AU767520B2 - Crystalline form of activated trap and use thereof for structure-based drug design - Google Patents

Description

WO 00/37620 PCT/SE99/02192 CRYSTALLINE FORM OF ACTIVATED TRAP AND USE THEREOF

FOR

STRUCTURE-BASED DRUG DESIGN.

The invention relates to crystalline form of TRAP (tartrate-resistant and purple acid phosphatases), which is activated by cleavage. The TRAP is preferably human or rat TRAP.

The atomic structural coordinates are given as well as the conserved surface which is created by special atoms, relevant for the design of modulators or inhibitors of the human TRAP.

This crystalline form of activated TRAP can be used for structure-based drug design for specific modulator, activator or inhibitor of TRAP activity, useful in the treatment of diseases or degenerative conditions resulting in increased bone resorption, such as tissue damages, bone metabolic disorders, osteoporosis.

BACKGROUND

Tartrate resistant purple acid phosphatase (TRAP or PAP) is a mammalian di-iron containing enzyme highly expressed in a limited number of tissues. In humans and rodents it is primarily present in cells responsible for bone resorption, osteoclasts, and in macrophages of spleen, liver and lung.

Normal bone function requires a turnover of bone. Bone is constantly being rebuilt by cycles of resorption and formation which means that formation is closely linked to resorption (a phenomenon referred to as coupling).

TRAP is an enzyme expressed predominantly in bone resorbing cells (osteoclasts).

Investigations in TRAP knockout mice show that the resorption process is disrupted so that, with increasing age, TRAP knockout mice become osteopetrotic, i.e. have an increased bone WO 00/37620 PCT/SE99/02192 mineral content and more dense bone is formed. Osteoclasts prepared from these animals are functional and do resorb bone but to a lesser extent than wild type mouse osteoclasts.

Phosphatases are enzymes that remove organic phosphates from proteins. The mammalian Purple Acid Phosphatases (PAPs), a group of enzymes to which Tartrate Resistant and purple Acid Phosphatase (TRAP) belongs, are characterized by a binuclear iron center at the active site.

The binuclear iron center, low pH optimum high isoelectric point 9) and insensitivity to inhibition by tartrate are features of TRAP that may be involved in the apparent to substrate specificity at the low pH in the osteoclastic resorption area. The TRAP enzyme is a cationic glycoprotein with a molecular mass of 35 kD. The rat TRAP is a protein with a monomeric 306 amino acid peptide structure. See Figure 1. The peptide sequence of rat bone TRAP displays 89-94% homology to TRAP enzyme of the human placenta, bovine spleen, and uteroferrin.

TRAP hydrolyzes aryl phosphates, nucleoside di- and triphosphates, pyrophosphate and phosphoproteins. Its physiological role remains unclear but TRAP may mediate dephosphorylation of bone matrix proteins such as osteopontin and bone sialoprotein.

Dephosphorylation of bone matrix proteins enables osteoclasts to migrate over the bone surface and TRAP is therefore likely to be involved in the attachment of osteoclasts to the bone surface.

In humans and rats, PAP enzymes are highly expressed in certain cells of the monocytemacrophage lineage, such as the bone-resorbing osteoclasts and certain activated macrophages in spleen, liver and lung and TRAP has since long been used as a histochemical marker for these cells. Given the broad substrate specificity of PAP enzymes, it is conceivable that other factors, such as local availability and proper compartmentalisation of PAPs with their potential substrates, are other important factors in determining the physiological action of PAPs in biological systems.

WO 00/37620 PCT/SE99/02192 The cDNA sequences of TRAP/PAP enzymes from different species and organs all indicate that these enzymes are translated as a single polypeptide of around 35 kDa This contrasts with the predominantly two subunit structure, consisting of a 20-23 kDa N-terminal domain linked through a disulphide bond to a 15-17 kDa C-terminal domain, observed in purified enzyme preparations from a variety of sources including human and rat bone [9-10], giant cell tumors [11] and normal and pathological spleen [12-14]. In contrast, uteroferrin purified from endometrial secretions are mostly in the single subunit form [12, 15] as are the recombinant PAPs generated by overexpression using the Baculovirus system [16, 17, 18].

Orlando et al [13] managed to separate the monomeric and two-subunit variants of PAP from to bovine spleen, and demonstrated a markedly higher specific enzyme activity associated with the two subunit form. Moreover, digestion of the single subunit form with the serine proteases trypsin or chymotrypsin generated the 23 kDa and 15 kDa disulfide-linked fragments characteristic of the two subunit form together with a significant enhancement of enzyme activity. Similar nicking and activation of the non-cleaved purified recombinant human and mouse PAPs were noted upon prolonged storage [17].

Purple acid phosphatases (PAPs) are acid metallohydrolases that contain a binuclear Fe3+M2+ center in their active site, where M=Fe or Zn [19-22]. In mammals, these enzymes are also referred to as tartrate-resistant acid phosphatases (TRAPs) (EC 3.1.3.2) or type 5 acid phosphatases[23]. TRAPs are iron-containing, monomeric glycoproteins with molecular weights of around 35,000 Da The deduced amino acid sequences of human, rat and mouse TRAPs shows a high degree of identity to the mammalian members of the PAP family, e.g uteroferrin (Uf) and bovine spleen PAP[5-7]. Recently, EPR spectroscopic analysis of rat recombinant TRAPs[16] have provided compelling evidence that this enzyme belong to the purple acid phosphatase family.

Mammalian PAPs contain a FeFe centre, while a plant PAP from red kidney beans (KBPAP) instead has a FeZn center The anti-ferromagnetically spin-coupled binuclear iron centre of the mammalian PAPs exists in two stable interconvertible states: pink, reduced, EPR-visible WO 00/37620 PCT/SE99/02192 4 and enzymatically active, with a mixed-valent Fe2+ -Fe3+ cluster; and purple, oxidized, EPRsilent and catalytically inactive, with the binuclear pair as Fe3+ -Fe3+ [21, 26-27]. In contrast, the plant enzyme with a mixed-valent Zn2+ -Fe3+ centre is constitutively active [28 The site in the PAPs can harbour either Zn2+ or Fe2+ without alteration of enzyme activity or spectral properties [28-30]. KBPAP is the only PAP whose X-ray structure has been determined. [17] The active site of KBPAP consists of an iron and a zinc ion bridged by an aspartate and probably a hydroxide. The Fe3+ site is coordinated by tyrosine, histidine and aspartate, while the Zn2+ site is coordinated by two histidines and an asparagine [17,31]. One solvent molecule is probably bound to each metal ion. Kidney bean PAP is a homodimeric protein with a molecular weight of around 110,000 Da, and exhibits a low overall sequence homology to the mammalian PAPs However, an alignment of the sequences of Uf and KBPAP displays an identical positioning of the amino acid residues ligating the di-metal centre [31,32]. Moreover, the mammalian protein phosphatases calcineurin (type 2B) [1-2] and protein phosphatase type 1 (PP-1) both contain a di-nuclear metal centre and also reveal a striking similarity to the plant PAP enzyme in the coordination environments of the active site, except for the absence of the tyrosine ligand. These two latter enzymes are serine/threonine protein phosphatases, suggesting that also PAPs function as protein phosphatases. A sequence motif, DXH(X)nGDXXD(X)nGNHD/E, incorporating most of the metal-coordinating amino acids found in the PAP and PP structures so far identified has recently been identified also in a large group of phosphoesterases, including other phosphomonoesterases, nucleotide phosphatases and nucleases, from plants, bacteria and animal cells This phosphoesterase signature motif is represented at the secondary structure level as a p-a-p-a-p-fold that serves to position the two metal ions at the active site with four of the metal ligands provided by loop residues between each p-sheet and a-helix.

The importance of this motif has been confirmed by site-directed mutagenesis studies [12-13].

Furthermore, the PAP members are related to a superfamily of P-(hydr)oxo-bridged binuclear iron proteins, including hemerythrin, R2-subunit of ribonucleotide reductase, methane WO 00/37620 PCT/SE99/02192 -y monooxygenase hydroxylase and others All members of this superfamily of iron-oxygen proteins contain a binuclear iron center but have different functions.

No crystallisation of TRAP, nor of actived TRAP has earlier been performed. The crystal form of the new active form of TRAP is of great use in the screening for specific modulators, activators or inhibitor of TRAP activity. Such specific modulators, activators or inhibitor are useful in the treatment of diseases or degenerative conditions resulting in increased bone resorption, such as tissue damages, bone metabolic disorders, osteoporosis.

FIGURES

Figure 1. The amino acid sequence of rat TRAP, Sequence listing No 1.

Figure 2. A view of TRAP.

Figure 3. Secondary structure diagram of the catalytic domains of TRAP Figure 4. A tracing of a-carbons in TRAP.

Figure 5. A view of the active site of TRAP.

Figure 6. SDS-PAGE gel showing the contents of the crystal containing drops.

THE INVENTION The present invention relates to crystalline form of TRAP (tartrate-resistant and purple acid phosphatases), which is activated by cleavage, preferably human or rat TRAP (Sequence listing No The atomic structural coordinates are given in Table 2. The conserved surface which is created by special atoms is important and crucial for the design of modulators or inhibitors of the human TRAP.

This crystalline form of activated TRAP can be used for structure-based drug design for specific modulator, activator or inhibitor of TRAP activity, useful in the treatment of diseases or degenerative conditions resulting in increased bone resorption, such as tissue damages, bone metabolic disorders, osteoporosis.

WO 00/37620 PCT/SE99/02192 This claimed crystal form of TRAP is a cleaved form. The cleavage of TRAP increases activity and gives the TRAP, which here is called activated TRAP. Reference is given to SE9803959-7 The invention is defined in the attached claims.

EXAMPLE

Methods Protein production and purification Purification of baculovirus produced recombinant TRAP was performed as described [16].

Crystallisation The protein was crystallized by vapor diffusion with the hanging drop method. The crystals used in the structure determination were grown with a reservoir containing 16 %PEG 8000, 0.1 M HEPES (buffer precipitant salt) pH 7.0 and 0.1 M KHPO,. The drop consisted of 2 pl protein solution and 2 pl from the reservoir. The protein concentration was 5-8 mg/ml.

Purple crystals appeared within two weeks at 18 C and reached a maximum size of 0.1 x 0.1 x 0.05 mm.

Using different conditions, different crystal forms were obtained but not all of these crystals were suitable for X-ray studies. Common to all successful crystallisation attempts was the presence of inorganic phosphate.

Data collection Most X-ray data was collected on an inhouse Raxis-4 imageplate detector mounted on a Rigaku RU300 rotating anode. A two-wavelength MAD dataset was also collected on beamline BL14 at ESRF, Grenoble. All data collection was performed under cryoconditions.

Prior to freezing, the crystal was transferred for a few seconds to a cryosolution containing two parts reservoir solution and one part glycerol. The space group was I4, with cell dimensions a=b= 16.4 A and c=63.

3 A. The best crystal diffracted to 2.7 A resolution.

WO 00/37620 PCT/SE99/02192 7 -1 Three distinct heavy atom derivative crystals were produced, using Hg(CN),/HgCl 2 KPtCl, and NaWO 4 Heavy atom derivatives were prepared by adding small volumes (approximately 0.1 pl) of saturated heavy atom solutions to the crystal containing drop two hours prior to freezing. The mercury solution contained equal amounts of Hg(CN) 2 and HgCI 2 The diffraction images were processed with DENZO and Scalepack conserving the anomalous differences for all datasets, including the native. Native and derivative datasets were put to a common scale with the program Scaleit.

Structure determination and refinement The strongest heavy atom site for the mercury derivative was found by difference Patterson map analysis. The other sites were located using difference Fourier syntheses. Mlphare [34] was used for heavy atom parameter refinement and phasing at this stage. Anomalous difference Fouriers were calculated to confirm heavy atom sites and identify the correct enantiomer. The phases were improved by solvent flattening in dm [35] and the corresponding electron density map to 3.5 A resolution was used for most of the structure interpretation.

Later on the programs Sharp [36] and Solomon [37]were used to produce an electron density map of superior quality to 2.7 A. A partial model of kidney bean acid phosphatase was positioned into the density to facilitate model building. The two highest peaks in the anomalous difference Fourier of the native data corresponded well with the positions of the two metal binding sites in the positioned model of the kidney bean enzyme. A model of hTRAP was built with O [38] with intermittent rounds of refinement in CNS The progress of model improvement was monitored with Procheck The model consists of all residues for human TRAP, except a missing loop-region (residues 146-160) and the last four residues. The R-factor is 23 and the free R is 31 for reflections in the interval 50 2.7 A.

82 of the residues fall in the most favorable regions of the Ramachandran plot as defined by Procheck. Data collection and refinement statistics are summarized in Table 1.

The crystal structure giving the atomic structural coordinates is given in Table 2.

Table 1 0 Crystallographic data Data collection Data set resolution X Completeness Rsyma Risob Nr of Phasing (redundancy) sites Power, native 2.7 1.542 89(3.9) 0.107

K

2 PtCI 4 3.0 1.542 69 0.065 0. 4 33 6 1.4 Na 2 W0 4 6.0 1.542 93 0.101 0.288 31 mercury-i1 3.0 1.542 88 0.076 0.363 4 2.1 mercury-2 4.0 1.008 72(2.6) 0.059 0.290 4 3.2 mercury-3 4.0 0.918 68 0.080 0.279 4 2.8 Reflnement R-factor:0.23; Free R:0-31 d Ramachandran angle distribution most favourable: 78.9 allowed: 18.6 generously allowed: 1.2 ,disallowed: 1 .2 a Rsvm Zh~jI(h)-< I(h)j>I/ZhY~jI(h)j, where is the average intensity of reflection h. Zh is the sum over all reflections. and Yis the sum of all measurements of reflection h.

b i X hIFpH -FpI/ Xh Fp, where FpH and Fp are the derivative and native structure factor amplitudes.

C Phasing power FhI lack of closure. Acentric reflections.

d Values and definitions from Procheck (49).

mercury- 1 mixture of saturated solutions of Hg(CN) 2 and HgCl 2 WO 00/37620 PCT/SE99/02192 The structure The structure of TRAP can be described as a double beta sheet sandwhich surrounded on both sides by alpha helices and has the overall fold observed for the C-terminal domain of KBPAP.

See Figure 2 which shows a view of TRAP.

The active site with the two iron ions and the phosphate are shown at the top. The beginning and end of the repression loop (RL) are also marked.

The beta sheets have seven strands each and are mostly parallel and the di-iron active site is found at the C-terminal side of the sheets See Figure 3 which shows a secondary structure diagrams of the catalytic domains of TRAP.

After cleavage of the 21 amino acid N-terminal signal peptide, the sequential structure begins with five residues leading up to the first strand (pl) in the middle of sheet 1. This strand constitutes the first element in the conserved P-a-p-a-P motif. Asp 14 on 1p coordinate the Fe3+ ion and Asp 52 on p2 coordinate both the Fe2+ and Fe3+ ions. A tyrosine side chain, Tyr 55, also coordinates the Fe3+ ion and is responsible for the characteristic colour of this enzyme, due to a charge relay mechanism between the Fe3+ ion and the tyrosine side chain oxygen atom' 8 The delta oxygen of Asn 91 on p3 coordinates the Fe2+ ion. The sequence then adopts a helix-turn-helix structure followed by a final strand on this side of the sheet, before crossing over to sheet 2. The strand P4 does not have a corresponding element in KBPAP. Sheet 2 begins with two strands, p5 and p6, connected by a short turn. p6 is followed immediately by a short helix, a5. The region between Ser 145 and Val 161 is not visible in the electron density map. The density resumes at Val 161 and leads to a6 and p7. At the Cterminal edge of P7 His 186 is coordinating the Fe2+ ion. The following loop contains two residues, Glu 194 andHis 195, that is located close to the active site. The corresponding pair in KBPAP contains two histidine residues. The structure continues with two helices, a7 and a8, interrupted by a proline residue and followed by 38. A short loop between P9 and PI0 contains the last metal interaction site, where Ne of His 221 and N8 of His 223 coordinates the WO 00/37620 PCT/SE99/02192 :c2+ and Fe3+ ions respectively. Sheet 2 continues with three antiparallel strands. P311.

before crossing over back to sheet 1. Three sequential and antiparallel strands constitutes the C-terminal part of the structure. The last four residues, Arg 303 Pro 306 cannot be observed.

There is one disulfide bridge visible in the structure, between Cys 142 on a5 and Cys 200 on c7. The two cysteines are located on different sides of the cleavage site and agrees with SDSpolyacrylamide gel electrophoresis studies with and without reducing agent, which suggested that the two substructures were connected by a disulfide[16].

There are two N-glycosylation motifs in the TRAP sequence. At the extension of the Asn 97 side chain extra density can be seen for one carbohydrate moiety, which has been included in the model. For Asn 128 no such density can be seen. The exposed nature and high B-factors of that side chain suggests that high mobility may be the cause for not observing glycosylation at this site. See Figure 4 showing a view of a-carbons in TRAP. The active site and an Nglycosylation site at Asn 97 are displayed.

The active site The side chains coordinating the iron ions in TRAP all have their equivalent in KBPAP as has been predicted[32]. See Figure 5, a view of the active site of TRAP.

When all atoms in these residues, two aspartic acids, one asparagine, three histidines and a tyrosine, are aligned, the r.m.s distance is 0.7 A. To achieve such similiarty in structure for the active site, the two proteins also share a conserved overall structure. A large density is visible near the two metals that agrees with the size of a phosphate ion. The resolution of the data does not inform us of the orientation of this molecule. Likewise, no solvent molecules in the active site can be modelled accurately based on the present data.

The protein surface in and around the active site can be used for structure based drug design.

This surface is created by atoms from the two metal ions and from the following amino acid WO 00/37620 PCT/SE99/02192 I I "s residues: Aspl4, Asp52, Tyr55, Phe56, Asn91. His92, Hisl86, Tyr187. Glul94. I-lis221, His223, Phe244, Asp246. These amino acids are conserved between the rat enzyme, for which we have determined the structure, and the human enzyme. Their structure in the active site is therefore relevant for the design of modulators or inhibitors of the human TRAP.

The missing density for residues between Serl45 and Vail61 raises the question of proteolytic activation. SDS-polyacrylamide gel electrophoresis indicated that crystallized TRAP had been cleaved into two fragments. Figure 6 shows a SDS-PAGE gel showing the contents of the crystal containing drops. The first three lanes after marker were run under reducing conditions and the last three in non-reducing conditions. The gel shows that the protein has been cleaved between the residues forming the disulfide and where the sizes of the cleavage products corresponds to a cleavage of the protein in the repressions loop.

These fragments corresponded well in size to a cleavage of the protein in this region. We have in patent application SE9803959-7 shown that rat TRAP can be cleaved in this part of the sequence with a resulting increase in activity We cannot at this stage determine whether there is question of a single nicking of the enzyme or if a part of the sequence has been excised. A single cleavage site would give rise to two loose ends that could be too mobile to be detected in the electron density maps. We have labeled the region between a5 and a.6 the repression loop, since its cleavage or removal increases the activity of the enzyme up to ten fold. Serl45 is in close proximity to the active site and it is plausible that the uncleaved loop partly covers it and thereby interferes with activity. Interestingly, this loop domain is missing in KBPAP.

Catalytic mechanism The similarity of TRAP with the catalytic domain of KBPAP suggests a similar reaction mechanism for the two enzymes. Klabunde and coworkers have suggested a mechanism for hydrolysis of phosphate substrates by KBPAP, based on the crystal structures of this enzyme in unliganded form as well as in complex with the reaction product phosphate and with the inhibitor tungstate They conclude that the phosphate substrate interacts with the Zn2+ P:\OPER\PXk2427429 claims 113.doc-23/04/03 12 ion followed by a nucleophilic attack on the phosphorous by an hydroxide ion coordinated by the Fe3+ ion. The negatively charged transition state is believed to be stabilized by the Zn2+ ion and by the imidazoles of three histidine residues His202, His295 and His296, where the latter is also suggested as a potential proton donor to the leaving alcohol group.

These histidines in KBPAP have their structural counterparts in His92, Glu194 and His195 in TRAP. The side chain of Glu194 points down into the protein and is not in close contact with the phosphate group and probably has less of an effect on catalysis than His295 has in KBPAP. His 92 and His195 on the other hand superposes closely on their KBPAP counterparts. The large difference between KBPAP and TRAP in the active site is the nature of the M2+ ion, where KBPAP has a zink ion and TRAP an iron ion. Since the charge can alter between +2 and +3 for iron ions, TRAP is more sensitive than KBPAP to redox agents [21, 25, 28].

Throughout this specification and the claims which follow, unless the context requires otherwise, the word "comprise", and variations such as "comprises" and "comprising", will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integers or steps.

