(=O)C(CCCCN)NC(=O)C(N)CCC(N)=O)C1C(=O)NC(CO)C(=O)NC(CCC(N)=O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(C(=O)NC(CC(C)C)C(O)=O)CC1=CC=C(O)C=C1 KISWVXRQTGLFGD-UHFFFAOYSA-N 0.000 description 3
- WOVKYSAHUYNSMH-RRKCRQDMSA-N 5-bromodeoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 WOVKYSAHUYNSMH-RRKCRQDMSA-N 0.000 description 3
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 108091035707 Consensus sequence Proteins 0.000 description 3
- 108090000259 Cyclin D Proteins 0.000 description 3
- 102000003910 Cyclin D Human genes 0.000 description 3
- 230000004568 DNA-binding Effects 0.000 description 3
- 229920002307 Dextran Polymers 0.000 description 3
- 102000001301 EGF receptor Human genes 0.000 description 3
- 108060006698 EGF receptor Proteins 0.000 description 3
- 108010007457 Extracellular Signal-Regulated MAP Kinases Proteins 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 3
- 238000000636 Northern blotting Methods 0.000 description 3
- 239000004677 Nylon Substances 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 238000012300 Sequence Analysis Methods 0.000 description 3
- 241000282898 Sus scrofa Species 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 238000001042 affinity chromatography Methods 0.000 description 3
- 239000011543 agarose gel Substances 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 230000002759 chromosomal effect Effects 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- RGWHQCVHVJXOKC-SHYZEUOFSA-J dCTP(4-) Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-J 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 238000002825 functional assay Methods 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 238000001415 gene therapy Methods 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 238000011065 in-situ storage Methods 0.000 description 3
- 230000002779 inactivation Effects 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 210000000936 intestine Anatomy 0.000 description 3
- 239000012160 loading buffer Substances 0.000 description 3
- 210000004698 lymphocyte Anatomy 0.000 description 3
- 238000012423 maintenance Methods 0.000 description 3
- 230000003211 malignant effect Effects 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 229920001778 nylon Polymers 0.000 description 3
- 239000008194 pharmaceutical composition Substances 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 210000001541 thymus gland Anatomy 0.000 description 3
- 239000011534 wash buffer Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 108020005544 Antisense RNA Proteins 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 241000972773 Aulopiformes Species 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 108020004635 Complementary DNA Proteins 0.000 description 2
- 102100032857 Cyclin-dependent kinase 1 Human genes 0.000 description 2
- 101710106279 Cyclin-dependent kinase 1 Proteins 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 101001072338 Homo sapiens Proliferating cell nuclear antigen Proteins 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- 102000003960 Ligases Human genes 0.000 description 2
- 108090000364 Ligases Proteins 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- 102000047918 Myelin Basic Human genes 0.000 description 2
- 101710107068 Myelin basic protein Proteins 0.000 description 2
- 229930193140 Neomycin Natural products 0.000 description 2
- 108091005461 Nucleic proteins Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 102000006382 Ribonucleases Human genes 0.000 description 2
- 108010083644 Ribonucleases Proteins 0.000 description 2
- 101710137500 T7 RNA polymerase Proteins 0.000 description 2
- 108010006785 Taq Polymerase Proteins 0.000 description 2
- 102000004357 Transferases Human genes 0.000 description 2
- 108090000992 Transferases Proteins 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 239000000556 agonist Substances 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000002459 blastocyst Anatomy 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000032823 cell division Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 239000003184 complementary RNA Substances 0.000 description 2
- 230000002559 cytogenic effect Effects 0.000 description 2
- 230000007547 defect Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 210000001671 embryonic stem cell Anatomy 0.000 description 2
- 210000002257 embryonic structure Anatomy 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 239000013613 expression plasmid Substances 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical group O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000004255 ion exchange chromatography Methods 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 238000011813 knockout mouse model Methods 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 230000002297 mitogenic effect Effects 0.000 description 2
- 230000000394 mitotic effect Effects 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 229960004927 neomycin Drugs 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- -1 phosphoamino acids Chemical class 0.000 description 2
- 239000013600 plasmid vector Substances 0.000 description 2
- 102000054765 polymorphisms of proteins Human genes 0.000 description 2
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 2
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 2
- 210000001938 protoplast Anatomy 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 238000005215 recombination Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000022983 regulation of cell cycle Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 235000019515 salmon Nutrition 0.000 description 2
- 238000003118 sandwich ELISA Methods 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 238000011830 transgenic mouse model Methods 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 238000002424 x-ray crystallography Methods 0.000 description 2
- YKJYKKNCCRKFSL-RDBSUJKOSA-N (-)-anisomycin Chemical compound C1=CC(OC)=CC=C1C[C@@H]1[C@H](OC(C)=O)[C@@H](O)CN1 YKJYKKNCCRKFSL-RDBSUJKOSA-N 0.000 description 1
- KILNVBDSWZSGLL-KXQOOQHDSA-N 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCC KILNVBDSWZSGLL-KXQOOQHDSA-N 0.000 description 1
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- NKDFYOWSKOHCCO-YPVLXUMRSA-N 20-hydroxyecdysone Chemical compound C1[C@@H](O)[C@@H](O)C[C@]2(C)[C@@H](CC[C@@]3([C@@H]([C@@](C)(O)[C@H](O)CCC(C)(O)C)CC[C@]33O)C)C3=CC(=O)[C@@H]21 NKDFYOWSKOHCCO-YPVLXUMRSA-N 0.000 description 1
- 101150110188 30 gene Proteins 0.000 description 1
- BUADUHVXMFJVLH-UHFFFAOYSA-N 7-chloro-3-imidazol-1-yl-2H-1,2,4-benzotriazin-1-ium 1-oxide Chemical compound N1[N+](=O)C2=CC(Cl)=CC=C2N=C1N1C=CN=C1 BUADUHVXMFJVLH-UHFFFAOYSA-N 0.000 description 1
- 241001514645 Agonis Species 0.000 description 1
- YKJYKKNCCRKFSL-UHFFFAOYSA-N Anisomycin Natural products C1=CC(OC)=CC=C1CC1C(OC(C)=O)C(O)CN1 YKJYKKNCCRKFSL-UHFFFAOYSA-N 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 108010039627 Aprotinin Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 101710094648 Coat protein Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 108010051219 Cre recombinase Proteins 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 108010025468 Cyclin-Dependent Kinase 6 Proteins 0.000 description 1
- 108010016788 Cyclin-Dependent Kinase Inhibitor p21 Proteins 0.000 description 1
- 102000000578 Cyclin-Dependent Kinase Inhibitor p21 Human genes 0.000 description 1
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 description 1
- 102100026804 Cyclin-dependent kinase 6 Human genes 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- 108010017826 DNA Polymerase I Proteins 0.000 description 1
- 102000004594 DNA Polymerase I Human genes 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 1
- 108700020911 DNA-Binding Proteins Proteins 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 206010013710 Drug interaction Diseases 0.000 description 1
- 102100031480 Dual specificity mitogen-activated protein kinase kinase 1 Human genes 0.000 description 1
- 101710146526 Dual specificity mitogen-activated protein kinase kinase 1 Proteins 0.000 description 1
- 102100023274 Dual specificity mitogen-activated protein kinase kinase 4 Human genes 0.000 description 1
- 101710146518 Dual specificity mitogen-activated protein kinase kinase 4 Proteins 0.000 description 1
- 101710204837 Envelope small membrane protein Proteins 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 241001524679 Escherichia virus M13 Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 108060002716 Exonuclease Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 101710113436 GTPase KRas Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 1
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 1
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 206010053759 Growth retardation Diseases 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101000617830 Homo sapiens Sterol O-acyltransferase 1 Proteins 0.000 description 1
- 101000653540 Homo sapiens Transcription factor 7 Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000000585 Interleukin-9 Human genes 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 108010055717 JNK Mitogen-Activated Protein Kinases Proteins 0.000 description 1
- 102000019145 JUN kinase activity proteins Human genes 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- GDBQQVLCIARPGH-UHFFFAOYSA-N Leupeptin Natural products CC(C)CC(NC(C)=O)C(=O)NC(CC(C)C)C(=O)NC(C=O)CCCN=C(N)N GDBQQVLCIARPGH-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 101710145006 Lysis protein Proteins 0.000 description 1
- 102000001291 MAP Kinase Kinase Kinase Human genes 0.000 description 1
- 108010075654 MAP Kinase Kinase Kinase 1 Proteins 0.000 description 1
- 108060006687 MAP kinase kinase kinase Proteins 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 102100033115 Mitogen-activated protein kinase kinase kinase 1 Human genes 0.000 description 1
- 101000919317 Mus musculus Adapter molecule crk Proteins 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 241000282579 Pan Species 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 101710083689 Probable capsid protein Proteins 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 102000017006 Proto-Oncogene Protein c-ets-2 Human genes 0.000 description 1
- 108010014644 Proto-Oncogene Protein c-ets-2 Proteins 0.000 description 1
- KDCGOANMDULRCW-UHFFFAOYSA-N Purine Natural products N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 1
- 239000013614 RNA sample Substances 0.000 description 1
- 101100345684 Rattus norvegicus Mapk1 gene Proteins 0.000 description 1
- 101100345688 Rattus norvegicus Mapk3 gene Proteins 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 206010038997 Retroviral infections Diseases 0.000 description 1
- 101150010882 S gene Proteins 0.000 description 1
- 108010044012 STAT1 Transcription Factor Proteins 0.000 description 1
- 102100029904 Signal transducer and activator of transcription 1-alpha/beta Human genes 0.000 description 1
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 102100021993 Sterol O-acyltransferase 1 Human genes 0.000 description 1
- 101000697584 Streptomyces lavendulae Streptothricin acetyltransferase Proteins 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 102100030627 Transcription factor 7 Human genes 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 108700025716 Tumor Suppressor Genes Proteins 0.000 description 1
- 102000044209 Tumor Suppressor Genes Human genes 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 241000269370 Xenopus <genus> Species 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- QPMSXSBEVQLBIL-CZRHPSIPSA-N ac1mix0p Chemical compound C1=CC=C2N(C[C@H](C)CN(C)C)C3=CC(OC)=CC=C3SC2=C1.O([C@H]1[C@]2(OC)C=CC34C[C@@H]2[C@](C)(O)CCC)C2=C5[C@]41CCN(C)[C@@H]3CC5=CC=C2O QPMSXSBEVQLBIL-CZRHPSIPSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 102000016679 alpha-Glucosidases Human genes 0.000 description 1
- 108010028144 alpha-Glucosidases Proteins 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 230000002072 anti-mutant effect Effects 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 229960004405 aprotinin Drugs 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 1
- 230000003416 augmentation Effects 0.000 description 1
- 238000011888 autopsy Methods 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000008236 biological pathway Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 235000011132 calcium sulphate Nutrition 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 230000006369 cell cycle progression Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 108091092328 cellular RNA Proteins 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 238000011098 chromatofocusing Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000014107 chromosome localization Effects 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 238000004737 colorimetric analysis Methods 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 239000002875 cyclin dependent kinase inhibitor Substances 0.000 description 1
- 229940043378 cyclin-dependent kinase inhibitor Drugs 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 238000002651 drug therapy Methods 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 102000013165 exonuclease Human genes 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 210000002458 fetal heart Anatomy 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 108010081400 fluorescein isothiocyante avidin Proteins 0.000 description 1
- 238000005558 fluorometry Methods 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 230000002070 germicidal effect Effects 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 239000000185 hemagglutinin Substances 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 235000003642 hunger Nutrition 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 230000037417 hyperactivation Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 230000031146 intracellular signal transduction Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- GDBQQVLCIARPGH-ULQDDVLXSA-N leupeptin Chemical compound CC(C)C[C@H](NC(C)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C=O)CCCN=C(N)N GDBQQVLCIARPGH-ULQDDVLXSA-N 0.000 description 1
- 108010052968 leupeptin Proteins 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000021121 meiosis Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000000329 molecular dynamics simulation Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000001167 myeloblast Anatomy 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical class CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- 229940099990 ogen Drugs 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000001991 pathophysiological effect Effects 0.000 description 1
- 239000013610 patient sample Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000002831 pharmacologic agent Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000000358 protein NMR Methods 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000012743 protein tagging Effects 0.000 description 1
- 238000009163 protein therapy Methods 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 125000000561 purinyl group Chemical group N1=C(N=C2N=CNC2=C1)* 0.000 description 1
- 238000000163 radioactive labelling Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 150000003354 serine derivatives Chemical class 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229940048086 sodium pyrophosphate Drugs 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 230000037351 starvation Effects 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000000021 stimulant Substances 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 125000002730 succinyl group Chemical group C(CCC(=O)*)(=O)* 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 229910021653 sulphate ion Inorganic materials 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 235000019818 tetrasodium diphosphate Nutrition 0.000 description 1
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 239000003104 tissue culture media Substances 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- IMNIMPAHZVJRPE-UHFFFAOYSA-N triethylenediamine Chemical compound C1CN2CCN1CC2 IMNIMPAHZVJRPE-UHFFFAOYSA-N 0.000 description 1
- IHIXIJGXTJIKRB-UHFFFAOYSA-N trisodium vanadate Chemical compound [Na+].[Na+].[Na+].[O-][V]([O-])([O-])=O IHIXIJGXTJIKRB-UHFFFAOYSA-N 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 239000002691 unilamellar liposome Substances 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000003260 vortexing Methods 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1205—Phosphotransferases with an alcohol group as acceptor (2.7.1), e.g. protein kinases
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Wood Science & Technology (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biomedical Technology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Description
cdc2-RELATED KINASE ASSOCIATED WITH ACUTE
LEUKEMIA
Field of the Invention This invention relates to cdc2-related kinases and in particular to a cdc2-related kinase which is a putative tumour suppressor.
Background of the Invention Intracellular signaling cascades are manipulated by a range of extracellular stimuli resulting in diverse outcomes such as cell division and differentiation. These stimuli-sensitive signaling cascades focus on key cell cycle regulatory molecules which in turn directly control cell division.
One group of stimulus-sensitive cascades activates the MAP
kinases, which control cell cycle progression by regulating, directly or indirectly, the activities of the cyclin-dependent kinases (CDKs). CDK
activity is partially dependent on binding to cyclin regulatory partners which induce an activated conformation (1). Mitogenic stimuli promote entry into S phase from Gi by activating CDK4 and CDK6 which bind to members of the cyclin D family. Activation of these cyclin D-associated CDKs is the earliest identified point of S phase control and may be a common target of activated MAP kinases.
Both the MAP kinases (MAPKs) and the cyc:lin dependent kinases have characteristic sites of phosphorylation which distinguish them (10-14). The MAP.Ks have a specific dual phosphorylation motif, consisting of a threonineltyrosine pair, located in a regulatory loop of kinase domain VIII (15-:l7). These regulatory phosphoamino acids, which are separated by only one variable residue, are positioned on a lip at the entry into the kinase active site. When phosphorylated, a conformational change occurs exposing the kinase to ATP and substrate (18).
LEUKEMIA
Field of the Invention This invention relates to cdc2-related kinases and in particular to a cdc2-related kinase which is a putative tumour suppressor.
Background of the Invention Intracellular signaling cascades are manipulated by a range of extracellular stimuli resulting in diverse outcomes such as cell division and differentiation. These stimuli-sensitive signaling cascades focus on key cell cycle regulatory molecules which in turn directly control cell division.
One group of stimulus-sensitive cascades activates the MAP
kinases, which control cell cycle progression by regulating, directly or indirectly, the activities of the cyclin-dependent kinases (CDKs). CDK
activity is partially dependent on binding to cyclin regulatory partners which induce an activated conformation (1). Mitogenic stimuli promote entry into S phase from Gi by activating CDK4 and CDK6 which bind to members of the cyclin D family. Activation of these cyclin D-associated CDKs is the earliest identified point of S phase control and may be a common target of activated MAP kinases.
Both the MAP kinases (MAPKs) and the cyc:lin dependent kinases have characteristic sites of phosphorylation which distinguish them (10-14). The MAP.Ks have a specific dual phosphorylation motif, consisting of a threonineltyrosine pair, located in a regulatory loop of kinase domain VIII (15-:l7). These regulatory phosphoamino acids, which are separated by only one variable residue, are positioned on a lip at the entry into the kinase active site. When phosphorylated, a conformational change occurs exposing the kinase to ATP and substrate (18).
2 Characteristic of the cychn-dependent kinases are a threonine and tyrosine pair embedded within the glycine-rich ATP-binding sequence found in kinase domain I. Negatively charged phosphates on these residues repel ATI? and prevent kinase activity (18). In addition, cyclin-dependent kinases have a single site of activating phosphorylation within domain VIII, analogous to the MAPIis (19).
These regulatory sites are conserved within these two kinase families and are critical for their respective roles in cell cycle control.
Two protein kinases have been identified which have sequence similarity both to both the MAP kinases and to the cyclin dependent kinases (20,21). These cdc2-related kinases, named KKIAMRE and KKIALRE, after the amino acid sequences of the putative cyclin-binding domains, are expressed primarily in kidney, brain, lung and testis (p56 KKIAMRE) or ovary (p42 KKIALRE}. Bot;h of these molecules also have the conserved MAP kinase dual phosphorylation motif, TDY, located in kinase subdomain VIII. Activated MAPK/Erk Kinase (MEK) can phosphorylate both of these residues in KKIAMRE
in vitro, though less efficiently than similar sites on ERK (20). The kinase activity of KKIAMRE is increased by Epidermal Growth Factor (EGF) stimulation, independent of phosphorylation at these putative regulatory sites, suggesting an alternative mechanism of kinase regulation. Although expression of these two kinases in germinal tissues suggests their role in the normal function of these tissues, physiologic substrates have not yet been identified.
Mammalian cells respond to many complex stimuli and additional kinase regulators of cell cycle control remain to be described.
Patients with acui;e myeloid leukemia or myelodysplastic syndromes usually have many genetic abnormalities (47,48) and have a poor clinical prognosis. Small deletions in chromosome 5q31, in a region adjacent to the IL,S gene, have been found in many patients with
These regulatory sites are conserved within these two kinase families and are critical for their respective roles in cell cycle control.
Two protein kinases have been identified which have sequence similarity both to both the MAP kinases and to the cyclin dependent kinases (20,21). These cdc2-related kinases, named KKIAMRE and KKIALRE, after the amino acid sequences of the putative cyclin-binding domains, are expressed primarily in kidney, brain, lung and testis (p56 KKIAMRE) or ovary (p42 KKIALRE}. Bot;h of these molecules also have the conserved MAP kinase dual phosphorylation motif, TDY, located in kinase subdomain VIII. Activated MAPK/Erk Kinase (MEK) can phosphorylate both of these residues in KKIAMRE
in vitro, though less efficiently than similar sites on ERK (20). The kinase activity of KKIAMRE is increased by Epidermal Growth Factor (EGF) stimulation, independent of phosphorylation at these putative regulatory sites, suggesting an alternative mechanism of kinase regulation. Although expression of these two kinases in germinal tissues suggests their role in the normal function of these tissues, physiologic substrates have not yet been identified.
Mammalian cells respond to many complex stimuli and additional kinase regulators of cell cycle control remain to be described.
Patients with acui;e myeloid leukemia or myelodysplastic syndromes usually have many genetic abnormalities (47,48) and have a poor clinical prognosis. Small deletions in chromosome 5q31, in a region adjacent to the IL,S gene, have been found in many patients with
3 these disorders (48,48). 'The presence of these conserved losses has suggested that a tumour suppressor gene, important in the development of leukemia, may be located in this region. Several groups have attempted to define the minimal region of chromosome 5q31 loss by studying small groups of patients with unusually small deletions of this chromosomal band (49). While mutually exclusive regions have been identified by different groups, all sites map within a 10 Mb region flanked by the genes for :ILS and NKSFl (47-52). Contained within this segment are genes for many cytokines or their receptors, including GSF
1R, IL9, CSF-2 and TCF7 (49). To date, candidate tumour suppressor genes have not been identified in this region.
Summary of the Inventian A previously undescribed cdc2-related kinase involved in cell growth and in the control of the cell cycle has been identified. The gene for the new kinase, designated NKIATRE, has been cloned and its cDNA sequence has been obtained and the encoded amino acid sequence determined.
The NKIATRE gene has been found to be associated with acute leukemia in humans.
In accordance with one embodiment, the invention provides isolated polynucleotides comprising nucleotide sequences encoding NKIATRE proteins.
In accordance with a further series of embodiments, the invention provides an isolated polynucleotide selected from the group consisting of (a) a nucleotide sequence encoding a mammalian NKIATRE
protein;
(b) a nucleotide sequence encoding a human NKIATRE
protein;
(c) a nucleotide sequence encoding a rat NKIATRE protein;
1R, IL9, CSF-2 and TCF7 (49). To date, candidate tumour suppressor genes have not been identified in this region.
Summary of the Inventian A previously undescribed cdc2-related kinase involved in cell growth and in the control of the cell cycle has been identified. The gene for the new kinase, designated NKIATRE, has been cloned and its cDNA sequence has been obtained and the encoded amino acid sequence determined.
The NKIATRE gene has been found to be associated with acute leukemia in humans.
In accordance with one embodiment, the invention provides isolated polynucleotides comprising nucleotide sequences encoding NKIATRE proteins.
In accordance with a further series of embodiments, the invention provides an isolated polynucleotide selected from the group consisting of (a) a nucleotide sequence encoding a mammalian NKIATRE
protein;
(b) a nucleotide sequence encoding a human NKIATRE
protein;
(c) a nucleotide sequence encoding a rat NKIATRE protein;
4 (d) a nucleotide sequence encoding a non-mammalian NKIATRE protein;
(e) a nucleotide sequence encoding the NKIATRE amino acid sequence of Table 2.
In accordance with a fur°ther embodiment, the invention provides the nucleotide sequence of Table 1 (rat NKIATRE).
In accordance with a further embodiment, the invention provides recombinant vectors including the polynucleotides disclosed herein and host cells transformed with these vectors.
The invention further provides a method for producing NKIATRE
proteins, comprising culturing such host cells to permit expression of a NKIATRE protein-encoding polynucleotide and production of the protein.
The invention also includes polynucleotides which are complementary to the disclosed nucleotide sequences, polynucleotides which hybridise to these sequences under high stringency and degeneracy equivalents of these sequences.
In accordance with a further embodiment, the invention provides antisense molecules which may be used to prevent expression of a NKIATRE protein. Such antisense molecules can be synthesised by methods known to those skilled in the art and include phosphorothioates and similar compounds.
The invention further includes polymorphisms and alternatively spliced versions of the NKIATRE genes and proteins wherein nucleotide or amino acid substitutions or deletions do not substantially affect the functioning of the gene or its encoding protein.
The invention also enables the identification and isolation of allelic variants or homologues of the described NKIATRE genes, and their corresponding proteins, using standard hybridisation screening or PCR techniques.
The invention provides a method for identifying allelic variants or homologues of the described NKIATRE genes, comprising choosing a nucleic acid probe or primer capable of hybridising to a NKIATRE gene sequence under stringent hybridisation conditions;
(e) a nucleotide sequence encoding the NKIATRE amino acid sequence of Table 2.
In accordance with a fur°ther embodiment, the invention provides the nucleotide sequence of Table 1 (rat NKIATRE).
In accordance with a further embodiment, the invention provides recombinant vectors including the polynucleotides disclosed herein and host cells transformed with these vectors.
The invention further provides a method for producing NKIATRE
proteins, comprising culturing such host cells to permit expression of a NKIATRE protein-encoding polynucleotide and production of the protein.
The invention also includes polynucleotides which are complementary to the disclosed nucleotide sequences, polynucleotides which hybridise to these sequences under high stringency and degeneracy equivalents of these sequences.
In accordance with a further embodiment, the invention provides antisense molecules which may be used to prevent expression of a NKIATRE protein. Such antisense molecules can be synthesised by methods known to those skilled in the art and include phosphorothioates and similar compounds.
The invention further includes polymorphisms and alternatively spliced versions of the NKIATRE genes and proteins wherein nucleotide or amino acid substitutions or deletions do not substantially affect the functioning of the gene or its encoding protein.
The invention also enables the identification and isolation of allelic variants or homologues of the described NKIATRE genes, and their corresponding proteins, using standard hybridisation screening or PCR techniques.
The invention provides a method for identifying allelic variants or homologues of the described NKIATRE genes, comprising choosing a nucleic acid probe or primer capable of hybridising to a NKIATRE gene sequence under stringent hybridisation conditions;
5 mixing the probe or primer with a sample of nucleic acids which may contain a nucleic acid corresponding to the variant or homologue;
and detecting hybridisation of the probe or primer to the nucleic acid corresponding to the variant or homologue.
In accordance with a further embodiment, the invention provides fragments of the disclosed polynucleotides, such as polynucleotides of at least 10, preferably 15, more preferably 20 consecutive nucleotides of the disclosed polynucleotide sequences. These fragments are useful as probes and PCR primers or for encoding fragments, functional domains or antigenic determinants of NKIATRE proteins.
In accordance with a further embodiment, the invention provides substantially purified NKIATRE proteins, including the protein of Table 2.
The invention further provides a method for producing antibodies which selectively bind to a NKIATRE protein comprising the steps of administering an immunologically effective amount of a NKIATRE immunogen to an animal;
allowing the animal to produce antibodies to the immunogen; and obtaining the antibodies from the animal or from a cell. culture derived therefrom.
The invention further provides substantially pure antibodies which bind selectively to an antigenic determinant of a NKIATRE
protein. The antibodies of the invention include polyclonal antibodies, monoclonal antibodies and single chain antibodies.
and detecting hybridisation of the probe or primer to the nucleic acid corresponding to the variant or homologue.
In accordance with a further embodiment, the invention provides fragments of the disclosed polynucleotides, such as polynucleotides of at least 10, preferably 15, more preferably 20 consecutive nucleotides of the disclosed polynucleotide sequences. These fragments are useful as probes and PCR primers or for encoding fragments, functional domains or antigenic determinants of NKIATRE proteins.
