<Desc/Clms Page number 1>
HET MANIPULEREN VAN FRUCTAANKATABOLISME IN PLANTEN
De onderhavige uitvinding heeft betrekking op het fructaan 1-exohydrclasegen, op het door dat gen gecodeerde enzym en cp het manipuleren van de activiteit van beiden in planten.
Het enzym fructaan 1-exohydrolase (1-FEH, EC 3. 2. 1. 80, G- (F) + H. O-G- (F), + F met n > 1) breekt fructanen af. De afbraak van fructanen in planten kan uit
EMI1.1
economisch oogpunt of nadelig zijn.
Voor de laire koolhydraten, zcals fructanen, is de voortijdige afbraak daarvan ong'nstig. Om een zo hoog mogelijke polymerisatiegraad (degree of polymerisacion of"DP") te krijgen, dient vermeden te worden dat de gevormde fructanen weer worden afgebroken tot hun bouwstenen.
In andere gevallen is het optreden van fructaanafbraak voor de plant juist gunstig. 1-FEH-activiteit wordt in Cichorium intvbus L. tot expressie gebracht tijdens noodsituaties (afsnijden van bladeren in jong stadium) of wanneer, zoals tijdens de teelt van witlof, het groen loof van volwassen planten wordt verwijderd en de wortels worden bewaard in koude kamers bij een temperatuur van +1 C vcor korte bewaring or-1 C voor langere bewaring (Van den Ende, W. & Van Laere, A. 1996a, Fructan synthesizing and degrading activities in chicory rcots (CichoriumintybusL.)duringgrowth,storageandforcing. J. Plant Physiol. 149: 43-50). Tijdens daarop volgend "trek" of "forcerie" worden in het donker de welbekende witlofkroppen gevcrmd.
Aangezien onder deze omstandigheden geen fctosynthese kan plaatsvinden is een
EMI1.2
efficiënte fructaanafbraak ning uit Om verschallende om het katabolisme , rucc rructanen, Het fructaanmetabclisme t enzymen die
<Desc/Clms Page number 2>
EMI2.1
syltransferasen, zoals sucrose transferase (1-SST, EC 2. G-F + G-F G-F-F + G) en fructaan 1-fructosyl transferase (1-FFT, EC 2. 4. 1. 100 + G- (F) met n > l, m > 0) en enzymen die fructanen afbreken. Van deze laatste is fructaan 1-exohydrolase een voorbeeld. Daarnaast komen invertasen (EC 3. 2. 1. 26) en ss-fructo (furano) sidasen voor.
Echte fructaanexohydrolasen breken preferentieel fructanen af, terwijl hun activiteit ten opzichte van sucrose gering of nihil is. Echte sucrasen of invertasen breken preferentieel sucrose af, hoewel bijvoorbeeld gistinvertase onder bepaalde condities ook ss-fructo (furano) sidaseen transfructosylase-activiteit kunnen vertonen (Cairns, A. J. & Ashton, J. E. 1991. The interpretation of in vitro measurements of fructosyl transferase activity : an analysis of patterns of fructosyltransfer by fungal invertase.
EMI2.2
New Phytol. 118 aspecifieke ss-fructo no) zowel fructanen als sucrose afbreken (Simpson, & Bonnett, G. from grasses. New Phytol. 123 : 453-469).
De fructaanconcentratie wordt bepaald door het samenspel van opbouw-en afbraakenzymen. Hoewel in de literatuur reeds transgene planten zijn beschreven, die verschillende soorten fructosyltranferasen in zieh dragen, is er veel minder informatie beschikbaar over de afbraakenzymen.
Tot nu toe is slechts de volledige zuivering beschreven van het enzym 1-FEH van Cichorium intybus L.
(Claessens, G., Van Laere, A. & De Proft, M. 1990.
Purification and properties of an inulinase from chicory roots (Cichorium intvbus L. ). J. Plant Physiol. 136 : 35- 39), van 1-FEH uit Helianthus tuberosus L. (Marx, S. P., Nösberger, J. & Frehner, M. 1997a. Seasonal variation cf fructan-ss-fructosidase (FEH) activity and characterisation of a S- (2, 1)-linkage specific FEH. New Phytol. 135 : 267-277) en van 6-FEH uit Lollium prenne (Marx, S. ?., Nösberger, J. & Frehner, M. 1997b. Hydrolysis of fructan in grasses : a ss- (2, 6) -linkage specific fructan-ss-fr cto-
<Desc/Clms Page number 3>
sidase from stubble of Lolium perenne. New Phytol. 135 : 279-290).
Van geen van deze zijn echter de N-terminale aminozuursequenties of de nucleotidesequenties van de overeenkomende genen of cDNA's bekend.
Het doel van onderhavige uitvinding is nu een efficiënte sturing mogelijk te maken van het fructaanmetabolisme in planten door het fructaankatabolisme te kunnen controleren.
Daartoe is de uitvinding gebaseerd op de klonering en sequentiebepaling van het cDNA dat codeert voor een fructaan 1-exohydrolase (1-FEH) uit de wortel van Cichorium intybus L. De sequentie van dit cDNA wordt gegeven in figuur 1.
De uitvinding heeft derhalve in algemene zin betrekking op een DNA-molecuul, welke codeert voor een enzym met fructaan 1-exohydrolaseactiviteit en een van de volgende nucleotidensequenties omvat : a) een sequentie die na wassen in lxSSPE bij 600C nog hybridiseert met de sequentie uit Figuur 1 of de complementaire sequentie daarvan ; of b) een sequentie die tenminste 60% homoloog is met de sequentie u-t Figuur l of de complementaire sequentie daarvan.
Meer in het bijzonder verschaft de uitvinding een DNA-molecuul, dat codeert voor een enzym met fructaan 1-exohydrolaseactiviteit en welk molecuul een nucleotidensequentie bezit zoals weergegeven in Figuur 1 of de complementaire sequentie daarvan.
De beschikking over het cDNA van dit 1-FEH leidt tot een aantal deelaspecten van de uitvinding.
Ten eerste kan op basis van het beschikbare gen de plant worden aangezet tot het produceren van antisense RNA tegen het RNA van het endogene gen. hierdoor wordt de expressie juisf verlaagd er uifgeschakeld en wordt af-
EMI3.1
braak van voorbeeld is bi-, roorbeeld-, ran belang wanneer een plane fructanen (bijvoorbeeld uit wcrtels chcrium --i ee
<Desc/Clms Page number 4>
geval moet met name aan het einde van het groeiseizoen voorkomen worden dat de fructanen met een hogere DP worden afgebroken tot fructanen met een lagere DP en fructose. Dit is ongewenst, omdat fructanen met een hogere DP interessanter zijn voor food en non-food toepassingen (Amerikaans octrooi nr. 5, 478, 737 ; Verraest, D. L., Peters J. A., Van Bekkum, H. & Van Rosmalen, G. M.
1996. Carboxymethyl inulin : a new inhibitor for calcium carbonate precipitation. J. Am. Oil Chem. Soc. 73 : 55-62 ; Verraest, D. L., Zitha-Bovens, E., Peters, J. A. & Van Bekkum, H. 1998. Preparation of O- (aminopropyl) inulin.
Carbohydr. Res. 310 : 109-115).
Door het verlagen van de 1-FEH activiteit kan
EMI4.1
bovendien voorkomen worden dat het door 1-FEH gevormde fructose (acceptor) met het enzym 1-FFT (l-fructaan taan fructosyltransferase, EC 2. 4. 1. 100) en lange fructanen als donor de ongewenste korte inulo-n-osen produceren (Van den Ende, W., De Roover, J. & Van Laere, A. 1996a.
In vitro synthesis of fructo-oligosaccharides from inulin and fructose by purified chicory root FFT. Physiol.
Plant. 97 : 346-352). Hierdoor neemt de concentratie van de fructanen met een gewenste hoge DP af. Bovendien zijn de geproduceerde inulo-n-osen reducerende suikers waardoor ze bij de hogere temperaturen, die worden gebruikt bij de industriële inuline-extractie, gemakkelijk reageren met vrije aminozuren (Maillardreactie ; Hofberger, R. 1997.
Caramel, a classic confection. Candy Industry 162,18- 21), waardoor ongewenste bruinkleuring kan optreden.
Tenslotte heeft het remmen van de 1-FEH activiteit volgens de onderhavige uitvinding als bijkomend voordeel dat de oogst en verwerking van de fructaanprodu- cerende planten, zoals bijvoorbeeld cichoreiwortels, over het jaar kunnen worden verspreid en over een veel langere periode (eind september tot maart) dan thans het geval is (eind september tot eind oktober) kunnen worden uitge- voerd. Er vindt immers geen ongewenste afbraak van de fructanen plaats en de wcrtels kunnen gewoon worden bewaard. Dit laatste zou tevens kunnen leiden tct een
<Desc/Clms Page number 5>
vergroting van het areaal waar fructaanproducerende planten, zcals cichoreiwortels, verbouwd kunnen worden.
Fructanen kunnen worden gebruikt in zogeheten "food"-en"non-food"-toepassingen. Ze (en dan in het bijzonder inuline uit cichorei) worden reeds volop toegevoegd aan voedingsmiddelen, zoals roomijs, chocolade, yoghurt, sauzen en veel andere (Van Hee, L. 1993. Fructanen, inzonderheid inuline en fructo-oligosacchariden in de voeding. Eindverhandeling tot het behalen van de graad van licentiaat in de voedingsleer en de dieetleer, Universiteit Gent, beschikbaar via de bibliotheek ; Amerikaans octrooi nr. 5, 527, 556). Ze kunnen worden beschouwd als laag-calorische voedingsvezels (Van Loo, J., Coussement, P., De Leenheer, L., Hoebregs, H. & Smits, G. 1995.
On the presence of inulin and oligofructose as natural ingredients in the wescern diet. Critical reviews in food science and nutrition 35 : 525-552) die bovendien een heilzaam effect hebben op de gezondheid vanwege hun bifidogene werking (Hidaka, H., Hirayama, M. & Yamada K.
1991. Fructooligosaccharides. Enzymatic preparation and biofunctions. J. Carbohydr. Chem. 10 : 509-522).
Wat betreft de vele potentiele non-food toepassingen (Fuchs, A. : 987. Pocencials for non-food utilization of fructose and inulin. Starch/ Stärke 39: 335-343; Fuchs, A. 1991. Current and potential food and non-food applicaticns of fructans. Redesigning Crop Products for Biotechnology. Biochem. Soc.
Trans. 19 : 555-560) zijn de meeste nog volop in het cntwikkelingsstadium. Sommige van
EMI5.1
aliseerd a-Is de zijn echter al gecommercialiseerd bijvocrbeeid"co-builders" samen met zcgehei ten"builders" om calcium-en te ccmplexeren octrooi van caiciumcarbcnaatkrstallisatie. inulinederivatenof zullen zijn derivaten in de nabije toekomst worden gebruikt in o. a. de Papierindustrie, de cosmetica en de productie van coatings en kleefmiddelen.