The reference to any prior art in this specification is not, and should not be taken as, an 20 acknowledgment or any form of suggestion that that prior art forms part of the common general knowledge in Australia.

o *o WO 00/37620 PCT/SE99/02192 Table 2 Column contents: 1: 2: 3: 4: 6: 7: 8: 9: Atom number Atom type Residue type Residue number atomic coordinate, X (unit Angstrom) atomic coordinate, Y atomic coordinate, Z atomic occupancy B-factor 1 2 3 4 1 2 3 4 6 7 8 9 11 12 13 14 16 17 18 19 21 22 23 24 26 27 28 29 31 32 33 34

CB

OG1 CG2

C

O

N

CA

N

CA

CB

C

O

N

CD

CA

CB

CG

C

O

N

CA

CB

C

O

N

CA

CB

OG

C

O

N

CA

CB

OG1 CG2

THR

THR

THR

THR

THR

THR

THR

ALA

ALA

ALA

ALA

ALA

PRO

PRO

PRO

PRO

PRO

PRO

PRO

ALA

ALA

ALA

ALA

ALA

SER

SER

SER

SER

SER

SER

THR

THR

THR

THR

THR

120.606 121.896 120.323 119.186 118.175 120.984 120.584 119.141 117.891 117.501 118.087 119.071 117.150 116.001 117.205 115.933 115.726 117.260 116.666 117.970 118.078 118.305 119.196 120.362 118.843 119.834 119.142 120.081 120.715 120.932 121.242 122.087 121.391 120.893 120.255 13.630 13.958 14.545 11.774 12.219 11.253 12.139 10.950 10.508 9.121 10.467 9.915 11.057 11.837 11.102 11.872 12.768 9.738 9.570 8.775 7.433 6.409 7.335 7.557 6.984 6.880 6.930 6.760 5.630 4.953 5.343 4.174 3.142 3.793 2.480 3.450 1.00 30.00 2.918 1.00 30.00 4.633 1.00 30.00 4.394 1.00 30.00 3.846 1.00 30.00 2.757 1.00 30.00 3.885 1.00 30.00 5.440 1.00 30.00 6.061 1.00 30.00 5.541 1.00 30.00 7.582 1.00 30.00 8.072 1.00 30.00 8.344 1.00 30.00 7.847 1.00 '30.00 9.812 1.00 30.00 10.179 1.00 30.00 9.002 1.00 30.00 10.516 1.00 30.00 11.584 1.00 30.00 9.931 1.00 30.00 10.512 1.00 30.00 9.401 1.00 30.00 11.553 1.00 30.00 11.237 1.00 30.00 12.787 1.00 30.00 13.859 1.00 30.00 15.220 1.00 30.00 16.269 1.00 30.00 13.791 1.00 30.00 14.797 1.00 3C.00 12.609 1.00 3C.00 12.427 1.00 3C.00 11.537 1.00 30.00 10.362 1.00 30.00 12.279 1.00 3C.00 SUBSTITUTE SHEET (RULE 26) in,'riolvnlOIl WtJ UU/JIOlU 14U' IM 7 36 C THR 6 123.436 4.486 11.790 1.00 30.00 37 0 THR 6 123.582 5.485 11.082 1.00 30.00 38 N LEU 7 124.418 3.624 12.053 1.00 30.00 39 CA LEU 7 125.746 3.769 11.467 1.00 30.00 40 CB LEU 7 126.779 2.926 12.225 1.00 30.00 41 CG LEU 7 128.207 2.995 11.671 1.00 30.00 42 CDI LEU 7 128.810 4.361 11.954 1.00 30.00 43 CD2 LEU 7 129.050 1.930 12.308 1.00 30.00 44 C LEU 7 125.578 3.218 10.060 1.00 30.00 45 0 LEU 7 125.203 2.061 9.888 1.00 30.00 46 N ARG 8 125.830 4 .040 9.052 1.00 30.00 47 CA ARG 8 125.664 3.587 7.680 1.00 30.00 48 CB ARG 8 124.577 4.408 6.983 1.00 30.00 49 CG ARG 8 123.174 4.239 7.551 1.00 30.00 50 CD ARG 8 122.378 5.529 7.390 1.00 30.00 51 NE ARG 8 122.937 6.621 8.193 1.00 30.00 52 CZ ARG 8 123.262 7.820 7.719 1.00 30.00 53 NH1 ARG 8 123.090 8.105 6.433 1.00 30.00 54 NH2 ARG 8 123.781 8.735 8.528 1.00 30.00 55 C ARG 8 126.965 3.716 6.913 1.00 30.00 56 0 ARG 8 127.823 4.529 7.264 1.00 30.00 57 N PHE 9 127.122 2.905 5.872 1.00 30.00 58 CA PHE 9 128.326 2.965 5.050 1.00 30.00 59 CB PHE 9 129.596 2.632 5.872 1.00 30.00 60 CG PHE 9 129.721 1.179 6.278 1.00 30.00 61 CD1 PHE 9 130.156 0.214 5.368 1.00 30.00 62 CD2 PHE 9 129.420 0.780 7.585 1.00 30.00 63 CEl PHE 9 130.287 -1.128 5.753 1.00 30.00 64 CE2 PHE 9 129.547 -0.553 7.982 1.00 30.00 65 CZ PHE 9 129.981 -1.509 7.070 1.00 30.00 66 C PHE 9 128.215 2.016 3.890 1.00 30.00 67 0 PHE 9 127.553 0.983 3.996 1.00 30.00 68 N VAL 10 128.844 2.387 2.775 1.00 30.00 69 CA VAL 10 128.874 1.534 1.594 1.00 30.00 70 CB VAL 10 128.829 2.346 0.291 1.00 30.00 71 CG1 VAL 10 129.384 1.518 -0.854 1.00 30.00 72 CG2 VAL 10 127.393 2.752 -0.015 1.00 30.00 73 C VAL 10 130.192 0.777 1.663 1.00 30.00 74 0 VAL 10 131.169 1.274 2.224 1.00 30.00 75 N ALA 11 130.201 -0.432 1.116 1.00 30.00 76 CA ALA 11 131.395 -1.269 1.096 1.00 30.00 77 CB ALA 11 131.246 -2.414 2.093 1.00 30.00 78 C ALA 11 131.612 -1.811 -0.323 1.00 30.00 79 0 ALA 11 130.892 -2.706 -0.777 1.00 30.00 80 N VAL 12 132.578 -1.227 -1.029 1.00 30.00 81 CA VAL 12 132.919 -1.638 -2.394 1.00 30.00 82 CB VAL 12 133.080 -0.427 -3.386 1.00 30.00 83 CG1 VAL 12 131.886 -0.315 -4.316 1.00 30.00 84 CG2 VAL 12 133.288 0.866 -2.610 1.00 30.00 85 C VAL 12 134.269 -2.341 -2.357 1.00 30.00 86 0 VAL 12 135.033 -2.229 -1.397 1.00 30.00 87 N GLY 13 134.560 -3.062 -3.423 1.00 30.00 SUBSTITUTE SHEET (RULE 26) PCT/SE99/02192 WO 00/37620 CTSQIO 9 15 88 CA GLY 13 135.825 -3.742 -3.500 1.00 30.00 89 C GLY 13 136.144 -3.918 -4.963 1.00 30.00 0 GLY 13 135.244 -3.903 -5.802 1.00 30.00 91 N ASP 14 137.426 -4.013 -5.273 1.00 30.00 92 CA ASP 14 137.850 -4.266 -6.630 1.00 30.00 93 CB ASP 14 137.354 -5.659 -7.016 1.00 30.00 94 CG ASP 14 137.870 -6.730 -6.078 1.00 30.00 002 ASP 14 137.298 -6.842 -4.968 1.00 30.00 96 C ASP 14 137.467 -3.275 -7.718 1.00 30.00 97 0 ASP 14 137.030 -3.692 -8.790 1.00 30.00 98 ODi ASP 14 138.845 -7.439 -6.443 1.00 30.00 99 N TRP 15 137.652 -1.980 -7.465 1.00 30.00 100 CA TRP 15 137.348 -0.937 -8.458 1.00 30.00 101 CB TRP 15 136.492 0.156 -7.815 1.00 30.00 102 CG TRP 15 137.047 0.586 -6.511 1.00 30.00 103 CD2 TRP 15 138.005 1.624 -6.304 1.00 30.00 104 CE2 TRP 15 138.408 1.566 -4.948 1.00 30.00 105 CE3 TRP 15 138.574 2.596 -7.137 1.00 30.00 106 CDl TRP 15 136.890 -0.038 -5.296 1.00 30.00 107 NEl TRP 15 137.711 0.545 -4.355 1.00 30.00 108 CZ2 TRP 15 139.358 2.435 -4.410 1.00 30.00 109 CZ3 TRP 15 139.527 3.465 -6.600 1.00 30.00 110 CH2 TRP 15 139.905 3.379 75.249 1.00 30.00 ill C TRP 15 138.647 -0.328 -9.027 1.00 30.00 112 0 TRP 15 139.733 -0.541 -8.482 1.00 30.00 113 N GLY 16 138.546 0.402 -10.135 1.00 30.00 114 CA GLY 16 139.733 1.029 -10.714 1.00 30.00 115 C GLY 16 140.336 0.329 -11.920 1.00 30.00 116 0 GLY 16 141.070 -0.643 -11.765 1.00 30.00 117 N GLY 17 140.058 0.840 -13.119 1.00 30.00 118 CA GLY 17 140.559 0.218 -14.338 1.00 30.00 119 C GLY 17 141.923 0.575 -14.915 1.00 30.00 120 0 GLY 17 142.136 0.393 -16.114 1.00 30.00 121 N VAL 18 142.842 1.100 -14.106 1.00 30.00 122 CA VAL 18 144.185 1.400 -14.613 1.00 30.00 123 CB VAL 18 144.995 2.387 -13.709 1.00 30.00 124 CG1 VAL 18 144.574 3.801 -13.984 1.00 30.00 125 CG2 VAL 18 144.842 2.030 -12.235 1.00 30.00 126 C VAL 18 144.968 0.088 -14.674 1.00 30.00 127 0 VAL 18 144.574 -0.912 -14.059 1.00 30.00 128 N PRO 19 146.110 0.080 -15.383 1.00 30.00 129 CD PRO 19 147.072 -1.032 -15.327 1.00 30.00 130 CA PRO 19 146.691 1.214 -16.105 1.00 30.00 131 CB PRO 19 148.074 0.697 -16.499 1.00 30.00 132 CG PRO 19 148.386 -0.308 -15.417 1.00 30.00 133 C PRO 19 145.877 1.634 -17.315 1.00 30.00 134 0 PRO 19 144.682 1.350 -17.405 1.00 30.00 135 N ASN 20 146.547 2.321 -18.236 1.00 30.00 136 CA ASN 20 145.943 2.799 -19.474 1.00 30.00 137 CB ASN 20 145.103 1.693 -20.123 1.00 30.00 138 CG ASN 20 145.899 0.428 -20.374 1.00 30.00 139 ODi ASN 20 146.992 0.471 -20.947 1.00 30.00 SUBSTITUTE SHEET (R ULE 26) PCT/SE99/02192 WO 00/37620PTIFI2 9 16- 140 ND2 ASN 20 145.348 -0.711 -19.957 1.00 30.00 141 C ASN 20 145.082 4.041 -19.289 1.00 30.00 142 0 ASN 20 145.060 4.655 -18.217 1.00 30.00 143 N ALA 21 144.380 4.411 -20.352 1.00 30.00 144 CA ALA 21 143.510 5.572 -20.327 1.00 30.00 145 GB ALA 21 143.992 6.610 -21.318 1.00 30.00 146 C ALA 21 142.099 5.142 -20.669 1.00 30.00 147 0 ALA 21 141.876 4 .467 -21.671 1.00 30.00 148 N PRO 22 141.125 5.519 -19.826 1.00 30.00 149 CD PRO 22 139.695 5.510 -20.177 1.00 30.00 150 CA PRO 22 141.346 6.308 -18.603 1.00 30.00 151 GB PRO 22 139.989 6.970 -18.361 1.00 30.00 152 CG PRO 22 139.267 6.862 -19.700 1.00 30.00 153 C PRO 22 141.747 5.412 -17.430 1.00 30.00 154 0 PRO 22 142.462 4 .433 -17.608 1.00 30.00 155 N PHE 23 141.298 5.756 -16.231 1.00 30.00 156 GA PilE 23 141.593 4.942 -15.057 1.00 30.00 157 GB PilE 23 142.059 5.828 -13.886 1.00 30.00 158 CG PHE 23 141.719 5.288 -12.500 1.00 30.00 159 CD1 PHE 23 142.293 4.119 -12.017 1.00 30.00 160 GD2 PHE 23 140.807 5.952 -11.692 1.00 30.00 161 GEl PHE 23 141.957 3.625 -10.759 1.00 30.00 162 CE2 PHE 23 140.466 5.470 -10.438 1.00 30.00 163 CZ PilE 23 141.040 4.302 -9.971 1.00 30.00 164 C PilE 23 140.310 4 .207 -14.699 1.00 30.00 165 0 PHE 23 140.246 3.479 -13.709 1.00 30.00 166 N HIS 24 139.291 4.374 -15.535 1.00 30.00 167 CA HIS 24 138.005 3.746 -15.272 1.00 30.00 168 GB HIS 24 136.968 4.817 -14.953 1.00 30.00 169 CG HIS 24 136.785 5.812 -16.054 1.00 30.00 170 CD2 HIS 24 136.039 5.763 -17.185 1.00 30.00 171 ND1 HIS 24 137.454 7.018 -16.089 1.00 30.00 172 GEl HIS 24 137.125 7.668 -17.192 1.00 30.00 173 NE2 HIS 24 136.270 6.929 -17.875 1.00 30.00 174 C HIS 24 137.463 2.874 -16.395 1.00 30.00 175 0 HIS 24 137.894 2.959 -17.548 1.00 30.00 176 N THR 25 136.489 2.049 -16.011 1.00 30.00 177 GA THR 25 135.784 1.130 -16.896 1.00 30.00 178 GB THR 25 135.888 -0.305 -16.377 1.00 30.00 179 OGi THR 25 135.449 -0.340 -15.012 1.00 30.00 180 GG2 THR 25 137.325 -0.805 -16.467 1.00 30.00 181 C THR 25 134.314 1.550 -16.865 1.00 30.00 182 0 THR 25 133.878 2.230 -15.932 1.00 30.00 183 N ALA 26 133.553 1.151 -17.878 1.00 30.00 184 CA ALA 26 132.139 1.509 -17.925 1.00 30.00 185 CB ALA 26 131.419 0.672 -18.982 1.00 30.00 186 C ALA 26 131.524' 1.256 -16.558 1.00 30.00 187 0 ALA 26 130.741 2.064 -16.041 1.00 30.00 188 N ARG 27 131.920 0.123 -15.981 1.00 30.00 189 CA ARG 27 131.432 -0.332 -14.691 1.00 30.00 190 GB ARG 27 131.823 -1.796 -14.474 1.00 30.00 191 CG ARG 27 131.135 -2.741 -15.433 1.00 30.00 SUBSTITUTE SHEET (RULE 26) 1700/fl' 0" .17 192 CD ARG 27 131.429 -4.187 -15.116 1.00 193 NE ARG 27 130.852 -5.061 -16.130 1.00 30 0 194 CZ ARG 27 131.320 -6.267 -16.430 1.00 195 NH1 ARG 27 132.380 -6.748 -15.792 1.00 196 NH2 ARG 27 130.743 -6.986 -17.384 1.00 197 C ARG 27 131.842 0.488 -13.485 1.00 198 0 ARG 27 130.998 0.782 -12.642 1.00 30.0: 199 N GLU 28 133.114 0.858 -13.368 1.00 200 CA GLU 28 133.492 1.643 -12.200 1.00 201 CB GLU 28 134.975 2.021 -12.215 1.00 30 .C: 202 CG GLU 28 135.378 2.787 -10.951 1.00 30.0: 203 CD GLU 28 136.796 3.310 -10.989 1.00 204 OE1 GLU 28 137.266 3.670 -12.090 1.00 30.0: 205 OE2 GLU 28 137.436 3.381 -9.914 1.00 30.0: 206 C GLU 28 132.623 2.901 -12.204 1.00 30.0: 207 0 GLU 28 131.988 3.251 -11.201 1.00 30.0: 208 N MET 29 132.588 3.566 -13.353 1.00 30.0: 209 CA MET 29 131.776 4.761 -13.524 1.00 30.0: 210 CB MET 29 131.762 5.150 -15.001 1.00 30.0: 211 CG MET 29 133.109 5.603 -15.507 1.00 30.0: 212 SD MET 29 133.606 7.152 -14.730 1.00 30.0! 213 CE MET 29 133.077 8.328 -16.001 1.00 30.0' 214 C MET 29 130.341 4.515 -13.027 1.00 30.0: 215 0 MET 29 129.809 5.296 -12.226 1.00 30.0: 216 N ALA 30 129.730 3.426 -13.501 1.00 30.0: 217 CA ALA 30 128.366 3.055 -13.119 1.00 30.02 218 CB ALA 30 127.991 1.730 -13.764 1.00 30.0 219 C ALA 30 128.199 2.961 -11.608 1.00 30.02 220 0 ALA 30 127.256 3.518 -11.042 1.00 30.0.