In accordance with a further embodiment, the invention provides substantially purified NKIATRE proteins, including the protein of Table 2.
The invention further provides a method for producing antibodies which selectively bind to a NKIATRE protein comprising the steps of administering an immunologically effective amount of a NKIATRE immunogen to an animal;
allowing the animal to produce antibodies to the immunogen; and obtaining the antibodies from the animal or from a cell. culture derived therefrom.
The invention further provides substantially pure antibodies which bind selectively to an antigenic determinant of a NKIATRE
protein. The antibodies of the invention include polyclonal antibodies, monoclonal antibodies and single chain antibodies.
6 The invention includes analogues of the disclosed protein sequences, having conservative amino acid substitutions therein. The invention also includes fragments of the disclosed protein sequences, such as peptides of at least 5, preferably 10, more preferably 20 consecutive amino acids of the disclosed protein sequences.
The invention further provides polypeptides comprising at least one functional domain or at least one antigenic determinant of a NKIATRE protein.
In accordance with a further embodiment, the invention provides a method for preventing or treating diseases associated with an abnormal NKIATRE gene.
The invention further provides a method for identifying acute leukemias associated with loss or mutation of the NKIATRE gene.
In accordance with a further embodiment, the invention provides non-human transgenic animals and methods for the production of non-human transgenic animals which afford models for further study of NKIATRE protein-associated signalling and tools for screening of candidate compounds as therapeutics. For example, knock-out animals, such as mice, may be produced with deletion of a NKIATRE gene.
These animals may be used to screen candidate compounds for effectiveness to reverse t;he phenotype produced.
In accordance with a fur ther embodiment, the invention provides methods for screening candidate compounds to identify those able to modulate signalling through a pathway involving a NKIATRE protein.
The invention further provides screening methods for candidate compounds able to bind to a NKIATRE protein, these being therefore candidates for modifying the activity of a NKIATRE protein. Various suitable screening methods are known to those in the art, including immobilisation of a NKLATRE protein on a substrate and exposure of
The invention further provides polypeptides comprising at least one functional domain or at least one antigenic determinant of a NKIATRE protein.
In accordance with a further embodiment, the invention provides a method for preventing or treating diseases associated with an abnormal NKIATRE gene.
The invention further provides a method for identifying acute leukemias associated with loss or mutation of the NKIATRE gene.
In accordance with a further embodiment, the invention provides non-human transgenic animals and methods for the production of non-human transgenic animals which afford models for further study of NKIATRE protein-associated signalling and tools for screening of candidate compounds as therapeutics. For example, knock-out animals, such as mice, may be produced with deletion of a NKIATRE gene.
These animals may be used to screen candidate compounds for effectiveness to reverse t;he phenotype produced.
In accordance with a fur ther embodiment, the invention provides methods for screening candidate compounds to identify those able to modulate signalling through a pathway involving a NKIATRE protein.
The invention further provides screening methods for candidate compounds able to bind to a NKIATRE protein, these being therefore candidates for modifying the activity of a NKIATRE protein. Various suitable screening methods are known to those in the art, including immobilisation of a NKLATRE protein on a substrate and exposure of
7 the bound NKIATRE protein to candidate compounds, followed by elution of compounds which have bound to the NKIATRE protein.
In accordance with a further embodiment of the invention, the invention provides a method of gene therapy comprising administering an effective amount of a NKIATRE nucleic acid sequence to a cell or organism which has a defective or absent. NKIATRE gene.
Summary of the Drawings Figure lA shows a southern analysis of rat genomic DNA probed with full length NKIATRE. 15 ~g samples of genomic DNA were digested with EcoRI, BamHl or HindIII. Molecular weight is shown in kilobases.
Figure 1B shows a phylogenetic southern analysis. Genomic DNA from rat, pig, mouse, human and Drosophila were digested with EcoRl and analyzed and probed with full length NKIATRE. Cross hybridization is observed most; strongly in mouse, human and Drosophila samples.
Figure 2 shows a northern analysis of rat NKIATRE. Full length cDNA was used to probe poly A RNA samples from various tissues.
Two prominent bands were observed at 4.4 kB and at 2.6 kB suggesting alternatively spliced forms. NKIATRE expression was observed most strongly in brain, muscle and heart.
Figure 3A shows NKIATRE activity in Hela cells exposed to the indicated stimuli (FCS C>/N = incubation with FCS overnight).
Figure 3B shows NKIATRE activity in Hela cells exposed to pcDNA3 vector only (vec), Serum, PMA or EGF at 20. 40 or 60 ng/ml.
Figure 4 shows progression into S phase, expressed as incorporation of BrdU (°roBrdU+), of RAT-1 cells transiently transfected with NKIATRE (MKH), mutant NKIATRE deficient in kinase activity (MKH-KD), dominant negative CDK2 (CDK2-DN), cyclin-dependent kinase inhibitor p21 (p21) or plasmid clone (pcDNA3), arrested by serum starvation and measured at 14 hours after serum replenishment.
Detailed Description of the Invention The inventors have identified a new cdc2-related kinase involved in cell growth and in the control of the cell cycle. The new kinase, designated NKIATRE, has been demonstrated in rats and humans.
The full cDNA sequence and deduced amino acid sequence of rat NKIATRE is provided, as shown in Tables 1, 2 and 3. A partial sequence of human NKLATRE is also provided (Table 4).
The inventors have shown that a high percentage of human acute leukemia patients have both NKIATRE alleles deleted, indicating that the NKIATRE gene is a putative tumour suppressor gene.
In Table 3, the protein kinase consensus residues are shown in bold and the NKIATRE motif and the two sites of potential regulation, the SY duplex and the TDY MAP kinase-like regulatory region, are boxed.
The invention provides a novel, EGF-stimulated protein kinase with sequence similarity to both the MAP kinases and to the cyclin-dependent kinases. Overexpression of NKIATRE leads to growth suppression, suggesting that it may function in E(xF-mediated growth suppressive pathways leading to enhanced p21~~'=~'''' expression.
The kinase NKIA'CRE has sequence similarity to both the MAPKs and the cyclin dependent kinase family of cell cycle regulators.
Similar to the MAPKs, NKIATRE has a potential MAPK activation motif, TDY, followed by the MAPK specific sequence, VATRW. In this regard, it is most similar to the ERK-family of MAPKs which also have an acidic residue separating these two regulatory hydroxy aminoacids.
Unexpectedly, the new kinase also has considerable similarity to the cyclin-dependent kinases, as suggested by the presence of a putative cyclin-binding motif, NK.IATRE, and of potential negative regulatory phosphorylation sites found within the amino-terminal glycine rich ATP-binding domain. Cyclin-dependent kinases have the sequence GEGTYG, with dual phosphorylation on threonine and tyrosine preventing ATP binding and enzymatic inactivation. NKIATRE has a conservative substitution of serine for threonine, suggesting a similar mechanism of regulation. In contrast, the MAPKs do not have phosphorylation sites within this motif, underscoring a divergence from NKIATRE.
Analysis of the sequence of NKIATRE reveals that it contains all twelve of the invariant or nearly invariant residues that are characteristic of the kinase catalytic domain. The 12 residues that are conserved and their positions within NKIATRE are as follows: Glycine 11 and glycine 13 within subdomain I of Hanks (31) (GXGXXGXV
motif), lysine 33 in subdomain II, glutamic acid 50 in subdomain III, aspartic acid 125 and asparagine 130 in subdomain VIB, aspartic acid 143 and glycine 145 in subdomain VII (DFG motif, glutamic acid 170 in subdomain VIII (APE motifj, aspartic acid 183 and glycine 188 in subdomain IX, and arginine 274 in subdomain XI.
In genes al, strong indicators of the specificity of the kinase can be found within two short motifs in subdomain VI and subdomain VIII. In subdomain VI, the consensus DLKPEN predicts serine/threonine specificity, whereas DLRAAN or DLAARN predicts tyrosine specificity.
NKIATRE contains the sequence DIKPEN (residues 125-130), which conforms most closely to the serine/threonine specific kinase consensus sequence. In subdomain VIII, the sequence (xT/SXXY/FX is found to be conserved in serinelthreonine specific kinases, whereas PIIVK/RWT/M
is characteristic of the tyrosine specific kinases. NKIATRE contains the sequence ATRWYR (residues 162-167) which again is most closely related to the serine/threonine specific kinases.
Comparison of NKIATRE with all known protein kinases reveals that it is most homologous to the cdc2-related protein kinases KKIAMRE and KKIALRE (Table 5), Each of these other kinases possesses the MAPK activation motif, TDY, putative cyclin-binding 5 sequence, and sites of potential negative regulatory phosphorylation within their ATP binding motifs. Overall NKIATRE protein has 44%
and 47% identity to KKIALRE and KKIAMRE respectively.
Within the kinase domain, NKIATRE has 60'% identity to KKIAMRE, 50°/> identity to KKIALRE, 33% identity to rat ERK1, 32°/>
10 identity to rat ERK2, 34% identity to mouse p38~3~'~~, and 33°/~
identity to rat SAPKa. Threonine 158 and Tyrosine 161, in subdomain VIII, correspond to the sites of activating phosphorylation for the MAPKs.
Threonine 158 of NKIA7.'RE corresponds to a critical site of activating phosphorylation in the C;DKs while serine 14 and Tyrosine 15 correspond to CDK sites of negative regulation.
KKIALRE and KKIAMRE are not dependent on phosphorylation within the TDY motif for activity, suggesting that regulation of these enzymes is unlike that of the MAPKs. The inventors have shown that a mutant form of NKIATRE, in which the TDY putative activation motif has been mutated to ADF, also retains enzymatic activity, suggesting that its mechanism of regulation is also distinct from the MAPKs.
NKIATRE is expressed strongly in muscle, heart, liver and brain, all tissues which have a very low mitotic index.
To investigate the effects of NKIATRE expression on cell growth, this enzyme was transiently expressed in rat-1 cells. A technique of CD20 expression was used to tag transiently-transfected cells and DNA
synthesis was measured by BrdU incorporation flow cytometrically.
This technique can rapidly identify genes which inhibit DNA synthesis, such as p2lw'~E''' and dominant interfering mutants of CDK2. NKIATRE
overexpression is associated with a marked decreased in DNA
synthesis, suggesting that it is a negative regulator of cell growth.
Mutants of NKIATRE lacking the TDY MAP kinase motif are equally capable of delaying DNA synthesis, suggesting that phosphorylation at these sites is not needed for this action. 'These data indicate that NKIATRE restricts cell growth and may contribute to the maintenance of the low mitotic rate in differentiated tissues in which it is expressed.
Signaling through the epidermal growth factor receptor usually causes ERK activation, often resulting in increased cell growth. It has been shown by the inventors that NKIATRE is both stimulated by EGF
and causes suppression of cell growth, suggesting its participation in signaling pathways which are distinct from ERK-induced mitogenic signaling cascades. NKIATRE overexpression may mimic hyperactivation of the EGF receptor, inducing its growth suppressive effects through p21~'~'' ~. This kinase may be a novel link between the EGF receptor and STAT1 activation.
The human NKIATRE gene has been mapped to chromosome 5q31.1, a chromosome region implicated in human acute leukemia.
More than 60% of human acute leukemia patients examined showed loss of both alleles of the NKIATRE gene, indicating that the NKIATRE
gene is a putative tumour suppressor gene.
Isolated Nucleic Acids In accordance with one series of embodiments, this invention provides an isolated nucleic acid corresponding to the nucleic acid sequence encoding rat NKIATRE protein. Also provided are portions of the NKIATRE sequence useful as probes and PC;R primers or for encoding fragments, functional domains or antigenic determinants of NKIATRE proteins.
One of ordinary skill in the art is now enabled to identify and isolate NKIATRE genes or cDNAs which are allelic variants or homologues of the disclosed NKIATRE sequence, using standard hybridisation screening or PCR techniques.
Depending on the intended use, the invention provides portions of the disclosed nucleic acid sequence comprising about 10 consecutive nucleotides (e.g. for use as PCR primers) to nearly the complete disclosed nucleic acid sequences. The invention provides isolated nucleic acid sequences comprising sequences corresponding to at least 10, preferably 15 and more preferably at least 20 consecutive nucleotides of the NKIATRE gene as disclosed herein.
In addition, the isolated nucleic acids of the invention include any of the above described nucleotide sequences included in a vector.
Substantially Pure Proteins In accordance with a further series of embodiments, this invention provides substantially pure NKIATRE protein, fragments of this protein and fusion proteins including this protein and fragments.
The proteins, fragments and fusion proteins have utility, as described herein, for the preparation of polyclonal and monoclonal antibodies to NKIATRE proteins, for the identification of binding partners of the NKIATRE proteins and for diagnostic and therapeutic methods, as described herein. For these uses, the present invention provides substantially pure proteins, polypeptides or derivatives of polypeptides which comprise portions of the NKIATRE amino acid sequences disclosed or enabled herein and which may vary fiom about 4 to 5 amino acids (e.g. for use as immunogens) to the complete amino acid sequence of the NKIATRE protein. The invention provides substantially pure proteins or polypeptides comprising sequences corresponding to at least 5, preferably at least 10 and more preferably 50 or 100 consecutive amino acids of the NKIATRE proteins disclosed or enabled herein.
Preparation of Proteins NKIATRE proteins, fragments of the proteins and fusion proteins may be isolated and purified by techniques well known to those skilled in the art. The NKIATR,E protein may be purified from tissues (e.g.
heart and muscle) in which there is a high level of expression of the protein or it may be made by recombinant techniques. Isolated proteins, or fragments thereof. can be used for the generation of antibodies, in the identification of proteins which may bind to NKIATRE or for diagnostic or therapeutic methods and assays. Full length proteins and fragments of at least 5 amino acids may be isolated and purified for various applications.
The protein may be isolated from tissue by extraction and solubilised using a detergent.
Purification can be achieved using protein purification procedures such as chromatography methods (gel-filtration, ion-exchange and immunoaffinity), by high-performance liquid chromatography (RP-HPLC, ion-exchange HPLC, size-exclusion HPLC, high-performance chromatofocusing and hydrophobic interaction chromatography) or by precipitation (immunoprecipitation or immunoaffinity SDS-Page and Page). Polyacrylamide gel electrophoresis can also be used to isolate the NKIATRE protein based on its molecular weight, charge properties and hydrophobicity.
Similar procedures may be used to purify the protein obtained from recombinant expression systems.
For protein expression, eukaryotic or prokaryotic expression systems may be generated in which the NKIATRE gene sequence, cDNA or genomic, is introduced into a plasmid or other expression vector which is then introduced into living cells. Constructs in which the NKIATRE cDNA sectuence containing the entire open reading frame or portions thereof is inserted in t;he correct orientation into an expression plasmid may be used for protein expression.
Typical expression vectors contain promoters that direct the synthesis of large amounts of mRNA corresponding to the gene. They may also include sequences allowing for their autonomous replication within the host organism, sequences that encode genetic traits that allow cells containing the vectors to be selected, and sequences that increase the efficiency with which the mRNA is translated. Stable long-term vectors may be maintained as freely replicating entities by using regulatory elements of viruses. Cell lines may also be produced which have integrated the vector into the genomic DNA and in this manner the gene product is produced on a continuous basis.
Expression of foreign sequences in bacteria such as E. coli require the insertion of the sequence into an expr ession vector, usually a plasmid which contains several elements such as sequences encoding a selectable marker that assures maintenance of the vector in the cell, a controllable transcriptional promoter which upon induction can produce large amounts of mRNA from the cloned gene, translational control sequences and a polylinker to simplify insertion of the gene in the correct orientation within the vector. A relatively simple E. coli expression system utilizes the lac promoter and a neighbouring lacZ
gene which is cut out of the expression vector with restriction enzymes and replaced by the NKIATRE gene sequence.
In vitro expression of proteins encoded by cloned DNA is also possible using the T7 late-promoter expression system. Plasmid vectors containing late promoters and the corresponding RNA polymerases from related bacteriophages such as T3, T5 and SP6 may also be used for i.n vitro production of proteins from cloned DNA. E. coli can also be used for expression by infection with M13 Phage mGPI-2. E. coli vectors can also be used with phage lambda regulatory sequences, with fusion protein vectors, with maltase-binding protein fusions, and with glutathione-S-transferase fusion proteins.
Eukaryotic expression systems permit appropriate post-translational modifications of expressed proteins. This allows for 5 studies of the NKIATRE gene and gene product including determination of proper expressian and post-t;ranslational modifications for biological activity, identifying regulatory elements in the 5' region of the gene and their role i:n tissue regulation of protein expression. It also permits the production of large amounts of protein for isolation and 10 purification, the use of cells expressing NKIATRE as a functional assay system for antibodies generated against the protein, the testing the effectiveness of pharmacological agents to increase or decrease the activity of NKIATRE, and the study of the function of the normal complete protein, specific portions of the protein, or of naturally 15 occurring polymorphisms and artificially produced mutated proteins.
In order to produce mutated or polymorphic proteins, the NKIATRE DNA sequen<:e can be altered using procedures such as restriction enzyme digestion, DNA polymerase fill-in, exonuclease deletion, terminal deoxynucleotide transferase extension, hgation of synthetic or cloned DNA. sequences and site-directed sequence alteration using specific oligonucleotides together with PCR.
Alteration of the cDNA will allow for the production of specific mutations within cDNA sequence in order to express the created mutated proteins and study their biological effects.
Once an appropriate expression vector containing the NKIATRE
gene is constructed, it is introduced into eukaryotic cells by techniques that include calcium phosphate transfection, DEAE-dextran transfection, electroporation, microinjection, protoplast fusion and hposome-mediated transfection.
The host cell to be transfected with the vector of this invention may be selected from the group consisting of E.coli,, Pseudomorras, Bacillus Subtilis, or other bacilli, other bacteria, yeast, fungi, insect (using baculoviral vectors for expression), mouse or other animal or human tissue cells. Marnmahan cells can also be used to express the NKIATRE protein using a vaccinia virus expression system.
In order to express and purify the protein as a fusion protein, the NKIATRE cDNA sequence is inserted into a vector which contains a nucleotide sequence encoding another peptide (eg. GST - glutathionine succinyl transferase). The fusion protein is expressed and recovered from prokaryotic (eg. bac;terial or baculovirus) or eukaryotic cells. The fusion protein can then be purified by affinity chromatography based upon the fusion vector sequence and the NKIATRE protein obtained by enzymatic cleavage of the fusion protein.
Purified protein can also be used in further biochemical analyses to establish secondary and tertiary structure. The preparation of substantially purified NKIATRE protein or fragments thereof allows for the determination of the protein tertiary structure by x-ray crystallography of crystals of NKIATRE protein or by NMR.
Determination of structure may aid in the design of pharmaceuticals which interact with the protein, alter protein charge configuration or charge interaction with other proteins, or to alter its function in the cell.
Antibodies The knowledge of the amino acid and nucleotide sequence of the NKIATRE protein allows for the production of antibodies which selectively bind the NKLATRE protein or fragments thereof. The term antibodies includes polyclonal antibodies, monoclonal antibodies, single chain antibodies and fragments thereof such as Fab fragments.
In order to prepare polyclonal antibodies, fusion proteins containing defined portions or all of the NKIATRE protein can be synthesized in bacteria by expression of corresponding DNA sequences in a suitable cloning vehicle. Fusion proteins are commonly used as a ~ source of antigen for producing antibodies. Alternatively protein may be isolated and purified .from NKIATRE expressing cultures and used as a source of antigen. It is understood that the entire protein or fragments thereof can be used as a source of antigen to produce antibodies.
The purified NKIATRE protein is purified, coupled to a carrier protein and mixed with Freund's adjuvant (to help stimulate the antigenic response by the animal) and injected into rabbits or other appropriate labor atory animals. Following booster injections at weekly intervals, the rabbits or other laboratory animals are then bled and the sera isolated. The sera can be used directly or purified prior to use by various methods including affinity chromatography employing Protein A-Sepharose, Antigen Sepharose or Anti-mouse-Ig-Sepharose, to give polyclonal antibodies.
Alternatively, synthetic peptides can be made corresponding to the antigenic portions of the protein, and used to inoculate the animals.
The most common practice is to choose a 10 to 15 amino acid residue peptide corresponding to the carboxyl or amino terminal sequence of a protein antigen, and to chemically cross-link it to a carrier molecule such as keyhole limpet hemocyanin or BSA. However, if an internal sequence peptide is desired, selection of the peptide is based on the use of algorithms that predict potential antigenic sites. These predictive methods are, in turn, based on predictions of hydrophilicity (Kyte and Doolittle 1982, Hopp and Woods 1983) or secondary structure (Chou and Fasman 1978). The objective is to choose a region of the protein that is either surface exposed, such as a hydrophilic region, or is conformationally flexible relative to the rest of the structure, such as a loop region or a region predicted t;o form a ~3-turn. The selection process is also limited by constraints imposed by the chemistry of the coupling procedures used to attach peptide to carrier protein. Carboxyl-terminal peptides are frequently chosen because these are often more mobile than the rest of the molecule and the peptide can be coupled to a carrier in a straightforward manner using glutaraldehyde. The amino-terminal peptide has the disadvantage that it may be modified post-translationally by acetylation or by the removal of a leader sequence. A
comparison of the protein amino acid sequence between species can yield important information. Those regions with sequence differences between species are likely to be immunogenic. Synthetic peptides can also be synthesized as immunogens as long as they mimic the native antigen as closely as possible.
As will be understood by those skilled in the art, monoclonal NKIATRE antibodies may also be produced. NKIATRE protein isolated from tissues, or from cells recombinantly expressing the protein, is injected in Freund's adjuvant into mice. Mice are injected 9 times over a three week period, after which their spleens are removed and resuspended in phosphate buffered saline (PBS). The spleen cells serve as a source of lymphocytes, some of which are producing antibody of a selected specificity. These are then fused with a permanently growing myeloma partner cell, and the products of the fusion are plated into a number of tissue culture wells in the presence of a selective agent such as HAT. The wells are then screened by ELISA to identify those containing cells making binding antibody. These are then plated and after a period of growth, these wells are again screened to identify antibody-producing cells. Several cloning procedures are carried out until over 90'%~ of the wells contain single clones which are positive for production of the desired antibody. From this procedure, a stable line of clones which produce the antibody is established. The monoclonal antibody can then be purified by affinity chromatography using Protein A Sepharose, ion-exchange chromatography, as well as variations and combinations of these techniques. Truncated versions of monoclonal antibodies may also be produced by recombinant techniques in which plasmids are generated which express the desired monoclonal antibody fragment in a suitable host.
Antibodies are useful in various immunoassays for detecting and quantitating relative amounts of wild type and mutant protein.
Enzyme-linked immunosorbant assays (ELISA) may be used to detect both wild type and mutant NKIATRE as well as antibodies generated against these proteins. Commonly used ELISA systems are indirect ELISA to detect specific antibodies, direct competitive ELISA to detect soluble antigens, antibody-sandwich ELISA to detect soluble antigens and double antibody-sandwich ELISA to detect specific antibodies.
For a review of methods for preparation of antibodies, see Antibody Engin.eerireg: A Practical Guide, Barreback, ed., W.H.
Freeman & Company, NY (1992) or Antibody Ertgirceerarcg, 2nd Ed., Barreback, ed., Oxford University Press, Oxford (1995).
Diagnostic Methods The NKIATRE gene and gene product, as well as the NKIATRE-derived probes, primers and antibodies, disclosed or otherwise enabled herein, are useful for screening for carriers of deletions associated with acute leukemia, and for the diagnosis of acute leukemia associated with loss or mutation of the NKIATRE gene. Individuals at risk for developing acute leukemia, for example those with acute leukemia present in the family pedigree, or individuals not previously known to be at risk, may be routinely screened using probes to detect the presence of a relevant deletion in the NKIATRE gene by a variety of techniques.
Diagnostic methods are provided based upon the nucleic acids (including genomic and mRNA/cDNA sequences), proteins, and/or 5 antibodies disclosed and enabled herein, including functional assays designed to detect failure or augmentation of the normal NKIATRE
activity. Preferably, the methods and products are based upon the human NKIATRE nucleic acids, protein or antibodies. The significant evolutionary conservation of large portions of the NKIATRE nucleotide 10 and amino acid sequence, even in species as diverse as humans and rats, allows the skilled artisan to make use of such non-human NKIATRE-homologue nucleic acids, proteins and antibodies, even for applications directed toward human or other animal subjects.
As will be appreciated by one of ordinary skill in the art, the 15 choice of diagnostic methods of the present invention will be influenced by the nature of the available biological samples to be tested and the nature of the information required.
Protein Based Screens and Dia~~nostics 20 When a diagnostic; assay is to be based upon the NKIATRE
protein, a variety of approaches are possible. For example, diagnosis can be achieved by monitoring differences in the electrophoretic mobility of normal and mutant proteins. Such an approach will be particularly useful in identifying mutants in which charge substitutions are present, or in which insertions, deletions or substitutions have resulted in a significant change in the electrophoretic migration of the resultant protein. Alternatively, diagnosis may be based upon differences in the proteolytic cleavage patterns of normal and mutant proteins, differences in molar ratios of the various amino acid residues, or by functional assays demonstrating altered function of the gene products.
In preferred embodiments, protein-based diagnostics will employ differences in the ability of antibodies to bind to normal and mutant NKIATRE proteins. Such diagnostic tests may employ antibodies which bind to the normal proteins but not to mutant proteins, or vice versa. In particular, an assay in which a plurality of monoclonal antibodies are used, each capable of binding to a mutant epitope, may be employed. The levels of anti-mutant antibody binding in a sample obtained from a test subject (visualized by, for example, radiolabelling, ELISA or chemiluminescence) may be compared to the levels of binding to a control sample. Alternatively, antibodies which bind to normal but not mutant NKIATRE may be employed, and decreases in the level of antibody binding may be used to distinguish homozygous normal individuals from mutant, heterozygotes or homozygotes. Such antibody diagnostics may be used for in situ immunohistochemistry using biopsy samples of tissues obtained antemortem or postmortem.