<Desc/Clms Page number 6>
Verder is het nu mogelijk geworden om het 1-FEH gen in te bouwen in planten waarin endogene fructanen en 1-FEH reeds voorkomen (homologe expressie) ten einde te komen tot een hogere expressie van het gen boven het endogene niveau. Het gen kan zowel uit hetzelfde species als uit een ander species afkomstig zijn. Echter, om het gevaar voor zogeheten "silencing" te minimaliseren, heeft het de voorkeur 1-FEH van een ander species te introduceren, zoals bijvoorbeeld 1-FEH van Cichorium intvbus in Helianthus tuberosus of omgekeerd.
Daarnaast kan het gen worden ingebracht in planten die van nature geen fructanen kunnen aanmaken.
Zij dienen dan eerst wel tot de synthese van fructanen te worden aangezet door transformatie met de nodige fructosyltransferase-genen (zie bijvoorbeeld W097/42331). Het
EMI6.1
"ructanen kan voor planten kunnen synthetiseren van uitermate interessant zijn, bijvoorbeeld om beter resistent te worden tegen droogtestress, koude of zuurstofge-
EMI6.2
brek de bodem (Albrecht, G., Kammerer, S., W. & Fructan content of wheat seed- lings under hypoxia an following re-aeration. New Phytol. 123 : 471-476i SpolIen, W. G., & Nelson, C. J. 1994. Response of fructan to water deficit in growing leaves of tall fescue. Plant Physiol. 106, 329-336 ; Pilon-Smits, E. A. H., Ebskamp, M. J. M., Jeuken, M. J. W., Weisbeek, P. J. & Smeekens, S. C. M. 1995. Improved performance of transgenic fructan-accumulating tobacco under drought stress.
Plant Physiology 107 : 125-130i Livingston, D. P. III. & Henson, C. A. 1998. Apoplastic sugars, fructans, fructan exohy-
EMI6.3
drolase, and invertase in winter oat Responses to second-phase cold hardening. Plant Physiol. 116 403-408).
Indien het gewenst is dat de transgene planten, die nu wel fructanen synthetiseren, dit ook als energiebron kunnen gebruiken, is het uiteraard noodzakelijk dat ook 1-FEH wordt geïntr0àuceed. De transgene planten kunnen dan hun aangelegde fruciaanreserve aanspreken wanneer dit nodig is, bijvoorbeeld na vernietiging van het fotosyntheseapparaat docr vraat, vorst cf stormwind
<Desc/Clms Page number 7>
of in energievragende perioden tijdens bloei, rijping of kieming. Het 1-FEH kan in dergelijke gevallen eventueel onder controle van een reguleerbare of orgaanspecifieke promotor worden geplaatst.
Gebleken is dat tijdens de witlofteelt in augustus-september (vrcege forcerie met wortels van het nieuwe seizoen) nog maar weinig fructanen worden afgebroken doordat 1-FEH ncg niet of onvoldoende is geïnduceerd (Van den Ende, W. & Van Laere, A., 1996a. supra). Juist op dat soort momenten zou extra expressie van het FEHenzym gewenst zijn. 1-FEH activiteit is met name onontbeerlijk voor de kropvorming. In transgene witlofplanten kan het 1-FEH-gen volgens de uitvinding, of enig ander daarmee overeenkomend gen onder de regulatie van een
EMI7.1
induceerbare, bijvcorbeeld een koude-induceerbare, promo-cer worden gebracht, waardoor tijdens forcerie in een vroeg stadium extra 1-FEH wordt geproduceerd.
Het vervaardigen van transgene planten kan met op zichzelf bekende technieken tot stand gebracht worden.
Meestal wordt gebruikt gemaakt van Agrobacterium-gemedieerde transformatie (Horsch, R. B., Fry, J. E., Hoffman, N.L., Eichholtz, D., Rogers, S.G. & Fraley, R. T. 1985. A simple and general mechod for transferring genes into plants. Science 227 : 1229-1232). Transformatie van cichorei en witlof wordt beschreven in Vermeulen, A., Vaucheret, H., Fautot, V. & Chupeau, A. 1992. Aarobacterium-
EMI7.2
mediated transfer cf s synthase to chlcrsulfuron in chicory L.).
Plant Cell Rep. 11, 243- a mutanc Arabidops247 ; Vijn, I., van ken, A., Sprenger, N., van Dun, K., Weisbeek, P., Wiemken, A. & Smeekens, S. 1997. Fructan of the inulin neoseries is synthesized in transgenic chicory
EMI7.3
planes ntybus ceca L.) fructan ctan Plant Journal Jacobs erLum -ns-mediated rcrmation -cuds and Organ 7-112
<Desc/Clms Page number 8>
(Cichorium baum, L., van Dun, K., Boller, T. & Wiemken, A. 1997.
Fructan synthesis in transgenic tobacco and chicory plants expressing barley sucrose : fructan 6-fructosyltransferase. FEBS Letters 400 : 355-358. Hellwege, E. M., Gritscher, D., Willmitzer, L. & Heyer, A. G. hebben in 1997 de transformatie van aardappel beschreven in "Trans- genic potato tubers accumulate high levels of 1-kestose and nystose : functional identification of a sucrose : sucrose 1-fructosyltransferase of artichoke (Cynara scolv- mus) blossom discs", The Plant Journal 12 : 1057-1065. De transformatie van suikerbiet is gedemonstreerd in Sevenier, R., Hall, R. D., Van der Meer, I. M., Hakkert, H. J. C, van Tunen, A. & Koops, A. 1998.
High level fructan accumulation in a transgenic sugar beet. Nature-biotech- nology 16 : 843-846.
Voor het verkrijgen van transgene planten, die antisense RNA tot expressie brengen, wordt uitgegaan van een antisense versie van het gen. Verder worden transgene planten op dezelfde wijze verkregen als boven beschreven.
Door de promoter te variëren kan de expressie van het gen in bepaalde gewenste situaties tot stand worden gebracht of in bepaalde ongewenste situaties worden uitgeschakeld. Indien bijvoorbeeld afbraak op een bepaald moment in het groeiseizoen moet plaatsvinden, kan het gen werkbaar gekoppeld zijn aan een promoter, die op dat moment geactiveerd wordt. Een voorbeeld hiervan is de koude-induceerbare promoter van Hordeum (Dunn, M. A., White, A. J., Vural, S. & Hughes, M. A. 1998. Identifiation of promotor elements in a low-temperature responsive gene (blt 4. 9) from barley (Hordeum vulqare L. ). Plant Molecular Biology 38 : 551-564).
Om de expressie van het gen in bepaalde delen of organen van de plant, zoals oogstbare delen als vruchten, bollen of knollen door middel van antisense RNA te remmen, kan de antisense versie van het gen onder de controle van een orgaanspecifieke promoter gebracht worden. Een voorbeelden van een dergelijke orgaanspeci- fieke promoter is de aardappel patatine promoter (Pur-
<Desc/Clms Page number 9>
EMI9.1
cell, P. & Halford, 1998. Antisense expression of related protein kinase sequence in potato results in decreased expression of sucrose synthase in tubers and loss of sucrose-inducibility of sucrose synthase transcripts in leaves. Plant Journal 14 : 195-202).
Op basis van de 1-FEH sequentie van Cichorium intvbus L. verschafft de uitvinding volgens een verder aspect daarvan andere voor fructaan l-exohydrolase coderende nucleinezuren, in het bijzonder genen en cDNA's van andere plantenspecies. Deze kunnen worden verkregen door DNA-banken of cDNA-banken te screenen met probes die zijn afgeleid van het l-FEH cDNA volgens de uitvinding, de positieve kloons tot expressie te brengen en het expressieproduct vervolgens te testen op 1-FEH-activiteit.
EMI9.2
Dergelijke probes zijn bij voorkeur tenminste ongeveer 400 nucleotiden lang.
Met het 1-FEH-gen van Cichorium homologe genen kunnen bijvcorbeeld worden geisoleerd uit andere Aster- aceae, zoals Helianthus tuberosus (aardpeer) of Schorsonera hispanic (schorseneer). Door middel van de 1-FEHprobe van Cichorium is het ook mogelijk de 6-FEH genen uit Gramineae, waaronder economisch belangrijke graangewassen als Triticum en Hordeum, te isoleren.
De uitvinding verschaff verder in het algemeen probes, welke specifiek zijn vcor 1-FEH en een sequentie van tenminste ongeveer 16 aaneengesloten nucleotiden cmvatten gekozen uit de sequentie, zoals gegeven in Figuur 1. Dergelijke probes zijn bijvoorbeeld PCR-primers
EMI9.3
of hybridisatieprobes.
Volgens een van de uitvinding kan het enzym cok als zodanig door middel van recombinant DNA-technieken aangewend cm bijvccreeld produceren''n ,, an-iez : enzim-s Een e F & 14,-mken, P--. expressie U., & Wiemken, A.
<Desc/Clms Page number 10>
1998. Expression of a functional barley sucrose-fructan 6-fructosyltransferase in the methylotrophic yeast Pichia pastoris. FEBS Lett. 440 : 356-360). De resten van de fructaanproducerende gewassen kunnen op hun beurt worden gebruikt als veevoeder. Eventueel kan het enzym nog eens extra aan het voeder worden toegevoegd om de verteerbaarheid daarvan te verhogen.
Een andere toepassing van het enzym zelf is de toevoeging daarvan aan (vaat) wasmiddelen om fructaanbevattende vlekken af te breken. Dergelijke vlekken zijn bijvoorbeeld chocoladevlekken.
De onderhavige uitvinding zal verder worden verduidelijkt aan de hand van de volgende voorbeelden. De in deze voorbeelden gebruikte algemene moleculair-biologische technieken zijn als beschreven in Sambrook, J., Fritsch, E. F., & Maniatis, T. 1988. Molecular Cloning : a Laboratory Manual. Cold Spring Harbor, New York : Cold Spring Harbor Laboratory Press, tenzij anders aangegeven.
VOORBEELDEN VOORBEELD 1 Isolatie van het 1-FEH-aen van Cichorium intvbus
Een fructaan 1-exohydrolase van Cichorium intv- bus L. wordt uit gevernaliseerde (in koude kamers bewaarde) wortels gezuiverd tot op het punt van electroforetische homogeniteit door toepassing van achtereenvolgens ammonium sulfaat precipitate, fenylsepharose hydrofobe interactiechromatografie, concanavaline A affiniteitschromatografie, Mono Q anionenuitwisselingschromatografie en Uno S6 (BioRad, Hercules, CA) kationenuitwisselingschromatografie. Hoe deze technieken werden uitgevoerd staat beschreven in Claessens, G., Van Laere, A. & De
Proft, M. 1990. sucra en in Van den Ende, W., Van Won- terghem, D. Verhaler., 9., Dewil, E., De Loof, A. & Van
EMI10.1
Laere, A. 1996c.