221 N ASN 31 129.112 2.250 -10.955 1.00 30.02 222 CA ASN 31 129.056 2.104 -9.506 1.00 30.0: 223 CB ASN 31 130.094 1.100 -9.021 1.00 30.0: 224 CG ASN 31 129.642 -0.313 -9.215 1.00 30.0- 225 ODI ASN 31 129.866 -0.907 -10.265 1.00 30.0: 226 ND2 ASN 31 128.973 -0.862 -8.203 1.00 30.0: 227 C ASN 31 129.273 3.431 -8.800 1.00 30.0- 228 0 ASN 31 128.663 3.691 -7.764 1.00 30.0: 229 N ALA 32 130.151 4.260 -9.366 1.00 30.0' 230 CA ALA 32 130.450 5.574 -8.807 1.00 30.02 231 CB ALA 32 131.516 6.270 -9.649 1.00 30.02 232 C ALA 32 129.165 6.397 -8.787 1.00 30.0: 233 0 ALA 32 128.817 7.006 7.769 1.00 30.0- 234 N LYS 33 128.457 6.396 -9.917 1.00 30.0[ 235 CA LYS 33 127.201 7.129 -10.043 1.00 30.0: 236 CB LYS 33 126.670 7.052 -11.479 1.00 30.0 237 CG LYS 33 125.255 7.599 -11.635 1.00 30.0 238 CD LYS 33 124.882 7.822 -13.085 1.00 30.0: 239 CE LYS 33 125.720 8.938 -13.690 1.00 240 NZ LYS 33 125.321 9.257 -15.089 1.00 30.0: 241 C LYS 33 126.134 6.620 -9.077 1.00 30.0: 242 0 LYS 33 125.422 7.423 -8.466 1.00 30.0 243 N GLU 34 126.028 5.296 -8.933 1.00 30.0: m SUBSTITUTE SHEET (RULE 26) wn n(i 18 244 CA GLU 34 125.026 4.707 -8.042 1.00 30.00 245 CB GLU 34 124.806 3.225 -8.362 1.00 30.00 246 CG GLU 34 123.694 2.581 -7.538 1.00 30.00 247 CD GLU 34 122.423 3.423 -7.531 1.00 30.00 248 OE1 GLU 34 122.011 3.870 -8.624 1.00 30.00 249 0E2 GLU 34 121.839 3.638 -6.441 1.00 30.00 250 C GLU 34 125.384 4.855 -6.572 1.00 30.00 251 0 GLU 34 124.507 5.104 -5.743 1.00 30.00 252 N ILE 35 126.662 4.687 -6.243 1.00 30.00 253 CA ILE 35 127.103 4.835 -4.856 1.00 30.00 254 CB ILE 35 128.597 4.470 -4.673 1.00 30.00 255 CG2 ILE 35 129.051 4.824 -3.256 1.00 30.00 256 CG1 ILE 35 128.805 2.977 -4.935 1.00 30.00 257 CD1 ILE 35 130.257 2.571 -4.967 1.00 30.00 258 C ILE 35 126.897 6.290 -4.456 1.00 30.00 259 0 ILE 35 126.728 6.605 -3.271 1.00 30.00 260 N ALA 36 126.907 7.178 -5.448 1.00 30.00 261 CA ALA 36 126.691 8.593 -5.174 1.00 30.00 262 CB ALA 36 127.163 9.449 -6.350 1.00 30.00 263 C ALA 36 125.204 8.842 -4.896 1.00 30.00 264 0 ALA 36 124.861 9.568 -3.966 1.00 30.00 265 N ARG 37 124.323 8.235 -5.690 1.00 30.00 266 CA ARG 37 122.899 8.438 -5.483 1.00 30.00 267 CB ARG 37 122.074 7.923 -6.665 1.00 30.00 268 CG ARG 37 120.561 8.052 -6.418 1.00 30.00 269 CD ARG 37 119.761 8.324 -7.690 1.00 30.00 270 NE ARG 37 119.886 7.241 -8.659 1.00 30.00 271 CZ ARG 37 119.471 6.000 -8.439 1.00 30.00 272 NH1 ARG 37 118.899 5.684 -7.281 1.00 30.00 273 NH2 ARG 37 119.638 5.076 -9.375 1.00 30.00 274 C ARG 37 122.430 7.758 -4.218 1.00 30.00 275 0 ARG 37 121.706 8.352 -3.415 1.00 30.00 276 N THR 38 122.841 6.504 -4.057 1.00 30.00 277 CA THR 38 122.484 5.707 -2.893 1.00 30.00 278 CB THR 38 123.294 4.372 -2.886 1.00 30.00 279 OGi THR 38 122.665 3.430 -3.773 1.00 30.00 280 CG2 THR 38 123.389 3.781 -1.475 1.00 30.00 281 C THR 38 122.734 6.489 -1.601 1.00 30.00 282 0 THR 38 121.932 6.433 -0.661 1.00 30.00 283 N VAL 39 123.836 7.232 -1.565 1.00 30.00 284 CA VAL 39 124.181 8.016 -0.386 1.00 30.00 285 CB VAL 39 125.730 8.201 -0.299 1.00 30.00 286 CG1 VAL 39 126.241 8.909 -1.536 1.00 30.00 287 CG2 VAL 39 126.107 8.951 0.970 1.00 30.00 288 C VAL 39 123.436 9.374 -0.322 1.00 30.00 289 0 VAL 39 123.415 10.028 0.720 1.00 30.00 290 N GLN 40 122.818 9.794 -1.425 1.00 30.00 291 CA GLN 40 122.047 11.043 -1.421 1.00 30.00 292 CB GLN 40 121.663 11.487 -2.829 1.00 30.00 293 CG GLN 40 122.802 11.684 -3.787 1.00 30.00 294 CD GLN 40 122.318 12.190 -5.131 1.00 30.00 295 QEl GLN 40 123.081 12.262 -6.097 1.00 30.00 SUBSTITUTE SHEET (R ULE 26) WO 00/37620 WO 0037620PCT/SE99/02 192 296 NE2 GLN 40 121.040 12.554 -5.196 1.00 30.00 297 C GLN 40 120.754 10.719 0.697 1.00 30.00 298 0 GLN 40 120.290 11.454 0.167 1.00 30.00 299 N ILE 41 120.183 9.590 -1.085 1.00 30.00 300 CA ILE 41 118.938 9.099 -0.535 1.00 30.00 301 CB ILE 41 118.365 8. 042 -1.499 1.00 30.00 302 CG2 ILE 41 116.981 7.609 -1.066 1.00 30.00 303 CG1 ILE 41 118.325 8.644 -2.912 1.00 30.00 304 CD1 ILE 41 117.797 7.725 -3.974 1.00 30.00 305 C ILE 41 119.083 8.545 0.893 1.00 30.00 306 0 ILE 41 118.540 9.115 1.845 1.00 30.00 307 N MET 42 119.824 7.454 1.057 1.00 30.00 308 CA MET 42 120.006 6.863 2.387 1.00 30.00 309 CB MET 42 120.429 5.388 2.260 1.00 30.00 310 CG MET 42 119.292 4.367 2.156 1.00 30.00 311 SD MET 42 118.354 4.383 0.607 1.00 30.00 312 CE MET 42 119.623 3.863 -0.581 1.00 30.00 313 C MET 42 121.021 7.600 3.282 1.00 30.00 314 0 MET 42 120.872 7.637 4.507 1.00 30.00 315 N GLY 43 122.046 8.186 2.670 1.00 30.00 316 CA GLY 43 123.070 8.864 3.443 1.00 30.00 317 C GLY 43 124.097 7.832 3.872 1.00 30.00 318 0 GLY 43 123.749 6.677 4.100 1.00 30.00 319 N ALA 44 125.362 8.220 3.977 1.00 30.00 320 CA ALA 44 126.401 7.276 4.385 1.00 30.00 321 CB ALA 44 127.068 6.665 3.141 1.00 30.00 322 C ALA 44 127.451 7.954 5.265 1.00 30.00 323 0 ALA 44 127.889 9.066 4.966 1.00 30.00 324 N ASP 45 127.849 7.292 6.351 1.00 30.00 325 CA ASP 45 128.873 7.844 7.246 1.00 30.00 326 CB ASP 45 128.903 7.087 8.571 1.00 30.00 327 CG ASP 45 127.612 7.200 9.323 1.00 30.00 328 ODi ASP 45 127.397 6.416 10.265 1.00 30.00 329 0D2 ASP 45 126.808 8.083 8.973 1.00 30.00 330 C ASP 45 130.240 7.740 6.583 1.00 30.00 331 0 ASP 45 131.011 8.699 6.562 1.00 30.00 332 N PHE 46 130.541 6.567 6.042 1.00 30.00 333 CA PHE 46 131.820 6.381 5.380 1.00 30.00 334 CB PHE 46 132.895 5.983 6.397 1.00 30.00 335 CG PHE 46 132.656 4.660 7.054 1.00 30.00 336 CD1 PHE 46 133.039 3.481 6.430 1.00 30.00 337 CD2 PHE 46 132.068 4.591 8.312 1.00 30.00 338 CEI PHE 46 132.846 2.245 7.054 1.00 30.00 339 CE2 PHE 46 131.866 3.358 8.947 1.00 30.00 340 CZ PHE 46 132.258 2.186 8.317 1.00 30.00 341 C PHE 46 131.739 5.350 4.275 1.00 30.00 342 0 PHE 46 130.675 4.814 3.973 1.00 30.00 343 N ILE 47 132.879 5.084 3.663 1.00 30.00 344 CA ILE 47 132.945 4.113 2.591 1.00 30.00 345 CB ILE 47 132.968 4.826 1.221 1.00 30.00 346 CG2 ILE 47 133.182 3.819 0.098 1.00 30.00 347 CG1 ILE 47 131.660 5.594 '1.025 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PrTI'.f9/0f2 192 20 348 CD1 ILE 47 131.601 6.372 -0.273 1.00 30.00 349 C ILE 47 134.220 3.307 2.775 1.00 30.00 350 0 ILE 47 135..273 3.886 3.015 1.00 30.00 351 N MET 48 134.134 1.978 2.717 1.00 30.00 352 CA MET 48 135.350 1.182 2.838 1.00 30.00 353 CB MET 48 135.306 0.176 4.002 1.00 30.00 354 CG MET 48 134.511 -1.084 3.761 1.00 30.00 355 SD MET 48 134 .848 -2.367 5.017 1.00 30.00 356 CE MET 48 134.008 -1.691 6.535 1.00 30.00 357 C MET 48 135.595 0.451 1.541 1.00 30.00 358 0 MET 48 134.696 -0.182 0.980 1.00 30.00 359 N SER 49 136.816 0.604 1.048 1.00 30.00 360 CA SER 49 137.270 -0.040 -0.168 1.00 30.00 361 CB SER 49 138.421 0.762 -0.773 1.00 30.00 362 OG SER 49 138.718 0.342 -2.087 1.00 30.00 363 C SER 49 137.769 -1.403 0.303 1.00 30.00 364 0 SER 49 138.572 -1.493 1.229 1.00 30.00 365 N LEU 50 137.283 -2.466 -0.317 1.00 30.00 366 CA LEU 50 137.694 -3.793 0.093 1.00 30.00 367 CB LEU 50 136.505 -4.743 -0.012 1.00 30.00 368 CG LEU 50 135.395 -4.431 1.003 1.00 30.00 369 CD1 LEU 50 134.104 -5.139 0.610 1.00 30.00 370 CD2 LEU 50 135.856 -4.844 2.399 1.00 30.00 371 C LEU 50 138.901 -4.355 -0.650 1.00 30.00 372 0 LEU 50 139.201 -5.536 -0.525 1.00 30.00 373 N GLY 51 139.598 -3.529 -1.428 1.00 30.00 374 CA GLY 51 140.778 -4.041 -2.107 1.00 30.00 375 C GLY 51 140.865 -3.903 -3.609 1.00 30.00 376 0 GLY 51 139.854 -3.725 -4.277 1.00 30.00 377 N ASP 52 142.080 -4.031 -4.140 1.00 30.00 378 CA ASP 52 142.312 -3.874 -5.567 1.00 30.00 379 CB ASP 52 141.503 -4.905 -6.368 1.00 30.00 380 CG ASP 52 142.065 -6.328 -6.254 1.00 30.00 381 ODi ASP 52 143.282 -6.490 -6.002 1.00 30.00 382 C ASP 52 141.892 -2.444 -5.930 1.00 30.00 383 0 ASP 52 141.074 -2.224 -6.821 1.00 30.00 384 0D2 ASP 52 141.283 -7.295 -6.440 1.00 30.00 385 N ASN 53 142.476 -1.482 -5.214 1.00 30.00 386 CA ASN 53 142.209 -0.052 -5.391 1.00 30.00 387 CB ASN 53 142.853 0.719 -4.232 1.00 30.00 388 CG ASN 53 142.327 0.264 -2.877 1.00 30.00 389 ODi ASN 53 141.131 0.333 -2.617 1.00 30.00 390 ND2 ASN 53 143.217 -0.205 -2.014 1.00 30.00 391 C ASN 53 142.608 0.575 -6.752 1.00 30.00 392 0 ASN 53 141.945 1.501 -7.240 1.00 30.00 393 N PHlE 54 143.691 0.088 -7.354 1.00 30.00 394 CA PHE 54 144.143 0.569 -8.670 1.00 30.00 395 CB PHE 54 145.278 1.572 -8.497 1.00 30.00 396 CG PHE 54 144.929 2.685 -7.559 1.00 30.00 397 CD1 PHlE 54 145.239 2.593 -6.201 1.00 30.00 398 CD2 PHlE 54 144.201 3.781 -8.008 1.00 30.00 399 CEl PHlE 54 144.820 3.577 -5.305 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 WO 0037620PCT/SE99/021 92 400 CE2 PHE 54 143.778 4.769 -7.124 1.00 30.00 401 CZ PHE 54 144.087 4 .666 -5.769 1.00 30.00 402 C PilE 54 144.582 -0.736 -9.298 1.00 30.00 403 0 PilE 54 145.712 -1.179 -9.139 1.00 30.00 404 N TYR 55 143.656 -1.317 -10.048 1.00 30.00 405 CA TYR 55 143.779 -2.665 -10.581 1.00 30.00 406 GB TYR 55 142.641 -2.941 -11.542 1.00 30.00 407 CG TYR 55 141.719 -3.887 -10.869 1.00 30.00 408 CD1 TYR 55 140.739 -3.409 -10.015 1.00 30.00 409 CEl TYR 55 139.992 -4.259 -9.260 1.00 30.00 410 CD2 TYR 55 141.920 -5.261 -10.954 1.00 30.00 411 CE2 TYR 55 141.169 -6.129 -10.191 1.00 30.00 412 CZ TYR 55 140.212 -5.610 -9.352 1.00 30.00 413 C TYR 55 144.940 -3.495 -11.066 1.00 30.00 414 0 TYR 55 144 .973 -4 .672 -10.701 1.00 30.00 415 OH TYR 55 139.438 -6.428 -8.585 1.00 30.00 416 N PilE 56 145.890 -3.019 -11.854 1.00 30.00 417 CA PHE 56 146.894 -4.018 -12.214 1.00 30.00 418 GB PHE 56 147.140 -3.972 -13.718 1.00 30.00 419 CG PHE 56 145.953 -4.489 -14.513 1.00 30.00 420 CD1 PilE 56 145.902 -4.374 -15.894 1.00 30.00 421 CD2 PHE 56 144.860 -5.072 -13.854 1.00 30.00 422 GET PilE 56 144.782 -4.827 -16.606 1.00 30.00 423 GE2 PilE 56 143.744 -5.522 -14.555 1.00 30.00 424 CZ PHE 56 143.702 -5.400 -15.927 1.00 30.00 425 C PHE 56 148.144 -4.002 -11.349 1.00 30.00 426 0 PilE 56 148.644 -5.051 -10.944 1.00 30.00 427 N THR 57 148.614 -2.812 -11.025 1.00 30.00 428 CA THR 57 149.738 -2.650 -10.133 1.00 30.00 429 GB THR 57 151.057 -2.470 -10.875 1.00 30.00 430 OGi THR 57 151.244 -3.554 -11.792 1.00 30.00 431 CG2 THR 57 152.205 -2.468 -9.883 1.00 30.00 432 C THR 57 149.331 -1.368 -9.447 1.00 30.00 433 0 THR 57 149.179 -0.330 -10.091 1.00 30.00 434 N GLY 58 149.133 -1.442 -8.141 1.00 30.00 435 GA GLY 58 148.667 -0.280 -7.411 1.00 30.00 436 C GLY 58 149.544 0.869 -6.953 1.00 30.00 437 0 GLY 58 150.013 0.851 -5.813 1.00 30.00 438 N VAL 59 149.774 1.852 -7.826 1.00 30.00 439 CA VAL 59 150.519 3.051 -7.443 1.00 30.00 440 GB VAL 59 149.865 3.607 -6.146 1.00 30.00 441 GG1 VAL 59 150.767 4.579 -5.459 1.00 30.00 442 GG2 VAL 59 148.538 4.257 -6.486 1.00 30.00 443 C VAL 59 152.060 3.049 -7.284 1.00 30.00 444 0 VAL 59 152.616 2.332 -6.445 1.00 30.00 445 N HIS 60 152.725 3.892 -8.087 1.00 30.00 446 GA HIS 60 154.192 4.069 -8.077 1.00 30.00 447 GB HIS 60 154.691 4.744 -9.371 1.00 30.00 448 GG HIS 60 154.563 3.906 -10.607 1.00 30.00 449 GD2 HIS 60 153.904 4.131 -11.768 1.00 30.00 450 ND1 HIS 60 155.199 2.692 -10.757 1.00 30.00 451 GEl HIS 60 154.936 2.204 -11.958 1.00 30.00 SUBSTITUTE SHEET (R UL E 2 6) Wn no '74')A Dd-'r/CVQO/A')10'7 452 NE2 HIS 60 154.153 3.058 -12.591 1.00 30.00 453 C HIS 60 154.597 4 .994 -6.927 1.00 30.00 454 0 HIS 60 154.911 4.553 -5.817 1.00 30.00 455 N ASP 61 154.594 6.293 -7.236 1.00 30.00 456 CA ASP 61 154.949 7.348 -6.290 1.00 30.00 457 CB ASP 61 154.780 8.738 -6.919 1.00 30.00 458 CG ASP 61 155.718 8.980 -8.075 1.00 30.00 459 ODi ASP 61 156.935 8.785 -7.894 1.00 30.00 460 0D2 ASP 61 155.240 9.375 -9.160 1.00 30.00 461 C ASP 61 154.106 7.305 -5.033 1.00 30.00 462 0 ASP 61 152.872 7.219 -5.084 1.00 30.00 463 N ALA 62 154.792 7.370 -3.900 1.00 30.00 464 CA ALA 62 154.123 7.379 -2.618 1.00 30.00 465 CB ALA 62 155.153 7.404 -1.478 1.00 30.00 466 C ALA 62 153.286 8.653 -2.615 1.00 30.00 467 0 ALA 62 153.817 9.734 -2.390 1.00 30.00 468 N ASN 63 151.993 8.521 -2.906 1.00 30.00 469 CA ASN 63 151.050 9.644 -2.921 1.00 30.00 470 CB ASN 63 151.390 10.675 -1.832 1.00 30.00 471 CG ASN 63 151.733 10.042 -0.500 1.00 30.00 472 ODi ASN 63 151.021 9.169 -0.017 1.00 30.00 473 ND2 ASN 63 152.831 10.492 0.107 1.00 30.00 474 C ASN 63 150.953 10.400 4.241 1.00 30.00 475 0 ASN 63 149.864 10.759 -4.683 1.00 30.00 476 N ASP 64 152.096 10.651 -4.861 1.00 30.00 477 CA ASP 64 152.140 11.414 -6.101 1.00 30.00 478 CB ASP 64 153.555 11.954 -6.314 1.00 30.00 479 CG ASP 64 154.056 12.749 -5.120 1.00 30.00 480 ODi ASP 64 153.371 13.713 -4.713 1.00 30.00 481 0D2 ASP 64 155.132 12.406 -4.588 1.00 30.00 482 C ASP 64 151.677 10.679 -7.348 1.00 30.00 483 0 ASP 64 151.426 11.304 -8.378 1.00 30.00 484 N LYS 65 151.564 9.359 -7.259 1.00 30.00 485 CA LYS 65 151.128 8.563 -8.398 1.00 30.00 486 CB LYS 65 150.877 7.119 -7.963 1.00 30.00 487 CG LYS 65 151.125 6.090 -9.058 1.00 30.00 488 CD LYS 65 150.401 6.440 -10.354 1.00 30.00 489 CE LYS 65 151.054 5.694 -11.526 1.00 30.00 490 NZ LYS 65 150.570 6.149 -12.875 1.00 30.00 491 C LYS 65 149.845 9.185 -8.946 1.00 30.00 492 0 LYS 65 148.903 9.428 -8.194 1.00 30.00 493 N ARG 66 149.814 9.447 -10.252 1.00 30.00 494 CA ARG 66 148.644 10.066 -10.882 1.00 30.00 495 CB ARG 66 148.937 10.415 -12.349 1.00 30.00 496 CG ARG 66 149.582 11.779 -12.566 1.00 30.00 497 CD ARG 66 149.562 12.159 -14.043 1.00 30.00 498 NE ARC 66 150.212 13.444 -14.306 1.00 30.00 499 CZ ARG 66 150.283 14.021 -15.504 1.00 30.00 500 NH1 ARG 66 149.744 13.434 -16.567 1.00 30.00 501 NH2 ARG 66 150.903 15.188 -15.645 1.00 30.00 502 C ARG 66 147.341 9.275 -10.814 1.00 30.00 503 0 ARG 66 146.268 9.842 -10.999 1.00 30.00 SUBSTITUTE SHEET (RULE 26)