Nucleic Acid Based Screens and Diagnostics When the diagnostic assay is to be based upon nucleic acids from a sample, the assay may be based upon mRNA, cDNA or genomic DNA.
Whether mRNA, cDNA or genomic DNA is assayed, standard methods well known in the art may be used to detect the presence of a particular sequence either in situ or in vitro (see, e.g., Sambrook et al., (1989) Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Press, Cold Spring Harbor, NIA. As a general matter, however, any tissue with nucleated cells may be examined.
Genomic DNA used for the diagnosis may be obtained from body cells, such as those present in the blood, tissue biopsy, surgical specimen, or autopsy material. The DNA may be isolated and used directly for detection of a specific sequence or may be amplified by the polymerase chain reaction (PCR) prior to analysis. Similarly, RNA or cDNA may also be used, with or without PCR amplification. To detect a specific nucleic acid sequence, direct nucleotide sequencing, hybridization using specific oligonucleotides, restriction enzyme digest and mapping, PCR mapping, RNase protection, chemical mismatch cleavage, ligase-mediated detection, and various other methods may be employed. Oligonucleotides specific to particular sequences can be chemically synthesized and labeled radioactively or nonradioactively (e.g., biotin tags, ethidium bromide), and hybridised to individual samples immobilized on membranes or other solid-supports (e.g., by dot-blot or transfer from gels after electrophoresis), or in solution. The presence or absence of the target sequences may then be visualized using methods such as autoradiography, fluorometry, or colorimetry.
These procedures can be automated using redundant, short oligonucleotides of known sequence fixed in high density to silicon chips.
Whether for hybridisation, RNase protection, ligase-mediated detection, PCR amplification or any other standards methods described herein and well known in the art, a variety of subsequences of the NKIATRE sequences disclosed or otherwise enabled herein will be useful as probes and/or primers. In general, useful sequences will include at least 8-9, more preferably 10-50, and most preferably 18-24 consecutive nucleotides from the NKIATRE introns, exons or intron/exon boundaries. Depending upon the target sequence, the specificity required, and future technological developments, shorter sequences may also have utility. Therefore, any NKIATRE derived sequence which is employed to isolate, clone, amplify, identify or otherwise manipulate a NKIATRE sequence may be regarded as an appropriate probe or primer.
Methods of Treatment Therapies may be designed to circumvent or overcome a NKIATRE gene defect or inadequate NKIATRE gene expression, and thus moderate and possibly prevent malignancy.
Protein Therapy Treatment or prevention of acute leukemia can be accomplished by replacing a mutant or absent NKIATRE protein with normal protein, by modulating the function of a mutant protein, or by delivering normal NKIATRE protein to the appropriate cells. Once the biological pathway involving the NKIATRE protein has been completely elucidated and understood, it may also be possible to modify the pathophysiologic pathway in which the protein participates in order to correct the physiological defect.
To replace a mutant protein with normal protein, or to add protein to cells which no longer express normal NKIATRE, it is necessary to obtain large amounts of pure NKIATRE protein from cultured cell systems which can express the protein. Delivery of the protein to the affected cells and tissues can then be accomplished using appropriate packaging or administration systems. The NKIATRE can be provided in the form of a stable composition for oral or parental administration, the latter route including intravenous and subcutaneous administration. The composition containing the NKIATRE protein of the present invention can also be administered in an solution or emulsion contained within phospholipid vesicles called liposomes. The liposomes may be unilamellar or multilamellar and are formed of constituents selected from phosphatidylcholine, dipalmitoylphosphatidylcholine, cholesterol, phosphatidylethanolamine, phosphatidylserine, demyristoylphosphatidylcholine and combinations 24:
thereof. The multilamellar liposomes comprise multilamellar vesicles of similar composition to unilamellar vesicles, but are prepared so as to result in a plurality of compartments in which the NKIATRE protein-containing solution or emulsion is entrapped. Additionally, other adjuvants and modifiers may be included in the liposomal formulation such as polyethyleneglyc;ol, or other materials. The liposomes containing the NKIATRE protein or peptide composition may also have modifications such as having antibodies immobilized onto the surface of the liposome in order to target their delivery.
In one embodiment of the present invention, a pharmaceutical composition for administration to subjects in a biologically compatible form suitable for administration in vavo for treating malignancies characterized by abnormal NKIATRE function comprises a safe and effective amount of NKIATRE protein alone, or in combination with other agents and pharmaceutical carriers. Accordingly, the composition may vary to include not only NKIATRE protein or peptides, but as well a vector containing an appropriate NKIATRE sequence. The composition may be administered to any living organism including humans and animals. By safe and effective as used herein is meant providing sufficient potency in order to decrease, prevent, ameliorate or treat a malignancy affecting a subject while avoiding serious side effects. A safe and effective amount will vary depending on the age of the subject, the physical condition of the subject being treated, the severity of the proliferative disorder, the duration of treatment and the nature of any concurrent therapy.
Administration of a therapeutically active amount of the pharmaceutical composition of the present invention is defined as an amount effective, at dosages and for periods of time necessary to achieve the desired result. This may also vary according to factors such as the disease state, age, sex, and weight of the subject, and the ability of the NKIATRE to elicit; a desired response in the subject. Dosage regima may be adjusted to provide the optimum therapeutic response.
For example, several divided doses may be administered daily or the dose may be proportionally reduced as indicated by the exigencies of the 5 therapeutic situation.
By pharmaceutically acceptable carrier as used herein is meant one or more compatible solid or liquid delivery systems. Some examples of pharmaceutically acceptable carriers are sugars, starches, cellulose and its derivatives, powdered tragacanth, malt, gelatin, collagen, talc, 10 stearic acids, magnesium stearate, calcium sulfate, vegetable oils, polyols, agar, alginic acids, pyrogen-free water, isotonic saline, phosphate buffer, and other suitable non-toxic substances used in pharmaceutical formulations. Other excipients such as wetting agents and lubricants, tableting agents, stabilizers, anti-oxidants and 15 preservatives are also contemplated.
The compositions described herein can be prepared by known methods for the preparation of pharmaceutically acceptable compositions which can be administered to subjects, such that an effective quantity of the active substance is combined in a mixture with 20 a pharmaceutically acceptable carrier. Suitable carriers are described for example in Remington's Pharmaceutical Sciences (Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, Pa., USA
1985). On this basis the compositions include, albeit not exclusively, solutions of the substanc:e in association with one or more 25 pharmaceutically acceptable vehicles or diluents, and contained in buffered solutions with a suitable pH and iso-osmotic with the physiological fluids.
Alternatively, small molecule analogs may be used and administered to act as NKIATRE agonises or antagonists and in this manner produce a desired physiological effect. In order to screen for analogues, one can design functional screens based on the sequence of NKIATRE. One can also fuse NKIATRE to heterologous DNA binding proteins to design screens for agonists. Yeast screens can be used for small molecules that may interact by promoting or disrupting NKIATRE binding with other proteins.
NKIATRE expressed as a fusion p~wotein can be utilized to identify small peptides that bind to NKIATRE. In one approach, termed phage display, random peptides (up to 20 amino acids long) are expressed with coat proteins (geneIII or geneVIII) of filamentous phage such that they are expressed on the surface of the phage thus generating a library of phage that express random sequences. A library of these random sequences is then selected by incubating the library with the NKIATRE protein or fragments thereof and phage that bind to the protein are then eluted either by cleavage of NKIATRE from the support matrix or by elution using an exc;ess concentration of soluble NKIATRE protein or fragments. The eluted phage are then repropagated and the selection repeated many times to enrich for higher affinity interactions. The random peptides can either by completely random or constrained at certain positions through the introduction of specific residues. After several rounds of selection, the final positive phage are sequenced to determine the sequence of the peptide.
An alternate but related approach uses the y east two hybrid system to identify binding partners for NKIATRE. NKIATRE or fragments are expressed in yeast as a fusion to a DNA binding domain.
This fusion protein is capable of binding to target promoter elements in genes that have been engineered into the yeast. These promoters drive expression of specific reporter genes (typically the auxotrophic marker HISS and the enzyme bgalactosidase). A library of cDNAs can then be constructed from any tissue or cell line and fused to a transcriptional activation domain. Transcription of HISS and b-galactosidase depends on association of the NKIATRE fusion protein (which contains the DNA
binding domain) and the target protein (which carries the activation domain). Yeast survival on specific growth media lacking histidine requires this interaction. This approach allows for the identification of specific proteins that interact with NKIATRE. The approach has also been adapted to identify small peptides. NKIATRE, or its fragments, are fused with the DNA binding domain and are screened with a library of random peptides or peptides which are constrained at specific positions linked to a transcriptional activation domain. Inter action is detected by growth of the inter acting peptides on media lacking histidine and by detection of b-galactosidase activity using standard techniques.
The identification of proteins or small peptides that interact with NKIATRE can provide the basis for the design of small peptide antagonists or agonists of NKIATRE function. Further, the structure of these peptides determined by standard techniques such as protein NMR
or X-ray crystallography can provide the structural basis for the design of small molecule drugs.
Gene Therapy Gene then apy is another potential therapeutic approach in which normal copies of the NK:fATRE gene are introduced into selected tissues to successfully code for normal protein in affected cell types. The gene must be delivered to affected cells in a form in which it can be taken up and can code for sufficient protein to provide effective function.
Transducing retroviral vectors can be used for somatic cell gene therapy especially because of their high efficiency of infection and stable integration and expression. The targeted cells must be able to divide and the expression level of normal protein should be high. The full length NKIATRE gene, or portions thereof, can be cloned into a retroviral vector and driven from its endogenous promoter or from the retroviral long terminal repeat or from a promoter specific for the target cell type of interest. Other viral vectors which can be used include adeno-associated virus, vaccinia virus, bovine papilloma virus, or a herpes virus such as Epstein-Barr virus.
Gene transfer could also be achieved using non-viral methods of infection in Uatro. These methods would include calcium phosphate, DEAE dextran, electroporation, and protoplast fusion. Liposomes may also be potentially beneficial for delivery of DNA into a cell. DNA itself may be taken up by cells directly.
Antisense-based strategies can be employed to explore NKIATRE
gene function and as a basis for therapeutic drug design. The principle is based on the hypothesis that sequence-specific suppression of gene expression can be achieved by intracellular hybridization between mRNA and a complementary antisense species. The formation of a hybrid RNA duplex may then interfere with the processing/transportltranslation and/or stability of the target NKIATRE
mRNA. Antisense strategies may use a variety of approaches including the use of antisense oligonucleotides, injection of antisense RNA and transfection of antisense RNA expr ession vectors.
Transplantation of normal genes into the affected cells of a patient with a malignancy can also be useful therapy. In this procedure, normal NKIATRE is transferred into a cultivatable cell type, either exogenously or endogenously t,o a patient. These cells are then injected into the targeted tissue.
Animal Models The present invention also provides for the production of transgenic non-human animal models for the study of the NKIATRE
tumor suppressor gene function, to study the mechanisms of carcinogenesis as related to the NKIATRE gene, for the screening of candidate pharmaceutical compounds, for the creation of explanted mammalian cell cultures which express the protein or mutant protein or in which the NKIATRE gene has been inactivated by knock-out deletion, and for the evaluation of potential therapeutic interventions.
The creation of an animal model for acute leukemia and other related cancers is important to the understanding of the NKIATRE
gene function in the cancer and for the testing of possible therapies.
Animal species which are suitable for use in the animal models of the present, invention include, but are not limited to, rats, mice, hamsters, guinea pigs, rabbits, dogs, cats, goats, sheep, pigs, and non-human primates such as monkeys and chimpanzees. For initial studies, transgenic mice and rats are highly desirable due to their relative ease of maintenance and shorter life spans. For certain studies, transgenic yeast or invertebrates m.ay be suitable and preferred because they allow for rapid screening and provide for much easier handling. For longer term studies, non-human primates may be desired due to their similarity with humans.
There are several ways in which to create an animal model for NKIATRE-related malignancy . Generation of a specific mutation in a homologous animal gene is one strategy. Secondly, a wild type human gene andlor a humanized animal gene could be inserted by homologous recombination. Thirdly, it is also possible to insert a mutant (single or multiple) human gene as genomic or minigene cDNA construct using wild type or mutant or artificial promoter elements. Fourthly, knock-out of the endogenous homologous animal genes may be accomplished by the insertion of artificially modified fragments of the endogenous gene by homologous recombination. The modifications include insertion of mutant stop codons, the deletion of DNA sequences, or the inclusion of recombination elements (lox p sites) recognized by enzymes such as Cre recombinase.
If it is desired to inactivate or replace the endogenous NKIATRE
gene, homologous recombination using embryonic stem cells may be 5 applied.
For oocyte injection, one or more copies of the mutant or wild type NKIATRE gene can be inserted into the pronucleus of a just-fertilized mouse oocyte. This oocyte is then reimplanted into a pseudo-pregnant foster mother. The liveborn mice can then be screened for integrants 10 using analysis of tail DNA for the presence of the NKIATRE gene sequences. The transgene can be either ~~ complete genomic sequence injected as a YAC, BAC, PAC or other chromosome DNA fragment, a cDNA with either the natural promoter or a heterologous promoter, or a minigene containing all of the coding region and other elements found 15 to be necessary for optimum expression.
Retroviral infection of early embryos can also be done to insert the mutant or wild type NKIATRE. In this method, the mutant or wild type NKIATRE is inserted into a retroviral vector which is used to directly infect mouse embryos during the early stages of development to 20 generate a chimera, some of which will lead to germline transmission.
Similar experiments can be conducted in the case of mutant proteins, using mutant murine or other animal NKIATRE gene sequences.
Homologous recombination using stem cells allows for the screening of gene transfer cells to identify the rare homologous 2~ recombination events. Once identified, these can be used to generate chimeras by injection of mouse blastocyst;s, and a proportion of the resulting mice will show germline transmission from the recombinant line. This methodology is especially useful if inactivation of the NKIATRE gene is desired. For example, inactivation of the NKIATRE
30 gene can be done by designing a DNA fragment which contains sequences from a NKIATRE exon flanking a selectable marker.
Homologous recombination leads to the insertion of the marker sequences in the middle of an exon, inactivating the NKIATRE gene.
DNA analysis of individual clones can then be used to recognize the homologous recombination events.
It is also possible to create mutations in the mouse germline by injecting oligonucleotides containing the mutation of interest and screening the resulting cells by PCR.
In general, techniques of generating transgenic animals are widely accepted and practiced. A laboratory manual on the manipulation of the mouse embryo, for example, is available detailing standard laboratory techniques for the production of transgenic mice (Hogan et al.. 1986).
This embodiment of the invention has t:he most significant potential as a model for acute leukemia and related malignancies in which the function of the NKIATRE gene could be studied as well as the effects of new therapeutic treatments and the design of new drug therapies. Animal models are also valuable in order to study the time frame in which an introduced mutation in the NKIATRE gene causes a malignancy.
Dru~Screenin~
Cell lines may be cultured which express NKIATRE, to which a test compound is added to the culture medium. After a period of incubation, the expression of NKIATRE mRNA and resultant protein product can be quantified to determine any changes in expression as a result of the test compound. Cell lines transfected with constructs expressing mutant or normal NKIATRE can also be used to test the function of compounds developed to modify with the protein function.
Transformed cell lines expressing NKIATRE protein could be mutagenized by the use of mutagenizing agents to produce a malignant phenotype in which the :role of mutated NKIATRE can be studied.
With respect to normal NKIATRE, the effect of protein drugs or agents which interact with the protein's normal function could be studied in order to more precisely define the intracellular role of the protein.
EXAMPLES
The examples are described for the purposes of illustration and are not intended to limit the scope of the invention, Example 1 - Cloning and Sequencing of NKIATRE
Methods:
A degenerate anti-sense oligonucleotide corresponding to the conserved MAPK consensus sequence YV'(AI~TRW, found in subdomain VIII, was synthesized as follows:
CC(AII)CC(G/T)(G/A)GT(G/A)C(C/T/A)A(;(G/A)TA. This oligonucleotide and the Ml3/pLIC forwa:rd amplification primer (Gibco BRL, Gaithersburg MD, USA), were used to amplify DNA isolated from a rat brain library, constructed in ~, ZAPII (Clontech) as previously described (22). PCR was performed in a 50 pl reaction consisting of 10 pmol of degenerate primer, 20 pmol Ml3/pUC Forward amplification primer, 2 mM MgCla, 0.2 mM dNTP, 50 mM KC1. 10 mM Tris-HCl (pH 9.0), 0.1%
Triton X-100, and 0.1 U/~l Taq DNA polymerase (Promega, Madison WI, USA). Before the addition of Taq DNA polymerase each reaction was heated to 94"C for 3 minutes. For 30 cycles the reaction mixtures were denatured at 94°C for 1 minute, allowed to anneal at 5 i°C
for 1 minutes and 30 second, and extended at 72°C for 2 minutes. After all cycles were complete 4 Ll of DNA polymerase I Klenow fragment (Amersham, Amersham UK) were added to create blunt termimi by incubation at, 3 r "C for 30 minutes. A 0. 5 kb product was purified from an agarose gel using the Geneclean II kit (Bio 101, La Jolla CA, USA) and cloned into the Smal site of the pUC 18 plasmid using standard methodology.
DNA sequencing was performed using an AmpliCycle Sequencing Kit (Perkin Elmer, Branchburg NJ, USA). Amplification of the 5' end of cDNA was accomplished with the 5' RACE System (Gibco BRL, Gaithersburg MD, USA).
cDNA library screening was performed as previously described (23). In brief, 5x10' pfu of a rat jejunum ~, zap II cDNA library (Stratagene, La Jolla CA, USA) or of the rat brain cDNA library used for amplification were incubated with XL-1 blue bacteria and plated on each of 10, 150 mm, YT agar plates. The phage DNA from the lysed bacteria cells was transferred to duplicate Hybond-N nylon membranes (Amersham, Amersham UK). After transfer, the filters were denatured for 2 minutes in a solution of 1.5 M NaCl and 0.5 M NaOH, and neutralized for 5 minutes in a solution of 1.5 M NaCl and 0.5 M Tris-HC1 (pH 8). The filters were then briefly rinsed in 2x SSC and allowed to dry at room temperature. DNA was UV crosslinked to the filters using a UV Str atalinker (Stratagene, La Jolla CA, U SA). For screening, the filters were pre-hybridized for two hours at 42°C in a solution of 50°/« formamide, 5x SSC, 5x Denhardt's reagent, 20 mM
Na2P0~, and 0.2 mg/ml salmon sperm DNA. Hybridization was performed overnight at 42°C in a solution of 50'~~> formamide, 5x SSC, 5x Denhardt's reagent, 20 rnM NazPOa, 10°/~ dextran sulphate, 0.2 mg/ml salmon sperm DNA, and. 1x10~~ cpm/ml of probe. To prepare the probe, 25 ng of the PCR product was radiolabelled with 50 ~Ci of [a-3''P]dCTP
using the Multiprime DNA labeling system (Amersham, Amersham UK). Following hybridization, the filters were washed at 55°C in O. lx SSC and 0.1% SDS. Filters were exposed to film overnight at -70°C
with an intensifying screen. Purification of the hybridizing plaques was performed by secondary, tertiary, and quaternary screens, as described above. Excision of the cDNA inserts from the purified phage followed the manufacturer's 7~ZAP II automatic excision protocol (Stratagene, La Jolla CA, USA).
"Anchored PCR" was performed using the degenerate anti-sense oligonucleotide described above and the pUCl8 Universal Forward primer on ~,ZAPII rat brain library target DNA. Products of approximately 500 by were consistently amplified, and were batch cloned into pLTC 18. Sequence analysis of 44 of these products led to the discovery of a single novel putative MAP kinase.
A rat jejunum cDNA library and a rat brain cDNA library were screened with the PCR product to isolate the complete cDNA. Three clones were isolated from the jejunum library which upon sequence analysis were shown to be identical. From the brain library two additional positive phage were isolated, each representing independent clones. Criteria for a full length cDNA included the presence of a Kozak consensus translation initiation sequence of GCCCCC(A/G)CCAUGG
and the presence of an upstream stop codon in the same reading frame as the initiation codon (29). Sequencing of all clones demonstrated that none were complete by these criteria. To determine 5' sequence, "RACE" was performed on rat brain poly(A)+RNA (30) using the sequence specific anti-sense oligonucleotide CAGGCTTTATATCTCCiGTG(~ and a standard poly T anchoring oligonucleotide. A second round of amplification was performed using a nested anti-sense oligonucleotide, GGACTAGTCTTAATGC~CCACTATCCGC to ensure specificity.
Sequence analysis of the amplified products identified a putative initiation methionine with an in-frame upstream si;op codon and an adjacent Kozak consensus sequence, with seven of the thirteen nucleotides conserved at this site, including a purine at position -3 and a guanine at position +4. The complete rat NKIATRE cDNA was sequenced using 12 internal ohgonucleotides.
The cDNA sequence and deduced amino acid sequence of rat 5 NKIATRE are shown in Tables 1, 2 and 3. In Table 3, protein kinase consensus residues are shown in bold face type. The NKIATRE motif and two sites of potential regulation, the SY duplex, and the TDY MAP
kinase-like regulatory region, are boxed.
The cloned rat NKI:ATRE cDNA described above was used to screen 10 a human 7~gt 11 fetal heart genomic library. A human NKIATRE genomic DNA was cloned and the cDNA and amino acid sequence obtained is shown in Table 4. The sequence shown corresponds to nucleotides 424 to 618 and amino acids 121 to 185 of the rat sequences of Table 1 and 2.
15 Example 2 Methods:
Southern and Northern Blot analysis: Total cellular RNA was prepared using the TRIzol Reagent (Gibco BRL, Gaithersburg MD, USA) and from this poly(A)+RNA was prepared using Oligo (dT) 20 cellulose (Boehringer Mannheim Biochemica, Laval PQ, Canada) as follows. 1 g of Ohgo (dT) cellulose was suspended in 20 ml of loading buffer (400 mM NaCl, 20 mM Tris pH 7.4, 10 mM EDTA, 0.2'% SDS) and mixed for 20 minutes at room temperature. Oligo (dT) cellulose was added to each sample of total RNA and each mixture was gently 25 rotated at room temperature overnight. All samples were then spun for 5 minutes at 2000 rpm, washed 2-3 times with 20 ml of loading buffer, and then 2-3 times with 20 ml of wash buffer (100 mM NaCl, 10 mM
Tris pH 7.4, 1 mM EDTA, 0.2°/~ SDS). Cellulose samples were then resuspended in 10 ml of wash buffer and poured into columns (Bio Rad, 30 Hercules California, USA). Columns were packed with 10 ml of wash buffer and then poly(A)+RNA was eluted with five 1 ml volumes of elution buffer pre-warmed to 37°C (1 mM Tris pH 7.4, 1 mM EDTA, 0.2% SDS). Polv(A)+RNA was precipitated overnight at -20°C by the addition of 30 ~g tRNA, 0.6 ml 3 M sodium acetate, and 12 ml 99%
ethanol. Pellets were air dried and resuspended in DEPC-treated water. Ten ~ g of poly(A)+RNA from rat intestine, brain, muscle, lung, spleen, heart, liver, and thymus were used to generate a rat tissue blot.
RNA was fractionated overnight by electrophoresis on a 1.2'%~
formaldehyde agarose gel with buffer recirculation. The gel was then washed thoroughly in DEPC treated water and the RNA was transferred to nylon membrane by capillary transfer. The blot was probed with the 1.3 kb EcoRl fragment of NKIATRE cDNA, radiolabelled with [a-vzP] dCTP, as described above. To control for the level of RNA in each lane, a rat ~i-actin probe was also used.
Southern blot analysis: 10 ~g of rat genomic DNA was digested overnight at 37'~C with either EcoRl, BamHl or HindIII. For the cross species Southern blot, 10 ~,g of either rat, pig, mouse, human or Drosophila genomic DNA was digested overnight at 37°C with EcoRl.
Each of these digests were fractionated overnight by electrophoresis on a 1.0% agarose gel. Following electrophoresis, the geI was incubated with shaking for 15 min at room temperature in 0.1 M HCl, followed by min in a solution of 0.5 M NaOH, 1.5 M NaCI, and then for 45 min in a solution of 1 M Tris pH 7.0, 1.5 M NaCl. The genomic DNA was transferred to nylon membrane by capillary transfer. For all blots, the 1.3 kb EcoRl fragment (nucleotides 1-1372) of the rat jejunum cDNA
25 was radiolabelled with [cx-~32P]dCTP, as described above, and used as a probe. Prehybridization, hybridization, and wash conditions were performed as pr eviously described for the hbr ary screens (section 3.2.1).
Filters were visualized by Phosphor Imager (Molecular Dynamics) using the Image (auant software (Molecular Dynamicsj.
Phylogenetic conservation.
The EcoRl-EcoRl 1.3 kb fragment of the rat NKIATRE cDNA
clone was used to screen rat genomic DNA digested with three separate restriction endonucleases. Results of Southern blotting revealed that three bands hybridized t;o EcoRl digested DNA with approximate sizes of 7.5 kb, 5.6 kb, and 4.7 kb. Two bands of approximately 5.4 kb and 4.0 kb hybridized in BamHl digests, while two bands of 9.4 kb, and 4.7 kb were seen in HindIII digested DNA (figure 4A). Results of cross species Southern blot analysis demonstrates that rat NKIATRE hybridizes to EcoRl digested genomic DNA from rat, pig, mouse, human, and drosophila (figure 4B). No hybridizing bands were seen in EcoRl digested DNA from either, Dactyosteliuna (data not shown) or S.
cereuasaae (data not shown).
Tissue distribution of NKIATRE.