Purifcacon and characteriz t SST, the key enzyme initiating young chicory chorium L.). Physlcicga
<Desc/Clms Page number 11>
Plantarum 98 : 455-466. Na Western blotting van het enzym wordt via de Edman-degradatietechniek de N-terminale aminozuursequentie bepaald. De sequentie bestaat uit de volgende 28 aminozuren: SSPTEESQPYRTEGFHFQPPKNWINDPNG.
Op basis van deze aminozuur-sequentie en geconserveerde cDNA sequenties van fructosyltranferasen en invertasen worden 2 gedegenereerde sense primers en 1 gedegenereerde antisense primer ontworpen. De eerste sense primer (5'-GGWTTYCAYTTYCARCC-3'), genaamd HFQP, wordt geconstrueerd op basis van het 1-FEH peptide GFHFQP. De tweede sense primer (5'-TGGATGAAYGAYCCNAAYGG- 3'), genaamd UINV, stemt overeen met het geconserveerde peptide WMNDPNG (Pons, T., Olmea, 0., Chinea, G., Beldarrain, A., Marquez, G., Acosta, N., Rodriguez, L. & Valencia, A. 1998. Structural model for family 32 of glycosyl hydrolase enzymes ; Proteins : structure, function and genetics ; In het 1-FEH terminale peptide is de sequentie WINDPNG).
De antisense primer (5'-CCNGTNGCRTTGTTRAA-3'), CTERM genaamd, is afgeleid van de geconserveerde sequentie FNNATG van plantenfructosyltransferasen en -invertasen (Vijn et al., 1997, supra).
Totaal RNA wcrdt bereid uit gevernaliseerde wortels met een hoge 1-FEH activiteit (RNeasy Plant Mini Kit, Qiagen).
Vervolgens wordt Touchdown RT-PCR uitgevoerd met behulp van de PCR Access System-kit (Promega) dcor gebruik te maken van HFQP en CTERM. De Reverse Transcrip- tasestap wordt gedurende 45 min uitgevoerd bij 48 C. De reactiecondities van de PCR waren als volgt : 94OC, 3 min gevolgd door 30 PCR cycli : 940C gedurende 1 min ; een annealingtemperatuur van 50 C gedurende 1 min (per cyclus daalt deze temperatuur met 0. 2 C, dus er is een gradient tussen 51 en 46 C cver 30 cycli) en extensie bij 720C gedurende 2 min.
De laatste extensie was 7 min bij 72 C.
EMI11.1
oc een :-en-zcudi ( Op een tienvcudige verdunning van dit ? CR-mengsel wordt dan verder serr. i-nested PCR toegepast met de UINV en CTERM primers onder dezelfde condities als nier-
<Desc/Clms Page number 12>
boven. Alleen de annealingtemperatuur was hoger, te weten 54, 4 C.
Het verkregen PCR-mengsel werd onderworpen aan een subklonering in E. coli door middel van de TOPO-LA PCR cloning kit (Invitrogen). Na een negatieve PCR screening van de verkregen kloons met behulp van van Cichorium intybus L. 1-SST en 1-FFT afgeleide primers wordt een aantal kloons partieel gesequenced. Enkele daarvan blijken duidelijk homoloog te zijn met bekende invertasen/hydrolasen. Op basis van deze kloons worden PCR producten aangemaakt aan de hand waarvan random 32p radioactieve probes worden ontworpen (Feinberg, A. P. & Vogelstein, B.
1984. Addendum : a technique for radiolabeling DNA restriction endonuclease fragments to high specific activity. Anal. Biochem 137 : 266 ; T7 Quick-Prime Kit, Pharmacia).
Deze probes worden vervolgens aangewend in een Northern blotting-experiment (Thomas, 1980. Hybridization of denatured RNA and DNA fragments transferred to nitrocellulose. PNAS USA 77 : 5201-5205 ; hybridisatietempera- tuur 65 C) waarin totaal RNA van verschillende ontwikkelingsstadia (jong, gevernaliseerd en geforceerd stadium) en verschillende organen (blad, wortel, krop) van Cichorium intvbus L. worden vergeleken. De probe afkomstig van een enkele kloon reageert zeer sterk met het RNA van een gevernaliseerde wortel en niet of zeer zwak met de andere stadia.
De partiële cDNA-sequentie van deze specifieke kloon wordt daarom gebruikt om zeer specifieke primers te ontwerpen om te gebruiken tijdens 5'RACE (5'Full RACE Cores Set, Takara) en 3'RACE teneinde zowel het 5'als het 3'uiteinde van het cDNA te bepalen. Het grote probleem tijdens 5'RACE blijkt dat de verkregen fragmenten steeds afbreken op eenzelfde plaats ongeveer 36 basen verwijderd van de N-terminus waardoor het vermoeden
EMI12.1
ontstaat van een breukgevoelige plaats (shearing) cf het optreden van secundaire structuren (lussen) in het RNA.
Dit euvel kan worden opgelost door zeer voorzichtig te
<Desc/Clms Page number 13>
werk te gaan, een initiële denaturatie van het RNA door te voeren op 650C en M-MuLV reverse transcriptase (Roche) te gebruiken bij 55 C in combinatie met de 5'RACE Takara kit. Zo kan door 5'RACE inderdaad de N-terminale sequentie van het : 1-FEH enzym worden geverifieerd wat als bewijs kan worden beschouwd dat het hier inderdaad gaat over 1-FEH cDNA.
Op basis van de verkregen 5'en 3'RACE fragmenten werden 2 specifieke primers aangemaakt genaamd EXFEHF (5'-ATGTGCTCAGAAAGAAGGGTA-3') en EXFEHR (5'- CCATTAATACTACAGCCACATC-3'). Deze worden gebruikt om het gehele cDNA tijdens PCR (constante annealingtemperatuur 58 C) met een prcofreading DNA polymerase (fuzz Promega) te amplificeren.
Onafhankelijke PCR producten worden vervolgens gekloneerd in de TC ?O-XL vector (TOPO-XLTM PCR cloning kit, Invitrogen) en daarin volledig dubbelstrengs gesequenced door gebruik te maken van M13 forward en reverse primers. De sequentie van het 1-FEH cDNA is weergegeven in Figuur 1.
VOORBEELD 2 Productie van transcende cichoreiclanten vcor het remmen van 1-FEH expressie
Door PCR mutagenese (constante annealingtempe-
EMI13.1
ratuur GAAAGAAGGGTA-3'EN
58 C) mec de primers 5'-ATAAGAATGCGGCCGCATGTGCTCA-wordt het 1-FEH cDNA zoals beschreven in VOORBEELD 1 voorzien van een 5' NotI knipplaats (vetgedrukt in eerste
EMI13.2
primer) primer). ze1 don. Na knippen zcwel het PCR pJD ciD 302 met : Nct-I en NC,-T se richting geligeerd tussen een constitucieve blcemkool nczaiekvirus(CaMV358RNApromotorendeplantspecifiekenosterminatorsequentie.
<Desc/Clms Page number 14>
Uiteraard kan er worden geopteerd een andere promoter in te bouwen in pJD 302 (bijvoorbeeld een koudeinduceerbare promoter, zie hoger).
Na vermeerdering van het plasmide in E. coli wordt het gehele chimere genconstruct uit het plasmide geknipt met behulp van HindIII en SacI en vervolgens geligeerd in de HindIII en SacI site van een van pBIN19 afgeleide binaire plant vector, in het bijzonder pBINPLUS. Het resulterende plasmide wordt vervolgens getransformeerd naar Aqrobacterium, zoals beschreven in Höfgen en Willmitzer (1988. Storage of competent cells for Aarobacterium transformation. Nucl. Acids Res. 16 : 9077). Vervolgens wordt het DNA van de getransformeerde Aarobacterium zelf binnengebracht. in het cichorei genoom. Hierbij kan er gebruik worden gemaakt van stukjes bladschijfjes van cichoreizaailingen (Vermeulen, A., 1992. supra)
EMI14.1
of-scheutjes (Frulleux, F. Weyens, G. & Jacobs M. 1997.
Agrobacterium tumefaciens-mediated transformation of shoot-buds of chicory. Plant Cell, Tissue and
OrganCulture 50 : 107-112).
De getransformeerde planten worden geselecteerd op kanamycineresistentie. Als extra controle wordt een specifieke. PCR (zie hoger) uitgevoerd, waarmee echte transformanten kunnen worden herkend. Planten geregenereerd op kanamycine-vrije media, getransformeerd met Aarobacterium zonder de binaire vector fungeren als controle.
Als alternatief kunnen Cichorium intybus-protoplasten worden getransformeerd met de antisense versie van het 1-FEH cDNA (Hansen, G., Shilitto, R. D., & Chilton, M. D. 1997. T-strand integration in maize protoplasts after codelivery of a T-DNA substrate and virulence genes) gekoppeld aan een selecteerbare merker. Daarna kan volledige regeneratie van Cichorium intvbus-planten plaatsvinden, zoals beschreven door Varotto e. a. (Varotto, S., Lucchin, M. & Parrini, P. 1997. Plant regeneration from protoplasts sf : tallan red chicory (Cichorium intvbus L. ). Journal er Genetics and breeding 51, 17-22).
<Desc/Clms Page number 15>
VOORBEELD 3 Analyse van transaene cichoreiplanten
Transgene en controle planten worden gedurende een zestal maanden opgekweekt in de kas tot volledige volwassenheid. Dan worden ze onderworpen aan een koude- behandeling (OOC, 48 h) om de activiteit van het endogene 1-FEH te induceren (Van den Ende et al. 1996b, supra).
Wortelwee : sel (1 g) van transgene cichoreiplanten (en concroleplanten) wordt met mortier en stamper geextraheerd in 1 ml 50 mM Na-acetaat buffer pH 5 met 1 mM fenylmethylsulfonylfuoride, 10 mM NaHSO3, 1 mM mercaptoethanol, 0. 02% (w/v) Na-azide en 0. 1% (w/v) Polyclar
EMI15.1
ATI'M (Serva, Heidelberg, Voor de koolhydraat- analyse wordt 500 mg van dit homogenaat tweemaal verdund met 0. 02% (w/v) Na-azide en vervolgens verhit tot 950C gedurende 15 min. Na afkoelen tot kamertemperatuur worden de extracten gecentrifugeerd op 3000 g gedurende 5 min.
Het supernatans wordt vervolgens over Dowex-50 HE (1 ml) en Dowex-1-acetaat (1 ml) kolommetjes geleid, die 5 keer nagespoeld worden met 1 ml water. Deze neutrale fractie wordt gedroogd in een Speed Vac concentrator en vervolgens opnieuw opgelost in een geschikt volume 0. 02% (w/v) Na-azide. De koolhydraten worden dan geanalyseerd door middel van een CarboPac PA1 (Dionex, Sunnyva-
EMI15.2
le, Ca,, an ¯Tekwantificeerd met
Ca) anionenuitwisselingskolom en gekwantificeerd meteen gepulseerde ampercmetrische detectcr voorzien van een goudelectrode (potentialen : E : +0. 05 Vi E : +0. 6 V ;
EMI15.3
E, is l ml per minuut. De 3 :-0. 3 V).