A

Df'r1cc'naIfll 10~7 504 N PHE 67 147.419 7.974 -10.556 1.00 30.00 505 CA PHE 67 146.201 7.167 -10.472 1.00 30.00 506 CB PHE 67 146.537 5.671 -10.559 1.00 30.00 507 CG PHE 67 146.973 5.223 -11.931 1.00 30.00 508 CD1 PHE 67 147.549 3.970 -12.115 1.00 30.00 509 CD2 PHE 67 146.826 6.061 -13.038 1.00 30.00 510 CEl PHE 67 147.979 3.556 -13.379 1.00 30.00 511 CE2 PHE 67 147.250 5.658 -14.307 1.00 30.00 512 CZ PHE 67 147.828 4.402 -14.476 1.00 30.00 513 C PHE 67 145.395 7.466 -9.201 1.00 30.00 514 0 PHE 67 144.168 7.320 -9.189 1.00 30.00 515 N GLN 68 146.081 7.880 -8.137 1.00 30.00 516 CA GLN 68 145.406 8.215 -6.888 1.00 30.00 517 CB GLN 68 146.401 8.770 -5.861 1.00 30.00 518 CG GLN 68 147.415 7.777 -5.285 1.00 30.00 519 CD GLN 68 146.872 7.007 -4.094 1.00 30.00 520 OE1 GLN 68 147.631 6.429 -3.310 1.00 30.00 521 NE2 GLN 68 145.553 6.995 -3.953 1.00 30.00 522 C GLN 68 144.392 9.301 -7.245 1.00 30.00 523 0 GLN 68 143.376 9.485 -6.571 1.00 30.00 524 N GLU 69 144.674 10.008 -8.333 1.00 30.00 525 CA GLU 69 143.812 11.085 -8.778 1.00 30.00 526 CB GLU 69 144.635 12.140 -9.511 1.00 30.00 527 CG GLU 69 145.570 12.878 -8.575 1.00 30.00 528 CD GLU 69 144.872 13.276 -7.284 1.00 30.00 529 OE1 GLU 69 143.770 13.867 -7.365 1.00 30.00 530 OE2 GLU 69 145.426 12.996 -6.196 1.00 30.00 531 C GLU 69 142.638 10.665 -9.630 1.00 30.00 532 0 GLU 69 141.523 11.126 -9.402 1.00 30.00 533 N THR 70 142.856 9.799 -10.609 1.00 30.00 534 CA THR 70 141.728 9.388 -11.428 1.00 30.00 535 CB THR 70 142.179 8.618 -12.673 1.00 30.00 536 OGI THR 70 143.356 9.232 -13.220 1.00 30.00 537 CG2 THR 70 141.071 8.659 -13.729 1.00 30.00 538 C THR 70 140.669 8.587 -10.634 1.00 30.00 539 0 THR 70 139.609 8.261 -11.177 1.00 30.00 540 N PHE 71 140.961 8.256 -9.367 1.00 30.00 541 CA PHE 71 139.991 7.594 -8.474 1.00 30.00 542 CB PHE 71 140.681 6.909 -7.300 1.00 30.00 543 CG PHE 71 140.120 7.321 -5.946 1.00 30.00 544 CD1 PHE 71 138.955 6.739 -5.445 1.00 30.00 545 CD2 PHE 71 140.731 8.327 -5.196 1.00 30.00 546 CEI PHE 71 138.408 7.153 -4.221 1.00 30.00 547 CE2 PHE 71 140.193 8.748 -3.974 1.00 30.00 548 CZ PHE 71 139.032 8.160 -3.487 1.00 30.00 549 C PHE 71 139.172 8.766 -7.900 1.00 30.00 550 0 PHE 71 137.944 8.725 -7.812 1.00 30.00 551 N GLU 72 139.906 9.799 -7.489 1.00 30.00 552 CA GLU 72 139.356 11.029 -6.927 1.00 30.00 553 CB GLU 72 140.500 12.017 -6.688 1.00 30.00 554 CG GLU 72 140.370 12.901 -5.461 1.00 30.00 555 CD GLU 72 140.977 12.284 -4.210 1.00 30.00 wW,, SUBSTITUTE SHEET (RULE 26) WO 00/37620 WO 0037620PCTISE99/02192 556 OE1 GLU 72 142.093 11.722 -4.290 1.00 30.00 557 0E2 GLU 72 140.342 12.376 -3.138 1.00 30.00 558 C GLU 72 138.386 11.614 -7.956 1.00 30.00 559 0 GLU 72 137.332 12.145 -7.607 1.00 30.00 560 N ASP 73 138.763 11.492 -9.225 1.00 30.00 561 CA ASP 73 137.982 11.991 -10.349 1.'00 30.00 562 CB ASP 73 138.891 12.170 -11.564 1.00 30.00 563 CG ASP 73 139.740 13.424 -11.473 1.00 30.00 564 ODI ASP 73 140.337 13.680 -10.402 1.00 30.00 565 0D2 ASP 73 139.816 14.157 -12.480 1.00 30.00 566 C ASP 73 136.794 11.118 -10.723 1.00 30.00 567 0 ASP 73 135.791 11.625 -11.221 1.00 30.00 568 N VAL 74 136.911 9.810 -10.505 1.00 30.00 569 CA VAL 74 135.818 8.878 -10.808 1.00 30.00 570 CB VAL 74 136.322 7.413 -10.794 1.00 30.00 571 CG1 VAL 74 135.159 6.461 -10.643 1.00 30.00 572 CG2 VAL 74 137.077 7.113 -12.073 1.00 30.00 573 C VAL 74 134.699 9.044 -9.771 1.00 30.00 574 0 VAL 74 133.521 9.131 -10.115 1.00 30.00 575 N PHE 75 135.090 9.089 -8.500 1.00 30.00 576 CA PHE 75 134.154 9.266 -7.405 1.00 30.00 577 CB PHE 75 134.633 8.478 -6.181 1.00 30.00 578 CG PHE 75 134.491 6.993 -6.350 1.00 30.00 579 CD1 PHE 75 135.316 6.296 -7.230 1.00 30.00 580 CD2 PHE 75 133.460 6.305 -5.714 1.00 30.00 581 CEl PHE 75 135.106 4.936 -7.478 1.00 30.00 582 CE2 PHE 75 133.243 4.942 -5.956 1.00 30.00 583 CZ PHE 75 134.064 4.260 -6.839 1.00 30.00 584 C PHE 75 134.032 10.753 -7.114 1.00 30.00 585 0 PHE 75 134.223 11.223 -5.993 1.00 30.00 586 N SER 76 133.710 11.482 -8.173 1.00 30.00 587 CA SER 76 133.541 12.923 -8.132 1.00 30.00 588 CB SER 76 134.385 13.564 -9.229 1.00 30.00 589 OG SER 76 133.939 13.136 -10.506 1.00 30.00 590 C SER 76 132.066 13.223 -8.382 1.00 30.00 591 0 SER 76 131.583 13.092 -9.514 1.00 30.00 592 N ASP 77 131.358 13.622 -7.327 1.00 30.00 593 CA ASP 77 129.930 13.930 -7.403 1.00 30.00 594 CB ASP 77 129.128 12.633 -7.606 1.00 30.00 595 CG ASP 77 127.676 12.881 -8.005 1.00 30.00 596 0D1 ASP 77 126.947 13.577 -7.255 1.00 30.00 597 0D2 ASP 77 127.266 12.364 -9.072 1.00 30.00 598 C ASP 77 129.593 14.551 -6.053 1.00 30.00 599 0 ASP 77 129.835 13.936 -5.015 1.00 30.00 600 N ARG 78 129.044 15.763 -6.067 1.00 30.00 601 CA ARG 78 128.707 16.475 -4.832 1.00 30.00 602 CB ARG 78 127.722 17.617 -5.130 1.00 30.00 603 CG ARG 78 126.485 17.187 -5.892 1.00 30.00 604 CD ARG 78 125.545 18.356 -6.169 1.00 30.00 605 NE ARG 78 124.377 17.928 -6.939 1.00 30.00 606 CZ ARG 78 123.395 18.732 -7.332 1.00 30.00 607 NH1 ARG 78 123.428 20.024 -7.032 1.00 30.00 SUBSTITUTE SHEET (R ULE 26) PCT/SE99/02192 WO 00/37620PCIE9012 25 608 NH2 ARG 78 122.377 18.244 -8.030 1.00 30.00 609 C ARG 78 128.164 15.607 -3.689 1.00 30.00 610 0 ARG 78 128.327 15.957 -2.514 1.00 30.00 611 N ALA 79 127.524 14.485 -4.022 1.00 30.00 .612 CA ALA 79 126.974 13.599 -2.998 1.00 30.00 613 CB ALA 79 126.124 12.525 -3.642 1.00 30.00 614 C ALA 79 128.086 12.964 -2.167 1.00 30.00 615 0 ALA 79 128.016 12.949 -0.939 1.00 30.00 616 N LEU 80 129.111 12.445 -2.842 1.00 30.00 617 CA LEU -80 130.249 11.813 -2.173 1.00 30.00 618 CB LEU 80 130.865 10.733 -3.060 1.00 30.00 619 CG LEU 80 129.990 9.709 -3.771 1.00 30.00 620 CD1 LEU 80 130.899 8.830 -4.594 1.00 30.00 621 CD2 LEU 80 129.193 8.884 -2.779 1.00 30.00 622 C LEU 80 131.331 12.850 -1.878 1.00 30.00 623 0 LEU 80 132.318 12.554 -1.201 1.00 30.00 624 N ARG 81 131.138 14.055 -2.416 1.00 30.00 625 CA ARG 81 132.061 15.175 -2.256 1.00 30.00 626 CE ARG 81 131.364 16.480 -2.686 1.00 30.00 627 CG ARG 81 132.135 17.766 -2.359 1.00 30.00 628 CD ARG 81 131.369 19.046 -2.732 1.00 30.00 629 NE ARG 81 131.386 19.319 -4.170 1.00 30.00 630 CZ ARG 81 130.932 20.437 -4.728 1.00 30.00 631 NH1 ARG 81 130.420 21.400 -3.972 1.00 30.00 632 NH2 ARG 81 130.994 20.596 -6.043 1.00 30.00 633 C ARG 81 132.641 15.344 -0.851 1.00 30.00 634 0 ARG 81 133.613 16.073 -0.671 1.00 30.00 635 N ASN 82 132.071 14.685 0.149 1.00 30.00 636 CA ASN 82 132.608 14.843 1.491 1.00 30.00 637 CB ASN 82 131.939 16.048 2.144 1.00 30.00 638 CG ASN 82 132.750 16.609 3.282 1.00 30.00 639 ODi ASN 82 133.919 16.964 3.106 1.00 30.00 640 ND2 ASN 82 132.138 16.699 4.459 1.00 30.00 641 C ASN 82 132.475 13.610 2.395 1.00 30.00 642 0 ASN 82 132.471 13.729 3.622 1.00 30.00 643 N ILE 83 132.391 12.427 1.791 1.00 30.00 644 CA ILE 83 132.241 11.185 2.545 1.00 30.00 645 CB ILE 83 131.316 10.191 1.802 1.00 30.00 646 CG2 ILE 83 130.962 9.032 2.728 1.00 30.00 647 CG1 ILE 83 130.042 10.894 1.322 1.00 30.00 648 CD1 ILE 83 129.082 11.286 2.434 1.00 30.00 649 C ILE 83 133.565 10.459 2.803 1.00 30.00 650 0 ILE 83 134.266 10.071 1.858 1.00 30.00 651 N PRO 84 133.919 10.258 4.090 1.00 30.00 652 CD PRO 84 133.171 10.732 5.268 1.00 30.00 653 CA PRO 84 135.148 9.571 4.508 1.00 30.00 654 CE PRO 84 134.960 9.410 6.017 1.00 30.00 655 CG PRO 84 134.191 10.599 6.385 1.00 30.00 656 C PRO 84 135.289 8.203 3.832 1.00 30.00 657 0 PRO 84 134.295 7.503 3.619 1.00 30.00 658 N TRP 85 136.522 7.830 3.500 1.00 30.00 659 CA TRP 85 136.805 6.535 2.885 1.00 30.00 SUBSTITUTE SHEET (RULE 26) prT/SE99/02192 WO 00/3I762APT/FOfl1Q 26 660 GB TRP 85 137.419 6.683 1.490 1.00 30.00 661 CG TRP 85 136.452 6.791 0.374 1.00 30.00 662 CD2 TRP 85 136.237 5.835 -0.673 1.00 30.00 663 CE2 TRP 85 135.231 6.357 -1.516 1.00 30.00 664 CE3 TRP 85 136.793 4.586 -0.979 1.00 30.00 665 CD! TRP 85 135.599 7.820 0.132 1.00 30.00 666 NEl TRP 85 134.860 7.572 -1.000 1.00 30.00 667 CZ2 TRP 85 134.766 5.676 -2.649 1.00 30.00 668 CZ3 TRP 85 136.330 3.905 -2.108 1.00 30.00 669 CH2 TRP 85 135.326 4. 457 -2.926 1.00 30.00 670 C TRP 85 137.823 5.816 3.749 1.00 30.00 671 0 TRP 85 138.817 6.416 4.157 1.00 30.00 672 N TYR 86 137.565 4.541 4.032 1.00 30.00 673 CA TYR 86 138.492 3.710 4.798 1.00 30.00 674 GB TYR 86 137.797 3.093 6.013 1.00 30.00 675 CG TYR 86 137.431 4.141 7.023 1.00 30.00 676 CD1 TYR 86 138.417 4.832 7.726 1.00 30.00 677 GEl TYR 86 138.089 5.883 8.581 1.00 30.00 678 CD2 TYR 86 136.107 4.517 7.207 1.00 30.00 679 CE2 TYR 86 135.767 5.562 8.056 1.00 30.00 680 CZ TYR 86 136.759 6.242 8.738 1.00 30.00 681 OH TYR 86 136.414 7.287 9.557 1.00 30.00 682 C TYR 86 138.961 2.652 3.807 1.00 30.00 683 0 TYR 86 138.171 1.838 3.338 1.00 30.00 684 N VAL 87 140.249 2.690 3.479 1.00 30.00 685 CA VAL 87 140.829 1.793 2.490 1.00 30.00 686 GB VAL 87 141.821 2.577 1.603 1.00 30.00 687 CG1 VAL 87 142.368 1.690 0.495 1.00 30.00 688 CG2 VAL 87 141.126 3.796 1.020 1.00 30.00 689 C VAL 87 141.523 0.538 3.015 1.00 30.00 690 0 VAL 87 141.974 0.479 4.163 1.00 30.00 691 N LEU 88 141.589 -0.464 2.138 1.00 30.00 692 CA LEU 88 142.224 -1.746 2.420 1.00 30.00 693 GB LEU 88 141.193 -2.870 2.529 1.00 30.00 694 CG LEU 88 140.844 -3.287 3.947 1.00 30.00 695 GD1 LEU 88 140.070 -4.586 3.919 1.00 30.00 696 CD2 LEU 88 142.127 -3.440 4.736 1.00 30.00 697 C LEU 88 143.180 -2.118 1.311 1.00 30.00 698 0 LEt] 88 143.013 -1.713 0.158 1.00 30.00 699 N ALA 89 144.176 -2.912 1.678 1.00 30.00 700 CA ALA 89 145.163 -3.389 0.741 1.00 30.00 701 GB ALA 89 146.429 -3.708 1.496 1.00 30.00 702 C ALA 89 144.641 -4.647 0.018 1.00 30.00 703 0 ALA 89 144.256 -5.637 0.653 1.00 30.00 704 N GLY 90 144.600 -4.599 -1.307 1.00 30.00 705 CA GLY 90 144.171 -5.765 -2.069 1.00 30.00 706 C GLY 90 145.430 -6.482 -2.544 1.00 30.00 707 0 GLY 90 146.519 -6.119 -2.104 1.00 30.00 708 N ASN 91 145.316 -7.485 -3.417 1.00 30.00 709 GA ASN 91 146.517 -8.169 -3.906 1.00 30.00 710 GB ASN 91 146.217 -9.592 -4.443 1.00 30.00 711 CG ASN 91 145.086 -9.631 -5.461 1.00 30.00 SUBSTITUTE SHEET (R ULE 26) WO 00/37620 PCT/SE99/02192 27 712 ND2 ASN 91 145.415 -9.931 -6.709 1.00 30.00 713 C ASN 91 147.221 -7.337 -4.973 1.00 30.00 714 0 ASN 91 148.447 -7.256 -4.990 1.00 30.00 715 ODi ASN 91 143.934 -9.412 -5.122 1.00 30.00 716 N HIS 92 146.451 -6.705 -5.847 1.00 30.00 717 CA HIS 92 147.035 -5.874 -6.886 1.00 30.00 718 CB HIS 92 145.973 -5.490 -7.896 1.00 30.00 719 CG HIS 92 145.653 -6.596 -8.847 1.00 30.00 720 CD2 HIS 92 144.741 -7.597 -8.777 1.00 30.00 721 ND1 HIS 92 146.365 -6.805 -10.008 1.00 30.00 722 CEl HIS 92 145.906 -7.883 -10.615 1.00 30.00 723 NE2 HIS 92 144.922 -8.384 -9.888 1.00 30.00 724 C HIS 92 147.712 -4.634 -6.333 1.00 30.00 725 0 HIS 92 148.658 -4.116 -6.925 1.00 30.00 726 N ASP 93 147.237 -4.163 -5.187 1.00 30.00 727 CA ASP 93 147.834 -2.992 -4.562 1.00 30.00 728 CB ASP 93 146.898 -2.432 -3.491 1.00 30.00 729 CG ASP 93 145.544 -2.021 -4.057 1.00 30.00 730 ODi ASP 93 145.496 -1.119 -4.927 1.00 30.00 731 0D2 ASP 93 144.523 -2.602 -3.629 1.00 30.00 732 C ASP 93 149.177 -3.379 -3.943 1.00 30.00 733 0 ASP 93 149.985 -2.523 -3.612 1.00 30.00 734 N HIS 94 149.410 -4.679 -3.789 1.00 30.00 735 CA HIS 94 150.665 -5.155 -3.228 1.00 30.00 736 CB HIS 94 150.414 -6.381 -2.348 1.00 30.00 737 CG HIS 94 150.090 -6.050 -0.923 1.00 30.00 738 CD2 HIS 94 148.911 -6.023 -0.258 1.00 30.00 739 ND1 HIS 94 151.047 -5.669 -0.009 1.00 30.00 740 CEl HIS 94 150.476 -5.423 1.156 1.00 30.00 741 NE2 HIS 94 149.178 -5.630 1.030 1.00 30.00 742 C HIS 94 151.678 -5.476 -4.339 1.00 10.00 743 0 HIS 94 152.786 -5.949 -4.070 1.00 30.00 744 N LEU 95 151.282 -5.231 -5.587 1.00 30.00 745 CA LEU 95 152.162 -5.439 -6.729 1.00 30.00 746 CB LEU 95 151.371 -5.909 -7.957 1.00 30.00 747 CG LEU 95 150.837 -7.355 -7.943 1.00 30.00 748 CD1 LEU 95 150.032 -7.619 -9.195 1.00 30.00 749 CD2 LEU 95 151.981 -8.338 -7.856 1.00 30.00 750 C LEU 95 152.769 -4.063 -6.978 1.00 30.00 751 0 LEU 95 153.680 -3.889 -7.785 1.00 30.00 752 N GLY 96 152.234 -3.088 -6.252 1.00 30.00 753 CA GLY 96 152.702 -1.720 -6.338 1.00 30.00 754 C GLY 96 153.147 -1.279 -4.953 1.00 30.00 755 0 GLY 96 153.381 -2.122 -4.069 1.00 30.00 756 N ASN 97 153.257 0.034 -4.756 1.00 30.00 757 CA ASN 97 153.692 0.595 -3.480 1.00 30.00 758 CB ASN 97 154.437 1.922 -3.710 1.00 30.00 759 CG ASN 97 154.997 2.522 -2.418 1.00 30.00 760 ODi ASN 97 154.719 2.024 -1.315 1.00 30.00 761 ND2 ASN 97 155.778 3.608 -2.546 1.00 30.00 762 C ASN 97 152.501 0.824 -2.561 1.00 30.00 763 0 ASN 97 151.706 1.739 -2.787 1.00 30.00 SUBSTITUTE SHEET (R ULE 26) DCT-rlIvO/A7 1q2 i~vt, U fJIIi.U28 764 N VAL 98 152.385 -0.008 -1.527 1.00 30.00 765 CA VAL 98 151.292 0.102 -0.559 1.00 30.00 766 CB VAL 98 151.119 -1.228 0.231 1.00 30.00 767 CG1 VAL 98 150.361 -0.999 1.527 1.00 30.00 768 CG2 VAL 98 150.343 -2.209 -0.621 1.00 30.00 769 C VAL 98 151.495 1.276 0.405 1.00 30.00 770 0 VAL 98 150.550 2.009 0.725 1.00 30.00 771 N SER 99 152.733 1.459 0.855 1.00 30.00 772 CA SER 99 153.065 2.547 1.762 1.00 30.00 773 CB SER 99 154.567 2.580 1.997 1.00 30.00 774 OG SER 99 155.018 1.296 2.372 1.00 30.00 775 C SER 99 152.618 3.841 1.110 1.00 30.00 776 0 SER 99 152.350 4.834 1.792 1.00 30.00 777 N ALA 100 152.542 3.809 -0.220 1.00 30.00 778 CA ALA 100 152.121 4.948 -1.025 1.00 30.00 779 CB ALA 100 152.297 4.632 -2.492 1.00 30.00 780 C ALA 100 150.665 5.291 -0.747 1.00 30.00 781 0 ALA 100 150.330 6.435 -0.447 1.00 30.00 782 N GLN 101 149.795 4.296 -0.851 1.00 30.00 783 CA GLN 101 148.384 4.526 -0.599 1.00 30.00 784 CB GLN 101 147.572 3.283 -0.961 1.00 30.00 785 CG GLN 101 147.754 2.791 -2.384 1.00 30.00 786 CD GLN 101 146.773 1.681 -2.723 1.00 30.00 787 QEl GLN 101 146.866 1.048 -3.779 1.00 30.00 788 NE2 GLN 101 145.817 1.446 -1.827 1.00 30.00 789 C GLN 101 148.170 4.876 0.872 1.00 30.00 790 0 GLN 101 147.236 5.580 1.222 1.00 30.00 791 N ILE 102 149.027 4.368 1.744 1.00 30.00 792 CA ILE 102 148.891 4.678 3.161 1.00 30.00 793 CB ILE 102 149.879 3.860 4.013 1.00 30.00 794 CG2 ILE 102 149.891 4.384 5.440 1.00 30.00 795 CG1 ILE 102 149.496 2.380 3.966 1.00 30.00 796 CD1 ILE 102 150.504 1.458 4.624 1.00 30.00 797 C ILE 102 149.173 6.164 3.370 1.00 30.00 798 0 ILE 102 148.377 6.883 3.971 1.00 30.00 799 N ALA 103 150.311 6.618 2.858 1.00 30.00 800 CA ALA 103 150.713 8.010 2.989 1.00 30.00 801 CB ALA 103 152.126 8.187 2.457 1.00 30.00 802 C ALA 103 149.756 8.945 2.256 1.00 30.00 803 0 ALA 103 149.598 10.107 2.633 1.00 30.00 804 N TYR 104 149.112 8.432 1.212 1.00 30.00 805 CA TYR 104 148.191 9.233 0.422 1.00 30.00 806 CB TYR 104 147.545 8.391 -0.661 1.00 30.00 807 CG TYR 104 146.740 9.220 -1.612 1.00 30.00 808 CD1 TYR 104 147.366 10.120 -2.465 1.00 30.00 809 CEl TYR 104 146.637 10.894 -3.345 1.00 30.00 810 CD2 TYR 104 145.350 9.117 -1.658 1.00 30.00 811 CE2 TYR 104 144.605 9.894 -2.540 1.00 30.00 812 CZ TYR 104 145.262 10.7"78 -3.380 1.00 30.00 813 OH TYR 104 144.553 11.532 -4.274 1.00 30.00 814 C TYR 104 147.098 9.850 1.273 1.00 30.00 815 0 TYR 104 146.441 10.806 0.859 1.00 30.00 SUBSTITUTE SHEET (R ULE 26) pi-r/croo/mio,) Wu O U/IDOU 29i-)gI~L 816 N SER 105 146.902 9.294 2.462 1.00 30.00 817 CA SER 105 145.885 9.790 3.375 1.00 30.00 818 CB SER 105 145.605 8.749 4.457 1.00 30.00 819 OG SER 105 146.735 8.561 5.286 1.00 30.00 820 C SER 105 146.328 11.102 4.013 1.00 30.00 821 0 SER 105 145.703 11.587 4.955 1.00 30.00 822 N LYS 106 147.421 11.660 3.498 1.00 30.00 823 CA LYS 106 147.962 12.930 3.983 1.00 30.00 824 CB LYS 106 149.460 12.796 4.271 1.00 30.00 825 CG LYS 106 149.806 11.766 5.349 1.00 30.00 826 CD LYS 106 149.527 12.280 6.752 1.00 30.00 827 CE LYS 106 150.428 13.461 7.092 1.00 30.00 828 NZ LYS 106 150.255 13.953 8.489 1.00 30.00 829 C LYS 106 147.724 13.993 2.903 1.00 30.00 830 0 LYS 106 147.709 15.194 3.184 1.00 30.00 831 N ILE 107 147.529 13.531 1.669 1.00 30.00 832 CA ILE 107 147.265 14.412 0.534 1.00 30.00 833 CB ILE 107 147.880 13.835 -0.774 1.00 30.00 834 CG2 ILE 107 147.514 14.704 -1.97-7 1.00 30.00 835 CG1 ILE 107 149.405 13.750 -0.628 1.00 30.00 83.6 CD1 ILE 107 150.139 13.581 -1.936 1.00 30.00 837 C ILE 107 145.750 14.577 0.354 1.00 30.00 838 0 ILE 107 145.284 15.607 70.133 1.00 30.00 839 N SER 108 144.990 13.559 0.758 1.00 30.00 840 CA SER 108 143.530 13.577 0.645 1.00 30.00 841 CB SER 108 143.063 12.475 -0.317 1.00 30.00 842 OG SER 108 141.732 12.684 -0.743 1.00 30.00 843 C SER 108 142.862 13.399 2.018 1.00 30.00 844 0 SER 108 143.147 12.449 2.769 1.00 30.00 845 N LYS 109 141.970 14.323 2.349 1.00 30.00 846 CA LYS 109 141.291 14.249 3.627 1.00 30.00 847 CB LYS 109 140.540 15.555 3.922 1.00 30.00 848 CG LYS 109 139.216 15.723 3.198 1.00 30.00 849 CD LYS 109 138.382 16.794 3.885 1.00 30.00 850 CE LYS 109 136.960 16.860 3.347 1.00 30.00 851 NZ LYS 109 136.185 17.956 4.005 1.00 30.00 852 C LYS 109 140.328 13.066 3.648 1.00 30.00 853 0 LYS 109 140.230 12.359 4.653 1.00 30.00 854 N ARG 110 139.632 12.834 2.538 1.00 30.00 855 CA ARG 110 138.683 11.729 2.497 1.00 30.00 856 CB ARG 110 137.707 11.875 1.322 1.00 30.00 857 CG ARG 110 138.249 11.610 -0.070 1.00 30.00 858 CD ARG 110 137.103 11.764 -1.078 1.00 30.00 859 NE ARG 110 137.556 11.734 -2.468 1.00 30.00 860 CZ ARG 110 136.751 11.567 -3.516 1.00 30.00 861 NH1 ARG 110 135.437 11.411 -3.338 1.00 30.00 862 NH2 ARG 110 137.264 11.551 -4.745 1.00 30.00 863 C ARG 110 139.346 10.359 2.455 1.00 30.00 864 0 ARG 110 138.750 9.364 2.869 1.00 30.00 865 N TRP 111 140.579 10.303 1.969 1.00 30.00 866 CA TRP 111 141.285 9.034 1.910 1.00 30.00 867 CB TRP 111 142.356 9.072 0.823 1.00 30.00 S UBS TITUTE SHEE T (R UL E 2 6) PCT/SE99/02192 WO 00f/374'70PT5~q/0I9 30 868 CG TRP 111 143.066 7.764 0.631 1.00 30.00 869 CD2 TRP 111 142.801 6.788 -0.387 1.00 30.00 870 CE2 TRP 111 143.73 0 5.742 -0.208 1.00 30.00 871 CE3 TRP I11 141.870 6.699 -1.434 1.00 30.00 872 CDl TRP 111 144.105 7.281 1.367 1.00 30.00 873 NEI TRP 111 144.511 6.070 0.869 1.00 30.00 874 CZ2 TRP 111 143.761 4.612 -1.045 1.00 30.00 875 GZ3 TRP 111 141.898 5.576 -2.268 1.00 30.00 876 CH2 TRP 111 142.840 4.549 -2.065 1.00 30.00 877 C TRP 111 141.925 8.703 3.253 1.00 30.00 878 0 TRP 111 142.803 9.418 3.715 1.00 30.00 879 N ASN 112 141.460 7.624 3.872 1.00 30.00 880 CA ASN 112 141.975 7.173 5.156 1.00 30.00 881 CB ASN 112 140.856 7.073 6.189 1.00 30.00 882 CG ASN 112 140.337 8.419 6.613 1.00 30.00 883 001 ASN 112 139.866 9.203 5.789 1.00 30.00 884 ND2 ASN 112 140.415 8.697 7.910 1.00 30.00 885 C ASN 112 142.613 5.804 5.001 1.00 30.00 886 0 ASN 112 141.952 4.843 4.607 1.00 30.00 887 N PHE 113 143.896 5.720 5.329 1.00 30.00 888 CA PHE 113 144.636 4.474 5.218 1.00 30.00 889 CB PHE 113 145.008 4.224 3.749 1.00 30.00 890 CG PHE 113 145.328 2.791 3.435 1.00 30.00 891 CD1 PHE 113 145.511 2.387 2.117 1.00 30.00 892 CD2 PHE 113 145.454 1.842 4.454 1.00 30.00 893 CEl PHE 113 145.817 1.065 1.816 1.00 30.00 894 CE2 PHE 113 145.759 0.513 4.164 1.00 30.00 895 CZ PHE 113 145.941 0.125 2.845 1.00 30.00 896 C PHE 113 145.882 4.643 6.072 1.00 30.00 897 0 PHE 113 146.976 4.869 5.562 1.00 30.00 898 N PRO 114 145.721 4.531 7.395 1.00 30.00 899 CD PRO 114 144.460 4.073 8.009 1.00 30.00 900 CA PRO 114 146.775 4.666 8.409 1.00 30.00 901 GB PRO 114 145.973 4.678 9.710 1.00 30.00 902 CG PRO 114 144.889 3.691 9.413 1.00 30.00 903 C PRO 114 147.861 3.574 8.395 1.00 30.00 904 0 PRO 114 149.051 3.861 8.483 1.00 30.00 905 N SER 115 147.431 2.323 8.282 1.00 30.00 906 CA SER 115 148.331 1.181 8.268 1.00 30.00 907 GB SER 115 148.440 0.613 9.687 1.00 30.00 908 OG SER 115 148.930 -0.721 9.690 1.00 30.00 909 C SER 115 147.760 0.121 7.315 1.00 30.00 910 0 SER 115 146.628 0.241 6.854 1.00 30.00 911 N PRO 116 148.549 -0.909 6.970 1.00 30.00 912 CD PRO 116 150.010 -1.038 7.129 1.00 30.00 913 CA PRO 116 148.029 -1.947 6;070 1.00 30.00 914 GB PRO 116 149.204 -2.914 5.959 1.00 30.00 915 CG PRO 116 150.382 -1.978 6.006 1.00 30.00 916 C PRO 116 146.793 -2.594 6.722 1.00 30.00 917 0 PRO 116 145.847 -3.022 6.048 1.00 30.00 918 N TYR 117 146.842 -2.666 8.049 1.00 30.00 919 CA TYR 117 145.754 -3.201 8.840 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971