To determine the tissue distribution of NKIATRE, a Northern blot of poly(A)+mRNA from rat intestine, brain, muscle, lung, spleen, heart, liver, and thymus was probed with the 1.3 kb EcoRl fragment of NKIATRE cDNA. Northern blotting revealed bands of 4.4 kb, 2.5 kb or 2.2 kb in brain, muscle, lung, intestine and heart (figure 5). No expression of NKIATRE was seen in rat spleen, liver, or thymus (not shown). Quality of poly(A)+mRNA was determined by probing for rat ~3-actin.
Examt~le 3 - Stimulation. by EGF
Cell culture and transfectaon: NIH 3T3 and HeLa cells were maintained in Alpha medium (Gibco BRIO containing 10'% Cool Calf serum (Gibco BRL). Semiconfluent cells grown on 10 cm plastic dishes (Nunc) were tr ansfected with 10~g of individual expression constructs using Lipfectin (Gibco BRL) as described (25). To achieve high level expression, HeI,a cells w-ere infected with recombinant human vaccinia virus, directing the expression of T7 RNA polymerase (26) one hour prior to the introduction of T7 polymerase-driven expression plasmids.
Transfected NIH 3T3 cells were selected in culture with 150 ~.g/ml 6418 (Sigma).
Immunoprecipatation: Cells (1 x 1()s) were lysed on ice for 1 hour in 500 X10.1% NP40> 125 mM NaCl, 25 mM Tris, pH 7.2 with the protease inhibitors leupeptin 1 ~.g/ml, aprotinin 1 ~g/ml and 1 mM
phenylmethylsulfonyl fluoride, followed by centrifugation. Phosphatase activity was inhibited by 5 mM sodium orthovanadate and 50 mM
dibasic sodium pyrophosphate (Sigma). I~ysates were incubated on ice with 5 ~1 PY20 antibody for 2 hours followed by incubation with 50 ~1 of Sepharose protein A beads (Pharmacia) at 4°C with agitation.
Precipitates were washed 4 times with 1 ml of ice cold lysis buffer.
Kanase Assay: In vitro kinase reactions were performed using immunoprecipitated bead immobilized HA fusion proteins and myelin basic protein (Sigma) as a substrate. Each reaction was performed in a final volume of 50 ~.l containing 25 ~l of 2X kinase buffer (100~M
[3zP]ATP, lOmM MgCl, 50 mM Tris HCl-pH 7.5, 1mM EDTA), 5 ~1 of myelin basic protein (1 ~.g/ml) or cJun (1 u.glml) dissolved in distilled water and 20 ~,l of immobilized kinase slury. Samples were incubated at 37° for 30 minutes. Reactions were terminated by the addition of 50 ~,1 of 2X SDS protein loading buffer followed by boiling for 10 minutes.
Products were separated on an 8'% polyacrylamide protein gel followed by transfer to a PVDF membrane (Immobilon N, Millipore) and phosphoimaging as described above.
A characteristic of MAP kinases is activation by extracellular stimuli. To evaluate NKIATRE activity after a variety of extracellular stimuli, (HA)NKIATREpcDNA3, a plasmid directing the expression of epitope tagged full length kinase, or the mutant (HA)NKIATRE(ADF)pcDNA3 were transiently transfected into HeLa cells. Cells had been infected 1 hour previously with a human recombinant vaccinia virus, engineered to express T7 RNA polymerase.
After 48 hours, cells expressing wildtype protein were washed and resuspended in 0.1% fetal calf serum for 12 hours. Cells (2 x 106) were then exposed for 30 minutes either to medium containing 10 or 20%
FCS, 10 nM PMA, 20-60 ng/ml EGF, 400 mM sorbitol and 500 ~glml anisomycin, or to germicidal LTV light [ 254 nm (General Electric)] for 10 minutes. Cells were then washed, harvested and ly sed. (HA)NKIATRE
was immunoprecipitated and its activity towards myelin basic protein (MBP) was evaluated in vitro as described above. Figure 3A
demonstrates that NKIATRE is quiescent in serum starved cells and is not stimulated by brief exposures to either stress stimuli, or to growth stimulants such as FCS and PMA, however mild stimulation was observed after overnight incubation with 10°/> FCS. In contrast, activation was observed after EGF stimulation in a dose dependent manner, with a 15 fold increase observed after a 30 minute exposure (Figure 3B). These observations demonstrate a very specific pattern of activation by extracellular stimuli.
Example 4 - Expression of NKIATRE and S phase Entry Vector Construction and mutagenesis: NKIATRE was mutated at threonine 158 and tyrosine 160, putative sites of activating phosphorylation, to alanine and phenylalanine, respectively, using the 4 primer mutagenesis protocol, as previously described (10) and the sense oligonucleotide GGAGACGTTTACGCACxAATTCGTGGCCACCCGCTGG. Asparagine 143 of NKIATRE was similarly mutated to aspartic acid using the sense sequence X. NKIATRE was cloned in frame, downstream of the sequence ATGGCTTACC;CATACGATGTTCCAGAT, defining the influenza hemagglutinin epitope tag (HA) MAYPYDVPD, and was cloned into the pcDNA3 plasmid (Invitrogen). NKIATRE was expressed as a eukaryotic GST fusion protein in the plasmid pEBG and as a prokaryotic GST fusion using pGEX-KG as previously described (24).
PCMVCD20 pcDNA3, p2lw'aF~ and N144CDK2 were gifts of Dr. E.
5 Harlow (Massachusetts General Hospital, Boston MA).
Brd U cell stainin~~ and Flow Cytonzetry: Analysis of growth parameters in transiently transfected cells was performed as previously described (27). In brief, cos cells were transiently transfected with both pCMVCD20 and (HA)NI~IATREpcDNA3 or mutant forms in a molar 10 ratio of 1:5. Thirty six hours later, cells (5 x l0e) were pulsed with 10 pM BrdU for 16 hours then trypsinized, washed in PBS and resuspended in 2 ml IFA buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 4% fetal calf serum, 0.1°rb NaNs) to neutralize trypsin. Cells were then centrifuged and incubated at 4°C for 1 hour in 901 of PBS containing 15 2% FCS (PBS-F) and 101 of anti-human CD20-RPE. Cells were washed in PBS-F and resuspended in 0.5 ml ice-cold 0.15M NaCl and fixed by dropwise addition of 1.2 ml ice-cold 90% ethanol while gently vortexing on ice. After 30 min incubation on ice, cells were washed, and resuspended in 1'% paraformaldehyde and 0.01°~~ Tween-20. Cells were 20 centrifuged and resuspended in 1 ml freshly prepared DNAse I solution (50 Kunitz U/ml bovine pancreas deoxyribonuclease I (Sigma), 4.2 mM
MgClz/0.15M NaCl pH5). Cells were incubated 10 min at room temperature, washed in pBS-F and resuspended in 10 ~l anti-BrdU-FITC Becton-Dickinson). Samples were incubated at room temperature 25 for 30 min, washed, and resuspended in 2 ml PBS-F. Analysis was done using an EPICS-XL flow cytometer (Coulter) with 488 nm excitation and 525 nm and 575nm bandpass filters. Fluorescence was measured in at least 2000 CD20 positive cells for each sample. Results were analyzed using the WinMDI software (J. Trotter, Scripps Research 30 Institute).
Rat-1 fibroblast cells were co-transfected with (HA)NKIATREpcDNA3, (HA)NKIATRE(AEF)pcDNA3 or pcDNA3 control plasmid with pCaVIVCD20, in a 1:5 ratio, to allow identification of DNA uptake using a flow cytometric technique. As controls for mediators of S phase entry, samples were transfected with plasmids directing the expression of p21~~'Af'' and a dominant negative form of CKD2. Cell transfection efficiencies were 20+I- 10'% in all cases as indicated by CD20 expression. The S phase fraction among transfected cells was evaluated and compared to cells transfected with vector alone.
Results are shown in Figure 4. Eighty percent of vector transfected cells were in S phase during the 16 hour period of Br dU labeling. As expected, the dominant negative CDK2 mutant and p2lw'AF decreased the number of S phase cells to 55'% and 52% respectively. Similarly, overexpression of wild type NKIATRE decreased the proportion of S
phase cells to 60%. The kinase dead mutant of NKIATRE also reduced the proportion of cells entering S phase, again suggesting that phosphorylation at the TDY motif is not required far this biological activity. These data show that NKIATRE expression leads to decreased cell growth.
Example 5 - Chromosomal Localization of Human NKIATRE
The human genomic DNA clone obtained as described in Example 1 was used as probe in Fluorescent In Situ Chromosomal Hybridization (FISH) performed on normal human peripheral lymphocytes, to determine the chromosomal location of the gene for human NKIATRE.
The method used was based on published procedures (28).
Hybridization was carried out for 16 to 20 hours at 37°C. This was followed by three 5-min washes in 50'% formamide and 2 x SSC at 42°C.
All procedures involving the handling of fluorescein isothiocyanate (FITC) were per formed in subdued lighting. The slides were soaked in 3% BSA in 4 x SSC blocking solution for 30 min. before being incubated in FITC - avidin (Oncor :Laboratories, Gaithersburg, MD, USA) at 5 ~g for 390 min at 3 7 °C. Fluorophores were washed off with 4 x SSC
0.1°/, Tween 20 at 42°C using three 3-minute washes. To amplify the FITC
signal biotinylated anti-avidin antibody (Oncor was added to each slide, and the slides were incubated at 37°C for 30 min. This was followed by further washes in 4 x SSC 0.1"% Tween 20 at 42°C, another incubation with FITC-avidin, a second series of washes as above, and counterstaining with either 0.2~,g/ml DAPI, or 0.2 yglml propidium iodide (Boehringer Mannheim. Indianapolis, IN, USA) or with both counter stains as a mixture for 2 min. The slides were washed in phosphate buffered saline (PBS) for ~ min and mounted in 20 mM Tris-HCL, pH 8.0, 90'% glycerol containing 2.3% D.ABCC) antifade (1,4 diazabicyclo-[2.2.2] octane). The photomicrographs were obtained using a Nikon Microphot FXA epifluorescence microscope equipped with dual band TITC/Texas red filters (Omega Optical Inc. FL, USA). The images were captured by a thermoelecarically cooled charge coupled (CCD) camera (Photometrics, Tucson. AZ, USA). For these images, separate propidium iodide-stained nuclei and chromosomes, and hybridization signals were acquired and merged using image analysis software (courtesy of Tim Rand and David Ward, Yale University, New Haven, CT, USA).
Localization of the probe indicated that the human NKIATRE
gene is on chromosome ~iq3l.1 (Data not show n).
Example 6 - NKIATRE Gene Loss and Acute Leukemia FISH was performed on primary acute myeloblasts from nineteen acute leukemia patients known from cytogenetic analysis to have 5q31 deletion. A bacterial artificial chromosome probe consisting of the telomeric region 5p15 was used in combination and provided an internal control for hybridization. Scoring criteria: Each round of FISH
comprised four patient samples and one normal lymphocyte control.
Patient blasts previously identified to contain a single 5q31 deletion were analyzed. Only those cells that contained two red 5p15 signals, which was used as an internal control, were scored. Each cell was then scored based on the number of green 5q31 (NKIATRE) signals. Two green signals indicated a "contaminating" normal cell, whereas one or zero signals indicated malignant cells. If both 5q31 signals were missing cells were scored as having deleted both copies of NKIATRE.
Fifty cells were counted on each slide. Background absence of hybridization among cells displaying two 5q15 alleles was determined from each normal slide as a percentage of cells with one or zero signals.
This background frequency was subtracted from the patient data to normalize for hybridization efficiency. In order to calculate the percentage of deleted cells, the number of one and zero signals were pooled defining the denominator. The number of zero signals defined the numerator. Table 4 demonstrates that malignant cells ranged from 0 to 61.5% deletion of both copies of NKIATRE, with >60% of patients known from cytogenetic analysis to be missing one NKIATRE locus having the second allele deleted.
Example 7 - NKIATRE knock-out mice A NKIATRE knock-out mouse is generated using the technique of embryonic stem (ES) cell homologous recombination, as described by Fung-Leung et al., (1992), Imrnunology, v. 4, pp. 189-192.
Briefly, the genornic sequence of mouse NKIATRE is isolated by phage library screening using a rat NKIATRE nucleic acid sequence as disclosed herein. The sequence surrounding exon 1 of the mouse DNA
is obtained and cloned into a standard plasmid vector by conventional methods. A bacterial neomycin resistance gene is inserted in an anti-sense orientation into the coding region of exon 1 t-o create an inactive mutation.
The mutant NKIATRE is introduced into the mouse embryonic stem cells by electropora.tion, followed by subsequent selection in neomycin containing tissue culture medium. ES cell clones harboring a single homologous integration of mutant NKIATRE are identified by PCR screen and southern analysis. Mutant ES cells are introduced into murine blastocysts and then implanted into the uteri of hormonally manipulated mice. Chimeric mice born are bred to identify individuals in which germline heterozygous mutation of NKIATRE has been achieved. Heterozygous mutated mice are mated to homozygosity.
Homozygous deleted mice show development; of hyperproliferation of hematopoietic tissues, resulting in acute leukemia.
References:
1. Yan M, Templeton DJ. Identification of 2 serine residues of MEK-1 that are differentially phosphorylated during activation by raf and 5 MEK kinase. Journal of Biological Chemistry 1994; 269:19067-73.
2. Davis RJ. The mit,ogen-activated protein kinase signal transduction pathway. [Review]. J Biol Chem 1993;268:14553-6.
10 3. Davis RJ. MAPKs: new JNK expands the group. [Review].
Trends in Biochemical Sciences 1994;19:470-3.
4. Yan M, Dai T, Deak JC, Kyriakis JM, Zon Ll, Woodgett JR, Templeton DJ. Activation of stress-activated protein kinase by MEKK1 15 phosphorylation of its activator SEK1. Nature 1994; 372:798-800.
5. Lin A, Minden A, Martinetto H, Claret F, Lange-Carter C, Mercurio F, Johnson G, Karin M. Identification of a dual specificity kinase that activates the jun kinases and p38-mpk2. Science 20 1995; 268:286-90.
6. Payne DM, Rossomando AJ, Martino P, Erickson AK, Her JH, Shabanowitz J, Hunt DF, Weber MJ, Sturgill TW. Identification of the regulatory phosphorylation sites in pp42/mitogen-activated protein 25 kinase (MAP kinase). EMBO J 1991;10(4):885-92.
7. Posada J, Cooper JA. Requirements for phosphorylation of MAP
kinase during meiosis in Xenopus oocytes. Science 1992;255(5041):212 5.
In accordance with a further embodiment of the invention, the invention provides a method of gene therapy comprising administering an effective amount of a NKIATRE nucleic acid sequence to a cell or organism which has a defective or absent. NKIATRE gene.
Summary of the Drawings Figure lA shows a southern analysis of rat genomic DNA probed with full length NKIATRE. 15 ~g samples of genomic DNA were digested with EcoRI, BamHl or HindIII. Molecular weight is shown in kilobases.
Figure 1B shows a phylogenetic southern analysis. Genomic DNA from rat, pig, mouse, human and Drosophila were digested with EcoRl and analyzed and probed with full length NKIATRE. Cross hybridization is observed most; strongly in mouse, human and Drosophila samples.
Figure 2 shows a northern analysis of rat NKIATRE. Full length cDNA was used to probe poly A RNA samples from various tissues.
Two prominent bands were observed at 4.4 kB and at 2.6 kB suggesting alternatively spliced forms. NKIATRE expression was observed most strongly in brain, muscle and heart.
Figure 3A shows NKIATRE activity in Hela cells exposed to the indicated stimuli (FCS C>/N = incubation with FCS overnight).
Figure 3B shows NKIATRE activity in Hela cells exposed to pcDNA3 vector only (vec), Serum, PMA or EGF at 20. 40 or 60 ng/ml.
Figure 4 shows progression into S phase, expressed as incorporation of BrdU (°roBrdU+), of RAT-1 cells transiently transfected with NKIATRE (MKH), mutant NKIATRE deficient in kinase activity (MKH-KD), dominant negative CDK2 (CDK2-DN), cyclin-dependent kinase inhibitor p21 (p21) or plasmid clone (pcDNA3), arrested by serum starvation and measured at 14 hours after serum replenishment.
Detailed Description of the Invention The inventors have identified a new cdc2-related kinase involved in cell growth and in the control of the cell cycle. The new kinase, designated NKIATRE, has been demonstrated in rats and humans.
The full cDNA sequence and deduced amino acid sequence of rat NKIATRE is provided, as shown in Tables 1, 2 and 3. A partial sequence of human NKLATRE is also provided (Table 4).
The inventors have shown that a high percentage of human acute leukemia patients have both NKIATRE alleles deleted, indicating that the NKIATRE gene is a putative tumour suppressor gene.
In Table 3, the protein kinase consensus residues are shown in bold and the NKIATRE motif and the two sites of potential regulation, the SY duplex and the TDY MAP kinase-like regulatory region, are boxed.
The invention provides a novel, EGF-stimulated protein kinase with sequence similarity to both the MAP kinases and to the cyclin-dependent kinases. Overexpression of NKIATRE leads to growth suppression, suggesting that it may function in E(xF-mediated growth suppressive pathways leading to enhanced p21~~'=~'''' expression.
The kinase NKIA'CRE has sequence similarity to both the MAPKs and the cyclin dependent kinase family of cell cycle regulators.
Similar to the MAPKs, NKIATRE has a potential MAPK activation motif, TDY, followed by the MAPK specific sequence, VATRW. In this regard, it is most similar to the ERK-family of MAPKs which also have an acidic residue separating these two regulatory hydroxy aminoacids.
Unexpectedly, the new kinase also has considerable similarity to the cyclin-dependent kinases, as suggested by the presence of a putative cyclin-binding motif, NK.IATRE, and of potential negative regulatory phosphorylation sites found within the amino-terminal glycine rich ATP-binding domain. Cyclin-dependent kinases have the sequence GEGTYG, with dual phosphorylation on threonine and tyrosine preventing ATP binding and enzymatic inactivation. NKIATRE has a conservative substitution of serine for threonine, suggesting a similar mechanism of regulation. In contrast, the MAPKs do not have phosphorylation sites within this motif, underscoring a divergence from NKIATRE.
Analysis of the sequence of NKIATRE reveals that it contains all twelve of the invariant or nearly invariant residues that are characteristic of the kinase catalytic domain. The 12 residues that are conserved and their positions within NKIATRE are as follows: Glycine 11 and glycine 13 within subdomain I of Hanks (31) (GXGXXGXV
motif), lysine 33 in subdomain II, glutamic acid 50 in subdomain III, aspartic acid 125 and asparagine 130 in subdomain VIB, aspartic acid 143 and glycine 145 in subdomain VII (DFG motif, glutamic acid 170 in subdomain VIII (APE motifj, aspartic acid 183 and glycine 188 in subdomain IX, and arginine 274 in subdomain XI.
In genes al, strong indicators of the specificity of the kinase can be found within two short motifs in subdomain VI and subdomain VIII. In subdomain VI, the consensus DLKPEN predicts serine/threonine specificity, whereas DLRAAN or DLAARN predicts tyrosine specificity.
NKIATRE contains the sequence DIKPEN (residues 125-130), which conforms most closely to the serine/threonine specific kinase consensus sequence. In subdomain VIII, the sequence (xT/SXXY/FX is found to be conserved in serinelthreonine specific kinases, whereas PIIVK/RWT/M
is characteristic of the tyrosine specific kinases. NKIATRE contains the sequence ATRWYR (residues 162-167) which again is most closely related to the serine/threonine specific kinases.
Comparison of NKIATRE with all known protein kinases reveals that it is most homologous to the cdc2-related protein kinases KKIAMRE and KKIALRE (Table 5), Each of these other kinases possesses the MAPK activation motif, TDY, putative cyclin-binding 5 sequence, and sites of potential negative regulatory phosphorylation within their ATP binding motifs. Overall NKIATRE protein has 44%
and 47% identity to KKIALRE and KKIAMRE respectively.
Within the kinase domain, NKIATRE has 60'% identity to KKIAMRE, 50°/> identity to KKIALRE, 33% identity to rat ERK1, 32°/>
10 identity to rat ERK2, 34% identity to mouse p38~3~'~~, and 33°/~
identity to rat SAPKa. Threonine 158 and Tyrosine 161, in subdomain VIII, correspond to the sites of activating phosphorylation for the MAPKs.
Threonine 158 of NKIA7.'RE corresponds to a critical site of activating phosphorylation in the C;DKs while serine 14 and Tyrosine 15 correspond to CDK sites of negative regulation.
KKIALRE and KKIAMRE are not dependent on phosphorylation within the TDY motif for activity, suggesting that regulation of these enzymes is unlike that of the MAPKs. The inventors have shown that a mutant form of NKIATRE, in which the TDY putative activation motif has been mutated to ADF, also retains enzymatic activity, suggesting that its mechanism of regulation is also distinct from the MAPKs.
NKIATRE is expressed strongly in muscle, heart, liver and brain, all tissues which have a very low mitotic index.
To investigate the effects of NKIATRE expression on cell growth, this enzyme was transiently expressed in rat-1 cells. A technique of CD20 expression was used to tag transiently-transfected cells and DNA
synthesis was measured by BrdU incorporation flow cytometrically.
This technique can rapidly identify genes which inhibit DNA synthesis, such as p2lw'~E''' and dominant interfering mutants of CDK2. NKIATRE
overexpression is associated with a marked decreased in DNA
synthesis, suggesting that it is a negative regulator of cell growth.
Mutants of NKIATRE lacking the TDY MAP kinase motif are equally capable of delaying DNA synthesis, suggesting that phosphorylation at these sites is not needed for this action. 'These data indicate that NKIATRE restricts cell growth and may contribute to the maintenance of the low mitotic rate in differentiated tissues in which it is expressed.
Signaling through the epidermal growth factor receptor usually causes ERK activation, often resulting in increased cell growth. It has been shown by the inventors that NKIATRE is both stimulated by EGF
and causes suppression of cell growth, suggesting its participation in signaling pathways which are distinct from ERK-induced mitogenic signaling cascades. NKIATRE overexpression may mimic hyperactivation of the EGF receptor, inducing its growth suppressive effects through p21~'~'' ~. This kinase may be a novel link between the EGF receptor and STAT1 activation.
The human NKIATRE gene has been mapped to chromosome 5q31.1, a chromosome region implicated in human acute leukemia.
More than 60% of human acute leukemia patients examined showed loss of both alleles of the NKIATRE gene, indicating that the NKIATRE
gene is a putative tumour suppressor gene.
Isolated Nucleic Acids In accordance with one series of embodiments, this invention provides an isolated nucleic acid corresponding to the nucleic acid sequence encoding rat NKIATRE protein. Also provided are portions of the NKIATRE sequence useful as probes and PC;R primers or for encoding fragments, functional domains or antigenic determinants of NKIATRE proteins.
One of ordinary skill in the art is now enabled to identify and isolate NKIATRE genes or cDNAs which are allelic variants or homologues of the disclosed NKIATRE sequence, using standard hybridisation screening or PCR techniques.
Depending on the intended use, the invention provides portions of the disclosed nucleic acid sequence comprising about 10 consecutive nucleotides (e.g. for use as PCR primers) to nearly the complete disclosed nucleic acid sequences. The invention provides isolated nucleic acid sequences comprising sequences corresponding to at least 10, preferably 15 and more preferably at least 20 consecutive nucleotides of the NKIATRE gene as disclosed herein.
In addition, the isolated nucleic acids of the invention include any of the above described nucleotide sequences included in a vector.
Substantially Pure Proteins In accordance with a further series of embodiments, this invention provides substantially pure NKIATRE protein, fragments of this protein and fusion proteins including this protein and fragments.
The proteins, fragments and fusion proteins have utility, as described herein, for the preparation of polyclonal and monoclonal antibodies to NKIATRE proteins, for the identification of binding partners of the NKIATRE proteins and for diagnostic and therapeutic methods, as described herein. For these uses, the present invention provides substantially pure proteins, polypeptides or derivatives of polypeptides which comprise portions of the NKIATRE amino acid sequences disclosed or enabled herein and which may vary fiom about 4 to 5 amino acids (e.g. for use as immunogens) to the complete amino acid sequence of the NKIATRE protein. The invention provides substantially pure proteins or polypeptides comprising sequences corresponding to at least 5, preferably at least 10 and more preferably 50 or 100 consecutive amino acids of the NKIATRE proteins disclosed or enabled herein.
Preparation of Proteins NKIATRE proteins, fragments of the proteins and fusion proteins may be isolated and purified by techniques well known to those skilled in the art. The NKIATR,E protein may be purified from tissues (e.g.
heart and muscle) in which there is a high level of expression of the protein or it may be made by recombinant techniques. Isolated proteins, or fragments thereof. can be used for the generation of antibodies, in the identification of proteins which may bind to NKIATRE or for diagnostic or therapeutic methods and assays. Full length proteins and fragments of at least 5 amino acids may be isolated and purified for various applications.
The protein may be isolated from tissue by extraction and solubilised using a detergent.
Purification can be achieved using protein purification procedures such as chromatography methods (gel-filtration, ion-exchange and immunoaffinity), by high-performance liquid chromatography (RP-HPLC, ion-exchange HPLC, size-exclusion HPLC, high-performance chromatofocusing and hydrophobic interaction chromatography) or by precipitation (immunoprecipitation or immunoaffinity SDS-Page and Page). Polyacrylamide gel electrophoresis can also be used to isolate the NKIATRE protein based on its molecular weight, charge properties and hydrophobicity.
Similar procedures may be used to purify the protein obtained from recombinant expression systems.
For protein expression, eukaryotic or prokaryotic expression systems may be generated in which the NKIATRE gene sequence, cDNA or genomic, is introduced into a plasmid or other expression vector which is then introduced into living cells. Constructs in which the NKIATRE cDNA sectuence containing the entire open reading frame or portions thereof is inserted in t;he correct orientation into an expression plasmid may be used for protein expression.