De docrviceisnelheidelutiecondities zign 90 mM NaOH en 20 mM Na-acetaat gedurende l min, gevolgd door een lineaire gradiënt van 20 to 500 mM Na-acetaat in 90 mM NaOH gedurende 1 h.
Regeneratie gebeurt door 1 M NaOH gedurende 10 min en equilibratie gedurende 20 min (90 mM NaOH) na elke run.
Op deze wijze worden de concentraties van glucose, fructose, sucrose, 1-kestose (DP3 inulin) en 1,1-nystose (DP4
EMI15.4
inulin) andaard I i-nes '. R. & Eenett, i. r.. 1993. ificaticn
<Desc/Clms Page number 16>
fructan (inulin) oligomers by anion exchange chromatography. In Inulin and Inulin-containing Crops (A. Fuchs, ed.), pp. 93-99. Elsevier, Amsterdam) bepaald.
Aan de hand van deze koolhydraatkwantificatie wordt geëvalueerd of er in de transgene antisense 1-FEHcichoreiplanten inderdaad een inhibitie is van fructaanafbraak ten opzichte van de controleplanten.
Om aan te tonen dat er in de getransformeerde cichoreiplanten effectief ook minder 1-FEH activiteit is, wordt de rest van het hoger vermelde homogenaat gecentrifugeerd gedurende 5 min (10000 g). Het verkregen supernatans wordt dan vervolgens gemengd met een verzadigde ammoniumsulfaatoplossing in Na-acetaatbuffer, pH 5,50 mM tot een eindconcentratie van 80% ammoniumsulfaat. Na een half uur incubatie op ijs wordt er gecentrifugeerd gedurende 5 min (10000 g). De neerslagen worden vervolgens gewassen met 80% ammoniumsulfaat in Na-acetaatbuffer, pH 5, 50 mM.
Na een tweede centrifugatie onder de bovenvermelde condities, worden de neerslagen opnieuw opgelost in 50 mM Na-acetaat buffer, pH 5 met 0. 02% (w/v) Na-azide.
Om ammoniumsulfaat en endogene koolhydraten te verwijderen worden de monsters vervolgens over een G-25 kolommetje geleid dat vooraf werd geëquilibreerd met 50 mM Naacetaat buffer, pH 5 aangevuld met 0. 02% (w/v) Na-azide en kort (45 s) gecentrifugeerd (3000 g). Elutie van het eiwitextract van de G25 kolom gebeurt dan eveneens door een korte centrifugatie (45 s, 3000 g). Door incubatie van een portie van dit eiwitextract samen met 3% (w/v) commercieel cichorei-inuline (DP & 10, Sigma, St. Louis, Mo) in 50 mM Na-acetaat buffer pH 5 met 0. 02% (w/v) Naazide gedurende 2 h bij 300C wordt het inulinesubstraat door 1-FEH gedeeltelijk afgebroken tot respectievelijk fructose en inuline met een lagere DP. De enzymatische reactie wordt stilgelegd door verwarmen op 950C gedurende 10 min.
Deze monsters werden vervolgens geanalyseerd op fructoseproductie op een Dionex kolom zoals boven be-
<Desc/Clms Page number 17>
schreven. De geproduceerde fructose per tijdseenheid is een maat voor de aanwezige 1-FEH activiteit.
VOORBEELD 4 Productie van transqene witlofplanten voor het stimuleren van de 1-FEH productie
Het 1-FEH cDNA zoals beschreven in VOORBEELD 1
EMI17.1
of een 1-FEH cDNA van een ander species (zie verder VOORBEELD 9) worden voorzien van een 5' NcoI- en een 3' NotI-knipplaats. Bij het ontwerpen van de sense primer dient er voor gezorgd te worden dat het ATG startcodon van de NcoI knipplaats in leesraam komt met het in 1-FEH gebruikte leesraam. Verder verloopt de procedure op dezelfde wijze als beschreven in VOORBEELD 2.
Na knippen van PCR product en de vector pJD 302 met NotI en NcoI wordt het : cDNA zo in de sense richting geligeerd tussen een koude-induceerbare promotor en de plantspecifieke nos terminator sequentie.
De transformatie naar witlof en selectie verloopt op dezelfde wijze als beschreven voor cichorei in VOORBEELD 2.
VOORBEELD 5 Analyse van transcene witlofplanten
In het geval dat het extra in het genoom geintroduceerde 1-FEH onder controle staat van een ccnstitutieve promotor, dan is er reeds in zeer jonge witlof- planten, zowel in wcrtel als bladweefsel, een verhcogde 1-FEH activiteit en worden snerk verlaagde fructaanconcentraties gevonden.
Echter, omdat hec opbouwen van voldoende reserve aan fructanen dcor fructosyltransferasen essentieel is, is het wenselijk het ingebouwde 1-FEH onder controle te plaatsen van bijvoorbeeld een koude-induceerbare of andere induceerbare promotor zodat transcriptie-initiatie seches kan beginnen wanneer d : :. : is gewenst (in geval van
<Desc/Clms Page number 18>
een koude-induceerbare promoter bijvoorbeeld in september).
Er zijn aanwijzingen dat de promotor van 1-FEH zelf koude-induceerbaar is. Het is dus uiteraard ook mogelijk de eigen promotor (waarschijnlijk ook wortelspecifiek, zie VOORBEELD 1) aan te wenden.
Om het risico van silencing (Wassenegger, M. & Pelissier, T. (1998). A model for RNA-mediated gene silencing in higher plants. Plant molecular biology 37 : 349-362) te verlagen, heeft het echter de voorkeur extra cDNA van een ander species (bijvoorbeeld Helianthus tuberosus, Taraxacum officinale, Schorzonera hispanic (schorseneer), Cynara scolymus (artisjok), Dahlia variabilis (Dahlia), Doronicum pardalianches (voorjaarszonnebloem), Inula helenium (Griekse Alant) te introduceren in Cichorium intvbus.
Transgene en controle witlofplanten worden gedurende een vijftal maanden (nog net geen volwassen planten) opgekweekt in de kas. Daarna worden de planten geoogst, de bladeren worden verwijderd en de wortels worden vervolgens gedurende een tiental dagen bewaard in een koude kamer (temperatuur 1 C) en vervolgens gedurende een drietal weken getrokken in donkere kamers (temperatuur 14 tot 20 C, relatieve luchtvochtigheid 90-98%).
Tijdens deze bewaring en trek worden koolhydraatextracten genomen zoals beschreven in VOORBEELD 3. Er wordt aan de hand van deze koolhydraatkwantificatie nagegaan of er in de transgene 1-FEH witlofplanten inderdaad een hoger niveau is van fructaanafbraak ten opzichte van de contro- leplanten. Verder wordt op dezelfde wijze als in VOORBEELD 3 nagegaan of deze verhoogde fructaan-afbraak positief is gecorreleerd met de kwaliteit van de geprodu- ceerde witlofkroppen en dat er in de getransformeerde witlofplanten effectief ook meer 1-FEH activiteit aanwe- zig is.
VOORBEELD 6 Recombin. ante oroductie van 1-FEH in Pichia pastors
<Desc/Clms Page number 19>
Expressie van planteneiwitten in gist (zoals Saccharomvces cerivisiae of andere) is een praktische manier om grote hoeveelheid functioneel enzym aan te maken, zeker als dit enzym door de gist wordt gesecreteerd in het groeimedium waaruit het eenvoudig kan worden teruggewonnen.
Het 1-FEH van Cichorium intvbus wordt daartoe ingebouwd in een gist pPICZa secretievector en worden getransformeerd naar Pichia pastoris (zoals uitvoerig beschreven in Pichia Expression System, EasySelect Pichia Expression, Invitrogen). Dit is een uniek expressiesysteem omdat het de voordelen van E. coli (hoge opbrengst, gemakkelijke schaalvergroting, goedkope groeiomstandigheden) combineert met de voordelen van eukaryotische expressie (enzymprocessing, vouwing en posttranslationele modificaties). In het bijzonder is de methylotrofe gist Pichia pastors bijzonder interessant wanneer het gaat over fructaan of sucrose-metaboliserende enzymen omdat deze gist zelf geen fructaan of sucrose-metaboliserende enzymen secreteert.
Bovendien zou de glycosylatie van de gesecreteerde eiwitten, in tegenstelling tot die verkre- gen in Saccharomyces cerivisiae, meer overeenkomst vertonen met de glycosylatie zoals die in planten gebeurt (Hochstrasser, U. et al., 1998. supra).
Er wordt dan nagegaan of 1-FEH inderdaad aanwezig is in het supernatans (zie VOORBEELD 3) door het testen van de enzymatische activiteit. Verdere bevesti-
EMI19.1
ging komt via SDS-PAGE ie van het molecuulge- (verificawinch) of via Western blotting (specifiek antilichaam tegen 1- FEH).
Het heeft de voorkeur het enzym te voorzien van een polyhistidine-tag, waardoor specifieke isolatie van het 1-FEH uit het supernatans eenvoudig wordt (EasySelect Pichia Expression, Invitrogen).
<Desc/Clms Page number 20>
VOORBEELD 7 Fructoseproductie met behulp van recombinant 1-FEH
Het onder VOORBEELD 6 beschreven recombinant 1FEH, dat door Pichia pastoris of een ander micro-organisme is geproduceerd, wordt vervolgens gebruikt voor de productie van fructose uit inuline volgens de methode van Zittan (Zittan, L. 1981. Enzymatic hydrolysis of inulinan alternative way to fructose production. Starch/Stärke 33 : 373-377).
Extractie van inuline uit reserve-organen (van bijvoorbeeld Cichorium intybus L., Helianthus tuberosus of Agave americana etc. ) en de productie van "fructose syrup" wordt uitgevoerd als beschreven in WO 97/34027.
VOORBEELD 8 Toevoeaina van het 1-FEH enzym aan (vaat) wasmiddel
De teelt van cichorei als bron voor de productie van fructanen heeft de laatste jaren sterk aan belang gewonnen. In de eerste plaats komt dit door de toegenomen interesse van de voedingsindustrie in fructanen in het algemeen en inuline in het bijzonder. Een probleem van onze tijd vormt inderdaad het overmatig gebruik van hoogcalorisch vet en suiker en het gebrek aan voedingsvezels in de voeding met alle gevolgen van dien (zwaarlijvigheid, hart en vaatziekten). Aangezien fructanen niet kunnen worden afgebroken in het maag- en darmstelsel zijn ze laag calorisch. Ze hebben de eigenschappen van voedingsvezels en komen in aanmerking als substituut van vet en/of suiker in de voeding.
Bovendien zouden ze heilzaam zijn voor de gezondheid door hun bifidogene werking (Hidaka et al., 1991i Van Hee, 1993, beiden supra).