CB

CG

CD1 CE1 CD2 CE2 Cz

OH

C

0

N

CA

CB

CG

CD1 CE1 CD2 CE2

CZ

OH

C

0

N

CA

CB

CG

CD

NE

CZ

NH1 NH2

C

0

N

CA

CB

CG

CD1 CD2

C

0

N

CA

CB

CG

CD

NE

CZ

NH1 NH2

C

0

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

ARG

ARG

ARG

ARG

ARG

ARG

ARG

ARG

ARG

ARG

ARG

LEU

LEU

LEU

LEU

LEU

LEU

LEU

LEU

ARG

ARG

ARG

ARG

ARG

ARG

ARG

ARG

ARG

ARG

ARG

117 117 117 117 117 117 117 117 117 117 118 118 118 118 118 118 118 118 118 118 118 118 119 119 119 119 119 119 119 119 119 119 119 120 120 120 120 120 120 120 120 121 121 121 121 121 121 121 121 121 121 121 146.018 147.243 148.462 149.570 147.169 148.273 149.467 150.544 145.641 146.654 144.409 144.170 144 .304 143.507 142.230 141.498 144.031 143.308 142.046 141.331 142.799 142 .000 142 .540 141.262 141.468 140.175 140.457 140. 980 141.572 141.726 142.006 140.489 141.047 139.206 138.313 137.605 138.452 137.593 139.034 137.295 137.020 136.737 135.763 136.466 135.738 136.687 137.782 138.679 138. 619 139. 627 134.656 134.885 -4.655 -4.907 -5.277 -5.591 -4.845 -5.154 -5.531 -5.874 -2.299 -1.871 -2 .004 -1.119 0.336 0. 660 1.228 1 .538 0.404 0.705 1.272 1 .562 -1 334 -2.127 -0.617 -0.710 -1.001 -1.135 -1.034 0.294 0. 635 -0.259 1.878 0. 592 1 .674 0.471 1 .612 1 .573 1.765 1 .526 3.170 1.459 0.344 2. 568 2.499 2.703 2 .092 1.209 1 .981 1.491 0.219 2.281 3.529 4.725 9.252 10.106 9. 531 10.322 11.495 12.294 11.700 12.491 10.064 10.615 10.476 11.606 11.140 9.885 9.965 8.804 8. 612 7.444 7. 550 6.407 12.230 11.744 13.317 14.006 15.488 16.268 17 .732 18.031 19.172 20. 143 19.345 13.870 14 .042 13.547 13.409 12.055 10. 798 9. 561 10.783 14 .533 14.981 15.000 16.083 17.421 18 .586 19. 387 19. 971 20.822 21.195 21.313 15. 921 16.057 1.00 1 .00 1 .00 1 .00 1 .00 1.00 1 .00 1 .00 1.00 1 .00 1 .00 1 .00 1.00 1 .00 1 .00 1 .00 1.00 1.00 1 .00 1 .00 1.00 1.00 1.00 1 .00 1.00 1.00 1.00 1 .00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1 .00 1.00 1 .00 1 .00 1 .00 1 .00 1 .00 1 .00 1 .00 1.00 1.00 1.00 1.00 1.00 1.00 310 O00 30 00 30 03 30 00 30 00 30.00 30. O0 30 .00 30.0 30. 00 30.00 30.00 30.00 30. 00 30.00 30 00 30.00 30.00 30. 00 30.00 30 .00 30. 00 30.00 30.00 30 00 30.00 30.00 30.00 30 0 30 .00 30.00 30. 0 30 00 30.00 30.00 30.00 30. 00 30 .00 30.00 30 .00 30.00 30.00 30.00 30.00 30.00 30. O0 30.00 30. 0 30.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 WO 0037620PCT/SE99/02 192 972 N PHE 122 133.450 3.059 15.634 1.00 30.00 973 CA PHE 122 132.329 3.963 15.451 1.00 30.00 974 CB PHE 122 131.702 3.732 14.080 1.00 30.00 975 CG PHE 122 132.685 3.823 12.944 1.00 30.00 976 CD1 PHE 122 133.584 2.788 12.701 1.00 30.00 977 CD2 PHE 122 132:720 4.943 12.122 1.00 30.00 978 GEI PHE 122 134.507 2.867 11.654 1.00 30.00 979 CE2 PHE 122 133.634 5.031 11.080 1.00 30.00 980 CZ PHE 122 134.533 3.988 10.844 1.00 30.00 981 C PHE 122 131.273 3.833 16.546 1.00 30.00 982 0 PilE 122 131.424 3.055 17.493 1.00 30.00 983 N LYS 123 130.207 4.611 16.417 1.00 30.00 984 CA LYS 123 129.136 4.591 17.405 1.00 30.00 985 GB LYS 123 129.472 5.572 18.536 1.00 30.00 986 CG LYS 123 128.711 5.337 19.826 1.00 30.00 987 CD LYS 123 129.333 6.120 20.972 1.00 30.00 988 CE LYS 123 128.661 5.791 22.298 1.00 30.00 989 NZ LYS 123 129.244 6.563 23.431 1.00 30.00 990 C LYS 123 127.795 4.956 16.766 1.00 30.00 991 0 LYS 123 127.704 5.901 15.974 1.00 30.00 992 N VAL 124 126.759 4.194 17.097 1.00 30.00 993 CA VAL 124 125.437 4.466 16.553 1.00 30.00 994 GB VAL 124 124.458 3.293 16.797 1.00 30.00 995 CG1 VAL 124 125.115 1.972 16.420 1.00 30.00 996 CG2 VAL 124 123.994 3.292 18.248 1.00 30.00 997 C VAL 124 124.884 5.699 17.259 1.00 30.00 998 0 VAL 124 125.146 5.911 18.443 1.00 30.00 999 N PRO 125 124.115 6.532 16.540 1.00 30.00 1000 CD PRO 125 123.875 6.496 15.086 1.00 30.00 1001 CA PRO 125 123.531 7.741 17.129 1.00 30.00 1002 GB PRO 125 122.673 8.286 15.994 1.00 30.00 1003 CG PRO 125 123.479 7.926 14.791 1.00 30.00 1004 C PRO 125 122.718 7.432 18.390 1.00 30.00 1005 0 PRO 125 122.264 8.338 19.087 1.00 30.00 1006 N ARG 126 122.533 6.144 18.668 1.00 30.00 1007 CA ARG 126 121.801 5.709 19.852 1.00 30.00 1008 GB ARG 126 120.879 4.538 19.506 1.00 30.00 1009 CG ARG 126 119.774 4.904 18.519 1.00 30.00 1010 CD ARG 126 118.975 6.121 18.995 1.00 30.00 1011 NE ARG 126 117.931 6.510 18.047 1.00 30.00 1012 CZ ARG 126 117.122 7.556 18.202 1.00 30.00 1013 NH1 ARG 126 117.229 8.331 19.273 1.00 30.00 1014 NH-2 ARG 126 116.202 7.828 17.285 1.00 30.00 1015 C ARG 126 122.806 5.316 20.931 1.00 30.00 1016 0 ARG 126 122.684 4.282 21.594 1.00 30.00 1017 N SER 127 123.809 6.178 21.069 1.00 30.00 1018 CA SER 127 124.896 6.051 22.032 1.00 30.00 1019 GB SER 127 124.500 6.722 23.351 1.00 30.00 1020 OG SER 127 124.435 8.132 23.202 1.00 30.00 1021 C SER 127 125.432 4.654 22.310 1.00 30.00 1022 0 SER 127 126.070 4.048 21.450 1.00 30.00 1023 N ASN 128 125.183 4.166 23.524 1.00 30.00 SUBSTITUTE SHEET (RULE 26) %lid'% nA/'2'7,C'ln Dricro/fllOl VV~~.JU~JIJIO~U 33 A 1024 CA ASN 128 125.649 2 .85-7 23.981 1.00 30.00 1025 GB ASN 128 124.559 2.186 24.825 1.00 30.00 1026 CG ASN 128 124.387 2.847 26.179 1.00 30.00 1027 ODI ASN 128 125.329 2.918 26.968 1.00 30.00 1028 ND2 ASN 128 123.183 3.336 26.456 1.00 30.00 1029 C ASN 128 126.136 1.892 22.899 1.00 30.00 1030 0 ASN 128 127.219 1.314 23.023 1.00 30.00 1031 N ILE 129 125.340 1.724 21.845 1.00 30.00 1032 CA ILE 129 125.688 0.826 20.746 1.00 30.00 1033 GB ILE 129 124.501 0.636 19.775 1.00 30.00 1034 CG2 ILE 129 124.925 -0.232 18.597 1.00 30.00 1035 CG1 ILE 129 123.324 -0.006 20.508 1.00 30.00 1036 CDl ILE 129 123.604 -1.409 20.973 1.00 30.00 1037 C ILE 129 126.893 1.304 19.943 1.00 30.00 1038 0 ILE 129 126.793 2.203 19.104 1.00 30.00 1039 N THR 130 128.032 0.677 20.207 1.00 30.00 1040 CA THR 130 129.276 1.010 19.529 1.00 30.00 1041 GB THR 130 130.382 1.330 20.539 1.00 30.00 1042 OGi THR 130 130.510 0.234 21.457 1.00 30.00 1043 CG2 THR 130 130.049 2.608 21.302 1.00 30.00 1044 C THR 130 129.729 -0.161 18.674 1.00 30.00 1045 0 THR 130 129.494 -1.325 19.002 1.00 30.00 1046 N VAL 131 130.391 0.164 17.576 1.00 30.00 1047 GA VAL 131 130.872 -0.847 16.659 1.00 30.00 1048 GB VAL 131 130.187 -0.676 15.290 1.00 30.00 1049 GG1 VAL 131 130.693 -1.707 14.297 1.00 30.00 1050 CG2 VAL 131 128.683 -0.800 15.471 1.00 30.00 1051 C VAL 131 132.381 -0.746 16.493 1.00 30.00 1052 0 VAL 131 132.948 0.346 16.541 1.00 30.00 1053 N ALA 132 133.026 -1.899 16.333 1.00 30.00 1054 GA ALA 132 134.464 -1.954 16.108 1.00 30.00 1055 GB ALA 132 135.151 -2.783 17.178 1.00 30.00 1056 C ALA 132 134.666 -2.597 14.737 1.00 30.00 1057 0 ALA 132 134.010 -3.579 14.394 1.00 30.00 1058 N ILE 133 135.564 -2.016 13.953 1.00 30.00 1059 GA ILE 133 135.868 -2.527 12.623 1.00 30.00 1060 GB ILE 133 135.497 -1.478 11.539 1.00 30.00 1061 GG2 ILE 133 136.177 -1.802 10.215 1.00 30.00 1062 GG1 ILE 133 133.982 -1.436 11.367 1.00 30.00 1063 CD1 ILE 133 133.536 -0.665 10.150 1.00 30.00 1064 C ILE 133 137.363 -2.841 12.553 1.00 30.00 1065 0 ILE 133 138.183 -1.989 12.872 1.00 30.00 1066 N PHE 134 137.714 -4.067 12.163 1.00 30.00 1067 GA PHE 134 139.120 -4.454 12.048 1.00 30.00 1068 GB PHE 134 139.410 -5.732 12.833 1.00 30.00 1069 CG PH-E 134 139.255 -5.568 14.305 1.00 30.00 1070 CD1 PHE 134 137.998 -5.573 14.887 1.00 30.00 1071 CD2 PHE 134 140.364 -5.332 15.110 1.00 30.00 1072 GEl PHE 134 137.846 -5.340 16.251 1.00 30.00 1073 GE2 PHE 134 140.221 -5.099 16.475 1.00 30.00 1074 GZ PHE 134 138.961 -5.101 17.045 1.00 30.00 1075 G PHE 134 139.514 -4.650 10.599 1.00 30.00 SUBSTITUTE SHEET (R ULE 26) WO 00/37620 PCT/SE99/02192 34 1076 0 PHE 134 139.167 -5.654 9.980 1.00 30.00 1077 N MET 135 140.224 -3.665 10.056 1.00 30.00 1078 CA MET 135 140.696 -3.709 8.675 1.00 30.00 1079 GB MET 135 140.889 -2._287 8.159 1.00 30.00 1080 CG MET 135 139.627 -1.444 8.213 1.00 30.00 1081 SD MET 135 138.439 -1.872 6.926 1.00 30.00 1082 CE MET 135 139.022 -0.825 5.555 1.00 30.00 1083 C MET 135 142.027 -4.471 8.650 1.00 30.00 1084 0 MET 135 142.995 -4.065 9.287 1.00 30.00 1085 N LEU 136 142.079 -5.573 7.919 1.00 30.00 1086 CA LEU 136 143.298 -6.368 7.877 1.00 30.00 1087 GB LEU 136 143.001 -7.818 8.307 1.00 30.00 1088 CG LEU 136 141.989 -7.959 9.452 1.00 30.00 1089 CD1 LEU 136 141.623 -9.421 9.660 1.00 30.00 1090 CD2 LEU 136 142.550 -7.330 10.730 1.00 30.00 1091 C LED 136 143.939 -6.387 6.499 1.00 30.00 1092 0 LED 136 143.332 -5.980 5.492 1.00 30.00 1093 N ASP 137 145.182 -6.851 6.463 1.00 30.00 1094 CA ASP 137 145.881 -6.977 5.205 1.00 30.00 1095 GB ASP 137 147.260 -6.338 5.270 1.00 30.00 1096 CG ASP 137 147.820 -6.069 3.894 1.00 30.00 1097 ODi ASP 137 147.747 -6.982 3.036 1.00 30.00 1098 0D2 ASP 137 148.322 -4.947 3.667 1.00 30.00 1099 C ASP 137 146.015 -8.473 4.944 1.00 30.00 1100 0 ASP 137 146.809 -9.160 5.591 1.00 30.00 1101 N THR 138 145.226 -8.977 4.002 1.00 30.00 1102 CA THR 138 145.249 -10.397 3.696 1.00 30.00 1103 GB THP. 138 144.009 -10.830 2.887 1.00 30.00 1104 OGi THR 138 143.894 -10.031 1.702 1.00 30.00 1105 CG2 THR 138 142.760 -10.683 3.736 1.00 30.00 1106 C THR 138 146.498 -10.868 2.980 1.00 30.00 1107 0 THR 138 146.954 -11.978 3.227 1.00 30.00 1108 N VAL 139 147.062 -10.058 2.094 1.00 30.00 1109 CA VAL 139 148.279 -10.499 1.429 1.00 30.00 1110 GB VAL 139 148.784 -9.492 0.380 1.00 30.00 1111 CG1 VAL 139 150.121 -9.965 -0.186 1.00 30.00 1112 CG2 VAL 139 147.768 -9.377 -0.755 1.00 30.00 1113 C VAL 139 149.359 -10.712 2.482 1.00 30.00 1114 0 VAL 139 150.130 -11.664 2.407 1.00 30.00 1115 N MET 140 149.390 -9.840 3.481 1.00 30.00 1116 CA MET 140 150.366 -9.939 4.561 1.00 30.00 1117 GB MET 140 150.468 -8.597 5.293 1.00 30.00 1118 CG MET 140 151.215 -7.541 4.502 1.00 30.00 1119 SD MET 140 151.164 -5.935 5.275 1.00 30.00 1120 CE MET 140 151.439 -6.397 7.016 1.00 30.00 1121 C MET 140 150.033 -11.036 5.569 1.00 30.00 1122 0 MET 140 150.894 -11.496 6.307 1.00 30.00 1123 N LED 141 148.778 -11.456 5.588 1.00 30.00 1124 CA LED 141 148.316 -12.472 6.524 1.00 30.00 1125 GB LED 141 146.886 -12.105 6.954 1.00 30.00 1126 CG LED 141 146.176 -12.765 8.137 1.00 30.00 1127 CDI LED 141 146.868 -12.424 9.458 1.00 30.00 SUBSTITUTE SHEET (RULE 26) W NN/ '7 Ii PrT/ 'l 'OO/fl'21 q2 WO 00/3761fl PrT/Q9/71 92 35 1128 CD2 LEU 141 144 .740 -12.263 8.149 1.00 30.00 1129 C LEU 141 148.368 -13.884 5.916 1.00 30.00 1130 0 LEU 141 148.443 -14.875 6.642 1.00 30.00 1131 N CYS 142 148.344 -13.951 4.583 1.00 30.00 1132 CA CYS 142 148.367 -15.201 3.810 1.00 30.00 1133 C CYS 142 149.481 -15.288 2.786 1.00 30.00 1134 0 CYS 142 150.648 -15.013 3.057 1.00 30.00 1135 CB CYS 142 147 .108 -15.349 2.979 1.00 30.00 1136 SG CYS 142 145.611 -16.016 3.725 1.00 30.00 1137 N GLY 143 149.038 -15.670 1.583 1.00 30.00 1138 CA GLY 143 149.888 -15.834 0.417 1.00 30.00 1139 C GLY 143 149.213 -16.549 -0.763 1.00 30.00 1140 0 GLY 143 149.620 -16.338 -1.911 1.00 30.00 1141 N ASN 144 148.193 -17.381 -0.503 1.00 30.00 1142 CA ASN 144 147.492 -18.130 -1.569 1.00 30.00 1143 CB ASN 144 146.363 -19.013 -0.981 1.00 30.00 1144 CG ASN 144 146.884 -20.227 -0.197 1.00 30.00 1145 ODI ASN 144 147.637 -21.050 -0.718 1.00 30.00 1146 ND2 ASN 144 146.464 -20.343 1.057 1.00 30.00 1147 C ASN 144 146.910 -17.218 -2.667 1.00 30.00 1148 0 ASN 144 146.643 -16.041 -2.426 1.00 30.00 1149 N SER 145 146.712 -17.761 -3.869 1.00 30.00 1150 CA SER 145 146.177 -16.960 -4.976 1.00 30.00 1151 CB SER 145 147.345 -16.339 -5.759 1.00 30.00 1152 OG SER 145 146.899 -15.334 -6.654 1.00 30.00 1153 C SER 145 145.246 -17.734 -5.939 1.00 30.00 1154 0 SER 145 144.050 -17.377 -6.037 1.00 30.00 1155 OXT SER 145 145.714 -18.691 -6.591 1.00 30.00 1156 CB VAL 161 155.920 -9.913 5.983 1.00 30.00 1157 CGI VAL 161 156.813 -9.398 7.099 1.00 30.00 1158 CG2 VAL 161 156.760 -10.563 4.893 1.00 30.00 1159 C VAL 161 154.015 -10.255 7.593 1.00 30.00 1160 0 VAL 161 154.030 -9.035 7.741 1.00 30.00 1161 N VAL 161 154.067 -11.506 5.441 1.00 30.00 1162 CA VAL 161 154.896 -10.936 6.540 1.00 30.00 1163 N ALA 162 153.244 -11.057 8.319 1.00 30.00 1164 CA ALA 162 152.365 -10.531 9.352 1.00 30.00 1165 CB ALA 162 151.153 -9.866 8.716 1.00 30.00 1166 C ALA 162 151.921 -11.624 10.314 1.00 30.00 1167 0 ALA 162 150.743 -11.988 10.357 1.00 30.00 1168 N ARG 163 152.872 -12.160 11.074 1.00 30.00 1169 CA ARG 163 152.565 -13.191 12.058 1.00 30.00 1170 CB ARG 163 153.774 -14.095 12.318 1.00 30.00 1171 CG ARG 163 153.478 -15.235 13.292 1.00 30.00 1172 CD ARG 163 154.713 -16.080 13.593 1.00 30.00 1173 NE ARG 163 155.217 -16.783 12.416 1.00 30.00 1174 CZ ARG 163 156.271 -17.595 12.421 1.00 30.00 1175 NHI ARG 163 156.940 -17.813 13.544 1.00 30.00 1176 NH2 ARG 163 156.658 -18.188 11.301 1.00 30.00 1177 C ARG 163 152.172 -12.470 13.340 1.00 30.00 1178 0 ARG 163 151.643 -13.078 14.272 1.00 30.00 1179 N THR 164 152.449 -11.168 13.383 1.00 30.00 SUBSTITUTE SHEET (R ULE 26) WO 00/37620 36 PCT/SE99/02192 1180 CA THR 164 152.083 -10.353 14.533 1.00 30.00 1181 CB THR 164 153.076 -9.194 14.796 1.00 30.00 1182 OGI THR 164 154.409 -9.704 14.885 1.00 30.00 1183 CG2 THR 164 152.738 -8.503 16.114 1.00 30.00 1184 C THR 164 150.710 -9.757 14.234 1.00 30.00 1185 0 THR 164 149.990 -9.379 15.156 1.00 30.00 1186 N GLN 165 150.348 -9.664 12.951 1.00 30.00 1187 CA GLN 165 149.034 -9.133 12.590 1.00 30.00 1188 CB GLN 165 148.874 -8.972 11.076 1.00 30.00 1189 CG GLN 165 147.535 -8.332 10.689 1.00 30.00 1190 CD GLN 165 147.238 -8.386 9.193 1.00 30.00 1191 OEI GLN 165 146.219 -7.867 8.737 1.00 30.00 1192 NE2 GLN 165 148.124 -9.015 8.425 1.00 30.00 1193 C GLN 165 148.000 -10.129 13.094 1.00 30.00 1194 0 GLN 165 147.034 -9.758 13.759 1.00 30.00 1195 N LEU 166 148.212 -11.403 12.778 1.00 30.00 1196 CA LEU 166 147.303 -12.446 13.223 1.00 30.00 1197 CB LEU 166 147.717 -13.796 12.647 1.00 30.00 1198 CG LEU 166 146.711 -14.911 12.938 1.00 30.00 1199 CD1 LEU 166 145.364 -14.534 12.334 1.00 30.00 1200 CD2 LEU 166 147.206 -16.233 12.373 1.00 30.00 1201 C LEU 166 147.317 -12.509 14.751 1.00 30.00 1202 0 LEU 166 146.312 -12.832 15.385 1.00 30.00 1203 N SER 167 148.465 -12.191 15.341 1.00 30.00 1204 CA SER 167 148.603 -12.194 16.792 1.00 30.00 1205 CB SER 167 150.081 -12.275 17.172 1.00 30.00 1206 OG SER 167 150.227 -12.619 18.537 1.00 30.00 1207 C SER 167 147.973 -10.921 17.371 1.00 30.00 1208 0 SER 167 147.518 -10.900 18.513 1.00 30.00 1209 N TRP 168 147.948 -9.866 16.562 1.00 30.00 1210 CA TRP 168 147.375 -8.583 16.951 1.00 30.00 1211 CB TRP 168 147.786 -7.514 15.937 1.00 30.00 1212 CG TRP 168 146.993 -6.242 16.000 1.00 30.00 1213 CD2 TRP 168 146.012 -5.802 15.056 1.00 30.00 1214 CE2 TRP 168 145.544 -4.545 15.493 1.00 30.00 1215 CE3 TRP 168 145.484 -6.348 13.879 1.00 30.00 1216 CD1 TRP 168 147.074 -5.264 16.953 1.00 30.00 1217 NEI TRP 168 146.205 -4.239 16.653 1.00 30.00 1218 CZ2 TRP 168 144.571 -3.827 14.795 1.00 30.00 1219 CZ3 TRP 168 144.516 -5.634 13.187 1.00 30.00 1220 CH2 TRP 168 144.073 -4.385 13.646 1.00 30.00 1221 C TRP 168 145.851 -8.683 17.004 1.00 30.00 1222 0 TRP 168 145.222 -8.259 17.980 1.00 30.00 1223 N LEU 169 145.269 -9.246 15.945 1.00 30.00 1224 CA LEU 169 143.823 -9.417 15.846 1.00 30.00 1225 CB LEU 169 143.464 -10.058 14.496 1.00 30.00 1226 CG LEU 169 141.981 -10.209 14.125 1.00 30.00 1227 CD1 LEU 169 141.283 -8.859 14.127 1.00 30.00 1228 CD2 LEU 169 141.877 -10.848 12.759 1.00 30.00 1229 C LEU 169 143.297 -10.272 17.006 1.00 30.00 1230 0 LEU 169 142.182 -10.054 17.491 1.00 30.00 1231 N LYS 170 144.105 -11.238 17.448 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 WO 0037620PCT/SE99/021 92 1232 1233 1234 1235 1236 12 37 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252- 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283