Typical expression vectors contain promoters that direct the synthesis of large amounts of mRNA corresponding to the gene. They may also include sequences allowing for their autonomous replication within the host organism, sequences that encode genetic traits that allow cells containing the vectors to be selected, and sequences that increase the efficiency with which the mRNA is translated. Stable long-term vectors may be maintained as freely replicating entities by using regulatory elements of viruses. Cell lines may also be produced which have integrated the vector into the genomic DNA and in this manner the gene product is produced on a continuous basis.
Expression of foreign sequences in bacteria such as E. coli require the insertion of the sequence into an expr ession vector, usually a plasmid which contains several elements such as sequences encoding a selectable marker that assures maintenance of the vector in the cell, a controllable transcriptional promoter which upon induction can produce large amounts of mRNA from the cloned gene, translational control sequences and a polylinker to simplify insertion of the gene in the correct orientation within the vector. A relatively simple E. coli expression system utilizes the lac promoter and a neighbouring lacZ
gene which is cut out of the expression vector with restriction enzymes and replaced by the NKIATRE gene sequence.
In vitro expression of proteins encoded by cloned DNA is also possible using the T7 late-promoter expression system. Plasmid vectors containing late promoters and the corresponding RNA polymerases from related bacteriophages such as T3, T5 and SP6 may also be used for i.n vitro production of proteins from cloned DNA. E. coli can also be used for expression by infection with M13 Phage mGPI-2. E. coli vectors can also be used with phage lambda regulatory sequences, with fusion protein vectors, with maltase-binding protein fusions, and with glutathione-S-transferase fusion proteins.
Eukaryotic expression systems permit appropriate post-translational modifications of expressed proteins. This allows for 5 studies of the NKIATRE gene and gene product including determination of proper expressian and post-t;ranslational modifications for biological activity, identifying regulatory elements in the 5' region of the gene and their role i:n tissue regulation of protein expression. It also permits the production of large amounts of protein for isolation and 10 purification, the use of cells expressing NKIATRE as a functional assay system for antibodies generated against the protein, the testing the effectiveness of pharmacological agents to increase or decrease the activity of NKIATRE, and the study of the function of the normal complete protein, specific portions of the protein, or of naturally 15 occurring polymorphisms and artificially produced mutated proteins.
In order to produce mutated or polymorphic proteins, the NKIATRE DNA sequen<:e can be altered using procedures such as restriction enzyme digestion, DNA polymerase fill-in, exonuclease deletion, terminal deoxynucleotide transferase extension, hgation of synthetic or cloned DNA. sequences and site-directed sequence alteration using specific oligonucleotides together with PCR.
Alteration of the cDNA will allow for the production of specific mutations within cDNA sequence in order to express the created mutated proteins and study their biological effects.
Once an appropriate expression vector containing the NKIATRE
gene is constructed, it is introduced into eukaryotic cells by techniques that include calcium phosphate transfection, DEAE-dextran transfection, electroporation, microinjection, protoplast fusion and hposome-mediated transfection.
The host cell to be transfected with the vector of this invention may be selected from the group consisting of E.coli,, Pseudomorras, Bacillus Subtilis, or other bacilli, other bacteria, yeast, fungi, insect (using baculoviral vectors for expression), mouse or other animal or human tissue cells. Marnmahan cells can also be used to express the NKIATRE protein using a vaccinia virus expression system.
In order to express and purify the protein as a fusion protein, the NKIATRE cDNA sequence is inserted into a vector which contains a nucleotide sequence encoding another peptide (eg. GST - glutathionine succinyl transferase). The fusion protein is expressed and recovered from prokaryotic (eg. bac;terial or baculovirus) or eukaryotic cells. The fusion protein can then be purified by affinity chromatography based upon the fusion vector sequence and the NKIATRE protein obtained by enzymatic cleavage of the fusion protein.
Purified protein can also be used in further biochemical analyses to establish secondary and tertiary structure. The preparation of substantially purified NKIATRE protein or fragments thereof allows for the determination of the protein tertiary structure by x-ray crystallography of crystals of NKIATRE protein or by NMR.
Determination of structure may aid in the design of pharmaceuticals which interact with the protein, alter protein charge configuration or charge interaction with other proteins, or to alter its function in the cell.
Antibodies The knowledge of the amino acid and nucleotide sequence of the NKIATRE protein allows for the production of antibodies which selectively bind the NKLATRE protein or fragments thereof. The term antibodies includes polyclonal antibodies, monoclonal antibodies, single chain antibodies and fragments thereof such as Fab fragments.
In order to prepare polyclonal antibodies, fusion proteins containing defined portions or all of the NKIATRE protein can be synthesized in bacteria by expression of corresponding DNA sequences in a suitable cloning vehicle. Fusion proteins are commonly used as a ~ source of antigen for producing antibodies. Alternatively protein may be isolated and purified .from NKIATRE expressing cultures and used as a source of antigen. It is understood that the entire protein or fragments thereof can be used as a source of antigen to produce antibodies.
The purified NKIATRE protein is purified, coupled to a carrier protein and mixed with Freund's adjuvant (to help stimulate the antigenic response by the animal) and injected into rabbits or other appropriate labor atory animals. Following booster injections at weekly intervals, the rabbits or other laboratory animals are then bled and the sera isolated. The sera can be used directly or purified prior to use by various methods including affinity chromatography employing Protein A-Sepharose, Antigen Sepharose or Anti-mouse-Ig-Sepharose, to give polyclonal antibodies.
Alternatively, synthetic peptides can be made corresponding to the antigenic portions of the protein, and used to inoculate the animals.
The most common practice is to choose a 10 to 15 amino acid residue peptide corresponding to the carboxyl or amino terminal sequence of a protein antigen, and to chemically cross-link it to a carrier molecule such as keyhole limpet hemocyanin or BSA. However, if an internal sequence peptide is desired, selection of the peptide is based on the use of algorithms that predict potential antigenic sites. These predictive methods are, in turn, based on predictions of hydrophilicity (Kyte and Doolittle 1982, Hopp and Woods 1983) or secondary structure (Chou and Fasman 1978). The objective is to choose a region of the protein that is either surface exposed, such as a hydrophilic region, or is conformationally flexible relative to the rest of the structure, such as a loop region or a region predicted t;o form a ~3-turn. The selection process is also limited by constraints imposed by the chemistry of the coupling procedures used to attach peptide to carrier protein. Carboxyl-terminal peptides are frequently chosen because these are often more mobile than the rest of the molecule and the peptide can be coupled to a carrier in a straightforward manner using glutaraldehyde. The amino-terminal peptide has the disadvantage that it may be modified post-translationally by acetylation or by the removal of a leader sequence. A
comparison of the protein amino acid sequence between species can yield important information. Those regions with sequence differences between species are likely to be immunogenic. Synthetic peptides can also be synthesized as immunogens as long as they mimic the native antigen as closely as possible.
As will be understood by those skilled in the art, monoclonal NKIATRE antibodies may also be produced. NKIATRE protein isolated from tissues, or from cells recombinantly expressing the protein, is injected in Freund's adjuvant into mice. Mice are injected 9 times over a three week period, after which their spleens are removed and resuspended in phosphate buffered saline (PBS). The spleen cells serve as a source of lymphocytes, some of which are producing antibody of a selected specificity. These are then fused with a permanently growing myeloma partner cell, and the products of the fusion are plated into a number of tissue culture wells in the presence of a selective agent such as HAT. The wells are then screened by ELISA to identify those containing cells making binding antibody. These are then plated and after a period of growth, these wells are again screened to identify antibody-producing cells. Several cloning procedures are carried out until over 90'%~ of the wells contain single clones which are positive for production of the desired antibody. From this procedure, a stable line of clones which produce the antibody is established. The monoclonal antibody can then be purified by affinity chromatography using Protein A Sepharose, ion-exchange chromatography, as well as variations and combinations of these techniques. Truncated versions of monoclonal antibodies may also be produced by recombinant techniques in which plasmids are generated which express the desired monoclonal antibody fragment in a suitable host.
Antibodies are useful in various immunoassays for detecting and quantitating relative amounts of wild type and mutant protein.
Enzyme-linked immunosorbant assays (ELISA) may be used to detect both wild type and mutant NKIATRE as well as antibodies generated against these proteins. Commonly used ELISA systems are indirect ELISA to detect specific antibodies, direct competitive ELISA to detect soluble antigens, antibody-sandwich ELISA to detect soluble antigens and double antibody-sandwich ELISA to detect specific antibodies.
For a review of methods for preparation of antibodies, see Antibody Engin.eerireg: A Practical Guide, Barreback, ed., W.H.
Freeman & Company, NY (1992) or Antibody Ertgirceerarcg, 2nd Ed., Barreback, ed., Oxford University Press, Oxford (1995).
Diagnostic Methods The NKIATRE gene and gene product, as well as the NKIATRE-derived probes, primers and antibodies, disclosed or otherwise enabled herein, are useful for screening for carriers of deletions associated with acute leukemia, and for the diagnosis of acute leukemia associated with loss or mutation of the NKIATRE gene. Individuals at risk for developing acute leukemia, for example those with acute leukemia present in the family pedigree, or individuals not previously known to be at risk, may be routinely screened using probes to detect the presence of a relevant deletion in the NKIATRE gene by a variety of techniques.
Diagnostic methods are provided based upon the nucleic acids (including genomic and mRNA/cDNA sequences), proteins, and/or 5 antibodies disclosed and enabled herein, including functional assays designed to detect failure or augmentation of the normal NKIATRE
activity. Preferably, the methods and products are based upon the human NKIATRE nucleic acids, protein or antibodies. The significant evolutionary conservation of large portions of the NKIATRE nucleotide 10 and amino acid sequence, even in species as diverse as humans and rats, allows the skilled artisan to make use of such non-human NKIATRE-homologue nucleic acids, proteins and antibodies, even for applications directed toward human or other animal subjects.
As will be appreciated by one of ordinary skill in the art, the 15 choice of diagnostic methods of the present invention will be influenced by the nature of the available biological samples to be tested and the nature of the information required.
Protein Based Screens and Dia~~nostics 20 When a diagnostic; assay is to be based upon the NKIATRE
protein, a variety of approaches are possible. For example, diagnosis can be achieved by monitoring differences in the electrophoretic mobility of normal and mutant proteins. Such an approach will be particularly useful in identifying mutants in which charge substitutions are present, or in which insertions, deletions or substitutions have resulted in a significant change in the electrophoretic migration of the resultant protein. Alternatively, diagnosis may be based upon differences in the proteolytic cleavage patterns of normal and mutant proteins, differences in molar ratios of the various amino acid residues, or by functional assays demonstrating altered function of the gene products.
In preferred embodiments, protein-based diagnostics will employ differences in the ability of antibodies to bind to normal and mutant NKIATRE proteins. Such diagnostic tests may employ antibodies which bind to the normal proteins but not to mutant proteins, or vice versa. In particular, an assay in which a plurality of monoclonal antibodies are used, each capable of binding to a mutant epitope, may be employed. The levels of anti-mutant antibody binding in a sample obtained from a test subject (visualized by, for example, radiolabelling, ELISA or chemiluminescence) may be compared to the levels of binding to a control sample. Alternatively, antibodies which bind to normal but not mutant NKIATRE may be employed, and decreases in the level of antibody binding may be used to distinguish homozygous normal individuals from mutant, heterozygotes or homozygotes. Such antibody diagnostics may be used for in situ immunohistochemistry using biopsy samples of tissues obtained antemortem or postmortem.
Nucleic Acid Based Screens and Diagnostics When the diagnostic assay is to be based upon nucleic acids from a sample, the assay may be based upon mRNA, cDNA or genomic DNA.
Whether mRNA, cDNA or genomic DNA is assayed, standard methods well known in the art may be used to detect the presence of a particular sequence either in situ or in vitro (see, e.g., Sambrook et al., (1989) Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Press, Cold Spring Harbor, NIA. As a general matter, however, any tissue with nucleated cells may be examined.
Genomic DNA used for the diagnosis may be obtained from body cells, such as those present in the blood, tissue biopsy, surgical specimen, or autopsy material. The DNA may be isolated and used directly for detection of a specific sequence or may be amplified by the polymerase chain reaction (PCR) prior to analysis. Similarly, RNA or cDNA may also be used, with or without PCR amplification. To detect a specific nucleic acid sequence, direct nucleotide sequencing, hybridization using specific oligonucleotides, restriction enzyme digest and mapping, PCR mapping, RNase protection, chemical mismatch cleavage, ligase-mediated detection, and various other methods may be employed. Oligonucleotides specific to particular sequences can be chemically synthesized and labeled radioactively or nonradioactively (e.g., biotin tags, ethidium bromide), and hybridised to individual samples immobilized on membranes or other solid-supports (e.g., by dot-blot or transfer from gels after electrophoresis), or in solution. The presence or absence of the target sequences may then be visualized using methods such as autoradiography, fluorometry, or colorimetry.
These procedures can be automated using redundant, short oligonucleotides of known sequence fixed in high density to silicon chips.
Whether for hybridisation, RNase protection, ligase-mediated detection, PCR amplification or any other standards methods described herein and well known in the art, a variety of subsequences of the NKIATRE sequences disclosed or otherwise enabled herein will be useful as probes and/or primers. In general, useful sequences will include at least 8-9, more preferably 10-50, and most preferably 18-24 consecutive nucleotides from the NKIATRE introns, exons or intron/exon boundaries. Depending upon the target sequence, the specificity required, and future technological developments, shorter sequences may also have utility. Therefore, any NKIATRE derived sequence which is employed to isolate, clone, amplify, identify or otherwise manipulate a NKIATRE sequence may be regarded as an appropriate probe or primer.
Methods of Treatment Therapies may be designed to circumvent or overcome a NKIATRE gene defect or inadequate NKIATRE gene expression, and thus moderate and possibly prevent malignancy.
Protein Therapy Treatment or prevention of acute leukemia can be accomplished by replacing a mutant or absent NKIATRE protein with normal protein, by modulating the function of a mutant protein, or by delivering normal NKIATRE protein to the appropriate cells. Once the biological pathway involving the NKIATRE protein has been completely elucidated and understood, it may also be possible to modify the pathophysiologic pathway in which the protein participates in order to correct the physiological defect.
To replace a mutant protein with normal protein, or to add protein to cells which no longer express normal NKIATRE, it is necessary to obtain large amounts of pure NKIATRE protein from cultured cell systems which can express the protein. Delivery of the protein to the affected cells and tissues can then be accomplished using appropriate packaging or administration systems. The NKIATRE can be provided in the form of a stable composition for oral or parental administration, the latter route including intravenous and subcutaneous administration. The composition containing the NKIATRE protein of the present invention can also be administered in an solution or emulsion contained within phospholipid vesicles called liposomes. The liposomes may be unilamellar or multilamellar and are formed of constituents selected from phosphatidylcholine, dipalmitoylphosphatidylcholine, cholesterol, phosphatidylethanolamine, phosphatidylserine, demyristoylphosphatidylcholine and combinations 24:
thereof. The multilamellar liposomes comprise multilamellar vesicles of similar composition to unilamellar vesicles, but are prepared so as to result in a plurality of compartments in which the NKIATRE protein-containing solution or emulsion is entrapped. Additionally, other adjuvants and modifiers may be included in the liposomal formulation such as polyethyleneglyc;ol, or other materials. The liposomes containing the NKIATRE protein or peptide composition may also have modifications such as having antibodies immobilized onto the surface of the liposome in order to target their delivery.
In one embodiment of the present invention, a pharmaceutical composition for administration to subjects in a biologically compatible form suitable for administration in vavo for treating malignancies characterized by abnormal NKIATRE function comprises a safe and effective amount of NKIATRE protein alone, or in combination with other agents and pharmaceutical carriers. Accordingly, the composition may vary to include not only NKIATRE protein or peptides, but as well a vector containing an appropriate NKIATRE sequence. The composition may be administered to any living organism including humans and animals. By safe and effective as used herein is meant providing sufficient potency in order to decrease, prevent, ameliorate or treat a malignancy affecting a subject while avoiding serious side effects. A safe and effective amount will vary depending on the age of the subject, the physical condition of the subject being treated, the severity of the proliferative disorder, the duration of treatment and the nature of any concurrent therapy.
Administration of a therapeutically active amount of the pharmaceutical composition of the present invention is defined as an amount effective, at dosages and for periods of time necessary to achieve the desired result. This may also vary according to factors such as the disease state, age, sex, and weight of the subject, and the ability of the NKIATRE to elicit; a desired response in the subject. Dosage regima may be adjusted to provide the optimum therapeutic response.
For example, several divided doses may be administered daily or the dose may be proportionally reduced as indicated by the exigencies of the 5 therapeutic situation.
By pharmaceutically acceptable carrier as used herein is meant one or more compatible solid or liquid delivery systems. Some examples of pharmaceutically acceptable carriers are sugars, starches, cellulose and its derivatives, powdered tragacanth, malt, gelatin, collagen, talc, 10 stearic acids, magnesium stearate, calcium sulfate, vegetable oils, polyols, agar, alginic acids, pyrogen-free water, isotonic saline, phosphate buffer, and other suitable non-toxic substances used in pharmaceutical formulations. Other excipients such as wetting agents and lubricants, tableting agents, stabilizers, anti-oxidants and 15 preservatives are also contemplated.
The compositions described herein can be prepared by known methods for the preparation of pharmaceutically acceptable compositions which can be administered to subjects, such that an effective quantity of the active substance is combined in a mixture with 20 a pharmaceutically acceptable carrier. Suitable carriers are described for example in Remington's Pharmaceutical Sciences (Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, Pa., USA
1985). On this basis the compositions include, albeit not exclusively, solutions of the substanc:e in association with one or more 25 pharmaceutically acceptable vehicles or diluents, and contained in buffered solutions with a suitable pH and iso-osmotic with the physiological fluids.
Alternatively, small molecule analogs may be used and administered to act as NKIATRE agonises or antagonists and in this manner produce a desired physiological effect. In order to screen for analogues, one can design functional screens based on the sequence of NKIATRE. One can also fuse NKIATRE to heterologous DNA binding proteins to design screens for agonists. Yeast screens can be used for small molecules that may interact by promoting or disrupting NKIATRE binding with other proteins.
NKIATRE expressed as a fusion p~wotein can be utilized to identify small peptides that bind to NKIATRE. In one approach, termed phage display, random peptides (up to 20 amino acids long) are expressed with coat proteins (geneIII or geneVIII) of filamentous phage such that they are expressed on the surface of the phage thus generating a library of phage that express random sequences. A library of these random sequences is then selected by incubating the library with the NKIATRE protein or fragments thereof and phage that bind to the protein are then eluted either by cleavage of NKIATRE from the support matrix or by elution using an exc;ess concentration of soluble NKIATRE protein or fragments. The eluted phage are then repropagated and the selection repeated many times to enrich for higher affinity interactions. The random peptides can either by completely random or constrained at certain positions through the introduction of specific residues. After several rounds of selection, the final positive phage are sequenced to determine the sequence of the peptide.
An alternate but related approach uses the y east two hybrid system to identify binding partners for NKIATRE. NKIATRE or fragments are expressed in yeast as a fusion to a DNA binding domain.
This fusion protein is capable of binding to target promoter elements in genes that have been engineered into the yeast. These promoters drive expression of specific reporter genes (typically the auxotrophic marker HISS and the enzyme bgalactosidase). A library of cDNAs can then be constructed from any tissue or cell line and fused to a transcriptional activation domain. Transcription of HISS and b-galactosidase depends on association of the NKIATRE fusion protein (which contains the DNA
binding domain) and the target protein (which carries the activation domain). Yeast survival on specific growth media lacking histidine requires this interaction. This approach allows for the identification of specific proteins that interact with NKIATRE. The approach has also been adapted to identify small peptides. NKIATRE, or its fragments, are fused with the DNA binding domain and are screened with a library of random peptides or peptides which are constrained at specific positions linked to a transcriptional activation domain. Inter action is detected by growth of the inter acting peptides on media lacking histidine and by detection of b-galactosidase activity using standard techniques.
The identification of proteins or small peptides that interact with NKIATRE can provide the basis for the design of small peptide antagonists or agonists of NKIATRE function. Further, the structure of these peptides determined by standard techniques such as protein NMR
or X-ray crystallography can provide the structural basis for the design of small molecule drugs.
Gene Therapy Gene then apy is another potential therapeutic approach in which normal copies of the NK:fATRE gene are introduced into selected tissues to successfully code for normal protein in affected cell types. The gene must be delivered to affected cells in a form in which it can be taken up and can code for sufficient protein to provide effective function.
Transducing retroviral vectors can be used for somatic cell gene therapy especially because of their high efficiency of infection and stable integration and expression. The targeted cells must be able to divide and the expression level of normal protein should be high. The full length NKIATRE gene, or portions thereof, can be cloned into a retroviral vector and driven from its endogenous promoter or from the retroviral long terminal repeat or from a promoter specific for the target cell type of interest. Other viral vectors which can be used include adeno-associated virus, vaccinia virus, bovine papilloma virus, or a herpes virus such as Epstein-Barr virus.
Gene transfer could also be achieved using non-viral methods of infection in Uatro. These methods would include calcium phosphate, DEAE dextran, electroporation, and protoplast fusion. Liposomes may also be potentially beneficial for delivery of DNA into a cell. DNA itself may be taken up by cells directly.
Antisense-based strategies can be employed to explore NKIATRE
gene function and as a basis for therapeutic drug design. The principle is based on the hypothesis that sequence-specific suppression of gene expression can be achieved by intracellular hybridization between mRNA and a complementary antisense species. The formation of a hybrid RNA duplex may then interfere with the processing/transportltranslation and/or stability of the target NKIATRE
mRNA. Antisense strategies may use a variety of approaches including the use of antisense oligonucleotides, injection of antisense RNA and transfection of antisense RNA expr ession vectors.
Transplantation of normal genes into the affected cells of a patient with a malignancy can also be useful therapy. In this procedure, normal NKIATRE is transferred into a cultivatable cell type, either exogenously or endogenously t,o a patient. These cells are then injected into the targeted tissue.
Animal Models The present invention also provides for the production of transgenic non-human animal models for the study of the NKIATRE
tumor suppressor gene function, to study the mechanisms of carcinogenesis as related to the NKIATRE gene, for the screening of candidate pharmaceutical compounds, for the creation of explanted mammalian cell cultures which express the protein or mutant protein or in which the NKIATRE gene has been inactivated by knock-out deletion, and for the evaluation of potential therapeutic interventions.
The creation of an animal model for acute leukemia and other related cancers is important to the understanding of the NKIATRE
gene function in the cancer and for the testing of possible therapies.
Animal species which are suitable for use in the animal models of the present, invention include, but are not limited to, rats, mice, hamsters, guinea pigs, rabbits, dogs, cats, goats, sheep, pigs, and non-human primates such as monkeys and chimpanzees. For initial studies, transgenic mice and rats are highly desirable due to their relative ease of maintenance and shorter life spans. For certain studies, transgenic yeast or invertebrates m.ay be suitable and preferred because they allow for rapid screening and provide for much easier handling. For longer term studies, non-human primates may be desired due to their similarity with humans.
There are several ways in which to create an animal model for NKIATRE-related malignancy . Generation of a specific mutation in a homologous animal gene is one strategy. Secondly, a wild type human gene andlor a humanized animal gene could be inserted by homologous recombination. Thirdly, it is also possible to insert a mutant (single or multiple) human gene as genomic or minigene cDNA construct using wild type or mutant or artificial promoter elements. Fourthly, knock-out of the endogenous homologous animal genes may be accomplished by the insertion of artificially modified fragments of the endogenous gene by homologous recombination. The modifications include insertion of mutant stop codons, the deletion of DNA sequences, or the inclusion of recombination elements (lox p sites) recognized by enzymes such as Cre recombinase.
If it is desired to inactivate or replace the endogenous NKIATRE
gene, homologous recombination using embryonic stem cells may be 5 applied.
For oocyte injection, one or more copies of the mutant or wild type NKIATRE gene can be inserted into the pronucleus of a just-fertilized mouse oocyte. This oocyte is then reimplanted into a pseudo-pregnant foster mother. The liveborn mice can then be screened for integrants 10 using analysis of tail DNA for the presence of the NKIATRE gene sequences. The transgene can be either ~~ complete genomic sequence injected as a YAC, BAC, PAC or other chromosome DNA fragment, a cDNA with either the natural promoter or a heterologous promoter, or a minigene containing all of the coding region and other elements found 15 to be necessary for optimum expression.
Retroviral infection of early embryos can also be done to insert the mutant or wild type NKIATRE. In this method, the mutant or wild type NKIATRE is inserted into a retroviral vector which is used to directly infect mouse embryos during the early stages of development to 20 generate a chimera, some of which will lead to germline transmission.
Similar experiments can be conducted in the case of mutant proteins, using mutant murine or other animal NKIATRE gene sequences.
Homologous recombination using stem cells allows for the screening of gene transfer cells to identify the rare homologous 2~ recombination events. Once identified, these can be used to generate chimeras by injection of mouse blastocyst;s, and a proportion of the resulting mice will show germline transmission from the recombinant line. This methodology is especially useful if inactivation of the NKIATRE gene is desired. For example, inactivation of the NKIATRE
30 gene can be done by designing a DNA fragment which contains sequences from a NKIATRE exon flanking a selectable marker.
Homologous recombination leads to the insertion of the marker sequences in the middle of an exon, inactivating the NKIATRE gene.
DNA analysis of individual clones can then be used to recognize the homologous recombination events.
It is also possible to create mutations in the mouse germline by injecting oligonucleotides containing the mutation of interest and screening the resulting cells by PCR.
In general, techniques of generating transgenic animals are widely accepted and practiced. A laboratory manual on the manipulation of the mouse embryo, for example, is available detailing standard laboratory techniques for the production of transgenic mice (Hogan et al.. 1986).
This embodiment of the invention has t:he most significant potential as a model for acute leukemia and related malignancies in which the function of the NKIATRE gene could be studied as well as the effects of new therapeutic treatments and the design of new drug therapies. Animal models are also valuable in order to study the time frame in which an introduced mutation in the NKIATRE gene causes a malignancy.