Een gevolg van het toegenomen gebruik van fructanen in de voeding heeft natuurlijk ook zijn conse- quenties voor wat betreft het verwijderen van vlekken kledingstukken (of eventueel ock voor de reinigen van de vaat). De oplosbaarheid van fructanen neemt sterk af met de polymerisatiegraad. Aangezien er duidelijk een tendens
<Desc/Clms Page number 21>
is om fructanen met een hcgere DP te gaan gebruiken, is het duidelijk dat de lange lineaire ketens stevig kunnen interageren met de text-elvezels. Een recente publicatie toont tevens aan dat hoge DP fructanen kunnen interageren met lipiden (vetten) (Demel, R. A., Dorrepaal, E., Ebskamp, M. J. M., Smeekens, J. C. M. & de Kruijff, B. 1998.
Fructans interact strongly with model membranes. Biochim.
Biophys. Acta 1375 : 36-42). Het is daarom niet onwaarschijnlijk dat de gevcrmde textiel-fructaan-vet netwerken hardnekkiger kunnen zijn dan de klassieke textiel-vet interacties. Een mogelijke oplossing zou zijn het wassen bij hogere temperatuur (60 of 90 C), omdat de oplosbaarheid van fructanen sterk toeneemt bij hogere temperatuur (Berghofer, E., Cramer, A., Schmidt, U. & Veigl, M. 1993.
Pilot-scale production of inulin from chicory roots and its use in foodstuffs. In Inulin and Inulin-containing Crops (A. Fuchs, ed.), pp. 77-84. Elsevier, Amsterdam).
Dit druist echter resoluut in tegen de tendens om te wassen bij lagere temperatuur (40 C) en dit zowel voor de kleurvastheid als uit milieu-en economische overwegingen. Een elegante oplossing is daarom het toevoegen van het onder VOORBEELD 6 vermelde recombinante 1-FEH enzym dat zeer snel en eifectief hoge DP fructanen kan afbreken tot fructose, dat op zijn beurt zeer snel oplost in het waswater. Een voordeel is dat het temperatuursoptimum van 1-FEH breed is met een optimum rond 50 graden (Van den Ende, 1996, supra) zcdat slechts een minimale hoeveelheid zou volstaan om effectief te kunnen worden toegepast tijdens het wassen op 40 of 60 C.
Het ligt binnen het bereik van de deskundige op het gebied van (vaat) wasmiddelen om een geschikte of optimale combinatie van het enzym met andere (vaat) wasmiddel-bestanddelen te kiezen.
<Desc/Clms Page number 22>
VOORBEELD 9 Isolatie van FEH-qenen uit andere planten
Net zoals fructosyltransferasen zijn de FEH genen waarschijnlijk geëvolueerd uit invertasen, waarmee ze nog een hoge graad van homologie vertonen. Wat betreft fructosyltransferasen blijkt dat de homologie tussen ISST's van verschillende species binnen de Asteraceae (Cichorium intybus L. ; Helianthus tuberosus, Cynara scolymus) veel hoger is dan de homologie tussen 1-SST en invertase van hetzelfde species. Dit maakt het bijvoorbeeld mogelijk het 1-SST van Helianthus tuberosus op een eenvoudige wijze op te pikken uit een cDNA of genomische bank van Helianthus tuberosus door gebruik te maken van een DNA probe van Cichorium intybus L.
De hybridisatietemperatuur die dan het best kan worden gebruikt ligt lager dan bij een homologe probe (65-68 C), maar toch hoog genoeg (tussen 60 en 65 C) om zo weinig mogelijk aanverwante cDNA's of genen zoals invertasen of FFT's op te pikken.
Net als Cichorium intvbus L. is Helianthus tuberosus L. een zeer interessant gewas voor de industri- ele productie van fructanen. Om de tijdrovende stap van de 1-FEH zuivering uit Helianthus tuberosus te kunnen vermijden is het daarom interessant het 1-FEH cDNA van Helianthus tuberosus op te pikken door gebruik te maken van een DNA-probe, die is afgeleid van de Cichorium intvbus 1-FEH cDNA-sequentie zoals beschreven in Figuur 1 (VOORBEELD 1).
Hiertoe wordt er eerst een cDNA bank van Helianthus tuberosus aangemaakt door gebruik te maken van klassieke moleculair-biologische technieken (Sambrook et al., 1988. supra) zoals beschreven in Van der Meer et al.
EMI22.1
(Van der Meer I., Koops A. Hakkert J. & van Tunen A. 1998. Cloning of the fructan biosynthesis pathway 0 Jerusalem artichoke. The Plant Journal 15
J.,Vervolgens wordt de bank gescreend met een"random-primer-labeled probe" (500 baseparen lang) van Cichorium intvbus 1-FEH cDNA (hybridisatietemperatuur 50 C). Ce
<Desc/Clms Page number 23>
identiteit van positieve kloons wordt verder geanalyseerd door middel van sequentiebepaling. Zekerheid over de functionaliteit van het vermeende l-FEH wordt verworven door een transiënte expressie in tabaksprotoplasten (Sprenger, N., Schellenbaum, L., van Dun, K., Boller, T.
& Wiemken, A. 1997. Fructan synthesis in transgenic tobacco and chicory plants expressing barley sucrose : fructan 6-fructosyltransferase. FEBS Letters 400 : 355- 358).
Een andere benaderingswijze is RT-PCR op Helianthus tuberosus RNA door gebruik te maken van PCR-primers afgeleid van het Cichorium intybus 1-FEH cDNA. Om het volledige cDNA op te pikken gebruikt men EXFEHF en EXFEHR (zie VOORBEELD 1) maar bij een minder stringente annealingtemperatuur (bijvoorbeeld tussen 50 en 55 C).
<Desc / Clms Page number 1>
MANIPULATING FRUCAN CATABOLISM IN PLANTS
The present invention relates to the fructan 1-exohydrcase gene, to the enzyme encoded by that gene and to the manipulation of the activity of both in plants.
The enzyme fructan 1-exohydrolase (1-FEH, EC 3. 2. 1. 80, G- (F) + H. O-G- (F), + F with n> 1) breaks down fructans. The breakdown of fructans in plants is possible
EMI1.1
economic point of view or disadvantageous.
For the low carbohydrates, such as fructans, their premature degradation is unnecessary. To achieve the highest possible degree of polymerization (degree of polymerization or "DP"), the fructans that are formed must be prevented from being broken down into their building blocks.
In other cases, the occurrence of fructan degradation is favorable for the plant. 1-FEH activity is expressed in Cichorium intvbus L. during emergency situations (cutting of leaves at a young stage) or when, such as during the cultivation of chicory, the green foliage of adult plants is removed and the roots are kept in cold rooms at a temperature of +1 C for short storage or -1 C for longer storage (Van den Ende, W. & Van Laere, A. 1996a, Fructan synthesizing and degrading activities in chicory rcots (Cichoriumintybus L.) duringgrowth, storageandforcing. J. Plant Physiol. 149: 43-50). During the subsequent "trek" or "forcerie", the well-known chicory heads are formed in the dark.
Since no fctosynthesis can take place under these circumstances, a
EMI1.2
efficient fructan degradation from To scaling to the catabolism, rucc rructans, The fructan metabolism t enzymes that
<Desc / Clms Page number 2>
EMI2.1
syltransferases, such as sucrose transferase (1-SST, EC 2. GF + GF GFF + G) and fructan 1-fructosyl transferase (1-FFT, EC 2. 4. 1. 100 + G- (F) with n> 1, m> 0) and enzymes that break down fructans. Of the latter, fructan 1-exohydrolase is an example. In addition, invertases (EC 3. 2. 1. 26) and ss-fructo (furano) sidases occur.
Real fructan exohydrolases preferentially degrade fructans, while their activity towards sucrose is low or zero. Real sucrases or invertases preferentially degrade sucrose, although, for example, yeast invertase may also exhibit ss-fructo (furano) sidaseen transfructosylase activity (Cairns, AJ & Ashton, JE 1991. The interpretation of in vitro measurements of fructosyl transferase activity: an analysis of patterns or fructosyl transfer by fungal invertase.
EMI2.2
New Phytol. 118 non-specific ss-fructo) break down both fructans and sucrose (Simpson, & Bonnett, G. from grasses. New Phytol. 123: 453-469).
The fructan concentration is determined by the interplay of build-up and breakdown enzymes. Although transgenic plants having different types of fructosyltransferases have already been described in the literature, much less information is available about the degradation enzymes.
So far only complete purification of the enzyme 1-FEH of Cichorium intybus L. has been described.
(Claessens, G., Van Laere, A. & De Proft, M. 1990.
Purification and properties of an inulinase from chicory roots (Cichorium intvbus L.). J. Plant Physiol. 136: 35-39), from 1-FEH from Helianthus tuberosus L. (Marx, SP, Nösberger, J. & Frehner, M. 1997a. Seasonal variation of fructan-ss-fructosidase (FEH) activity and characterization of a S- (2, 1) linkage specific FEH, New Phytol. 135: 267-277) and of 6-FEH from Lollium prenne (Marx, S.?., Nösberger, J. & Frehner, M. 1997b. Hydrolysis of fructan in grasses: a ss- (2, 6) linkage specific fructan-ss-fr cto-
<Desc / Clms Page number 3>
sidase from stubble or Lolium perenne. New Phytol. 135: 279-290).
Of none of these, however, are the N-terminal amino acid sequences or the nucleotide sequences of the corresponding genes or cDNAs known.
The object of the present invention is now to enable efficient control of fructan metabolism in plants by being able to control fructan catabolism.
To this end, the invention is based on the cloning and sequencing of the cDNA encoding a fructan 1-exohydrolase (1-FEH) from the root of Cichorium intybus L. The sequence of this cDNA is given in Figure 1.
The invention therefore relates in a general sense to a DNA molecule which codes for an enzyme with fructan 1-exohydrolase activity and which comprises one of the following nucleotide sequences: a) a sequence which, after washing in 1xSSPE at 600C, still hybridizes to the sequence of Figure 1 or the complementary sequence thereof; or b) a sequence that is at least 60% homologous to the sequence of Figure 1 or the complementary sequence thereof.
More specifically, the invention provides a DNA molecule that encodes an enzyme with fructan 1 exohydrolase activity and which molecule has a nucleotide sequence as shown in Figure 1 or the complementary sequence thereof.
The availability of the cDNA of this 1-FEH leads to a number of sub-aspects of the invention.
Firstly, based on the available gene, the plant can be induced to produce antisense RNA against the RNA of the endogenous gene. this lowers the expression juisf and switches it off and
EMI3.1
vomiting of example is bi, example, ran important when a plane fructans (e.g. from wcrtels chcrium --i ee
<Desc / Clms Page number 4>
In particular, at the end of the growing season it is necessary to prevent fructans with a higher DP from being broken down into fructans with a lower DP and fructose. This is undesirable because fructans with a higher DP are more interesting for food and non-food applications (U.S. Patent No. 5, 478, 737; Verraest, D. L., Peters J. A., Van Bekkum, H. & Van Rosmalen, G. M.