CA

CB

CG

CD

CE

NZ

C

0

N

CA

CB

CG

CD

CE

NZ

C

0

N

CA

CB

CG

CD

CE 1 NE2

C

0

N

CA

CB

CG

CD1 CD2

C

0

N

CA

CB

C

0

N

CA

CB

C

0

N

CA

CB

C

0

N

CA

CB

LYS

LYS

LYS

LYS

LYS

LYS

LYS

LYS

LYS

LYS

LYS

LYS

LYS

LYS

LYS

LYS

LYS

GLN

GLN

GLN

GLN

GLN

GLN

GLN

GLN

GLN

LEU

LEU

LEU

LEU

LED

LED

LED

LED

ALA

ALA

ALA

ALA

ALA

ALA

ALA

ALA

ALA

ALA

ALA

ALA

ALA

ALA

ALA

LYS

LYS

LYS

170 170 170 170 170 170 170 170 171 171 171 171 171 171 171 171 171 172 172 172 172 172 172 172 172 172 173 173 173 173 173 173 173 173 174 174 174 174 174 175 175 175 175 175 176 176 176 176 176 177 177 177 143.738 144 .862 144. 549 143.705 143.405 144. 618 143.487 142.379 144.522 144.408 145.719 145. 625 146.872 147.135 145.987 143.269 142.433 143. 254 142.228 142.339 143. 457 143.233 143.311 142. 938 140.814 140.061 140.473 139. 165 139. 100 139. 193 139.318 137.962 138.856 137 .697 139.901 139. 744 140. 938 139. 608 139.140 140.005 139. 942 141.293 138.846 138 .473 138.340 137.280 136. 993 136. 008 135.644 135.335 134.109 134 .317 -12.120 -13.123 -14.151 -15. 302 -16.352 -17.031 -11.288 -11.284 -10.590 -9.747 -8 .998 903 -7 .036 -6.447 650 -8.743 -8 .583 -8.071 -7.085 -6.694 -5.756 -4 .391 -4.203 426 605 -7 .057 663 310 -10.415 -9.971 -11 .183 -9.154 -9.884 930 -10.319 -10.880 -11.757 -9.765 994 -8 .555 -7.419 -6.720 -6.413 -5.586 -6.478 -5.571 -5.791 -5.793 930 -4.705 -4 .799 -4.198 18.559 18.840 19.926 19.388 20.459 20 .995 19.814 20.353 20.275 21.460 21.702 22 .760 22.761 21.376 20 .855 21.290 22.182 20.140 19. 811 18.341 18.012 18.595 19. 804 17.738 20.051 20.859 19.313 19. 363 18.299 16. 828 15. 928 16. 446 20.738 21.164 21 .430 22 .760 23.094 23.791 24 .905 23.411 24.320 24.361 23.975 24.813 22. 747 22 .303 20. 820 23.121 23.424 23.477 24.261 25.657 1.00 1.00 1 .00 1 .00 1 .00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1 .00 1.00 1.00 1.00 1 .00 1 .00 1.00 1 .00 1 .00 1 .00 1 .00 1 .00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1 .00 1 .00 1.00 1.00 1.00 1.00 1 .00 1.00 1 .00 1 .00 1 .00 1.00 1.00 1.00 1 .00 1 .00 1.00 30.00 30 .00 30-.00 30 .00 30 .00 30.00 30.00 30 .00 30 .00 30 .00 30.00 30 .00 30 .00 30 .00 30 .00 30 .00 30 .00 30 .00 30 .00 30 .00 30 .00 30 .00 30.00 30 .00 30. 00 30. 00 30.00 30 .00 30 .00 30. 00 30..00 30 .00 30 .00 30 .00 30 .00 30.00 30.00 30. 00 30 .00 30 .00 30.00 30. 00 30 .00 30 .00 30 .00 30. 00 30 .00 30 .00 30.00 30 .00 30 .00 30 .00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 38 1284 CG LYS 177 135.482 -4.803 26.441 1.00 30.00 1285 CD LYS 177 135.295 -6.299 26.688 1.00 30.00 1286 CE LYS 177 136.544 -6.934 27.302 1.00 30.00 1287 NZ LYS 177 136.909 -6.336 28.617 1.00 30.00 1288 C LYS 177 132.949 -4.094 23.567 1.00 30.00 1289 0 LYS 177 131.869 -3.965 24 .140 1.00 30.00 1290 N GLU 178 133.170 -3.643 22.334 1.00 30.00 1291 CA GLU 178 132.126 -2.956 21.576 1.00 30.00 1292 CB GLU 178 132.611 -2.617 20.167 1.00 30.00 1293 CG GLU 178 134.115 -2.568 20.020 1.00 30.00 1294 CD GLU 178 134.757 -1.544 20.915 1.00 30.00 1295 OE1 GLU 178 134.268 -0.396 20.936 1.00 30.00 1296 0E2 GLU 178 135.752 -1.881 21.591 1.00 30.00 1297 C GLU 178 130.905 -3.865 21.473 1.00 30.00 1298 0 GLU 178 130.967 -5.045 21.819 1.00 30.00 1299 N ASP 179 129.798 -3.315 20.989 1.00 30.00 1300 CA ASP 179 128.565 -4.082 20.849 1.00 30.00 1301 CB ASP 179 127.364 -3.140 20.867 1.00 30.00 1302 CG ASP 179 127.237 -2.405 22.178 1.00 30.00 1303 ODi ASP 179 126.941 -3.065 23.194 1.00 30.00 1304 0D2 ASP 179 127.446 -1.174 22.194 1.00 30.00 1305 C ASP 179 128.570 -4.901 19.570 1.00 30.00 1306 0 ASP 179 127.938 -5.954 19.490 1.00 30.00 1307 N TYR 180 129.273 -4.404 18.562 1.00 30.00 1308 CA TYR 180 129.385 -5.112 17.297 1.00 30.00 1309 CB TYR 180 128.662 -4.369 16.169 1.00 30.00 1310 CG TYR 180 127.155 -4.304 16.271 1.00 30.00 1311 CD1 TYR 180 126.531 -3.507 17.232 1.00 30.00 1312 CEl TYR 180 125.138 -3.406 17.294 1.00 30.00 1313 CD2 TYR 180 126.349 -5.007 15.376 1.00 30.00 1314 CE2 TYR. 180 124.958 -4.916 15.428 1.00 30.00 1315 CZ TYR 180 124.358 -4.112 16.389 1.00 30.00 1316 OH TYR 180 122.984 -4.005 16.432 1.00 30.00 1317 C TYR 180 130.865 -5.199 16.949 1.00 30.00 1318 0 TYR 180 131.665 -4.371 17.386 1.00 30.00 1319 N VAL 181 131.229 -6.212 16.173 1.00 30.00 1320 CA VAL 181 132.607 -6.373 15.742 1.00 30.00 1321 CB VAL 181 133.387 -7.348 16.637 1.00 30.00 1322 CG1 VAL 181 134.814 -7.478 16.122 1.00 30.00 1323 CG2 VAL 181 133.380 -6.855 18.085 1.00 30.00 1324 C VAL 181 132.620 -6.901 14.321 1.00 30.00 1325 0 VAL 181 132.172 -8.011 14.063 1.00 30.00 1326 N LEU 182 133.106 -6.082 13.398 1.00 30.00 1327 CA LEU 182 133.197 -6.476 12.001 1.00 30.00 1328 CB LEU 182 132.600 -540 11.073 1.00 30.00 1329 CG LEU 182 131.226 -4.801 11.352 1.00 30.00 1330 CD1 LEEJ 182 130.806 -3.965 10.147 1.00 30.00 1331 CD2 LEU 182 130.221 -5.878 11.634 1.00 30.00 1332 C LEU 182 134.673 -6.641 11.668 1.00 30.00 1333 0 LEU 182 135.527 -6.020 12.298 1.00 30.00 1334 N VAL 183 134.958 -7.491 10.687 1.00 30.00 1335 CA VAL 183 136.315 -7.747 10.233 1.00 30.00 SUBSTITUTE SHEET (RULE 26) W n n Al n U/Ca fflI7/7~')flPCT/SFQ9/l21 92 39 1336 CB VAL 183 136.854 -9.103 10.758 1.00 30.00 1337 CGT VAL 183 138.276 -9.327 10.273 1.00 30.00 1338 CG2 VAL 183 136.805 -9.135 12.278 1.00 30.00 1339 C VAL 183 136.261 -7.781 8.714 1.00 30.00 1340 0 VAL 183 135.375 -8.391 8.128 1.00 30.00 1341 N ALA 184 137.208 -7.102 8.085 1.00 30.00 1342 CA ALA 184 137.292 -7.055 6.630 1.00 30.00 1343 CB ALA 184 136.799 -5.702 6.121 1.00 30.00 1344 C ALA 184 138.741 -7.296 6.186 1.00 30.00 1345 0 ALA 184 139.686 -7.085 6.948 1.00 30.00 1346 N GLY 185 138.891 -7.753 4.951 1.00 30.00 1347 CA GLY 185 140.199 -8.032 4.375 1.00 30.00 1348 C GLY 185 139.934 -8.149 2.886 1.00 30.00 1349 0 GLY 185 138.784 -7.988 2.468 1.00 30.00 1350 N HIS 186 140.938 -8.437 2.070 1.00 30.00 *1351 CA HIS 186 140.674 -8.520 0.639 1.00 30.00 1352 CB HIS 186 141.847 -7.970 -0.173 1.00 30.00 1353 CG HIS 186 141.600 -7.972 -1.651 1.00 30.00 1354 CD2 HIS 186 142.241 -8.610 -2.666 1.00 30.00 1355 ND1 HIS 186 140.569 -7.263 -2.236 1.00 30.00 1356 CEl HIS 186 140.586 -7.464 -3.545 1.00 30.00 1357 C HIS 186 140.358 -9.915 0.146 1.00 30.00 1358 0 HIS 186 139.502 -10.093 -0.719 1.00 30.00 1359 NE2 HIS 186 141.590 -8.278 -3.830 1.00 30.00 1360 N TYR 187 141.057 -10.904 0.685 1.00 30.00 1361 CA TYR 187 140.844 -12.288 0.279 1.00 30.00 1362 CB TYR 187 142.073 -13.136 0.621 1.00 30.00 1363 CG TYR 187 143.290 -12.814 -0.215 1.00 30.00 1364 CD1 TYR 187 144.579 -13.007 0.293 1.00 30.00 1365 CEl TYR 187 145.703 -12.715 -0.470 1.00 30.00 1366 CD2 TYR 187 143.157 -12.321 -1.517 1.00 30.00 1367 CE2 TYR 187 144.271 -12.029 -2.289 1.00 30.00 1368 CZ TYR 187 145.541 -12.228 -1.760 1.00 30.00 1369 OH TYR 187 146.642 -11.933 -2.521 1.00 30.00 1370 C TYR 187 139.622 -12.850 0.978 1.00 30.00 1371 0 TYR 187 139.325 -12.476 2.108 1.00 30.00 1372 N PRO 188 138.891 -13.758 0.307 1.00 30.00 1373 CD PRO 188 139.083 -14.166 -1.099 1.00 30.00 1374 CA PRO 188 137.684 -14.385 0.868 1.00 30.00 1375 CB PRO 188 136.974 -14.968 -0.363 1.00 30.00 1376 CG PRO 188 137.672 -14.331 -1.565 1.00 30.00 1377 C PRO 188 138.033 -15.522 1.827 1.00 30.00 1378 0 PRO 188 139.082 -16.152 1.695 1.00 30.00 1379 N ILE 189 137.174 -15.772 2.803 1.00 30.00 1380 CA ILE 189 137.379 -16.928 3.665 1.00 30.00 1381 CB ILE 189 136.758 -16.757 5.050 1.00 30.00 1382 CG2 ILE 189 136.619 -18.122 5.710 1.00 30.00 1383 CG1 ILE 189 137.620 -15.823 5.897 1.00 30.00 1384 CD1 ILE 189 137.027 -15.523 7.275 1.00 30.00 1385 C ILE 189. 136.534 -17.933 2.871 1.00 30.00 1386 0 ILE 189 137.039 -18.915 2.337 1.00 30.00 1387 N TRP 190 135.240 -17.632 2.779 1.00 30.00 SUBSTITUTE SHEET (RULE 26) wn n(VAIMIM PCT/SFE9910Q2192 1388 CA TRP 190 134.279 -18.429 2.018 1.00 30.00 1389 CB TRP 190 133.025 -18.716 2.876 1.00 30.00 1390 CG TRP 190 133.259 -19.666 4.035 1.00 30.00 1391 CD2 TRP 190 133.989 -20.907 4.006 1.00 30.00 1392 CE2 TRP 190 134.018 -21.412 5.336 1.00 30.00 1393 CE3 TRP 190 134.628 -21.636 2.989 1.00 30.00 1394 CD1 TRP 190 132.876 -19.483 5.342 1.00 30.00 1395 NEl TRP 190 133.333 -20.526 6.128 1.00 30.00 1396 CZ2 TRP 190 134.661 -22.613 5.673 1.00 30.00 1397 CZ3 TRP 190 135.275 -22.830 3.327 1.00 30.00 1398 CH2 TRP 190 135.284 -23.304 4.660 1.00 30.00 1399 C TRP 190 133.880 -17.666 0.727 1.00 30.00 1400 0 TRP 190 133.674 -16.458 0.744 1.00 30.00 1401 N SER 191 133.815 -18.379 -0.392 1.00 30.00 1402 CA SER 191 133.412 -17.811 -1.682 1.00 30.00 1403 CB SER 191 134.385 -16.761 -2.197 1.00 30.00 1404 OG SER 191 134.220 -16.645 -3.612 1.00 30.00 1405 C SER 191 133.360 -18.904 -2.717 1.00 30.00 1406 0 SER 191 134.293 -19.688 -2.834 1.00 30.00 1407 N ILE 192 132.283 -18.936 -3.483 1.00 30.00 1408 CA ILE 192 132.094 -19.952 -4.507 1.00 30.00 1409 CB ILE 192 130.598 -20.248 -4.675 1.00 30.00 1410 CG2 ILE 192 129.940 -20.336 -3.302 1.00 30.00 1411 CG1 ILE 192 129.929 -19.115 -5.469 1.00 30.00 1412 CD1 ILE 192 128.493 -19.401 -5.871 1.00 30.00 1413 C ILE 192 132.647 -19.536 -5.874 1.00 30.00 1414 0 ILE 192 132.755 -20.366 -6.772 1.00 30.00 1415 N ALA 193 133.001 -18.258 -6.017 1.00 30.00 1416 CA ALA 193 133.485 -17.719 -7.283 1.00 30.00 1417 CB ALA 193 133.495 -16.214 -7.205 1.00 30.00 1418 C ALA 193 134.840 -18.237 -7.791 1.00 10.00 1419 0 ALA 193 135.352 -19.245 -7.306 1.00 30.00 1420 N GLU 194 135.406 -17.539 -8.777 1.00 30.00 1421 CA GLU 194 136.677 -17.917 -9.398 1.00 30.00 1422 CB GLU 194 137.146 -16.826 -10.369 1.00 30.00 1423 CG GLU 194 137.486 -15.481 -9.730 1.00 30.00 1424 CD GLU 194 136.280 -14.560 -9.591 1.00 30.00 1425 OEl GLU 194 136.471 -13.373 -9.250 1.00 30.00 1426 OE2 GLU 194 135..142 -15.020 -9.825 1.00 30.00 1427 C GLU 194 137.827 -18.259 -8.462 1.00 30.00 1428 0 GLU 194 138.441 -19.317 -8.589 1.00 30.00 1429 N HIS 195 138.145 -17.369 -7.534 1.00 30.00 1430 CA HIS 195 139.244 -17.643 -6.612 1.00 30.00 1431 CB HIS 195 139.721 -16.346 -5.935 1.00 30.00 1432 CG HIS 195 140.440 -15.415 -6.862 1.00 30.00 1433 CD2 HIS 195 140.164 -14.146 -7.247 1.00 30.00 1434 ND1 HIS 195 141.578 -15.782 -7.547 1.00 30.00 1435 CEl HIS 195 141.970 -14.782 -8.316 1.00 30.00 1436 NE2 HIS 195 141.128 -13.778 -8.151 1.00 30.00 1437 C HIS 195 138.846 -18.669 -5.558 1.00 30.00 1438 0 HIS 195 139.588 -19.619 -5.288 1.00 30.00 1439 N GLY 196 137.679 -18.472 -4.958 1.00 30.00 SUBSTITUTE SHEET (RULE 26) PCT/SE99/02192 WO 00/137620 C/E9012 41 1440 CA GLY 196 137.213 -19.404 -3.952 1.00 30.00 1441 C GLY 196 137.798 -19.203 -2.568 1.00 30.00 1442 0 GLY 196 138.581 -18.275 -2.337 1.00 30.00 1443 N PRO 197 137.430 -20.076 -1.615 1.00 30.00 1444 CD PRO 197 136.673 -21.331 -1.793 1.00 30.00 1445 CA PRO 197 137.937 -19.972 -0.246 1.00 30.00 1446 CB PRO 197 137.502 -21.293 0.393 1.00 30.00 1447 CG PRO 197 136.282 -21.670 -0.373 1.00 30.00 1448 C PRO 197 139.457 -19.847 -0.273 1.00 30.00 1449 0 PRO 197 140.126 -20.400 -1.159 1.00 30.00 1450 N THR 198 140.011 -19.119 0.684 1.00 30.00 1451 CA THR 198 141.450 -18.996 0.729 1.00 30.00 1452 CB THR 198 141.880 -17.510 0.871 1.00 30.00 1453 OGi THR 198 141.603 -17.047 2.197 1.00 30.00 1454 CG2 THR 198 141.108 -16. 