Dru~Screenin~
Cell lines may be cultured which express NKIATRE, to which a test compound is added to the culture medium. After a period of incubation, the expression of NKIATRE mRNA and resultant protein product can be quantified to determine any changes in expression as a result of the test compound. Cell lines transfected with constructs expressing mutant or normal NKIATRE can also be used to test the function of compounds developed to modify with the protein function.
Transformed cell lines expressing NKIATRE protein could be mutagenized by the use of mutagenizing agents to produce a malignant phenotype in which the :role of mutated NKIATRE can be studied.
With respect to normal NKIATRE, the effect of protein drugs or agents which interact with the protein's normal function could be studied in order to more precisely define the intracellular role of the protein.
EXAMPLES
The examples are described for the purposes of illustration and are not intended to limit the scope of the invention, Example 1 - Cloning and Sequencing of NKIATRE
Methods:
A degenerate anti-sense oligonucleotide corresponding to the conserved MAPK consensus sequence YV'(AI~TRW, found in subdomain VIII, was synthesized as follows:
CC(AII)CC(G/T)(G/A)GT(G/A)C(C/T/A)A(;(G/A)TA. This oligonucleotide and the Ml3/pLIC forwa:rd amplification primer (Gibco BRL, Gaithersburg MD, USA), were used to amplify DNA isolated from a rat brain library, constructed in ~, ZAPII (Clontech) as previously described (22). PCR was performed in a 50 pl reaction consisting of 10 pmol of degenerate primer, 20 pmol Ml3/pUC Forward amplification primer, 2 mM MgCla, 0.2 mM dNTP, 50 mM KC1. 10 mM Tris-HCl (pH 9.0), 0.1%
Triton X-100, and 0.1 U/~l Taq DNA polymerase (Promega, Madison WI, USA). Before the addition of Taq DNA polymerase each reaction was heated to 94"C for 3 minutes. For 30 cycles the reaction mixtures were denatured at 94°C for 1 minute, allowed to anneal at 5 i°C
for 1 minutes and 30 second, and extended at 72°C for 2 minutes. After all cycles were complete 4 Ll of DNA polymerase I Klenow fragment (Amersham, Amersham UK) were added to create blunt termimi by incubation at, 3 r "C for 30 minutes. A 0. 5 kb product was purified from an agarose gel using the Geneclean II kit (Bio 101, La Jolla CA, USA) and cloned into the Smal site of the pUC 18 plasmid using standard methodology.
DNA sequencing was performed using an AmpliCycle Sequencing Kit (Perkin Elmer, Branchburg NJ, USA). Amplification of the 5' end of cDNA was accomplished with the 5' RACE System (Gibco BRL, Gaithersburg MD, USA).
cDNA library screening was performed as previously described (23). In brief, 5x10' pfu of a rat jejunum ~, zap II cDNA library (Stratagene, La Jolla CA, USA) or of the rat brain cDNA library used for amplification were incubated with XL-1 blue bacteria and plated on each of 10, 150 mm, YT agar plates. The phage DNA from the lysed bacteria cells was transferred to duplicate Hybond-N nylon membranes (Amersham, Amersham UK). After transfer, the filters were denatured for 2 minutes in a solution of 1.5 M NaCl and 0.5 M NaOH, and neutralized for 5 minutes in a solution of 1.5 M NaCl and 0.5 M Tris-HC1 (pH 8). The filters were then briefly rinsed in 2x SSC and allowed to dry at room temperature. DNA was UV crosslinked to the filters using a UV Str atalinker (Stratagene, La Jolla CA, U SA). For screening, the filters were pre-hybridized for two hours at 42°C in a solution of 50°/« formamide, 5x SSC, 5x Denhardt's reagent, 20 mM
Na2P0~, and 0.2 mg/ml salmon sperm DNA. Hybridization was performed overnight at 42°C in a solution of 50'~~> formamide, 5x SSC, 5x Denhardt's reagent, 20 rnM NazPOa, 10°/~ dextran sulphate, 0.2 mg/ml salmon sperm DNA, and. 1x10~~ cpm/ml of probe. To prepare the probe, 25 ng of the PCR product was radiolabelled with 50 ~Ci of [a-3''P]dCTP
using the Multiprime DNA labeling system (Amersham, Amersham UK). Following hybridization, the filters were washed at 55°C in O. lx SSC and 0.1% SDS. Filters were exposed to film overnight at -70°C
with an intensifying screen. Purification of the hybridizing plaques was performed by secondary, tertiary, and quaternary screens, as described above. Excision of the cDNA inserts from the purified phage followed the manufacturer's 7~ZAP II automatic excision protocol (Stratagene, La Jolla CA, USA).
"Anchored PCR" was performed using the degenerate anti-sense oligonucleotide described above and the pUCl8 Universal Forward primer on ~,ZAPII rat brain library target DNA. Products of approximately 500 by were consistently amplified, and were batch cloned into pLTC 18. Sequence analysis of 44 of these products led to the discovery of a single novel putative MAP kinase.
A rat jejunum cDNA library and a rat brain cDNA library were screened with the PCR product to isolate the complete cDNA. Three clones were isolated from the jejunum library which upon sequence analysis were shown to be identical. From the brain library two additional positive phage were isolated, each representing independent clones. Criteria for a full length cDNA included the presence of a Kozak consensus translation initiation sequence of GCCCCC(A/G)CCAUGG
and the presence of an upstream stop codon in the same reading frame as the initiation codon (29). Sequencing of all clones demonstrated that none were complete by these criteria. To determine 5' sequence, "RACE" was performed on rat brain poly(A)+RNA (30) using the sequence specific anti-sense oligonucleotide CAGGCTTTATATCTCCiGTG(~ and a standard poly T anchoring oligonucleotide. A second round of amplification was performed using a nested anti-sense oligonucleotide, GGACTAGTCTTAATGC~CCACTATCCGC to ensure specificity.
Sequence analysis of the amplified products identified a putative initiation methionine with an in-frame upstream si;op codon and an adjacent Kozak consensus sequence, with seven of the thirteen nucleotides conserved at this site, including a purine at position -3 and a guanine at position +4. The complete rat NKIATRE cDNA was sequenced using 12 internal ohgonucleotides.
The cDNA sequence and deduced amino acid sequence of rat 5 NKIATRE are shown in Tables 1, 2 and 3. In Table 3, protein kinase consensus residues are shown in bold face type. The NKIATRE motif and two sites of potential regulation, the SY duplex, and the TDY MAP
kinase-like regulatory region, are boxed.
The cloned rat NKI:ATRE cDNA described above was used to screen 10 a human 7~gt 11 fetal heart genomic library. A human NKIATRE genomic DNA was cloned and the cDNA and amino acid sequence obtained is shown in Table 4. The sequence shown corresponds to nucleotides 424 to 618 and amino acids 121 to 185 of the rat sequences of Table 1 and 2.
15 Example 2 Methods:
Southern and Northern Blot analysis: Total cellular RNA was prepared using the TRIzol Reagent (Gibco BRL, Gaithersburg MD, USA) and from this poly(A)+RNA was prepared using Oligo (dT) 20 cellulose (Boehringer Mannheim Biochemica, Laval PQ, Canada) as follows. 1 g of Ohgo (dT) cellulose was suspended in 20 ml of loading buffer (400 mM NaCl, 20 mM Tris pH 7.4, 10 mM EDTA, 0.2'% SDS) and mixed for 20 minutes at room temperature. Oligo (dT) cellulose was added to each sample of total RNA and each mixture was gently 25 rotated at room temperature overnight. All samples were then spun for 5 minutes at 2000 rpm, washed 2-3 times with 20 ml of loading buffer, and then 2-3 times with 20 ml of wash buffer (100 mM NaCl, 10 mM
Tris pH 7.4, 1 mM EDTA, 0.2°/~ SDS). Cellulose samples were then resuspended in 10 ml of wash buffer and poured into columns (Bio Rad, 30 Hercules California, USA). Columns were packed with 10 ml of wash buffer and then poly(A)+RNA was eluted with five 1 ml volumes of elution buffer pre-warmed to 37°C (1 mM Tris pH 7.4, 1 mM EDTA, 0.2% SDS). Polv(A)+RNA was precipitated overnight at -20°C by the addition of 30 ~g tRNA, 0.6 ml 3 M sodium acetate, and 12 ml 99%
ethanol. Pellets were air dried and resuspended in DEPC-treated water. Ten ~ g of poly(A)+RNA from rat intestine, brain, muscle, lung, spleen, heart, liver, and thymus were used to generate a rat tissue blot.
RNA was fractionated overnight by electrophoresis on a 1.2'%~
formaldehyde agarose gel with buffer recirculation. The gel was then washed thoroughly in DEPC treated water and the RNA was transferred to nylon membrane by capillary transfer. The blot was probed with the 1.3 kb EcoRl fragment of NKIATRE cDNA, radiolabelled with [a-vzP] dCTP, as described above. To control for the level of RNA in each lane, a rat ~i-actin probe was also used.
Southern blot analysis: 10 ~g of rat genomic DNA was digested overnight at 37'~C with either EcoRl, BamHl or HindIII. For the cross species Southern blot, 10 ~,g of either rat, pig, mouse, human or Drosophila genomic DNA was digested overnight at 37°C with EcoRl.
Each of these digests were fractionated overnight by electrophoresis on a 1.0% agarose gel. Following electrophoresis, the geI was incubated with shaking for 15 min at room temperature in 0.1 M HCl, followed by min in a solution of 0.5 M NaOH, 1.5 M NaCI, and then for 45 min in a solution of 1 M Tris pH 7.0, 1.5 M NaCl. The genomic DNA was transferred to nylon membrane by capillary transfer. For all blots, the 1.3 kb EcoRl fragment (nucleotides 1-1372) of the rat jejunum cDNA
25 was radiolabelled with [cx-~32P]dCTP, as described above, and used as a probe. Prehybridization, hybridization, and wash conditions were performed as pr eviously described for the hbr ary screens (section 3.2.1).
Filters were visualized by Phosphor Imager (Molecular Dynamics) using the Image (auant software (Molecular Dynamicsj.
Phylogenetic conservation.
The EcoRl-EcoRl 1.3 kb fragment of the rat NKIATRE cDNA
clone was used to screen rat genomic DNA digested with three separate restriction endonucleases. Results of Southern blotting revealed that three bands hybridized t;o EcoRl digested DNA with approximate sizes of 7.5 kb, 5.6 kb, and 4.7 kb. Two bands of approximately 5.4 kb and 4.0 kb hybridized in BamHl digests, while two bands of 9.4 kb, and 4.7 kb were seen in HindIII digested DNA (figure 4A). Results of cross species Southern blot analysis demonstrates that rat NKIATRE hybridizes to EcoRl digested genomic DNA from rat, pig, mouse, human, and drosophila (figure 4B). No hybridizing bands were seen in EcoRl digested DNA from either, Dactyosteliuna (data not shown) or S.
cereuasaae (data not shown).
Tissue distribution of NKIATRE.
To determine the tissue distribution of NKIATRE, a Northern blot of poly(A)+mRNA from rat intestine, brain, muscle, lung, spleen, heart, liver, and thymus was probed with the 1.3 kb EcoRl fragment of NKIATRE cDNA. Northern blotting revealed bands of 4.4 kb, 2.5 kb or 2.2 kb in brain, muscle, lung, intestine and heart (figure 5). No expression of NKIATRE was seen in rat spleen, liver, or thymus (not shown). Quality of poly(A)+mRNA was determined by probing for rat ~3-actin.
Examt~le 3 - Stimulation. by EGF
Cell culture and transfectaon: NIH 3T3 and HeLa cells were maintained in Alpha medium (Gibco BRIO containing 10'% Cool Calf serum (Gibco BRL). Semiconfluent cells grown on 10 cm plastic dishes (Nunc) were tr ansfected with 10~g of individual expression constructs using Lipfectin (Gibco BRL) as described (25). To achieve high level expression, HeI,a cells w-ere infected with recombinant human vaccinia virus, directing the expression of T7 RNA polymerase (26) one hour prior to the introduction of T7 polymerase-driven expression plasmids.
Transfected NIH 3T3 cells were selected in culture with 150 ~.g/ml 6418 (Sigma).
Immunoprecipatation: Cells (1 x 1()s) were lysed on ice for 1 hour in 500 X10.1% NP40> 125 mM NaCl, 25 mM Tris, pH 7.2 with the protease inhibitors leupeptin 1 ~.g/ml, aprotinin 1 ~g/ml and 1 mM
phenylmethylsulfonyl fluoride, followed by centrifugation. Phosphatase activity was inhibited by 5 mM sodium orthovanadate and 50 mM
dibasic sodium pyrophosphate (Sigma). I~ysates were incubated on ice with 5 ~1 PY20 antibody for 2 hours followed by incubation with 50 ~1 of Sepharose protein A beads (Pharmacia) at 4°C with agitation.
Precipitates were washed 4 times with 1 ml of ice cold lysis buffer.
Kanase Assay: In vitro kinase reactions were performed using immunoprecipitated bead immobilized HA fusion proteins and myelin basic protein (Sigma) as a substrate. Each reaction was performed in a final volume of 50 ~.l containing 25 ~l of 2X kinase buffer (100~M
[3zP]ATP, lOmM MgCl, 50 mM Tris HCl-pH 7.5, 1mM EDTA), 5 ~1 of myelin basic protein (1 ~.g/ml) or cJun (1 u.glml) dissolved in distilled water and 20 ~,l of immobilized kinase slury. Samples were incubated at 37° for 30 minutes. Reactions were terminated by the addition of 50 ~,1 of 2X SDS protein loading buffer followed by boiling for 10 minutes.
Products were separated on an 8'% polyacrylamide protein gel followed by transfer to a PVDF membrane (Immobilon N, Millipore) and phosphoimaging as described above.
A characteristic of MAP kinases is activation by extracellular stimuli. To evaluate NKIATRE activity after a variety of extracellular stimuli, (HA)NKIATREpcDNA3, a plasmid directing the expression of epitope tagged full length kinase, or the mutant (HA)NKIATRE(ADF)pcDNA3 were transiently transfected into HeLa cells. Cells had been infected 1 hour previously with a human recombinant vaccinia virus, engineered to express T7 RNA polymerase.
After 48 hours, cells expressing wildtype protein were washed and resuspended in 0.1% fetal calf serum for 12 hours. Cells (2 x 106) were then exposed for 30 minutes either to medium containing 10 or 20%
FCS, 10 nM PMA, 20-60 ng/ml EGF, 400 mM sorbitol and 500 ~glml anisomycin, or to germicidal LTV light [ 254 nm (General Electric)] for 10 minutes. Cells were then washed, harvested and ly sed. (HA)NKIATRE
was immunoprecipitated and its activity towards myelin basic protein (MBP) was evaluated in vitro as described above. Figure 3A
demonstrates that NKIATRE is quiescent in serum starved cells and is not stimulated by brief exposures to either stress stimuli, or to growth stimulants such as FCS and PMA, however mild stimulation was observed after overnight incubation with 10°/> FCS. In contrast, activation was observed after EGF stimulation in a dose dependent manner, with a 15 fold increase observed after a 30 minute exposure (Figure 3B). These observations demonstrate a very specific pattern of activation by extracellular stimuli.
Example 4 - Expression of NKIATRE and S phase Entry Vector Construction and mutagenesis: NKIATRE was mutated at threonine 158 and tyrosine 160, putative sites of activating phosphorylation, to alanine and phenylalanine, respectively, using the 4 primer mutagenesis protocol, as previously described (10) and the sense oligonucleotide GGAGACGTTTACGCACxAATTCGTGGCCACCCGCTGG. Asparagine 143 of NKIATRE was similarly mutated to aspartic acid using the sense sequence X. NKIATRE was cloned in frame, downstream of the sequence ATGGCTTACC;CATACGATGTTCCAGAT, defining the influenza hemagglutinin epitope tag (HA) MAYPYDVPD, and was cloned into the pcDNA3 plasmid (Invitrogen). NKIATRE was expressed as a eukaryotic GST fusion protein in the plasmid pEBG and as a prokaryotic GST fusion using pGEX-KG as previously described (24).
PCMVCD20 pcDNA3, p2lw'aF~ and N144CDK2 were gifts of Dr. E.
5 Harlow (Massachusetts General Hospital, Boston MA).
Brd U cell stainin~~ and Flow Cytonzetry: Analysis of growth parameters in transiently transfected cells was performed as previously described (27). In brief, cos cells were transiently transfected with both pCMVCD20 and (HA)NI~IATREpcDNA3 or mutant forms in a molar 10 ratio of 1:5. Thirty six hours later, cells (5 x l0e) were pulsed with 10 pM BrdU for 16 hours then trypsinized, washed in PBS and resuspended in 2 ml IFA buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 4% fetal calf serum, 0.1°rb NaNs) to neutralize trypsin. Cells were then centrifuged and incubated at 4°C for 1 hour in 901 of PBS containing 15 2% FCS (PBS-F) and 101 of anti-human CD20-RPE. Cells were washed in PBS-F and resuspended in 0.5 ml ice-cold 0.15M NaCl and fixed by dropwise addition of 1.2 ml ice-cold 90% ethanol while gently vortexing on ice. After 30 min incubation on ice, cells were washed, and resuspended in 1'% paraformaldehyde and 0.01°~~ Tween-20. Cells were 20 centrifuged and resuspended in 1 ml freshly prepared DNAse I solution (50 Kunitz U/ml bovine pancreas deoxyribonuclease I (Sigma), 4.2 mM
MgClz/0.15M NaCl pH5). Cells were incubated 10 min at room temperature, washed in pBS-F and resuspended in 10 ~l anti-BrdU-FITC Becton-Dickinson). Samples were incubated at room temperature 25 for 30 min, washed, and resuspended in 2 ml PBS-F. Analysis was done using an EPICS-XL flow cytometer (Coulter) with 488 nm excitation and 525 nm and 575nm bandpass filters. Fluorescence was measured in at least 2000 CD20 positive cells for each sample. Results were analyzed using the WinMDI software (J. Trotter, Scripps Research 30 Institute).
Rat-1 fibroblast cells were co-transfected with (HA)NKIATREpcDNA3, (HA)NKIATRE(AEF)pcDNA3 or pcDNA3 control plasmid with pCaVIVCD20, in a 1:5 ratio, to allow identification of DNA uptake using a flow cytometric technique. As controls for mediators of S phase entry, samples were transfected with plasmids directing the expression of p21~~'Af'' and a dominant negative form of CKD2. Cell transfection efficiencies were 20+I- 10'% in all cases as indicated by CD20 expression. The S phase fraction among transfected cells was evaluated and compared to cells transfected with vector alone.
Results are shown in Figure 4. Eighty percent of vector transfected cells were in S phase during the 16 hour period of Br dU labeling. As expected, the dominant negative CDK2 mutant and p2lw'AF decreased the number of S phase cells to 55'% and 52% respectively. Similarly, overexpression of wild type NKIATRE decreased the proportion of S
phase cells to 60%. The kinase dead mutant of NKIATRE also reduced the proportion of cells entering S phase, again suggesting that phosphorylation at the TDY motif is not required far this biological activity. These data show that NKIATRE expression leads to decreased cell growth.
Example 5 - Chromosomal Localization of Human NKIATRE
The human genomic DNA clone obtained as described in Example 1 was used as probe in Fluorescent In Situ Chromosomal Hybridization (FISH) performed on normal human peripheral lymphocytes, to determine the chromosomal location of the gene for human NKIATRE.
The method used was based on published procedures (28).
Hybridization was carried out for 16 to 20 hours at 37°C. This was followed by three 5-min washes in 50'% formamide and 2 x SSC at 42°C.
All procedures involving the handling of fluorescein isothiocyanate (FITC) were per formed in subdued lighting. The slides were soaked in 3% BSA in 4 x SSC blocking solution for 30 min. before being incubated in FITC - avidin (Oncor :Laboratories, Gaithersburg, MD, USA) at 5 ~g for 390 min at 3 7 °C. Fluorophores were washed off with 4 x SSC
0.1°/, Tween 20 at 42°C using three 3-minute washes. To amplify the FITC
signal biotinylated anti-avidin antibody (Oncor was added to each slide, and the slides were incubated at 37°C for 30 min. This was followed by further washes in 4 x SSC 0.1"% Tween 20 at 42°C, another incubation with FITC-avidin, a second series of washes as above, and counterstaining with either 0.2~,g/ml DAPI, or 0.2 yglml propidium iodide (Boehringer Mannheim. Indianapolis, IN, USA) or with both counter stains as a mixture for 2 min. The slides were washed in phosphate buffered saline (PBS) for ~ min and mounted in 20 mM Tris-HCL, pH 8.0, 90'% glycerol containing 2.3% D.ABCC) antifade (1,4 diazabicyclo-[2.2.2] octane). The photomicrographs were obtained using a Nikon Microphot FXA epifluorescence microscope equipped with dual band TITC/Texas red filters (Omega Optical Inc. FL, USA). The images were captured by a thermoelecarically cooled charge coupled (CCD) camera (Photometrics, Tucson. AZ, USA). For these images, separate propidium iodide-stained nuclei and chromosomes, and hybridization signals were acquired and merged using image analysis software (courtesy of Tim Rand and David Ward, Yale University, New Haven, CT, USA).
Localization of the probe indicated that the human NKIATRE
gene is on chromosome ~iq3l.1 (Data not show n).
Example 6 - NKIATRE Gene Loss and Acute Leukemia FISH was performed on primary acute myeloblasts from nineteen acute leukemia patients known from cytogenetic analysis to have 5q31 deletion. A bacterial artificial chromosome probe consisting of the telomeric region 5p15 was used in combination and provided an internal control for hybridization. Scoring criteria: Each round of FISH
comprised four patient samples and one normal lymphocyte control.
Patient blasts previously identified to contain a single 5q31 deletion were analyzed. Only those cells that contained two red 5p15 signals, which was used as an internal control, were scored. Each cell was then scored based on the number of green 5q31 (NKIATRE) signals. Two green signals indicated a "contaminating" normal cell, whereas one or zero signals indicated malignant cells. If both 5q31 signals were missing cells were scored as having deleted both copies of NKIATRE.
Fifty cells were counted on each slide. Background absence of hybridization among cells displaying two 5q15 alleles was determined from each normal slide as a percentage of cells with one or zero signals.
This background frequency was subtracted from the patient data to normalize for hybridization efficiency. In order to calculate the percentage of deleted cells, the number of one and zero signals were pooled defining the denominator. The number of zero signals defined the numerator. Table 4 demonstrates that malignant cells ranged from 0 to 61.5% deletion of both copies of NKIATRE, with >60% of patients known from cytogenetic analysis to be missing one NKIATRE locus having the second allele deleted.
Example 7 - NKIATRE knock-out mice A NKIATRE knock-out mouse is generated using the technique of embryonic stem (ES) cell homologous recombination, as described by Fung-Leung et al., (1992), Imrnunology, v. 4, pp. 189-192.
Briefly, the genornic sequence of mouse NKIATRE is isolated by phage library screening using a rat NKIATRE nucleic acid sequence as disclosed herein. The sequence surrounding exon 1 of the mouse DNA
is obtained and cloned into a standard plasmid vector by conventional methods. A bacterial neomycin resistance gene is inserted in an anti-sense orientation into the coding region of exon 1 t-o create an inactive mutation.
The mutant NKIATRE is introduced into the mouse embryonic stem cells by electropora.tion, followed by subsequent selection in neomycin containing tissue culture medium. ES cell clones harboring a single homologous integration of mutant NKIATRE are identified by PCR screen and southern analysis. Mutant ES cells are introduced into murine blastocysts and then implanted into the uteri of hormonally manipulated mice. Chimeric mice born are bred to identify individuals in which germline heterozygous mutation of NKIATRE has been achieved. Heterozygous mutated mice are mated to homozygosity.
Homozygous deleted mice show development; of hyperproliferation of hematopoietic tissues, resulting in acute leukemia.
References:
1. Yan M, Templeton DJ. Identification of 2 serine residues of MEK-1 that are differentially phosphorylated during activation by raf and 5 MEK kinase. Journal of Biological Chemistry 1994; 269:19067-73.
2. Davis RJ. The mit,ogen-activated protein kinase signal transduction pathway. [Review]. J Biol Chem 1993;268:14553-6.
10 3. Davis RJ. MAPKs: new JNK expands the group. [Review].
Trends in Biochemical Sciences 1994;19:470-3.
4. Yan M, Dai T, Deak JC, Kyriakis JM, Zon Ll, Woodgett JR, Templeton DJ. Activation of stress-activated protein kinase by MEKK1 15 phosphorylation of its activator SEK1. Nature 1994; 372:798-800.
5. Lin A, Minden A, Martinetto H, Claret F, Lange-Carter C, Mercurio F, Johnson G, Karin M. Identification of a dual specificity kinase that activates the jun kinases and p38-mpk2. Science 20 1995; 268:286-90.
6. Payne DM, Rossomando AJ, Martino P, Erickson AK, Her JH, Shabanowitz J, Hunt DF, Weber MJ, Sturgill TW. Identification of the regulatory phosphorylation sites in pp42/mitogen-activated protein 25 kinase (MAP kinase). EMBO J 1991;10(4):885-92.
7. Posada J, Cooper JA. Requirements for phosphorylation of MAP
kinase during meiosis in Xenopus oocytes. Science 1992;255(5041):212 5.
8. Sanchez I, Hughes RT, Mayer BJ, Yee K, Woodgett JR, Avruch J, Kyriakis JM, Zon LI. Role of SAPK/ERK kinase-1 in the stress-activated pathway regulating transcription factor c-Jun. Nature 1994; 372:794-8.
9. Brondello JM, McKenzie FR, Sun H, Tonks NK, Pouyssegur J.
Constitutive MAP kinase phosphatase (MKP-1) expression blocks G1 specific gene transcription and S-phase entry in fibroblasts. Oncogene 1995;10:1895-904.