1996. Carboxymethyl inulin: a new inhibitor for calcium carbonate precipitation. J. Am. Oil Chem. Soc. 73: 55-62; Verraest, D.L., Zitha-Bovens, E., Peters, J.A. & Van Bekkum, H. 1998. Preparation of O- (aminopropyl) inulin.
Carbohydr. Res. 310: 109-115).
By reducing the 1-FEH activity you can
EMI4.1
in addition, it is prevented that the fructose formed by 1-FEH (acceptor) with the enzyme 1-FFT (1-fructan-tane fructosyltransferase, EC 2. 4. 1. 100) and long fructans as donors produce the undesired short inulo-n-oxes (Van den Ende, W., De Roover, J. & Van Laere, A. 1996a.
In vitro synthesis of fructo-oligosaccharides from inulin and fructose by purified chicory root FFT. Physiol.
Plant. 97: 346-352). This reduces the concentration of the fructans with a desired high DP. In addition, the inulin-oxen produced are reducing sugars, so that they react easily with free amino acids at the higher temperatures used in industrial inulin extraction (Maillard reaction; Hofberger, R. 1997.
Caramel, a classic confection. Candy Industry 162,18-21), which can cause unwanted browning.
Finally, the inhibition of the 1-FEH activity according to the present invention has the additional advantage that the harvest and processing of the fructan-producing plants, such as, for example, chicory roots, can be spread over the year and over a much longer period (end of September to March) ) than is currently the case (end of September to end of October). After all, there is no unwanted breakdown of the fructans and the toilets can simply be stored. The latter could also lead to a
<Desc / Clms Page number 5>
increasing the area where fructan-producing plants, such as chicory roots, can be grown.
Fructans can be used in so-called "food" and "non-food" applications. They (and in particular chicory inulin) are already fully added to foods such as ice cream, chocolate, yogurt, sauces and many others (Van Hee, L. 1993. Fructans, in particular inulin and fructo-oligosaccharides in the diet. to obtain the degree of Nutrition and Dietetics, Ghent University, available via the library; U.S. Patent No. 5, 527, 556). They can be considered low-calorie dietary fiber (Van Loo, J., Coussement, P., De Leenheer, L., Hoebregs, H. & Smits, G. 1995.
On the presence of inulin and oligofructose as natural ingredients in the western diet. Critical reviews in food science and nutrition 35: 525-552) that also have a beneficial effect on health because of their bifidogenic effect (Hidaka, H., Hirayama, M. & Yamada K.
1991. Fructooligosaccharides. Enzymatic preparation and biofunctions. J. Carbohydr. Chem. 10: 509-522).
With regard to the many potential non-food applications (Fuchs, A.: 987. Pocencials for non-food utilization or fructose and inulin. Starch / Stärke 39: 335-343; Fuchs, A. 1991. Current and potential food and non- food applicators or fructans Redesigning Crop Products for Biotechnology Biochem Soc.
Trans. 19: 555-560), most are still fully in the development stage. Some of
EMI5.1
However, it has already been commercialized as co-builders together with so-called "builders" to build a calcium and complex patent for calcium carbonate installation. inulin derivatives or its derivatives will be used in the near future in o. a. the Paper industry, cosmetics and the production of coatings and adhesives.
<Desc / Clms Page number 6>
Furthermore, it has now become possible to incorporate the 1-FEH gene into plants in which endogenous fructans and 1-FEH are already present (homologous expression) in order to achieve a higher expression of the gene above the endogenous level. The gene can be from the same species or from a different species. However, to minimize the risk of so-called "silencing", it is preferable to introduce 1-FEH from another species, such as, for example, 1-FEH from Cichorium intvbus in Helianthus tuberosus or vice versa.
In addition, the gene can be introduced into plants that cannot naturally produce fructans.
They must then first be encouraged to synthesize fructans by transformation with the necessary fructosyl transferase genes (see, for example, WO97 / 42331). It
EMI6.1
"ructans can be able to synthesize plants of great interest, for example to become more resistant to drought stress, cold or oxygenated
EMI6.2
break the soil (Albrecht, G., Kammerer, S., W. & Fructan content of wheat seedlings under hypoxia and subsequent re-aeration. New Phytol. 123: 471-476i Spoli, WG, & Nelson, CJ 1994. Response of fructan to water deficiency in growing leaves of tall fescue Plant Physiol 106, 329-336, Pilon-Smits, EAH, Ebskamp, MJM, Itching, MJW, Weisbeek, PJ & Smeekens, SCM 1995. Improved performance of transgenic fructan -accumulating tobacco under drought stress.
Plant Physiology 107: 125-130 Livingston, D. P. III. & Henson, C.A. 1998. Apoplastic sugars, fructans, fructan exohy
EMI6.3
drolase, and invertase in winter time Responses to second-phase cold hardening. Plant Physiol. 116 403-408).
If it is desired that the transgenic plants, which now synthesize fructans, can also use this as an energy source, it is of course necessary that 1-FEH is also introduced. The transgenic plants can then use their planted fruit reserves when necessary, for example after destruction of the photosynthetic device docr vraat, frost or storm wind
<Desc / Clms Page number 7>
or in energy-demanding periods during flowering, ripening or germination. In such cases, the 1-FEH can optionally be placed under the control of a regulatable or organ-specific promoter.
It has been found that during the chicory cultivation in August-September (free season with roots of the new season) few fructans are broken down because 1-FEH ncg is not or insufficiently induced (Van den Ende, W. & Van Laere, A., 1996a, supra). It is precisely at such moments that extra expression of the FEH enzyme would be desirable. 1-FEH activity is particularly indispensable for crop formation. In transgenic chicory plants, the 1-FEH gene of the invention, or any other corresponding gene under the regulation of a
EMI7.1
inducible, e.g., a cold-inducible, promoter, thereby producing extra 1-FEH at an early stage during forcing.
The production of transgenic plants can be achieved by techniques known per se.
Agrobacterium-mediated transformation is usually used (Horsch, RB, Fry, JE, Hoffman, NL, Eichholtz, D., Rogers, SG & Fraley, RT 1985. A simple and general method for transferring genes into plants. Science 227: 1229-1232). Transformation of chicory and chicory is described in Vermeulen, A., Vaucheret, H., Fautot, V. & Chupeau, A. 1992. Aarobacterium-
EMI7.2
mediated transfer or synthase to chlorosulfuron in chicory L.).
Plant Cell Rep. 11, 243-a mutanc Arabidops247; Vijn, I., van ken, A., Sprenger, N., van Dun, K., Weisbeek, P., Wiemken, A. & Smeekens, S. 1997. Fructan of the inulin neoseries is synthesized in transgenic chicory
EMI7.3
planes ntybus ceca L.) fructan ctan Plant Journal Jacobs erLum -ns-mediated rcrmation -cuds and Organ 7-112
<Desc / Clms Page number 8>
(Cichorium baum, L., van Dun, K., Boller, T. & Wiemken, A. 1997.
Fructan synthesis in transgenic tobacco and chicory plants expressing barley sucrose: fructan 6-fructosyl transferase. FEBS Letters 400: 355-358. Hellwege, EM, Gritscher, D., Willmitzer, L. & Heyer, AG described the transformation of potato in 1997 in "Transgenic potato tubers accumulate high levels of 1-kestosis and nystosis: functional identification of a sucrose: sucrose 1 -fructosyltransferase or artichoke (Cynara scolvus) blossom discs, "The Plant Journal 12: 1057-1065. The transformation of sugar beet has been demonstrated in Sevenier, R., Hall, R.D., Van der Meer, I.M., Hakkert, H.J. C, van Tunen, A. & Koops, A. 1998.
High level fructan accumulation in a transgenic sugar bite. Nature biotechnology 16: 843-846.
To obtain transgenic plants expressing antisense RNA, an antisense version of the gene is assumed. Furthermore, transgenic plants are obtained in the same manner as described above.
By varying the promoter, the expression of the gene can be accomplished in certain desired situations or disabled in certain unwanted situations. For example, if degradation is to take place at a certain time in the growing season, the gene may be operably linked to a promoter, which is being activated at that time. An example of this is Hordeum's cold-inducible promoter (Dunn, MA, White, AJ, Vural, S. & Hughes, MA 1998. Identification of promoter elements in a low-temperature responsive gene (blt 4.9) from barley ( Hordeum vulqare L.) Plant Molecular Biology 38: 551-564).
To inhibit the expression of the gene in certain parts or organs of the plant, such as harvestable parts such as fruits, bulbs or tubers by means of antisense RNA, the antisense version of the gene can be brought under the control of an organ-specific promoter. An example of such an organ-specific promoter is the potato patatin promoter (Pur-
<Desc / Clms Page number 9>
EMI9.1
cell, P. & Halford, 1998. Antisense expression of related protein kinase sequence in potato results in decreased expression or sucrose synthase in tubers and loss or sucrose-inducibility or sucrose synthase transcripts in leaves. Plant Journal 14: 195-202).
Based on the 1-FEH sequence of Cichorium intvbus L. according to a further aspect thereof, the invention provides other nucleic acids encoding fructan 1-exohydrolase, in particular genes and cDNAs from other plant species. These can be obtained by screening DNA libraries or cDNA libraries with probes derived from the 1-FEH cDNA of the invention, expressing the positive clones, and then testing the expression product for 1-FEH activity.
EMI9.2
Such probes are preferably at least about 400 nucleotides in length.
For example, the 1-FEH gene from Cichorium homologous genes can be isolated from other Asteraceae, such as Helianthus tuberosus (Jerusalem artichoke) or Schorsonera Hispanic (salsify). By means of the 1-FEH probe from Cichorium it is also possible to isolate the 6-FEH genes from Gramineae, including economically important cereals such as Triticum and Hordeum.
The invention further provides generally probes specific to 1-FEH and includes a sequence of at least about 16 contiguous nucleotides selected from the sequence given in Figure 1. Such probes are, for example, PCR primers
EMI9.3
or hybridization probes.
According to one of the invention, the enzyme can also produce as such by means of recombinant DNA techniques used in a protein-treated manner, such as enzymes, P,. expression U., & Wiemken, A.
<Desc / Clms Page number 10>
1998. Expression of a functional barley sucrose fructan 6-fructosyl transferase in the methylotrophic yeast Pichia pastoris. FEBS Lett. 440: 356-360). The remains of the fructan-producing crops can in turn be used as animal feed. Optionally, the enzyme can be added extra to the feed to increase its digestibility.
Another application of the enzyme itself is its addition to (dish) detergents to break down fructan-containing stains. Such stains are, for example, chocolate stains.
The present invention will be further elucidated with reference to the following examples. The general molecular biological techniques used in these examples are as described in Sambrook, J., Fritsch, E.F. & Maniatis, T. 1988. Molecular Cloning: a Laboratory Manual. Cold Spring Harbor, New York: Cold Spring Harbor Laboratory Press unless otherwise specified.