645 -0.151 1.00 30.00 1455 C THR 198 141.863 -19.847 1.921 1.00 30.00 1456 0 THR 198 141.487 -19.567 3.061 1.00 30.00 1457 N ARG 199 142.612 -20.905 1.629 1.00 30.00 1458 CA ARG 199 143.061 -21.855 2.634 1.00 30.00 1459 CB ARG 199 144.091 -22.796 1.989 1.00 30.00 1460 CG ARG 199 143.454 -23.592 0.837 1.00 30.00 1461 CD ARG 199 144.378 -24.609 0.167 1.00 30.00 1462 NE ARG 199 143.668 -25.471 -0.795 1.00 30.00 1463 CZ ARG 199 143.106 -25.057 -1'.932 1.00 30.00 1464 NH1 ARG 199 143.155 -23.775 -2.282 1.00 30.00 1465 NH2 ARG 199 142.502 -25.930 -2.734 1.00 30.00 1466 C ARG 199 143.569 -21.281 3.962 1.00 30.00 1467 0 ARG 199 143.074 -21.644 5.029 1.00 30.00 1468 N CYS 200 144.542 -20.382 3.892 1.00 30.00 1469 CA CYS 200 145.124 -19.760 5.080 1.00 30.00 1470 C CYS 200 144.099 -18.998 5.939 1.00 30.00 1471 0 CYS 200 144.185 -19.010 7.169 1.00 30.00 1472 CS CYS 200 146.241 -18.830 4.623 1.00 30.00 1473 SG CYS 200 145.656 -17.960 3.146 1.00 30.00 1474 N LEU 201 143.133 -18.334 5.304 1.00 30.00 1475 CA LEU 201 142.121 -17.593 6.055 1.00 30.00 1476 CB LEU 201 141.377 -16.611 5.142 1.00 30.00 1477 CG LEU 201 142.167 -15.346 4.776 1.00 30.00 1478 CD1 LEU 201 141.322 -14.450 3.894 1.00 30.00 1479 CD2 LEU 201 142.566 -14.605 6.038 1.00 30.00 1480 C LEU 201 141.153 -18.564 6.718 1.00 30.00 1481 0 LEU 201 140.834 -18.424 7.900 1.00 30.00 1482 N VAL 202 140.703 -19.556 5.956 1.00 30.00 1483 CA VAL 202 139.794 -20.572 6.479 1.00 30.00 1484 CB VAL 202 139.492 -21.670 5.419 1.00 30.00 1485 CG1 VAL 202 138.735 -22.825 6.062 1.00 30.00 1486 CG2 VAL 202 138.672 -21.088 4.273 1.00 30.00 1487 C VAL 202 140.426 -21.253 7.693 1.00 30.00 1488 0 VAL 202 139.730 -21.675 8.616 1.00 30.00 1489 N LYS 203 141.751 -21.347 7.689 1.00 30.00 1490 CA LYS 203 142.473 -21.995 8.777 1.00 30.00 1491 CB LYS 203 143.752 -22.667 8.244 1.00 30.00 SUBSTITUTE SHEET (RULE 26) ILI/ 112"AcIva lrT'r l oo/If" A110 VV~~J U~h~IU~1I 42 E7 1492 CG LYS 203 144.508 -23.477 9.302 1.00 30.00 1493 CD LYS 203 145.749 -24.188 8.759 1.00 30.00 1494 CE LYS 203 146.871 -23.221 8.415 1.00 30.00 1495 NZ LYS 203 148.116 -23.933 8.001 1.00 30.00 1496 C LYS 203 142.847 -21.082 9.934 1.00 30.00 1497 0 LYS 203 142.662 -21.451 11.090 1.00 30.00 1498 N ASN 204 143.364 -19.896 9.619 1.00 30.00 1499 CA ASN 204 143.814 -18.948 10.641 1.00 30.00 1500 CB ASN 204 145.122 -18.284 10.187 1.00 30.00 1501 CG ASN 204 146.280 -19.264 10.100 1.00 30.00 1502 OD1 ASN 204 146.333 -20.111 9.210 1.00 30.00 1503 ND2 ASN 204 147.215 -19.152 11.032 1.00 30.00 1504 C ASN 204 142.836 -17.859 11.089 1.00 30.00 1505 0 ASN 204 142.852 -17.450 12.261 1.00 30.00 1506 N LEU 205 141.993 -17.380 10.177 1.00 30.00 1507 CA LEU 205 141.039 -16.341 10.539 1.00 30.00 1508 CB LEU 205 140.860 -15.369 9.369 1.00 30.00 1509 CG LEU 205 140.120 -14.057 9.684 1.00 30.00 1510 CD1 LEU 205 140.730 -13.400 10.925 1.00 30.00 1511 CD2 LEU 205 140.189 -13.117 8.482 1.00 30.00 1512 C LEU 205 139.671 -16.890 10.988 1.00 30.00 1513 0 LEU 205 139.238 -16.639 12.121 1.00 30.00 1514 N ARG 206 139.010 -17.647 10.109 1.00 30.00 1515 CA ARG 206 137.685 -18.219 10.379 1.00 30.00 1516 CB ARG 206 137.416 -19.397 9.420 1.00 30.00 1517 CG ARG 206 135.967 -19.913 9.378 1.00 30.00 1518 CD ARG 206 135.641 -20.907 10.501 1.00 30.00 1519 NE ARG 206 134.428 -20.532 11.244 1.00 30.00 1520 CZ ARG 206 133.168 -20.750 10.854 1.00 30.00 1521 NH1 ARG 206 132.896 -21.367 9.700 1.00 30.00 1522 NH2 ARG 206 132.170 -20.327 11.630 1.00 30.00 1523 C ARG 206 137.472 -18.658 11.827 1.00 30.00 1524 0 ARG 206 136.425 -18.392 12.418 1.00 30.00 1525 N PRO 207 138.460 -19.338 12.420 1.00 30.00 1526 CD PRO 207 139.671 -19.949 11.840 1.00 30.00 1527 CA PRO 207 138.282 -19.771 13.805 1.00 30.00 1528 CB PRO 207 139.536 -20.612 14.064 1.00 30.00 1529 CG PRO 207 139.865 -21.163 12.720 1.00 30.00 1530 C PRO 207 138.152 -18.614 14.796 1.00 30.00 1531 0 PRO 207 137.546 -18.773 15.856 1.00 30.00 1532 N LEU 208 138.713 -17.455 14.443 1.00 30.00 1533 CA LEU 208 138.699 -16.277 15.314 1.00 30.00 1534 CB LEU 208 139.862 -15.352 14.959 1.00 30.00 1535 CG LEU 208 141.283 -15.825 15.270 1.00 30.00 1536 CD1 LEU 208 142.285 -14.752 14.868 1.00 30.00 1537 CD2 LEU 208 141.402 -16.125 16.753 1.00 30.00 1538 C LEU 208 137.416 -15.454 15.330 1.00 30.00 1539 0 LEU 208 137.194 -14.667 16.255 1.00 30.00 1540 N LEU 209 136.580 -15.630 14.309 1.00 30.00 1541 CA LEU 209 135.328 -14.888 14.205 1.00 30.00 1542 CB LEU 209 134.814 -14.955 12.772 1.00 30.00 1543 CG LEU 209 135.881 -14.580 11.745 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 43 1544 CD1 LEU 209 135.324 -14.715 10.346 1.00 30.00 1545 CD2 LEU 209 136.352 -13.171 11.992 1.00 30.00 1546 C LEU 209 134.277 -15.434 15.164 1.00 30.00 1547 0 LEU 209 133.806 -14.725 16.053 1.00 30.00 1548 N ALA 210 133.912 -16.698 14.987 1.00 30.00 1549 CA ALA 210 132.923 -17.319 15.860 1.00 30.00 1550 CB ALA 210 132.571 -18.711 15.344 1.00 30.00 1551 C ALA 210 133.480 -17.409 17.281 1.00 30.00 .1552 0 ALA 210 132.732 -17.387 18.257 1.00 30.00 1553 N ALA 211 134.804 -17.503 17.381 1.00 30.00 1554 CA ALA 211 135.493 -17.608 18.665 1.00 30.00 1555 CB ALA 211 136.991 -17.710 18.437 1.00 30.00 1556 C ALA 211 135.198 -16.444 19.595 1.00 30.00 1557 0 ALA 211 134.838 -16.644 20.754 1.00 30.00 1558 N TYR 212 135.366 -15.227 19.084 1.00 30.00 1559 CA TYR 212 135.127 -14.029 19.878 1.00 30.00 1560 CB TYR 212 136.335 -13.093 19.807 1.00 30.00 1561 CG TYR 212 137.606 -13.734 20.315 1.00 30.00 1562 CD1 TYR 212 138.496 -14.353 19.434 1.00 30.00 1563 CEl TYR 212 139.648 -14.980 19.902 1.00 30.00 1564 CD2 TYR 212 137.902 -13.758 21.678 1.00 30.00 1565 CE2 TYR 212 139.051 -14.386 22.156 1.00 30.00 1566 CZ TYR 212 139.917 -14.993 21.262 1.00 30.00 1567 OH TYR 212 141.044 -15.624 21.727 1.00 30.00 1568 C TYR 212 133.868 -13.290 19.462 1.00 30.00 1569 0 TYR 212 133.666 -12.134 19.827 1.00 30.00 1570 N GLY 213 133.028 -13.966 18.688 1.00 30.00 1571 CA GLY 213 131.764 -13.387 18.268 1.00 30.00 1572 C GLY 213 131.750 -12.226 17.295 1.00 30.00 1573 0 GLY 213 131.070 -11.229 17.541 1.00 30.00 1574 N VAL 214 132.495 -12.350 16.198 1.00 30.00 1575 CA VAL 214 132.530 -11.323 15.161 1.00 30.00 1576 CB VAL 214 133.662 -11.573 14.145 1.00 30.00 1577 CG1 VAL 214 133.656 -10.489 13.076 1.00 30.00 1578 CG2 VAL 214 135.001 -11.612 14.858 1.00 30.00 1579 C VAL 214 131.196 -11.434 14.432 1.00 30.00 1580 0 VAL 214 130.750 -12.526 14.091 1.00 30.00 1581 N THR 215 130.548 -10.312 14.193 1.00 30.00 1582 CA THR 215 129.266 -10.367 13.529 1.00 30.00 1583 CB THR 215 128.584 -8.983 13.585 1.00 30.00 1584 OGi THR 215 128.647 -8.493 14.931 1.00 30.00 1585 CG2 THR 215 127.120 -9.075 13.148 1.00 30.00 1586 C THR 215 129.405 -10.845 12.081 1.00 30.00 1587 0 THR 215 128.603 -11.658 11.598 1.00 30.00 1588 N ALA 216 130.434 -10.366 11.390 1.00 30.00 1589 CA ALA 216 130.596 -10.756 10.004 1.00 30.00 1590 CB ALA 216 129.511 -10.108 9.165 1.00 30.00 1591 C ALA 216 131.948 -10.410 9.422 1.00 30.00 1592 0 ALA 216 132.696 -9.602 9.972 1.00 30.00 1593 N TYR 217 132.239 -11.032 8.284 1.00 30.00 1594 CA TYR 217 133.481 -10.805 7.585 1.00 30.00 1595 CB TYR 217 134.325 -12.094 7.550 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 44 1596 CG TYR 217 135.644 -11.931 6.809 1.00 30.00 1597 CD1 TYR 217 135.861 -12.543 5.568 1.00 30.00 1598 GEl TYR 217 137.069 -12.359 4.874 1.00 30.00 1599 CD2 TYR 217 136.670 -11.128 7.337 1.00 30.00 1600 CE2 TYR 217 137.873 -10.939 6.651 1.00 30.00 1601 CZ TYR 217 138.065 -11.555 5.427 1.00 30.00 1602 OH TYR 217 139.262 -11.370 4.775 1.00 30.00 1603 C TYR 217 133.212 -10.315 6.167 1.00 30.00 1604 0 TYR 217 132.676 -11.048 5.321 1.00 30.00 1605 N LEU 218 133.580 -9.061 5.924 1.00 30.00 1606 CA LEU 218 133.431 -8.443 4.605 1.00 30.00 1607 CB LEU 218 133.120 -6.949 4.743 1.00 30.00 1608 CG LEU 218 131.761 6.597 5.346 1.00 30.00 1609 ODi LEE] 218 131.877 -6.603 6.863 1.00 30.00 1610 CD2 LEU 218 131.307 -5.229 4.841 1.00 30.00 1611 C LEE] 218 134.726 -8.628 3.801 1.00 30.00 1612 0 LEE] 218 135.828 -8.633 4.368 1.00 30.00 1613 N CYS 219 134.597 -8.772 2.484 1.00 30.00 1614 CA GYS 219 135.773 -8.964 1.647 1.00 30.00 1615 CB CYS 219 136.290 -10.381 1.809 1.00 30.00 1616 SG CYS 219 135.239 -11.548 0.914 1.00 30.00 1617 C CYS 219 135.408 -8.778 0.196 1.00 30.00 1618 0 CYS 219 134.240 -8.640 -0.132 1.00 30.00 1619 N GLY 220 136.419 -8.803 -0.667 1.00 30.00 1620 GA GLY 220 136.202 -8.677 -2.099 1.00 30.00 1621 C GLY 220 137.001 -9.764 -2.785 1.00 30.00 1622 0 GLY 220 136.866 -10.942 -2.463 1.00 30.00 1623 N HIS 221 137.834 -9.365 -3.734 1.00 30.00 1624 CA HIS 221 138.707 -10.281 -4.466 1.00 30.00 1625 CB HIS 221 139.428 -11.218 -3.496 1.00 30.00 1626 CG HIS 221 140.569 -11.953 -4.123 1.00 30.00 1627 CD2 HIS 221 140.852 -13.274 -4.192 1.00 30.00 1628 CEl HIS 221 142.405 -12.203 -5.314 1.00 30.00 1629 NE2 HIS 221 141.996 -13.403 -4.941 1.00 30.00 1630 C HIS 221 138.018 -11.076 -5.570 1.00 30.00 1631 0 HIS 221 138.525 -11.148 -6.690 1.00 30.00 1632 NDl HIS 221 141.561 -11.309 -4.831 1.00 30.00 1633 N ASP 222 136.889 -11.700 -5.258 1.00 30.00 1634 CA ASP 222 136.131 -12.415 -6.289 1.00 30.00 1635 GB ASP 222 135.312 -13.577 -5.697 1.00 30.00 1636 CG ASP 222 136.028 -14.930 -5.809 1.00 30.00 1637 001 ASP 222 136.495 -15.283 -6.913 1.00 30.00 1638 0D2 ASP 222 136.106 -15.652 -4.795 1.00 30.00 1639 C ASP 222 135.200 -11.354 -6.884 1.00 30.00 1640 0 ASP 222 134.365 -10.789 -6.185 1.00 30.00 1641 N HIS 223 135.371 -11.072 -8.169 1.00 30.00 1642 CA HIS 223 134.584 -10.057 -8.854 1.00 30.00 164 3 GB HIS 223 135.226 -9.784 -10.209 1.00 30.00 1644 CG HIS 223 136.643 -9.312 -10.105 1.00 30.00 1645 CD2 HIS 223 137.364 -8.906 -9.030 1.00 30.00 1646 NDl HIS 223 137.479 -9.192 -11.195 1.00 30.00 1647 GEl HIS 223 138.650 -8.733 -10.798 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 1648 C HIS 223 133.094 -10.367 -8.998 1.00 30.00 1649 0 HIS 223 132.600 -10.700 -10.077 1.00 30.00 1650 NE2 HIS 223 138.607 -8.551 -9.491 1.00 30.00 1651 N ASN 224 132.382 -10.232 -7.887 1.00 30.00 1652 CA ASN 224 130.962 -10.495 -7.841 1.00 30.00 1653 CE ASN 224 130.689 -11.963 -8.178 1.00 30.00 1654 CG ASN 224 131.687 -12.900 -7.546 1.00 30.00 1655 ODi ASN 224 131.679 -13.127 -6.328 1.00 30.00 1656 ND2 ASN 224 132.576 -13.446. -8.376 1.00 30.00 1657 C ASN 224 130.363 -10.145 -6.487 1.00 30.00 1658 0 ASN 224 131.045 -9.630 -5.589 1.00 30.00 1659 N LEU 225 129.071 -10.424 -6.360 1.00 30.00 1660 CA LEU 225 128.332 -10.136 -5.147 1.00 30.00 1661 CB LED 225 127.138 -9.236 -5.462 1.00 30.00 1662 CG LEU 225 127.419 -7.867 -6.069 1.00 30.00 1663 CD1 LEU 225 126.093 -7.224 -6.506 1.00 30.00 1664 CD2 LEU 225 128.169 -7.004 -5.041 1.00 30.00 1665 C LEU 225 127.793 -11.390 -4.494 1.00 30.00 1666 0 LED 225 127.072 -12.155 -5.141 1.00 30.00 1667 N GLN 226 128.130 -11.604 -3.222 1.00 30.00 1668 CA GLN 226 127.587 -12.749 -2.504 1.00 30.00 1669 CB GLN 226 128.306 -14.054 -2.896 1.00 30.00 1670 CG GLN 226 129.816 -14.052 -2.816 1.00 30.00 1671 CD GLN 226 130.436 -15.353 -3.340 1.00 30.00 1672 OE1 GLN 226 130.160 -16.436 -2.819 1.00 30.00 1673 NE2 GLN 226 131.277 -15.243 -4.376 1.00 30.00 1674 C GLN 226 127.532 -12.612 -0.993 1.00 30.00 1675 0 GLN 226 128.327 -11.911 -0.374 1.00 30.00 1676 N TYR 227 126.542 -13.270 -0.416 1.00 30.00 1677 CA TYR 227 126.356 -13.289 1.024 1.00 30.00 1678 CB TYR 227 125.038 -12.643 1.444 1.00 30.00 1679 CG TYR 227 124.859 -12.683 2.938 1.00 30.00 1680 CDI TYR 227 125.603 -11.837 3.758 1.00 30.00 1681 CEl TYR 227 125.540 -11.931 5.144 1.00 30.00 1682 CD2 TYR 227 124.025 -13.629 3.541 1.00 30.00 1683 CE2 TYR 227 123.951 -13.739 4.931 1.00 30.00 1684 CZ TYR. 227 124.717 -12.883 5.728 1.00 30.00 1685 OH TYR 227 124.692 -12.978 7.106 1.00 30.00 1686 C TYR 227 126.317 -14.748 1.436 1.00 30.00 1687 0 TYR 227 125.536 -15.536 0.889 1.00 30.00 1688 N LED 228 127.168 -15.102 2.391 1.00 30.00 1689 CA LEU 228 127.233 -16.463 2.898 1.00 30.00 1690 CB LED 228 128.627 -17.073 2.665 1.00 30.00 1691 CG LED 228 129.261 -17.170 1.268 1.00 30.00 1692 CD1 LED 228 128.490 -18.145 0.408 1.00 30.00 1693 CD2 LED 228 129.304 -15.804 0.616 1.00 30.00 1694 C LEU 228 126.992 -16.343 4.393 1.00 30.00 1695 0 LEU 228 127.055 -15.239 4.943 1.00 30.00 1696 N GLN 229 126.713 -17.468 5.045 1.00 30.00 1697 CA GLN 229 126.516 -17.474 6.484 1.00 30.00 1698 CE GLN '229 125.139 -16.926 6.840 1.00 30.00 1699 CG GLN 229 124.959 -16.636 8.325 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 46 1700 CD GLN 229 123.623 -15.976 8.627 1.00 30. 00 1701 OE1 GLN 229 123.123 -16.036 9.754 1.00 30.00 1702 NE2 GLN 229 123.045 -15.330 7.621 1.00 30 .00 1703 C GLN 229 126.701 -18.885 7.032 1.00 30 .00 1704 0 GLN 229 126.024 -19.824 6.610 1.00 30 .0C 1705 N ASP 230 127.645 -19.027 7.960 1.00 30.00 1706 CA ASP 230 127.945 -20.317 8.566 1.00 1707 CB ASP 230 129.392 -20.355 9.091 1.00 30.00 1708 CG ASP 230 129.639 -19.397 10.254 1.00 30.00 1709 OD1 ASP 230 128.816 -19.334 11.193 1.00 30.00 1710 OD2 ASP 230 130.685 -18.718 10.236 1.00 30.00 1711 C ASP 230 126.977 -20.656 9.688 1.00 30.00 1712 0 ASP 230 126.266 -19.791 10.192 1.00 30.00 1713 N GLU 231 126.972 -21.923 10.084 1.00 30.00 1714 CA GLU 231 126.084 -22.414 11.131 1.00 30.00 1715 CB GLU 231 126.209 -23.938 11.261 1.00 30.00 1716 CG GLU 231 127.331 -24. 