Constitutive MAP kinase phosphatase (MKP-1) expression blocks G1 specific gene transcription and S-phase entry in fibroblasts. Oncogene 1995;10:1895-904.
10. Sun H, Tonks NK, Bar-Sagi D. Inhibition of Ras-induced DNA
synthesis by expression of the phosphatase MKP-1. Science 1994;266:285-8.
synthesis by expression of the phosphatase MKP-1. Science 1994;266:285-8.
11. Kyriakis JM, Banerjee P, Nikolakaki E, Dai T, Rubie EA, Ahmad MF, Avruch J, Woodgett JR. The stress-activated protein kinase subfamily of c-Jun kinases. Nature 1994; 369:156-60.
12. Woodgett. JR, Avruch J, Kyriakis ~1. The stress activated protein kinase pathway. [Review] [41 refs]. Cancer Surveys 1996;127-388.
13. Deacon, K. and Blank, J. L, Charactrization of the mitogen-activated protein kinase kinase 4 (MKK4)Ic-jun NH2-terminal kinase 1 and MKK3/p38 pathways regulated by MEK kinases 2 and 3. J Biol Chem 272(22), :14489-14496. 1997. (GENERIC) Ref Type: Generic
14. Zanke BW, Boudreau K. Rubie E, Winnett E, Tibbles LA, Zon LI, Kyriakis JM, Liu F-F, Woodgett JR. The stress-activated protein kinase pathway mediates cell death following injury induced by cis-platinum, LTV irradiation or heat. Current Biology 1996;6:606-13.
15. Xia A, Dickens M, Raingeaud J, Davis RJ, Greenberg ME.
Opposing effects of ERK and JNK-p38 MAP kinases on apoptosis.
Science 1996;2 70:1326-31.
Opposing effects of ERK and JNK-p38 MAP kinases on apoptosis.
Science 1996;2 70:1326-31.
16. Waga S, Hannon (~J, Beach D, Stillman B. The p21 inhibitor of cyclin-dependent kinases controls DNA replication by interaction with PCNA [see comments]. :Mature 1994;369(6481):574-8.
17. Zanke BW, Rubie EA, Boudreau K, McGinnis M, Yan M, Templeton DJ, Woodgett JR. Insulation of mammalian MAP kinase pathways through formation of specific kinase:activator complexes. J
Biol Chem 1996;271(47}:29876-81.
Biol Chem 1996;271(47}:29876-81.
18. Catherino WH, Jordan VC. The biological action of cDNAs from mutated estrogen receptors transfected into breast cancer cells. Cancer Letters 1995;90:35-42.
19. Poon RY, Hunter 'T. Dephosphorylation of Cdk2 Thr160 by the cyclin-dependent kinase-interacting phosphatase KAP in the absence of cyclin. Science 1995;270(5233):90-3.
20. Atherton-Fessler S, Parker LL, Geahlen RL, Piwnica-Worms H.
Mechanisms of p34cdc2 regulation. Molecular & Cellular Biology 1993;13:1675-85.
Mechanisms of p34cdc2 regulation. Molecular & Cellular Biology 1993;13:1675-85.
21. Lavoie, J. N., L'AIlemain, G.. Brunet, A., Muller, R., and Pouyssegur, J. Cyclin D:l expression is regulated positively by the p421p44MAPK and negatively by the p38HOCIMAPK pathway. J Biol Chem 271(34), 20608-20616. 1996. (GENERI(~) Ref Type: Generic
22. Albanese, C., Johnson, J., Watanabe, CL, Eklund, N., Vu, D., Arnold, A., and Pestell, 1~,. G. Transforming p2lras mutants and c-Ets-2 activate the cyclin D 1 promoter through distinguishable regions. J Biol Chem 270(40), 23589-23597. 1995. (GENERIC) Ref Type: Generic
23. Aktas, H., Cai, H., and C',ooper, G. M. Ras links growth factor signaling to the cell cycle machinery via regulation of cyclin Dl and the CDK inhibitor p27KIP1. molecular and cellular biology 17, 3850-3857.
1997. (GENERIC) Ref Type: Generic
1997. (GENERIC) Ref Type: Generic
24. Peepe, D. S., Upton, T. M., Ladha, M. H., Neuman, E., Zalvide, J., Bernards, R., DeCaprio, J. A., and Ewen, M. E. Ras signalling linked to the cell-cycle machinery by the retinoblastoma protein. Nature 386, 177-181. 1997. (GENERIC) Ref Type: Generic
25. Fan, J. and Bertino, J. R. K-ras modulates the cell cycle via both positive and negative regulatory pathways. Oncogene 14, 2595-2607.
1997. (GENERIC) Ref Type: Generic
1997. (GENERIC) Ref Type: Generic
26. Molnar A, Theodoras AM, Zon LI, Kyriakis aIM. Cdc42Hs, but not Racl, inhibits serum-stimulated cell cycle progression at G1/S through a mechanism requiring p38/RK. Journal of Biological Chemistry 1997; 272(20):13229-35.
27. Coso OA, Chiariello M, Yu J-C, Teramoto H, Crespo P, Xu N, Miki T, Gutkind JS. The small GTP-binding proteins Racl and Cdc42 regulate the activity of the JNK/SAPK signaling pathway. Cell 1995; 81:1137-46.
28. Minden A, Lin A, Claret. F-X, Abo A, Karin M. Selective activation of the JNK signaling cascade and c-Jun transcriptional activity by the small GT:Pases Rac and Cdc42Hs. Cell 1995;81:1147-57.
29. Taglienti, C. A., VVysk, M., and Davis, R. J. Molecular cloning of the epidermal growth factor-stimulated protein kinase p56 KKIAMRE.
Oncogene 13, 2563-2574. 1996. (GENERIC) Ref Type: Generic
Oncogene 13, 2563-2574. 1996. (GENERIC) Ref Type: Generic
30. Meyerson M, Enders GH, Wu CL, Su LK, Gorka C, Nelson C, Harlow E, Tsai LH. A family of human cdc2-related protein kinases.
EMBO J 1992;11(8):2909-17.
EMBO J 1992;11(8):2909-17.
31. Zanke BW, Suzuki H, Kishihara K, Mizzen L, Minden M, Pawson A, Mak TW. Cloning and expression of an inducible lymphoid-specific, protein tyrosine phosphatase (HePTPase). European Journal of Immunology 1992;22:235-9.
32. Blakely RD, Clark JA, Rudnick G, Amara SG. Vaccinia-T7 RNA
polymerase expression system: evaluation for the expression cloning of plasma membrane transporters. Anal.Biochem. 1991;194(2):302-8.
polymerase expression system: evaluation for the expression cloning of plasma membrane transporters. Anal.Biochem. 1991;194(2):302-8.
33. Haq R and Zanke B. Transient assay of antiproliferative effects of genes using flow cytometry. Biotechniques 1998;
34. Kozak M. An analysis of vertebrate mRNA sequences:
intimations of translational control. [Review] [430 refs]. Journal of Cell Biology 1991;115(4):887-903.
intimations of translational control. [Review] [430 refs]. Journal of Cell Biology 1991;115(4):887-903.
35. Tibbles LA, Ing YL, Kiefer F, Chan J, Lscove N. Woodgett JR, Lassam NJ. MLK-3 activates the SAPKIJNK and p38/RK pathways via SEKl and MKK3/6. EMBO J 1996;15(24):7026-35.
36. Hanks SK, (~uinn AM, Hunter T. The protein kinase family:
Conserved features and deduced phylogeny of the catalytic domains.
Science 1988:241:42-52.
Conserved features and deduced phylogeny of the catalytic domains.
Science 1988:241:42-52.
37. Levin DE, Errede B. The proliferation of MAP kinase signaling pathways in yeast. Current Biology 1995;7:197-202.
38. Choi KY, Satterberg B, Lyons DM, Elion EA. SteS tethers multiple protein kinases in the MAP kinase cascade required for mating in S. cerevisiae. Cell 1994; 78:499-512.
39. Printen JA, Sprague GFJ. Protein-protein inter actions in the yeast pheromone response pathway: SteS interacts with all members of the MAP kinase cascade. Genetics 1994:138:609-19.
40. Brewster JL, de Valoir T, Dwyer ND, Winter E. Gustin MC.
Anosmosensing signal transduction pathway in yeast. Science 1993; 259:1760-3.
Anosmosensing signal transduction pathway in yeast. Science 1993; 259:1760-3.
41. Wilks AF. Two putative protein-tyrosine kinases identified by application of the polymerase chain reaction. Proceedings of the National Academy of Sciences of the United States of America 1989; 86(5):1603-7.
42. Norbury C, Blow J, Nurse P. Regulatory phosphorylation of the p34cdc2 protein kinase in vertebrates. EMBO J 1991;10:3321-9.
43. Prasad KA, Church JG. EGF-dependent growth inhibition in MDA-468 human breast cancer cells is characterized by late G1 arrest and altered gene expression [published erratum appears in Exp Cell Res 1991 Oct;196(2):365]. Experimental cell Research 1991;195(1):20-6.
44. Jakus J, Yeudall WA. Growth inhibitory concentrations of EGF
induce p21 (WAFIlCip1) and alter cell cycle control in squamous carcinoma cells. Oncogene 1996;12:2369-76.
induce p21 (WAFIlCip1) and alter cell cycle control in squamous carcinoma cells. Oncogene 1996;12:2369-76.
45. Konger RL, Chan TCK. Epidermal growth factor induces terminal differentiation in human epidermoid carcinoma cells. J Cell Physiol 1993;156:515-21.
46. Filmus J, Pollak MN, Cailleau R, Buick RN. MDA-468, a human breast cancer cell line with a high number of epidermal growth factor (EGF) receptors, has an amplified EGF receptor gene and is growth inhibited by EGF. Biochemical & Biophysical Research Communications 1985;1_28:898-905.
47. David M, Petricoin III E, Benjamin C, Pine R, Weber NIJ, Larner AC. Requirement for MAP kinase (ERK2) activity in interferon a -and interforon b-stimulated gene expression through STAT proteins.
Science 1995;269:1721-3.
Science 1995;269:1721-3.
48. Xie W, Su K, Wang D, Paterson AJ, Kudlow JE. MDA468 growth inhibition by E(~F is associated with the induction of the cyclin-dependent kinase inhibitor p21WAF1. Anticancer Research 1997;17:2627-34.
49. Chin YE, Kitagawa M, Su WC, You ZH. Iwamoto Y, Fu XY. Cell growth arrest and induction of cyclin-dependent kinase inhibitor p21 WAF11CIP1 mediated by STAT1. Science 1996;2'72(5262):719-22.
50. David M, Wong.L., Flavell R, Thompson SA, Wells A, Larner AC, Johnson GR. STAT activation by Epidermal Cxrowth Factor (EGF) and amphiregulin. The Journal of Biological Chemistry 1996;271:9185-8.
51. Ihle JN. STATs and MAPKs: obligate or opportunistic partners in signaling. [Review] [13 refs]. Bioessays 1996;18(2):95-8.
CGGCGGGACT ACAGGATGGG CTGAGGCc~GC GGCGATTCTC AGGACGAGAA GCCAGGCTTG
AAAA_TGGAGA TGTATGAAAC CCTTGGAi~AA GTAGGAGAGG GAAGTTATGG AACGGTCATG
AAATGCAAGC ATAAGGATAC TGGGCGGATA GTGGCCATTA AGATATTCTA TGAGAAACCA
GAAAAATCTG TCAACAAAAT TGCAACGAGA GAAATAAAGT TTCTAAAGCA ATTTCGTCAT
GAAAACCTGG TCAATCTGAT TGAAGTT'PTT AGACAAAAAA AGAAAATCCA TTTGGTATTT
GAGTTTATTG ACCACACGGT CTTAGATGAG TTACAGCATT ATTGTCACGG ATTAGAGAGT
AAGCGACTAA GAAAGTACCT GTTCCAGATC CTCCGAGCGA TCGAGTATCT GCACAACAAC
AACA'I'TATCC ACCGAGATAT AAAGCCTGAG AATATTTTAG TCTCCCAGTC AGGAATTACA
AAGCTCTGCG ATTTTGGGTT TGCGCGGACA CTAGCAGCTC CTGGAGACGT TTACACAGAC
TACGTGGCCA CCCGCTGGTA CAGAGCTCCA GAGCTGGTGT TGAAAGACAC CACCTATGGA
AAACCAGTGG ATATCTGGGC TTTGGGC'PGT ATGATCATTG AAATGGCCAC TGGCAATCCC
TACCTTCCTA GCAGTTCCGA TTTGGAT'PTG CTCCACAAGA TTGTTTTAAA AGTAGGCAAC
CTGACCCCGC ACCTGCACAA TATTTTT'PCC AAGAGTCCCA TCTTTGCTGG GGTGGTTCTT
CCTCAAGTTC AACATCCCAA AAACGCAAGA AAGAAATACC CAAAGCTCAA CGGATTGCTG
GCAGATATAG TTCATGCTTG TTTACAP.ATT GATCCTGCTG AGAGGATATC ATCCACCGAT
CTTTTGCATC ACGATTACTT TACTAGAGAT GGATTTATTG AGAAATTTAT ACCAGAGCTG
AGAGCTAAGT TATTACAGGA AGCAAAGGTT AATTCATTTA TAAAGCCAAA AGAGAATTTT
AAGGAAAATG AACCTGTGAG AGATGAGAAA AAACCAGTTT TTACCAACCC TCTGCTCTAT
GGAAACCCAA CACTTTATGG AAAGGAAGTG GACAGAGACA AAAGGGCCAA GGAGCTCAAA
GTCAGAGTCA TTAAGGCCAA AGGGGGAAAA GGAGACGTCC CAGACCTGAA GAAGACAGAG
AGTGAAGGTG AACACCGCCA GCAGGGCACA GCTGAGGACA CACACCCCAC ATCACTGGAC
AGGAAGCCTT CTGTCTCGGA ACTAACAAAC CCTGTCCATC CCAGTGCGAA TTCTGACACT
GTCAAAGAAG ACCCACACTC TGGGGGC'PGT ATGATAATGC CACCTATCAA CCTGACAAGC
AGTAATTTGT TGGCCGCAAA TCCCAGT'PCA AACCTCTCCC ACCCCAATTC ACGGTTAACT
GAAAGAACAA AAAAGAGACG CACCTCT'PCA CAAACTATTG GACAAACTTT GTCTAATAGC
AGACAAGAGG ACACAGGTCC CACACAAGTC CAAACAGAGA AAGGTGCATT TAATGAGCGA
ACAGGTCAGA ATGCAAAATA GCAAGTGGAA ACAAAAGAAA ACTGAATTTT TCCAAATGCG
ACAGGAAAGA ATTCCATTTC CCTGAGC'PGC CGTTCACAAT ACAGGC.'GAAG GAGATGAAAG
GGATGGAGGT TAAACAGATA AAAGTGC'PGA AGAGAGAATC AAAGAAAACG GATTCACC
MEMYETLGKVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKIATREIKFLKQFRHENL
VNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIEYLHNNNIIHR
DIKPENILVSQSGITKLCDFGFAR'rLAAPGDVYTDYVATRWYRAPELVLKDTTYGKPVDIWA
LGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLTPHLHNIFSKSPIFAGVVLPQVQHPKNA
RKKYPKLNGLLADIVHACLQIDPAERISSTDLLHHDYFTRDGFIEKFIPELRAKLLQEAKVN
SFIKPKENFKENEPVRDEKKPVFTNPLLYGNPTLYGKEVDRDKRAKELKVRVIKAKGGKGDV
PDLKKTESEGEHRQQGTAEDTHPTSLDRKPSVSELTNPVHPSANSDTVKEDPHSGGCMIMPP
INLTSSNLLAANPSSNLSHPNSRL'rERTKKRRTSSQTIGQTLSNSRQEDTGPTQVQTEKGAF
NERTGQNAK
L cgg gac tac agg 13 atg ggc tga ggc ggc ggc gat tct cag gac gag aag cca ggc ttg aaa ATG GAG ATG
TAT
1 * M E M Y
76 GAA ACC CTT GGA AAA GTA GGA GA(i GGA AGT TAT GGA ACG GTC ATG AAA TGC AAG
CAT AAG
E T L G K V G E G S Y G T V M K C K H K
136 GAT ACT GGG CGG ATA GTG GCC AT'P AAG ATA TTC TAT GAG AAA CCA GAA AAA TCT
GTC AAC
GTC AAT
256 CTG ATT GAA GTT TTT AGA CAA AAi~ AAG AAA ATC CAT TTG GTA TTT GAG TTT ATT
GAC CAC
316 ACG GTC TTA GAT GAG TTA CAG CA'P TAT TGT CAC GGA TTA GAG AGT AAG CGA CTA
AGA AAG
376 TAC CTG TTC CAG ATC CTC CGA GC(3 ATC GAG TAT CTG CAC AAC AAC AAC ATT ATC
CAC CGA
GAT TTT
496 GGG TTT GCG CGG ACA CTA GCA GC'P CCT GGA GAC GTT TAC.' ACA GAC TAC GTG GCC
ACC CGC
556 TGG TAC AGA GCT CCA GAG CTG GT(3 TTG AAA GAC ACC ACC.' TAT GGA AAA CCA GTG
GAT ATC
616 TGG GCT TTG GGC TGT ATG ATC AT'P GAA ATG GCC ACT GGC AAT CCC TAC CTT CCT
AGC AGT
CAC CTG
CAA CAT
796 CCC AAA AAC GCA AGA AAG AAA TAt~ CCA AAG CTC AAC GGA TTG CTG GCA GAT ATA
GTT CAT
856 GCT TGT TTA CAA ATT GAT CCT GC'P GAG AGG ATA TCA TCC ACC GAT CTT TTG CAT
CAC GAT
916 TAC TTT ACT AGA GAT GGA TTT AT'P GAG AAA TTT ATA CCA GAG CTG AGA GCT AAG
TTA TTA
976 CAG GAA GCA AAG GTT AAT TCA TT'P ATA AAG CCA AAA GAG AAT TTT AAG GAA AAT
GAA CCT
1036 GTG AGA GAT GAG AAA AAA CCA GT'P TTT ACC AAC CC'P CTC~ CTC TAT GGA AAC
CCA ACA CTT
1096 TAT GGA AAG GAA GTG GAC AGA GAt~ AAA AGG GCC AAG GAG CTC AAA GTC AGA GTC
ATT AAG
GAA CAC
TCT GTC
1276 TCG GAA CTA ACA AAC CCT GTC CA'P CCC AGT GCG AA'P TCT GAC ACT GTC AAA GAA
GAC CCA
TTG GCC
AAA AAG
1456 AGA CGC ACC TCT TCA CAA ACT AT'P GGA CAA ACT TTG TCT AAT AGC AGA CAA GAG
GAC ACA
1516 GGT CCC ACA CAA GTC CAA ACA GAG AAA GGT GCA TT'P AAT GAG CGA ACA GGT CAG
AAT GCA
caagtggaaacaaaagaaaactgaatttttccaaatgcgacaggaaagaattccatttccctgagctgccgt tcacaatacaggcgaaggagatgaaagggatggaggttaaacagataaaagtgctgaagagagaatcaaagaaaacgga t 1734 tcacc ATCATTCATC GAGATATAAA ACCTGAGAAT ATTTTAGTAT CCCAGTCAGC~
AATTACTAAG CTCTGTGATT TT(~GTTTTGC ACGAACACTA GCAGCTCCTG
GGGACATTTA TACGGACTAT GT(~GCCACAC GCTGGTATAG AGCTCCCGAA
TTAGTATTAA AAGATACTTC TTATGGAAAA CCTGTKGATA TCTGGGCT
IIHRDIKPENILVSQSGITKLCDF(JFARTLAAPGDIYTDYVATRWYRAPELVLKDTSYGKPV
DIW
NKIATRE ..............................MEmYetLgkVGEGsYGtVmKckhkdTGrIV
KKIALRE ..............................mMEkYekigkIGEGsYGvVFKcrnrdTGqIV
KKIAMRE ..............................MEkYenLgIVGEGsYGmVmKcrnkdTGrIV
CDKl ..........................-....MEdYtkiekIGEGtYGvVYKgrhktTGqW
CDK2 ..............................MEnFqkvekIGEGtYGvVYKArnklTGeW
ERKl eprgtagvvpvvpgevevvkgq....pfdvgprYtqLqyIGEGaYGmVssAydhvrktrV
ERK2 .......maaaaaagpemvrgq....vfdvgprYtnLsyIGEGaYGmVCsAydnlnkvrV
SAPK ........msdsksdgqfysvqvadstftvLkrYqqLkpIGsGaqGiVCaAfdtvlGinV
p38 ..........msqerptfyrqelnktiwevpErYqnLspVGsGaYGsVCaAfdtkTGhrV
Consensus --------------------------------ME-Y---L---IGEG-YG-VCKA----TG-IV
NKIATRE AIKiFye.kpeksVnKiAt:REIkFLKqFRHENIVnLiEVFrqkkki......hLVFEFiD
KKIALRE AIKKFleseDdpvIkKiAIREIrMLKqLkHpNIVnLLEVFrrkrrL......hLVFEYcD
KKIAMRE AIKKFlesdDdkmVkKiAmREIkLLKqLRHENIVnLLEVckkkkrw......YLVFEFvD
CDK1 AmKKirlesEeegVpstAiREIsLLKeLRHpNIVsLqDVLmqdsrL......YLIFEFLs CDK2 AlKKirxdtEtegVpstAiREIsLLKeLnHpNIVkLLDVihtenkL......YLVFEFLh ERK1 AIKKis.pfEhqtycqrtlREIqiLIgFRHENVIgirDIL.raptLeamrdvYiVqDLME
ERK2 AIKKis.pfEhqtycqrtlREIkiLIrFRHENIIginDIi.raptieqmkdvYiVqDLME
SAPK AVKKLsrpfqnqthaKrAyREIvLLKcvnHkNIIsLLnVFtpqktLeefqdvYLVmELMD
p38 AVKKLsrpfqsiihaKrtyRElrLLKhMkHENVIgLLDVFtparsLeefndvYLVthLMg Consensus AIKKF----E----V-K-A--REI-LLK-LRHENIV-LLDVF-----L------YLVFE-MD
NKIATRE htvldeLqhychg..Les~crlrkYLF'QILraIeYlHnnNIIHRDiKPeNiLVsqsgitKL
KKIALRE htvlheLdryqrg..vpehlVksitWQtLqaVnFcHkhNcIHRDvKPeNiLItkhsviKL
KKIAMRE htilddLelfpng..LdyqvVqkYLFQIinGIgFcHShNIIHRDiKPeNiLVsqsgvvKL
CDKl mDLkkyLdsippgqyMds:~lVksYLYQILqGIvFcHSrrVIHRDLKPqNLLIddkgtiKL
CDK2 qDLkkfMdasaltg.iplplIksYLFQILqGlaFcHShrVIHRDLKPqNLLIntegaiKL
ERKl tDLyklLk....sqqLsndhIcyFLYQILrGIkYiHSaNVIHRDLKPsNLLInttcdlKi ERK2 tDLyklLk....tqhLsndhIcyFLYQILrGIkYiHSaNVIHRDLKPsNLLlnttcdlKi SAPK anLcqvih.....meLdhermsyLLYQmLcGIkhlHSagIIHRDLKPsNivVksdctlKi p38 aDLnnivk....cqkLtddhVqfLiYQILrGIkYiHSadIIHRDLKPsNLaVnedcelKi Consensus -DL---L--------L-----V--YLYQIL-GI---HS-N-IHRDLKP-NLL-------KL
NKIATRE CDFGFARtLaa...PgdvYTDYVATRWYRAPEIvLkdttYgkpVDIWalGCmiiEMatgn KKIALRE CDFGFARILtg...PsdyYTDYVATRWYRsPEILvGdtqYgppVDVWaIGCVFAELLsgv KKIAMRE CDFGFARtLaa...PgevYTDYVATRWYRAPElLvGdvkYgkaVDVWaIGCIvtEMFmge CDKl aDFGLARaFgi...PirvYTheVvTlWYRsPEVLLGsarYstpVDIWSIGtIFAELatkk CDK2 aDFGLARaFgv...PvrtYTheVvTIWYRAPEILLGckyYstaVDIWS1GCIFAEMvtrr ERK1 CDFGLARiadpehdhtgflTEYVATRWYRAPEIMLnskgYtksIDIWSVGCILAEMLsnr ERK2 CDFGLARvadpdhdhtgflTEYVATRWYRAPEIMLnskgYtksIDIWSVGCILAEMLsnr SAPK 1DFGLARtactnf....mmTpYVvTRYYRAPEViLG.mgYkenVDIWSVGCIMAEMvlhk p38 1DFGLARhtdde......rnTgYVATRWYRAPEIMLnwmhYnqtVDIWSVGCIMAELLtgr Consensus CDFGLAR-L------P---'~TDYVATRWYRAPEILLG---Y----VDIWSVGCIFAEML---NKIATRE PyLPssSDlDlhhkIvlkvGnltphlhniFskspiFagvvlpqvq.hpknarkkYPkl..
KKIALRE PLWPGkSDVDQLylIrktLGdliprhqqvFstnqyFsgvkipdPe.dmepLelkFPni..
KKIAMRE PLFPGdSDIDQLyhIMmchGnliprhqelFnknpvFagvrlpeik.erepLerrYPkl..
CDKl PLFhGdSEIDQLfrIFrahG...tpnnevWpevesLqdYkntFPkwkpgsLashvknl..
CDK2 aLFPGdSEIDQLfrIFrtLG...tpdevvfnlpgvtsMpdYkpsFPkwarqdFskvvPpl..
ERK1 PiFPGkhylDQLnhILgiLGspsqedlnciinmka.rnYlqsLPsktkvaWaklFPk...
ERK2 PiFPGkhylDQLnhILgihGspsqedlnciirlka.rnYllsLPhknkvpWnrlFPn...