EXAMPLES EXAMPLE 1 Isolation of the 1-FEH-aen of Cichorium intvbus
A fructan 1-exohydrolase from Cichorium intvbus L. is purified from rooted (stored in cold chambers) roots to the point of electrophoretic homogeneity by applying successively ammonium sulfate precipitate, phenylsepharose hydrophobic interaction chromatography, concanavalin A affinity chromatography, Mono Q anionography exchange Uno S6 (BioRad, Hercules, CA) cation exchange chromatography. How these techniques were performed is described in Claessens, G., Van Laere, A. & De
Proft, M. 1990. sucra and in Van den Ende, W., Van Wotterghem, D. Verhaler., 9., Dewil, E., De Loof, A. & Van
EMI10.1
Laere, A. 1996c.
Purifcacon and characteriz t SST, the key enzyme initiating young chicory chorium L.). Physlcicga
<Desc / Clms Page number 11>
Plantarum 98: 455-466. After Western blotting of the enzyme, the N-terminal amino acid sequence is determined via the Edman degradation technique. The sequence consists of the following 28 amino acids: SSPTEESQPYRTEGFHFQPPKNWINDPNG.
Based on this amino acid sequence and conserved cDNA sequences of fructosyltransferases and invertases, 2 degenerate sense primers and 1 degenerate antisense primer are designed. The first sense primer (5'-GGWTTYCAYTTYCARCC-3 '), called HFQP, is constructed based on the 1-FEH peptide GFHFQP. The second sense primer (5'-TGGATGAAYGAYCCNAAYGG-3 '), called UINV, corresponds to the conserved peptide WMNDPNG (Pons, T., Olmea, 0., Chinea, G., Beldarrain, A., Marquez, G., Acosta, N., Rodriguez, L. & Valencia, A. 1998. Structural model for family 32 or glycosyl hydrolase enzymes; Proteins: structure, function and genetics; In the 1-FEH terminal peptide the sequence is WINDPNG).
The antisense primer (5'-CCNGTNGCRTTGTTRAA-3 '), called CTERM, is derived from the conserved sequence FNNATG of plant fructosyl transferases and invertases (Vijn et al., 1997, supra).
Total RNA was prepared from generalized roots with a high 1-FEH activity (RNeasy Plant Mini Kit, Qiagen).
Touchdown RT-PCR is then performed using the PCR Access System kit (Promega) using HFQP and CTERM. The Reverse Transcriptase step is performed for 45 minutes at 48 C. The reaction conditions of the PCR were as follows: 94 ° C, 3 minutes followed by 30 PCR cycles: 940 ° C for 1 minute; an annealing temperature of 50 C for 1 min (per cycle this temperature drops by 0. 2 C, so there is a gradient between 51 and 46 C over 30 cycles) and extension at 720 C for 2 min.
The last extension was 7 min at 72 C.
EMI11.1
oc a: -en-zcudi (At a ten-year dilution of this? CR mixture, serr. i-nested PCR is then applied with the UINV and CTERM primers under the same conditions as kidney
<Desc / Clms Page number 12>
above. Only the annealing temperature was higher, namely 54, 4 C.
The resulting PCR mixture was subcloned into E. coli by the TOPO-LA PCR cloning kit (Invitrogen). After a negative PCR screening of the clones obtained using primers derived from Cichorium intybus L. 1-SST and 1-FFT, a number of clones are partially sequenced. Some of them appear to be clearly homologous with known invertases / hydrolases. Based on these clones, PCR products are created based on which random 32p radioactive probes are designed (Feinberg, A. P. & Vogelstein, B.
1984. Addendum: a technique for radiolabeling DNA restriction endonuclease fragments to high specific activity. Anal. Biochem 137: 266; T7 Quick-Prime Kit, Pharmacia).
These probes are then used in a Northern blotting experiment (Thomas, 1980. Hybridization of denatured RNA and DNA fragments transferred to nitrocellulose. PNAS USA 77: 5201-5205; hybridization temperature 65 C) in which total RNA of different development stages (young, generalized and forced stage) and different organs (leaf, root, head) of Cichorium intvbus L. are compared. The probe from a single clone reacts very strongly with the RNA of a generalized root and not or very weakly with the other stages.
The partial cDNA sequence of this specific clone is therefore used to design very specific primers to use during 5'RACE (5'Full RACE Cores Set, Takara) and 3'RACE to both the 5 'and 3' ends of determine the cDNA. The major problem during 5'RACE shows that the fragments obtained always break down in one and the same place about 36 bases away from the N-terminus, so the suspicion
EMI12.1
arises from a fracture-sensitive site (shearing) or the occurrence of secondary structures (loops) in the RNA.
This problem can be solved by being very careful
<Desc / Clms Page number 13>
work, perform an initial denaturation of the RNA at 650C and use M-MuLV reverse transcriptase (Roche) at 55 C in combination with the 5'RACE Takara kit. For example, 5'RACE can indeed verify the N-terminal sequence of the: 1-FEH enzyme, which can be considered as evidence that this is indeed 1-FEH cDNA.
Based on the obtained 5 'and 3' RACE fragments, 2 specific primers were made called EXFEHF (5'-ATGTGCTCAGAAAGAAGGGTA-3 ') and EXFEHR (5'-CCATTAATACTACAGCCACATC-3'). These are used to amplify the entire cDNA during PCR (constant annealing temperature 58 C) with a prcofreading DNA polymerase (fuzz Promega).
Independent PCR products are then cloned into the TC10-XL vector (TOPO-XLTM PCR cloning kit, Invitrogen) and fully double-sequenced therein using M13 forward and reverse primers. The sequence of the 1-FEH cDNA is shown in Figure 1.
EXAMPLE 2 Production of transcending chicory clients for inhibiting 1-FEH expression
By PCR mutagenesis (constant annealing temperature
EMI13.1
rature GAAAGAAGGGTA-3 '
58 C) with the primers 5'-ATAAGAATGCGGCCGCATGTGCTCA-the 1-FEH cDNA as described in EXAMPLE 1 is provided with a 5 'NotI cut site (in bold in first
EMI13.2
primer). ze1 don. After cutting, the PCR pJD ciD 302 with: Nct-I and NC, -T se direction ligated between a constrictive carbon coal virus (CaMV358RNA promoter and plant specific host terminator sequence.
<Desc / Clms Page number 14>
It is of course possible to incorporate another promoter into pJD 302 (for example, a cold-inducible promoter, see above).
After amplification of the plasmid in E. coli, the entire chimeric gene construct is cut from the plasmid using Hind III and Sac I and then ligated into the Hind III and Sac I site of a pBIN19-derived binary plant vector, in particular pBINPLUS. The resulting plasmid is then transformed to Aqrobacterium, as described in Höfgen and Willmitzer (1988. Storage of competent cells for Aarobacterium transformation. Nucl. Acids Res. 16: 9077). The DNA of the transformed Aarobacterium itself is then introduced. in the chicory genome. Use can be made of pieces of leaf discs of chicory seedlings (Vermeulen, A., 1992. supra)
EMI14.1
or shoots (Frulleux, F. Weyens, G. & Jacobs M. 1997.
Agrobacterium tumefaciens-mediated transformation or shoot-buds or chicory. Plant Cell, Tissue and
OrganCulture 50: 107-112).
The transformed plants are selected for kanamycin resistance. As an additional check a specific one becomes. PCR (see above) performed, with which real transformants can be recognized. Plants regenerated on kanamycin-free media, transformed with Aarobacterium without the binary vector act as a control.
Alternatively, Cichorium intybus protoplasts can be transformed with the antisense version of the 1-FEH cDNA (Hansen, G., Shilitto, RD, & Chilton, MD 1997. T-strand integration in maize protoplasts after codelivery or a T-DNA substrate and virulence genes) linked to a selectable marker. After that, complete regeneration of Cichorium intvbus plants can take place, as described by Varotto e. a. (Varotto, S., Lucchin, M. & Parrini, P. 1997. Plant regeneration from protoplasts sf: tallan red chicory (Cichorium intvbus L.). Journal of Genetics and breeding 51, 17-22).
<Desc / Clms Page number 15>
EXAMPLE 3 Analysis of transaene chicory plants
Transgenic and control plants are grown in the greenhouse for six months until full maturity. They are then subjected to a cold treatment (OOC, 48 h) to induce the activity of the endogenous 1-FEH (Van den Ende et al. 1996b, supra).
Root whey (1 g) of transgenic chicory plants (and control plants) is extracted with mortar and pestle in 1 ml 50 mM Na acetate buffer pH 5 with 1 mM phenylmethylsulfonyl fluoride, 10 mM NaHSO3, 1 mM mercaptoethanol, 0. 02% (w / v) Na azide and 0. 1% (w / v) Polyclar
EMI15.1
ATI'M (Serva, Heidelberg, For the carbohydrate analysis, 500 mg of this homogenate is diluted twice with 0.02% (w / v) Na-azide and then heated to 950C for 15 minutes. After cooling to room temperature, the extracts are centrifuged at 3000 g for 5 minutes.
The supernatant is then passed over Dowex-50 HE (1 ml) and Dowex-1-acetate (1 ml) columns, which are rinsed 5 times with 1 ml of water. This neutral fraction is dried in a Speed Vac concentrator and then redissolved in a suitable volume of 0.02% (w / v) Na-azide. The carbohydrates are then analyzed by means of a CarboPac PA1 (Dionex, Sunnyva).
EMI15.2
le, Ca ,, an ´Quantified with
Ca) anion exchange column and quantified with a pulsed amperometric detector provided with a gold electrode (potentials: E: +0. 05 Vi E: +0. 6 V;
EMI15.3
E1 is 1 ml per minute. The 3: -0. 3 V).
The drug velocity elution conditions are 90 mM NaOH and 20 mM Na acetate for 1 min, followed by a linear gradient from 20 to 500 mM Na acetate in 90 mM NaOH for 1 h.
Regeneration is done by 1 M NaOH for 10 minutes and equilibration for 20 minutes (90 mM NaOH) after each run.
In this way the concentrations of glucose, fructose, sucrose, 1-kestose (DP3 inulin) and 1,1-nystose (DP4) are
EMI15.4
inulin) nature. R. & Eenett, i. r .. 1993. ificaticn
<Desc / Clms Page number 16>
fructan (inulin) oligomers by anion exchange chromatography. In Inulin and Inulin-containing Crops (A. Fuchs, etc.), pp. 93-99. Elsevier, Amsterdam).
Based on this carbohydrate quantification, it is evaluated whether there is indeed an inhibition of fructan degradation in the transgenic antisense 1-FEH chicory plants relative to the control plants.
To demonstrate that there is also effectively less 1-FEH activity in the transformed chicory plants, the rest of the homogenate mentioned above is centrifuged for 5 minutes (10000 g). The resulting supernatant is then mixed with a saturated ammonium sulfate solution in Na acetate buffer, pH 5.50 mM to a final concentration of 80% ammonium sulfate. After half an hour of incubation on ice, centrifugation is performed for 5 minutes (10000 g). The precipitates are then washed with 80% ammonium sulfate in Na-acetate buffer, pH 5.50 mM.
After a second centrifugation under the above conditions, the precipitates are redissolved in 50 mM Na acetate buffer, pH 5 with 0.02% (w / v) Na azide.
To remove ammonium sulphate and endogenous carbohydrates, the samples are then passed over a G-25 column that was pre-equilibrated with 50 mM Naacetate buffer, pH 5 supplemented with 0. 02% (w / v) Na-azide and short (45 s) centrifuged (3000 g). Elution of the protein extract from the G25 column is then also done by a short centrifugation (45 s, 3000 g). By incubating a portion of this protein extract together with 3% (w / v) commercial chicory inulin (DP & 10, Sigma, St. Louis, Mo) in 50 mM Na-acetate buffer pH 5 with 0. 02% (w / v) Naazide for 2 h at 30 DEG C. The inulin substrate is partially degraded by 1-FEH to fructose and inulin with a lower DP, respectively. The enzymatic reaction is stopped by heating at 950C for 10 minutes.
These samples were then analyzed for fructose production on a Dionex column as described above
<Desc / Clms Page number 17>
wrote. The fructose produced per unit of time is a measure of the 1-FEH activity present.
EXAMPLE 4 Production of transqene chicory plants to stimulate 1-FEH production
The 1-FEH cDNA as described in EXAMPLE 1
EMI17.1
or a 1-FEH cDNA from another species (see further EXAMPLE 9) are provided with a 5 'Nco I and a 3' Not I cut site. When designing the sense primer, care must be taken to ensure that the ATG start codon of the NcoI cleavage site comes into reading frame with the reading frame used in 1-FEH. Furthermore, the procedure proceeds in the same manner as described in EXAMPLE 2.
After cutting the PCR product and the vector pJD 302 with NotI and NcoI, the: cDNA is ligated in the sense direction between a cold-inducible promoter and the plant-specific nos terminator sequence.
The transformation to chicory and selection proceeds in the same manner as described for chicory in EXAMPLE 2.
EXAMPLE 5 Analysis of transcend chicory plants
In the case that the additional 1-FEH introduced into the genome is under the control of an institutional promoter, then already in very young chicory plants, both in wrcrtel and leaf tissue, a reduced 1-FEH activity is found and highly reduced fructan concentrations are found .
However, since it is essential to build up sufficient reserve of fructans and fructosyl transferases, it is desirable to place the built-in 1-FEH under control of, for example, a cold-inducible or other inducible promoter so that transcription initiation seches can begin when d::. : is required (in case of
<Desc / Clms Page number 18>
a cold-inducible promoter, for example in September).
There are indications that the promoter of 1-FEH itself is cold-inducible. It is of course also possible to use your own promoter (probably also root-specific, see EXAMPLE 1).
To reduce the risk of silencing (Wassenegger, M. & Pelissier, T. (1998). A model for RNA-mediated gene silencing in higher plants. Plant molecular biology 37: 349-362), however, it is preferable to use extra cDNA from another species (e.g. Helianthus tuberosus, Taraxacum officinale, Schorzonera hispanic (salsify), Cynara scolymus (artichoke), Dahlia variabilis (Dahlia), Doronicum pardalianches (spring sunflower), Inula helenium (Greek Alant) to be introduced in Cichorium intvbus.
Transgenic and control chicory plants are grown in the greenhouse for five months (not yet mature plants). The plants are then harvested, the leaves are removed and the roots are then stored in a cold room (temperature 1 C) for ten days and then pulled into dark rooms (temperature 14 to 20 C, relative humidity 90-) for three weeks. 98%).
During this storage and migration, carbohydrate extracts are taken as described in EXAMPLE 3. On the basis of this carbohydrate quantification, it is checked whether there is indeed a higher level of fructan degradation in comparison with the control plants in the transgenic 1-FEH chicory plants. Furthermore, in the same manner as in EXAMPLE 3, it is checked whether this increased fructan degradation is positively correlated with the quality of the chicory heads produced and that more effectively 1-FEH activity is also present in the transformed chicory plants.
EXAMPLE 6 Recombin. ante oration of 1-FEH in Pichia pastors
<Desc / Clms Page number 19>
Expression of plant proteins in yeast (such as Saccharomyces cerivisiae or others) is a practical way to produce a large amount of functional enzyme, especially if this enzyme is secreted by the yeast into the growth medium from which it can be easily recovered.
The 1-FEH of Cichorium intvbus is therefore built into a yeast pPICZa secretion vector and transformed into Pichia pastoris (as described in detail in Pichia Expression System, EasySelect Pichia Expression, Invitrogen). This is a unique expression system because it combines the benefits of E. coli (high yield, easy scaling, inexpensive growing conditions) with the benefits of eukaryotic expression (enzyme processing, folding and post-translational modifications). The methylotrophic yeast Pichia pastors is particularly interesting when it comes to fructan or sucrose metabolizing enzymes because this yeast itself does not secrete fructan or sucrose metabolizing enzymes.
Moreover, the glycosylation of the secreted proteins, in contrast to those obtained in Saccharomyces cerivisiae, would show more similarity with the glycosylation that occurs in plants (Hochstrasser, U. et al., 1998. supra).
It is then checked whether 1-FEH is indeed present in the supernatant (see EXAMPLE 3) by testing the enzymatic activity. Further confirmation
EMI19.1
comes from SDS-PAGE ie from the molecular (verificawinch) or via Western blotting (specific antibody against 1-FEH).
It is preferable to provide the enzyme with a polyhistidine tag, making specific isolation of the 1-FEH from the supernatant simple (EasySelect Pichia Expression, Invitrogen).
<Desc / Clms Page number 20>
EXAMPLE 7 Fructose production using recombinant 1-FEH
The recombinant 1FEH described under EXAMPLE 6, produced by Pichia pastoris or another microorganism, is then used for the production of fructose from inulin according to the method of Zittan (Zittan, L. 1981. Enzymatic hydrolysis or inulinan alternative way to fructose production (Starch / Stärke 33: 373-377).
Extraction of inulin from reserve organs (from for example Cichorium intybus L., Helianthus tuberosus or Agave americana etc.) and the production of "fructose syrup" is carried out as described in WO 97/34027.
EXAMPLE 8 Addition of the 1-FEH enzyme to (dish) detergent
The cultivation of chicory as a source for the production of fructans has gained considerable importance in recent years. In the first place, this is due to the increased interest of the food industry in fructans in general and inulin in particular. A problem of our time is indeed the excessive use of high-calorie fat and sugar and the lack of dietary fiber in the diet with all its consequences (obesity, heart disease). Since fructans cannot be broken down in the gastrointestinal tract, they are low in calories. They have the properties of dietary fiber and are eligible as a substitute for dietary fat and / or sugar.
Moreover, they would be beneficial to health through their bifidogenic effect (Hidaka et al., 1991i Van Hee, 1993, both supra).
A consequence of the increased use of fructans in the diet naturally also has its consequences with regard to the removal of stains from garments (or possibly ock for cleaning the dishes). The solubility of fructans strongly decreases with the degree of polymerization. Since there is clearly a trend
<Desc / Clms Page number 21>
is to start using fructans with a higher DP, it is clear that the long linear chains can interact strongly with the textile fibers. A recent publication also shows that high DP fructans can interact with lipids (fats) (Demel, R. A., Dorrepaal, E., Ebskamp, M.J.M., Smeekens, J.C.M. & de Kruijff, B. 1998.
Fructans interact strongly with model membranes. Biochim.
Biophys. Acta 1375: 36-42). It is therefore not unlikely that the formed textile-fructan-fat networks can be more stubborn than the traditional textile-fat interactions. A possible solution would be washing at a higher temperature (60 or 90 C), because the solubility of fructans strongly increases at higher temperatures (Berghofer, E., Cramer, A., Schmidt, U. & Veigl, M. 1993.
Pilot-scale production or inulin from chicory roots and its use in foodstuffs. In Inulin and Inulin-containing Crops (A. Fuchs, etc.), pp. 77-84. Elsevier, Amsterdam).
However, this resolutely contradicts the tendency to wash at a lower temperature (40 ° C), both for color fastness and for environmental and economic reasons. An elegant solution is therefore to add the recombinant 1-FEH enzyme mentioned under EXAMPLE 6 which can break down very fast and effectively high DP fructans to fructose, which in turn dissolves very quickly in the wash water. An advantage is that the temperature optimum is 1-FEH wide with an optimum around 50 degrees (Van den Ende, 1996, supra) so that only a minimal amount would suffice to be used effectively during washing at 40 or 60 C.
It is within the reach of those skilled in the art of dishwashing detergents to choose a suitable or optimum combination of the enzyme with other dishwashing detergent components.
<Desc / Clms Page number 22>
EXAMPLE 9 Isolation of FEH phenols from other plants
Just like fructosyltransferases, the FEH genes are probably evolved from invertases, with which they still show a high degree of homology. Regarding fructosyl transferases, it appears that the homology between ISSTs of different species within the Asteraceae (Cichorium intybus L.; Helianthus tuberosus, Cynara scolymus) is much higher than the homology between 1-SST and invertase of the same species. This makes it possible, for example, to easily pick up Helianthus tuberosus 1-SST from a Helianthus tuberosus cDNA or genomic library using a DNA probe from Cichorium intybus L.
The hybridization temperature that can best be used is lower than with a homologous probe (65-68 C), yet high enough (between 60 and 65 C) to pick up as few related cDNAs or genes as invertases or FFTs as possible.
Like Cichorium intvbus L., Helianthus tuberosus L. is a very interesting crop for the industrial production of fructans. To avoid the time-consuming step of 1-FEH purification from Helianthus tuberosus, it is therefore interesting to pick up the 1-FEH cDNA from Helianthus tuberosus by using a DNA probe derived from the Cichorium intvbus 1- FEH cDNA sequence as described in Figure 1 (EXAMPLE 1).
To this end, a Helianthus tuberosus cDNA library is first created using classical molecular-biological techniques (Sambrook et al., 1988. supra) as described in Van der Meer et al.
EMI22.1
(Van der Meer I., Koops A. Hakkert J. & van Tunen A. 1998. Cloning of the fructan biosynthesis pathway 0 Jerusalem artichoke. The Plant Journal 15
J., Next, the library is screened with a "random-primer-labeled probe" (500 base pairs long) of Cichorium intvbus 1-FEH cDNA (hybridization temperature 50 C). Ce
<Desc / Clms Page number 23>
identity of positive clones is further analyzed by sequencing. Certainty about the functionality of the putative 1-FEH is acquired through a transient expression in tobacco protoplasts (Sprenger, N., Schellenbaum, L., van Dun, K., Boller, T.
& Wiemken, A. 1997. Fructan synthesis in transgenic tobacco and chicory plants expressing barley sucrose: fructan 6-fructosyl transferase. FEBS Letters 400: 355-358).
Another approach is RT-PCR on Helianthus tuberosus RNA by using PCR primers derived from the Cichorium intybus 1-FEH cDNA. To pick up the complete cDNA, EXFEHF and EXFEHR are used (see EXAMPLE 1) but with a less stringent annealing temperature (for example between 50 and 55 C).