SAPK scsPGrdyIDQwnkVieqLGtpsaefmkkL.qptv.rnYvenrPkypgikFeelFPdwif p38 tLFPGtdhIDQLkIILrlvGtpgaellkkissesa.rnYiqsLaqmpkmnFanvFig...
Consensus PLFPG-SDIDQL--IL--LG---------F------F---Y----LP----------FP-----NKIATRE ..........ngllaDivhacLqiDPaeRIsstdlLhHdYFtr....dgfiekfipeLra KKIALRE ..........sypAlgLLkgcLhmDPteRltceqlLhHPYFenirEieDlakehdkptrk KKIAMRE ..........sevviDLakKcLhiDPdKRpfcaelLhHdFF....qmdgfaerfsqeLql CDKl ..........denglDLL;~KMLiYDPaKRIsgkmALnHPYFnd.......ldnqikkm..
CDK2 ..........dedgrsLL:~qMLhYDPnKRIsakaALaHPFFqd.......vtkpvphLrl ERK1 .........sdskAlDLLdrMLtFnPnKRItveeALaHPYLeqyyDptD.epvaeepFtf ERK2 .........adskAlDLLdKMLtFnPhKRIeveqALaHPYLeqyyDpsD.epiaeapFkf SAPK pseserdkiktsqArDLL:~KMLviDPdKRIsvdeALrHPYitvwyDpaEaeapppqiYda p38 .........anplAvDLLeKMLvLDsdKRItaaqALaHaYFaqyhDpdD.epvad.pYdq Consensus -------------A-DLL--KML--DP-KRI----AL-HPYF----D--D--------L
NKIATRE kLlqeakvnsfiKpkenf~cenepvrdekkpvftnpilygnptlygkevdrdkrakelkvr KKIALRE tLrksrkhhcftetskL.........qylpqltgssil...paldnkkyycdtkklnyrfp KKIAMRE kvqkdarnvslsKksqn.........rkkekek.ddslveerktlvvqdtnadpkikdyklf CDKl .............................................................
CDK2 .............................................................
ERK1 dMelddlpker~~KeliFqetarfqpgapeap.............................
ERK2 dMelddlpkek,~KeliFeetarfqpgyrs...............................
SAPK qLeerehaieewKeliYkevmdweerskngvkdqpsdaavsskatpsqsssindissmst p38 sFesrdllidewKsltYdevisfvpppldqeemes.........................
Consensus -L-_________K______________-________.__.._____________________..._ NKIATRE vikakggkgdvpdlkktesegehrqqgtaedthpt:~ldrkpsvselt.............
KKIALRE ni...........................................................
KKIAMRE kikgskidgekaekgnra:~nasclhdsrtshnkivpstslkdcsnvsvdhtrnpsvaipp CDKl .............................................................
CDK2 .............................................................
ERKI .............................................................
ERK2 .............................................................
SAPK ehtlasdtdss-ydastgplegcr.....................................
p38 .............................................................
Consensus ___________ _.______.______________ ___ ___.__..__ ____-____--_--___ CDK1: human Cyclin Dependent ICinase 1.
CDK2: human Cyclin Dependent ICinase 2 ERKl: human Extracellular stimulus Regulated Kinase 1 ERK2: human Extracellular stirnulus Regulated Kinase 2.
SAPK: human Stress Activated I?rote:in Kinase P38: human p38HOG kinase Patient Number Percent Deletion of NKIATRE
1 26.4 2 3. 7 3 6_1.5 _ 4 26.2 5 56. 5 6 56.6 7 25.4 8 38.1 9 0.0 10 68.0 11 20.6 12 8.8 13 0.0 14 48.3 15 30.3 16 0.0 17 0.0 18 36.6 19 0.0
CGGCGGGACT ACAGGATGGG CTGAGGCc~GC GGCGATTCTC AGGACGAGAA GCCAGGCTTG
AAAA_TGGAGA TGTATGAAAC CCTTGGAi~AA GTAGGAGAGG GAAGTTATGG AACGGTCATG
AAATGCAAGC ATAAGGATAC TGGGCGGATA GTGGCCATTA AGATATTCTA TGAGAAACCA
GAAAAATCTG TCAACAAAAT TGCAACGAGA GAAATAAAGT TTCTAAAGCA ATTTCGTCAT
GAAAACCTGG TCAATCTGAT TGAAGTT'PTT AGACAAAAAA AGAAAATCCA TTTGGTATTT
GAGTTTATTG ACCACACGGT CTTAGATGAG TTACAGCATT ATTGTCACGG ATTAGAGAGT
AAGCGACTAA GAAAGTACCT GTTCCAGATC CTCCGAGCGA TCGAGTATCT GCACAACAAC
AACA'I'TATCC ACCGAGATAT AAAGCCTGAG AATATTTTAG TCTCCCAGTC AGGAATTACA
AAGCTCTGCG ATTTTGGGTT TGCGCGGACA CTAGCAGCTC CTGGAGACGT TTACACAGAC
TACGTGGCCA CCCGCTGGTA CAGAGCTCCA GAGCTGGTGT TGAAAGACAC CACCTATGGA
AAACCAGTGG ATATCTGGGC TTTGGGC'PGT ATGATCATTG AAATGGCCAC TGGCAATCCC
TACCTTCCTA GCAGTTCCGA TTTGGAT'PTG CTCCACAAGA TTGTTTTAAA AGTAGGCAAC
CTGACCCCGC ACCTGCACAA TATTTTT'PCC AAGAGTCCCA TCTTTGCTGG GGTGGTTCTT
CCTCAAGTTC AACATCCCAA AAACGCAAGA AAGAAATACC CAAAGCTCAA CGGATTGCTG
GCAGATATAG TTCATGCTTG TTTACAP.ATT GATCCTGCTG AGAGGATATC ATCCACCGAT
CTTTTGCATC ACGATTACTT TACTAGAGAT GGATTTATTG AGAAATTTAT ACCAGAGCTG
AGAGCTAAGT TATTACAGGA AGCAAAGGTT AATTCATTTA TAAAGCCAAA AGAGAATTTT
AAGGAAAATG AACCTGTGAG AGATGAGAAA AAACCAGTTT TTACCAACCC TCTGCTCTAT
GGAAACCCAA CACTTTATGG AAAGGAAGTG GACAGAGACA AAAGGGCCAA GGAGCTCAAA
GTCAGAGTCA TTAAGGCCAA AGGGGGAAAA GGAGACGTCC CAGACCTGAA GAAGACAGAG
AGTGAAGGTG AACACCGCCA GCAGGGCACA GCTGAGGACA CACACCCCAC ATCACTGGAC
AGGAAGCCTT CTGTCTCGGA ACTAACAAAC CCTGTCCATC CCAGTGCGAA TTCTGACACT
GTCAAAGAAG ACCCACACTC TGGGGGC'PGT ATGATAATGC CACCTATCAA CCTGACAAGC
AGTAATTTGT TGGCCGCAAA TCCCAGT'PCA AACCTCTCCC ACCCCAATTC ACGGTTAACT
GAAAGAACAA AAAAGAGACG CACCTCT'PCA CAAACTATTG GACAAACTTT GTCTAATAGC
AGACAAGAGG ACACAGGTCC CACACAAGTC CAAACAGAGA AAGGTGCATT TAATGAGCGA
ACAGGTCAGA ATGCAAAATA GCAAGTGGAA ACAAAAGAAA ACTGAATTTT TCCAAATGCG
ACAGGAAAGA ATTCCATTTC CCTGAGC'PGC CGTTCACAAT ACAGGC.'GAAG GAGATGAAAG
GGATGGAGGT TAAACAGATA AAAGTGC'PGA AGAGAGAATC AAAGAAAACG GATTCACC
MEMYETLGKVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKIATREIKFLKQFRHENL
VNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIEYLHNNNIIHR
DIKPENILVSQSGITKLCDFGFAR'rLAAPGDVYTDYVATRWYRAPELVLKDTTYGKPVDIWA
LGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLTPHLHNIFSKSPIFAGVVLPQVQHPKNA
RKKYPKLNGLLADIVHACLQIDPAERISSTDLLHHDYFTRDGFIEKFIPELRAKLLQEAKVN
SFIKPKENFKENEPVRDEKKPVFTNPLLYGNPTLYGKEVDRDKRAKELKVRVIKAKGGKGDV
PDLKKTESEGEHRQQGTAEDTHPTSLDRKPSVSELTNPVHPSANSDTVKEDPHSGGCMIMPP
INLTSSNLLAANPSSNLSHPNSRL'rERTKKRRTSSQTIGQTLSNSRQEDTGPTQVQTEKGAF
NERTGQNAK
L cgg gac tac agg 13 atg ggc tga ggc ggc ggc gat tct cag gac gag aag cca ggc ttg aaa ATG GAG ATG
TAT
1 * M E M Y
76 GAA ACC CTT GGA AAA GTA GGA GA(i GGA AGT TAT GGA ACG GTC ATG AAA TGC AAG
CAT AAG
E T L G K V G E G S Y G T V M K C K H K
136 GAT ACT GGG CGG ATA GTG GCC AT'P AAG ATA TTC TAT GAG AAA CCA GAA AAA TCT
GTC AAC
GTC AAT
256 CTG ATT GAA GTT TTT AGA CAA AAi~ AAG AAA ATC CAT TTG GTA TTT GAG TTT ATT
GAC CAC
316 ACG GTC TTA GAT GAG TTA CAG CA'P TAT TGT CAC GGA TTA GAG AGT AAG CGA CTA
AGA AAG
376 TAC CTG TTC CAG ATC CTC CGA GC(3 ATC GAG TAT CTG CAC AAC AAC AAC ATT ATC
CAC CGA
GAT TTT
496 GGG TTT GCG CGG ACA CTA GCA GC'P CCT GGA GAC GTT TAC.' ACA GAC TAC GTG GCC
ACC CGC
556 TGG TAC AGA GCT CCA GAG CTG GT(3 TTG AAA GAC ACC ACC.' TAT GGA AAA CCA GTG
GAT ATC
616 TGG GCT TTG GGC TGT ATG ATC AT'P GAA ATG GCC ACT GGC AAT CCC TAC CTT CCT
AGC AGT
CAC CTG
CAA CAT
796 CCC AAA AAC GCA AGA AAG AAA TAt~ CCA AAG CTC AAC GGA TTG CTG GCA GAT ATA
GTT CAT
856 GCT TGT TTA CAA ATT GAT CCT GC'P GAG AGG ATA TCA TCC ACC GAT CTT TTG CAT
CAC GAT
916 TAC TTT ACT AGA GAT GGA TTT AT'P GAG AAA TTT ATA CCA GAG CTG AGA GCT AAG
TTA TTA
976 CAG GAA GCA AAG GTT AAT TCA TT'P ATA AAG CCA AAA GAG AAT TTT AAG GAA AAT
GAA CCT
1036 GTG AGA GAT GAG AAA AAA CCA GT'P TTT ACC AAC CC'P CTC~ CTC TAT GGA AAC
CCA ACA CTT
1096 TAT GGA AAG GAA GTG GAC AGA GAt~ AAA AGG GCC AAG GAG CTC AAA GTC AGA GTC
ATT AAG
GAA CAC
TCT GTC
1276 TCG GAA CTA ACA AAC CCT GTC CA'P CCC AGT GCG AA'P TCT GAC ACT GTC AAA GAA
GAC CCA
TTG GCC
AAA AAG
1456 AGA CGC ACC TCT TCA CAA ACT AT'P GGA CAA ACT TTG TCT AAT AGC AGA CAA GAG
GAC ACA
1516 GGT CCC ACA CAA GTC CAA ACA GAG AAA GGT GCA TT'P AAT GAG CGA ACA GGT CAG
AAT GCA
caagtggaaacaaaagaaaactgaatttttccaaatgcgacaggaaagaattccatttccctgagctgccgt tcacaatacaggcgaaggagatgaaagggatggaggttaaacagataaaagtgctgaagagagaatcaaagaaaacgga t 1734 tcacc ATCATTCATC GAGATATAAA ACCTGAGAAT ATTTTAGTAT CCCAGTCAGC~
AATTACTAAG CTCTGTGATT TT(~GTTTTGC ACGAACACTA GCAGCTCCTG
GGGACATTTA TACGGACTAT GT(~GCCACAC GCTGGTATAG AGCTCCCGAA
TTAGTATTAA AAGATACTTC TTATGGAAAA CCTGTKGATA TCTGGGCT
IIHRDIKPENILVSQSGITKLCDF(JFARTLAAPGDIYTDYVATRWYRAPELVLKDTSYGKPV
DIW
NKIATRE ..............................MEmYetLgkVGEGsYGtVmKckhkdTGrIV
KKIALRE ..............................mMEkYekigkIGEGsYGvVFKcrnrdTGqIV
KKIAMRE ..............................MEkYenLgIVGEGsYGmVmKcrnkdTGrIV
CDKl ..........................-....MEdYtkiekIGEGtYGvVYKgrhktTGqW
CDK2 ..............................MEnFqkvekIGEGtYGvVYKArnklTGeW
ERKl eprgtagvvpvvpgevevvkgq....pfdvgprYtqLqyIGEGaYGmVssAydhvrktrV
ERK2 .......maaaaaagpemvrgq....vfdvgprYtnLsyIGEGaYGmVCsAydnlnkvrV
SAPK ........msdsksdgqfysvqvadstftvLkrYqqLkpIGsGaqGiVCaAfdtvlGinV
p38 ..........msqerptfyrqelnktiwevpErYqnLspVGsGaYGsVCaAfdtkTGhrV
Consensus --------------------------------ME-Y---L---IGEG-YG-VCKA----TG-IV
NKIATRE AIKiFye.kpeksVnKiAt:REIkFLKqFRHENIVnLiEVFrqkkki......hLVFEFiD
KKIALRE AIKKFleseDdpvIkKiAIREIrMLKqLkHpNIVnLLEVFrrkrrL......hLVFEYcD
KKIAMRE AIKKFlesdDdkmVkKiAmREIkLLKqLRHENIVnLLEVckkkkrw......YLVFEFvD
CDK1 AmKKirlesEeegVpstAiREIsLLKeLRHpNIVsLqDVLmqdsrL......YLIFEFLs CDK2 AlKKirxdtEtegVpstAiREIsLLKeLnHpNIVkLLDVihtenkL......YLVFEFLh ERK1 AIKKis.pfEhqtycqrtlREIqiLIgFRHENVIgirDIL.raptLeamrdvYiVqDLME
ERK2 AIKKis.pfEhqtycqrtlREIkiLIrFRHENIIginDIi.raptieqmkdvYiVqDLME
SAPK AVKKLsrpfqnqthaKrAyREIvLLKcvnHkNIIsLLnVFtpqktLeefqdvYLVmELMD
p38 AVKKLsrpfqsiihaKrtyRElrLLKhMkHENVIgLLDVFtparsLeefndvYLVthLMg Consensus AIKKF----E----V-K-A--REI-LLK-LRHENIV-LLDVF-----L------YLVFE-MD
NKIATRE htvldeLqhychg..Les~crlrkYLF'QILraIeYlHnnNIIHRDiKPeNiLVsqsgitKL
KKIALRE htvlheLdryqrg..vpehlVksitWQtLqaVnFcHkhNcIHRDvKPeNiLItkhsviKL
KKIAMRE htilddLelfpng..LdyqvVqkYLFQIinGIgFcHShNIIHRDiKPeNiLVsqsgvvKL
CDKl mDLkkyLdsippgqyMds:~lVksYLYQILqGIvFcHSrrVIHRDLKPqNLLIddkgtiKL
CDK2 qDLkkfMdasaltg.iplplIksYLFQILqGlaFcHShrVIHRDLKPqNLLIntegaiKL
ERKl tDLyklLk....sqqLsndhIcyFLYQILrGIkYiHSaNVIHRDLKPsNLLInttcdlKi ERK2 tDLyklLk....tqhLsndhIcyFLYQILrGIkYiHSaNVIHRDLKPsNLLlnttcdlKi SAPK anLcqvih.....meLdhermsyLLYQmLcGIkhlHSagIIHRDLKPsNivVksdctlKi p38 aDLnnivk....cqkLtddhVqfLiYQILrGIkYiHSadIIHRDLKPsNLaVnedcelKi Consensus -DL---L--------L-----V--YLYQIL-GI---HS-N-IHRDLKP-NLL-------KL
NKIATRE CDFGFARtLaa...PgdvYTDYVATRWYRAPEIvLkdttYgkpVDIWalGCmiiEMatgn KKIALRE CDFGFARILtg...PsdyYTDYVATRWYRsPEILvGdtqYgppVDVWaIGCVFAELLsgv KKIAMRE CDFGFARtLaa...PgevYTDYVATRWYRAPElLvGdvkYgkaVDVWaIGCIvtEMFmge CDKl aDFGLARaFgi...PirvYTheVvTlWYRsPEVLLGsarYstpVDIWSIGtIFAELatkk CDK2 aDFGLARaFgv...PvrtYTheVvTIWYRAPEILLGckyYstaVDIWS1GCIFAEMvtrr ERK1 CDFGLARiadpehdhtgflTEYVATRWYRAPEIMLnskgYtksIDIWSVGCILAEMLsnr ERK2 CDFGLARvadpdhdhtgflTEYVATRWYRAPEIMLnskgYtksIDIWSVGCILAEMLsnr SAPK 1DFGLARtactnf....mmTpYVvTRYYRAPEViLG.mgYkenVDIWSVGCIMAEMvlhk p38 1DFGLARhtdde......rnTgYVATRWYRAPEIMLnwmhYnqtVDIWSVGCIMAELLtgr Consensus CDFGLAR-L------P---'~TDYVATRWYRAPEILLG---Y----VDIWSVGCIFAEML---NKIATRE PyLPssSDlDlhhkIvlkvGnltphlhniFskspiFagvvlpqvq.hpknarkkYPkl..
KKIALRE PLWPGkSDVDQLylIrktLGdliprhqqvFstnqyFsgvkipdPe.dmepLelkFPni..
KKIAMRE PLFPGdSDIDQLyhIMmchGnliprhqelFnknpvFagvrlpeik.erepLerrYPkl..
CDKl PLFhGdSEIDQLfrIFrahG...tpnnevWpevesLqdYkntFPkwkpgsLashvknl..
CDK2 aLFPGdSEIDQLfrIFrtLG...tpdevvfnlpgvtsMpdYkpsFPkwarqdFskvvPpl..
ERK1 PiFPGkhylDQLnhILgiLGspsqedlnciinmka.rnYlqsLPsktkvaWaklFPk...
ERK2 PiFPGkhylDQLnhILgihGspsqedlnciirlka.rnYllsLPhknkvpWnrlFPn...
SAPK scsPGrdyIDQwnkVieqLGtpsaefmkkL.qptv.rnYvenrPkypgikFeelFPdwif p38 tLFPGtdhIDQLkIILrlvGtpgaellkkissesa.rnYiqsLaqmpkmnFanvFig...
Consensus PLFPG-SDIDQL--IL--LG---------F------F---Y----LP----------FP-----NKIATRE ..........ngllaDivhacLqiDPaeRIsstdlLhHdYFtr....dgfiekfipeLra KKIALRE ..........sypAlgLLkgcLhmDPteRltceqlLhHPYFenirEieDlakehdkptrk KKIAMRE ..........sevviDLakKcLhiDPdKRpfcaelLhHdFF....qmdgfaerfsqeLql CDKl ..........denglDLL;~KMLiYDPaKRIsgkmALnHPYFnd.......ldnqikkm..
CDK2 ..........dedgrsLL:~qMLhYDPnKRIsakaALaHPFFqd.......vtkpvphLrl ERK1 .........sdskAlDLLdrMLtFnPnKRItveeALaHPYLeqyyDptD.epvaeepFtf ERK2 .........adskAlDLLdKMLtFnPhKRIeveqALaHPYLeqyyDpsD.epiaeapFkf SAPK pseserdkiktsqArDLL:~KMLviDPdKRIsvdeALrHPYitvwyDpaEaeapppqiYda p38 .........anplAvDLLeKMLvLDsdKRItaaqALaHaYFaqyhDpdD.epvad.pYdq Consensus -------------A-DLL--KML--DP-KRI----AL-HPYF----D--D--------L
NKIATRE kLlqeakvnsfiKpkenf~cenepvrdekkpvftnpilygnptlygkevdrdkrakelkvr KKIALRE tLrksrkhhcftetskL.........qylpqltgssil...paldnkkyycdtkklnyrfp KKIAMRE kvqkdarnvslsKksqn.........rkkekek.ddslveerktlvvqdtnadpkikdyklf CDKl .............................................................
CDK2 .............................................................
ERK1 dMelddlpker~~KeliFqetarfqpgapeap.............................
ERK2 dMelddlpkek,~KeliFeetarfqpgyrs...............................
SAPK qLeerehaieewKeliYkevmdweerskngvkdqpsdaavsskatpsqsssindissmst p38 sFesrdllidewKsltYdevisfvpppldqeemes.........................
Consensus -L-_________K______________-________.__.._____________________..._ NKIATRE vikakggkgdvpdlkktesegehrqqgtaedthpt:~ldrkpsvselt.............
KKIALRE ni...........................................................
KKIAMRE kikgskidgekaekgnra:~nasclhdsrtshnkivpstslkdcsnvsvdhtrnpsvaipp CDKl .............................................................
CDK2 .............................................................
ERKI .............................................................
ERK2 .............................................................
SAPK ehtlasdtdss-ydastgplegcr.....................................
p38 .............................................................
Consensus ___________ _.______.______________ ___ ___.__..__ ____-____--_--___ CDK1: human Cyclin Dependent ICinase 1.
CDK2: human Cyclin Dependent ICinase 2 ERKl: human Extracellular stimulus Regulated Kinase 1 ERK2: human Extracellular stirnulus Regulated Kinase 2.
SAPK: human Stress Activated I?rote:in Kinase P38: human p38HOG kinase Patient Number Percent Deletion of NKIATRE
1 26.4 2 3. 7 3 6_1.5 _ 4 26.2 5 56. 5 6 56.6 7 25.4 8 38.1 9 0.0 10 68.0 11 20.6 12 8.8 13 0.0 14 48.3 15 30.3 16 0.0 17 0.0 18 36.6 19 0.0
Claims
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA 2243784 CA2243784A1 (en) | 1998-08-31 | 1998-08-31 | Cdc2-related kinase associated with acute leukemia |
CA 2251249 CA2251249A1 (en) | 1998-08-31 | 1998-11-20 | Cdc2-related kinase associated with acute leukemia |
AU54993/99A AU5499399A (en) | 1998-08-31 | 1999-08-31 | Cdc2-related kinase associated with acute leukemia |
PCT/CA1999/000794 WO2000012719A1 (en) | 1998-08-31 | 1999-08-31 | Cdc2-related kinase associated with acute leukemia |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA 2243784 CA2243784A1 (en) | 1998-08-31 | 1998-08-31 | Cdc2-related kinase associated with acute leukemia |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2243784A1 true CA2243784A1 (en) | 2000-02-29 |
Family
ID=29409673
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA 2243784 Abandoned CA2243784A1 (en) | 1998-08-31 | 1998-08-31 | Cdc2-related kinase associated with acute leukemia |
Country Status (1)
Country | Link |
---|---|
CA (1) | CA2243784A1 (en) |
-
1998
- 1998-08-31 CA CA 2243784 patent/CA2243784A1/en not_active Abandoned
Similar Documents
Publication | Publication Date | Title |
---|---|---|
ES2248997T3 (en) | STE20-RELATED PROTEIN-KINASES. | |
JP5202583B2 (en) | Tumor suppressor called TS10Q23.3 | |
US5759811A (en) | Mutant human hedgehog gene | |
JPH10513359A (en) | Inhibitors of cyclin-dependent kinases CDK4 and CDK6, InK4c-p18 and InK4d-p19, and uses thereof | |
WO1996024603A9 (en) | InK4c-p18 AND InK4D-p19, INHIBITORS OF CYCLIN-DEPEDENT KINASES CDK4 AND CDK6, AND USES THEREOF | |
US20110104706A1 (en) | Novel kinases and uses thereof | |
US6017755A (en) | MADR2 tumour suppressor gene | |
JP2003535590A (en) | Tumor suppressors and their use | |
AU2001263952A1 (en) | Tumour suppressor and uses thereof | |
WO1999066051A2 (en) | Nek-related and bub1-related protein kinases | |
JP2005520481A (en) | Isolated human kinase protein, nucleic acid molecule encoding human kinase protein, and methods of use thereof | |
US6458561B1 (en) | Human NIM1 kinase | |
CA2243784A1 (en) | Cdc2-related kinase associated with acute leukemia | |
CA2251249A1 (en) | Cdc2-related kinase associated with acute leukemia | |
WO1998022507A2 (en) | Receptor tyrosine kinase genes | |
WO1999036548A1 (en) | Human lymphoid protein tyrosine phosphatases | |
JP2005503757A (en) | Isolated human kinase protein, nucleic acid molecule encoding human kinase protein, and methods of use thereof | |
US20040006777A1 (en) | Human lymphoid protein tyrosine phosphatases | |
US6682920B1 (en) | Compositions and methods for identifying PKB kinase inhibitors | |
US6372467B1 (en) | P54s6k and p85s6k genes, proteins, primers, probes, and detection methods | |
JP2005500819A (en) | Isolated human kinase protein, nucleic acid molecule encoding human kinase protein, and methods of use thereof | |
JP2003534008A (en) | Isolated human kinase protein, nucleic acid molecule encoding human kinase protein, and uses thereof | |
US6461846B2 (en) | Isolated human kinase proteins, nucleic acid molecules encoding human kinase proteins, and uses thereof | |
Tyrsin | Role of Raf family members in mouse development | |
JP2005500811A (en) | Isolated human kinase protein, nucleic acid molecule encoding human kinase protein, and methods of use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FZDE | Dead |