426 12.192 1.00 30.00 1717 CD GLU 231 128.726 -24.414 11.563 1.00 30.00 1718 OE1 GLU 231 129.687 -24.792 12.277 1.00 30.00 1719 OE2 GLU 231 128.859 -24.043 10.372 1.00 30.00 1720 C GLU 231 126.336 -21.772 12.490 1.00 30.00 1721 0 GLU 231 125.765 -22.191 13.494 1.00 30.00 1722 N ASN 232 127.190 -20.763 12.541 1.00 30.00 1723 CA ASN 232 127.459 -20.101 13.813 1.00 30.00 1724 CB ASN 232 128.976 -19.952 14.061 1.00 30.00 1725 CG ASN 232 129.618 -21.213 14.667 1.00 30.00 1726 ODI ASN 232 129.110 -21.783 15.635 1.00 30.00 1727 ND2 ASN 232 130.757 -21.629 14.106 1.00 30.00 1728 C ASN 232 126.801 -18.726 13.826 1.00 30.00 1729 0 ASN 232 126.781 -18.049 14.859 1.00 30.00 1730 N GLY 233 126.259 -18.321 12.680 1.00 30.00 1731 CA GLY 233 125.627 -17.015 12.587 1.00 30.00 1732 C GLY 233 126.562 -15.916 12.096 1.00 30.00 1733 0 GLY 233 126.131 -14.797 11.827 1.00 30.00 1734 N VAL 234 127.853 -16.224 12.012 1.00 30.00 1735 CA VAL 234 128.819 -15.269 11.513 1.00 30.00 1736 CB VAL 234 130.246 -15.830 11.594 1.00 30.00 1737 CG1 VAL 234 131.229 -14.852 10.967 1.00 30.00 1738 CG2 VAL 234 130.610 -16.109 13.046 1.00 30.00 1739 C VAL 234 128.415 -15.136 10.059 1.00 30.00 1740 0 VAL 234 128.177 -16.144 9.402 1.00 30.00 1741 N GLY 235 128.310 -13.905 9.565 1.00 30.00 1742 CA GLY 235 127.917 -13.703 8.183 1.00 30.00 1743 C GLY 235 129.123 -13.525 7.289 1.00 30.00 1744 0 GLY 235 130.205 -13.208 7.768 1.00 30.00 1745 N TYR 236 128.950 -13.742 5.991 1.00 30 .00 1746 CA TYR 236 130.054 -13.565 5.060 1.00 30.00 1747 CB TYR 236 130.583 -14.922 4.593 1.00 30.06 1748 CG TYR 236 131.222 -15.674 5.729 1.00 30.00 1749 CDI TYR 236 130.446 -16.427 6.616 1.00 30.00 1750 CEI TYR 236 131.017 -17.035 7.741 1.00 30.00 1751 CD2 TYR 236 132.586 -15.551 5.989 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 47 1752 CE2 TYR 236 133.166 -16.154 7.110 1.00 30.00 1753 CZ TYR 236 132.375 -16.891 7.982 1.00 30.00 1754 OH- TYR 236 132.935 -17.463 9.096 1.00 30.00 1755 C TYR 236 129.642 -12.703 3.885 1.00 30.00 1756 0 TYR 236 129.013 -13.170 2.941 1.00 30.00 1757 N VAL 237 130.020 -11.431 3.973 1.00 30.00 1758 CA VAL 237 129.707 -10.414 2.972 1.00 30.00 1759 GB VAL 237 129.462 -9.038 3.652 1.00 30.00 1760 CG1 VAL 237 129.007 -8.020 2.629 1.00 30.00 1761 CG2 VAL 237 128.449 -9.184 4.787 1.00 30.00 1762 C VAL 237 130.835 -10.241 1.965 1.00 30.00 1763 0 VAL 237 131.872 -9.648 2.287 1.00 30.00 1764 N LEU 238 130.633 -10.762 0.754 1.00 30.00 1765 CA LEU 238 131.630 -10.646 -0.316 1.00 30.00 1766 GB LEU 238 131.894 -12.014 -0.955 1.00 30.00 1767 CG LEU 238 133.043 -12.164 -1.967 1.00 30.00 1768 CD1 LEU 238 133.514 -13.624 -1.980 1.00 30.00 1769 CD2 LEU 238 132.598 -11.710 -3.360 1.00 310.00 1770 C LEU 238 131.076 -9.675 -1.348 1.00 30.00 1771 0 LEU 238 130.206 -10.025 -2.149 1.00 30.00 1772 N SER 239 131.589 -8.452 -1.325 1.00 30.00 1773 CA SER 239 131.107 -7.421 -2.224 1.00 30.00 1774 GB SER 239 130.406 -6.335 -1.419 1.00 30.00 1775 OG SER 239 131.275 -5.824 -0.434 1.00 30.00 1776 C SER 239 132.130 -6.754 -3.111 1.00 30.00 1777 0 SER 239 132.152 -5.527 -3.196 1.00 30.00 1778 N GLY 240 132.950 -7.537 -3.795 1.00 30.00 1779 CA GLY 240 133.948 -6.934 -4.654 1.00 30.00 1780 C GLY 240 133.577 -6.882 -6.128 1.00 30.00 1781 0 GLY 240 134.156 -7.592 -6.947 1.00 30.00 1782 N ALA 241 132.615 -6.047 -6.490 1.00 30.00 1783 CA ALA 241 132.259 -5.965 -7.894 1.00 30.00 1784 GB ALA 241 131.018 -6.782 -8.171 1.00 30.00 1785 C ALA 241 132.047 -4.532 -8.330 1.00 30.00 1786 0 ALA 241 130.999 -4.195 -8.880 1.00 30.00 1787 N GLY 242 133.052 -3.691 -8.097 1.00 30.00 1788 CA GLY 242 132.946 -2.294 -8.479 1.00 30.00 1789 C GLY 242 133.584 -1.956 -9.816 1.00 30.00 1790 0 GLY 242 133.362 -0.877 -10.355 1.00 30.00 1791 N ASN 243 134.355 -2.884 -10.368 1.00 30.00 1792 CA ASN 243 135.047 -2.649 -11.629 1.00 30.00 1793 GB ASN 243 136.534 -2.396 -11.338 1.00 30.00 1794 CG ASN 243 137.336 -2.086 -12.578 1.00 30.00 1795 ODi ASN 243 136.956 -1.239 -13.372 1.00 30.00 1796 ND2 ASN 243 138.464 -2.761 -12.741 1.00 30.00 1797 C ASN 243 134.888 -3.828 -12.576 1.00 30.00 1798 0 ASN 243 134.721 -3.649 -13.788 1.00 30.00 1799 N PHE 244 134.933 -5.031 -12.007 1.00 30.00 1800 CA PHE 244 134.812 -6.265 -12.780 1.00 30.00 1801 GB PH-I 244 136.091 -7.094 -12.653 1.00 30.00 1802 CG PHE 244 137.272 -6.515 -13.376 1.00 30.00 1803 GD1 PHE 244 138.377 -6.058 -12.674 1.00 30.00 SUBSTITUTE SHEET (RULE 26) AX/1-1 nnIllyflin lDf-TqrnorQfl'1 IOG' VT UI~~ ~LV48 1804 CD2 PHE 244 137.301 -6.469 -14.768 1.00 30.00 1805 CEl PHE 244 139.498 -5.568 -13.348 1.00 30.00 1806 CE2 PHE 244 138.418 -5.981 -15.452 1.00 30.00 1807 CZ PHE 244 139.515 -5.532 -14.742 1.00 30.00 1808 C PHE 244 133.628 -7.133 -12.352 1.00 30.00 1809 0 PHE 244 133.078 -6.969 -11.264 1.00 30.00 1810 N MET 245 133.251 -8.070 -13.215 1.00 30.00 1811 CA MET 245 132.142 -8.979 -12.928 1.00 30.00 1812 CB MET 245 130.871 -8.455 -13.589 1.00 30.00 1813 CG MET 245 129.600 -8.954 -12.957 1.00 30.00 1814 SD MET 245 129.286 -8.191 -11.360 1.00 30.00 1815 CE MET 245 127.683 -8.994 -10.925 1.00 30.00 1816 C MET 245 132.454 -10.396 -13.438 1.00 30.00 1817 0 MET 245 132.554 -10.618 -14.652 1.00 30.00 1818 N ASP 246 132.614 -11.348 -12.518 1.00 30.00 1819 CA ASP 246 132.922 -12.731 -12.895 1.00 30.00 1820 CE ASP 246 134.202 -13.206 -12.208 1.00 30.00 1821 CG ASP 246 134 .865 -14.347 -12.954 1.00 30.00 1822 ODi ASP 246 134.137 -15.186 -13.518 1.00 30.00 1823 0D2 ASP 246 136.111 -14.411 -12.976 1.00 30.00 1824 C ASP 246 131.779 -13.695 -12.554 1.00 30.00 1825 0 ASP 246 131.413 -13.852 -11.388 1.00 30.00 1826 N PRO 247 131.226 -14.375 -13.579 1.00 30.00 1827 CD PRO 247 131.698 -14.248 -14.971 1.00 30.00 1828 CA PRO 247 130.117 -15.342 -13.503 1.00 30.00 1829 CB PRO 247 129.630 -15.395 -14.941 1.00 30.00 1830 CG PRO 247 130.911 -15.335 -15.688 1.00 30.00 1831 C PRO 247 130.472 -16.731 -12.978 1.00 30.00 1832 0 PRO 247 129.604 -17.595 -12.851 1.00 30.00 1833 N SER 248 131.751 -16.928 -12.672 1.00 30.00 1834 CA SER 248 132.271 -18.200 -12.178 1.00 30.00 1835 CB SER 248 133.805 -18.182 -12.182 1.00 30.00 1836 OG SER 248 134.336 -19.351 -11.580 1.00 30.00 1837 C SER 248 131.803 -18.600 -10.794 1.00 30.00 1838 0 SER 248 131.600 -17.762 -9.907 1.00 30.00 1839 N VAL 249 131.649 -19.911 -10.638 1.00 30.00 1840 CA VAL 249 131.251 -20.535 -9.388 1.00 30.00 1841 CB VAL 249 129.738 -20.802 -9.339 1.00 30.00 1842 CG1 VAL 249 128.988 -19.485 -9.256 1.00 30.00 1843 CG2 VAL 249 129.306 -21.586 -10.563 1.00 30.00 1844 C VAL 249 132.010 -21.856 -9.292 1.00 30.00 1845 0 VAL 249 131.524 -22.821 -8.714 1.00 30.00 1846 N ARG 250 133.209 -21.879 -9.874 1.00 30.00 1847 CA ARG 250 134.079 -23.060 -9.861 1.00 30.00 1848 CB ARG 250 135.471 -22.717 -10.436 1.00 30.00 1849 CG ARG 250 136.529 -23.804 -10.197 1.00 30.00 1850 CD ARG 250 137.978 -23.325 -10.392 1.00 30.00 1851 NE ARG 250 138.934 -24.197 -9.695 1.00 30.00 1852 CZ ARG 250 140.247 -23.978 -9.602 1.00 30.00 1853 NH1 ARG 250 140.785 -22.908 -10.168 1.00 30.00 1854 NH2 ARG 250 141.021 -24.814 -8.915 1.00 30.00 1855 C ARG 250 134.262 -23.628 -8.456 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 49 1856 0 ARG 250 134.596 -24.799 -8.296 1.00 30.00 1857 N HIS 251 134.038 -22.806 -7.438 1.00 30.00 1858 CA HIS 251 134.236 -23.253 -6.066 1.00 30.00 1859 CB HIS 251 135.179 -22.289 -5.358 1.00 30.00 1860 CG HIS 251 136.571 -22.319 -5.906 1.00 30.00 1861 CD2 HIS 251 137.174 -21.559 -6.851 1.00 30.00 1862 ND1 HIS 251 137.503 -23.257 -5.515 1.00 30.00 1863 CEl HIS 251 138.622 -23.069 -6.192 1.00 30.00 1864 NE2 HIS 251 138.449 -22.046 -7.010 1.00 30.00 1865 C HIS 251 132.995 -23.468 -5.226 1.00 30.00 1866 0 HIS 251 133.066 -23.412 -3.989 1.00 30.00 1867 N GLN 252 131.865 -23.715 -5.893 1.00 30.00 1868 CA GLN 252 130.599 -23.967 -5.203 1.00 30.00 1869 CB GLN 252 129.506 -24.409 -6.173 1.00 30.00 1870 CG GLN 252 129.231 -23.492 -7.322 1.00 30.00 1871 CD GLN 252 127.829 -23.682 -7.849 1.00 30.00 1872 OE1 GLN 252 126.858 -23.206 -7.240 1.00 30.00 1873 NE2 GLN 252 127.705 -24.393 -8.971 1.00 30.00 1874 C GLN 252 130.868 -25.135 4.280 1.00 30.00 1875 0 GLN 252 130.550 -25.100 -3.090 1.00 30.00 1876 N ARG 253 131.456 -26.170 -4.872 1.00 30.00 1877 CA ARG 253 131.801 -27.393 -4.181 1.00 30.00 1878 CB ARG 253 132.454 -28.338 -5.182 1.00 30.00 1879 CG ARG 253 131.673 -28.476 -6.493 1.00 30.00 1880 CD ARG 253 130.812 -29.738 -6.524 1.00 30.00 1881 NE ARG 253 131.622 -30.953 -6.434 1.00 30.00 1882 CZ ARG 253 131.141 -32.190 -6.528 1.00 30.00 1883 NH1 ARG 253 129.844 -32.387 -6.719 1.00 30.00 1884 NH2 ARG 253 131.958 -33.230 -6.424 1.00 30.00 1885 C ARG 253 132.724 -27.178 -2.969 1.00 30.00 1886 0 ARG 253 132.654 -27.932 -2.002 1.00 30.00 1887 N LYS 254 133.581 -26.157 -3.004 1.00 30.00 1888 CA LYS 254 134.493 -25.901 -1.878 1.00 30.00 1889 CB LYS 254 135.695 -25.060 -2.336 1.00 30.00 1890 CG LYS 254 136.769 -25.814 -3.130 1.00 30.00 1891 CD LYS 254 136.311 -26.199 -4.539 1.00 30.00 1892 CE LYS 254 137.458 -26.821 -5.347 1.00 30.00 1893 NZ LYS 254 137.063 -27.165 -6.748 1.00 30.00 1894 C LYS 254 133.842 -25.211 -0.668 1.00 30.00 1895 0 LYS 254 134.478 -25.062 0.379 1.00 30.00 1896 N VAL 255 132.589 -24.790 -0.809 1.00 30.00 1897 CA VAL 255 131.879 -24.109 0.267 1.00 30.00 1898 CB VAL 255 131.177 -22.832 -0.274 1.00 30.00 1899 CG1 VAL 255 130.813 -21.894 0.877 1.00 30.00 1900 CG2 VAL 255 132.085 -22.131 -1.274 1.00 30.00 1901 C VAL 255 130.840 -25.069 0.867 1.00 30.00 1902 0 VAL 255 129.908 -25.488 0.186 1.00 30.00 1903 N PRO 256 130.982 -25.412 2.162 1.00 30.00 1904 CD PRO 256 131.865 -24.738 3.134 1.00 30.00 1905 CA PRO 256 130.066 -26.330 2.851 1.00 30.00 1906 CE PRO 256 130.598 -26.338 4.289 1.00 30.00 1907 CG PRO 256 131.153 -24.984 4.452 1.00 30.00 SUBS TITUTE SHEE T (R UL E 2 6) WO 00/37620 PCT/SE99/02192 1908 C PRO 256 128 .601 -25.938 2.742 1.00 30.00 1909 0 PRO 256 128.167 -24 .939 3.312 1.00 30.00 1910 N ASN 257 127.855 -26.755 1.997 1.00 30.00 1911 CA ASN 257 126.430 -26.547 1.727 1.00 30.00 1912 CB ASN 257 125.795 -27.877 1.327 1.00 30.00 1913 CG ASN 257 126.121 -28.256 -0.097 1.00 30.00 1914 ODI ASN 257 127.292 -28.301 -0.483 1.00 30.00 1915 ND2 ASN 257 125.085 -28.526 -0.894 1.00 30.00 1916 C ASN 257 125.588 -25.869 2.805 1.00 30.00 1917 0 ASN 257 125.579 -26. 278 3.970 1.00 30.00 1918 N GLY 258 124.866 -24.833 2.387 1.00 30.00 1919 CA GLY 258 124.038 -24 .089 3.311 1.00 30.00 1920 C GLY 258 124.627 -22.718 3.606 1.00 30.00 1921 0 GLY 258 123.922 -21.826 4.095 1.00 30.00 1922 N TYR 259 125.919 -22.543 3.320 1.00 30.00 1923 CA TYR 259 126.580 -21.258 3.552 1.00 30.00 1924 CB TYR 259 128.100 -21.430 3.538 1.00 30.00 1925 CG TYR 259 128.676 -22.010 4.821 1.00 30.00 1926 CDI TYR 259 127.899 -22.806 5.675 1.00 30.00 1927 CEI TYR 259 128.443 -23.363 6.845 1.00 30.00 1928 CD2 TYR 259 130.011 -21.785 5.170 1.00 30.00 1929 CE2 TYR 259 130.564 -22.339 6.337 1.00 30.00 1930 CZ TYR 259 129.773 -23.125 7.166 1.00 30.00 1931 OH TYR 259 130.320 -23.670 8.304 1.00 30.00 1932 C TYR 259 126.143 -20.222 2.508 1.00 30.00 1933 0 TYR 259 125.874 -19.063 2.851 1.00 30.00 1934 N LEU 260 126.060 -20.630 1.242 1.00 30.00 1935 CA LEU 260 125.612 -19.703 0.206 1.00 30.00 1936 CB LEU 260 125.780 -20.320 -1.185 1.00 30.00 1937 CG LEU 260 125.551 -19.306 -2.316 1.00 30.00 1938 CD1 LEU 260 126.690 -18.276 -2.311 1.00 30.00 1939 CD2 LEU 260 125.508 -20.000 -3.644 1.00 30.00 1940 C LEU 260 124.137 -19.329 0.401 1.00 30.00 1941 0 LEU 260 123.282 -20.202 0.511 1.00 30.00 1942 N ARG 261 123.837 -18.039 0.458 1.00 30.00 1943 CA ARG 261 122.453 -17.592 0.625 1.00 30.00 1944 CB ARG 261 122.263 -16.788 1.914 1.00 30.00 1945 CG ARG 261 122.729 -17.470 3.169 1.00 30.00 1946 CD ARG 261 122.154 -18.850 3.277 1.00 30.00 1947 NE ARG 261 122.851 -19.577 4.326 1.00 30.00 1948 CZ ARG 261 122.607 -19.432 5.620 1.00 30.00 1949 NH1 ARG 261 121.673 -18.589 6.029 1.00 30.00 1950 NH2 ARG 261 123.334 -20.104 6.499 1.00 30.00 1951 C ARG 261 122.114 -16.689 -0.532 1.00 30.00 1952 0 ARG 261 120.952 -16.549 -0.904 1.00 30.00 1953 N PHE 262 123. 144 -16.061 -1.085 1.00 30.00 1954 CA PHE 262 122.956 -15.153 -2.201 1.00 30.00 1955 CB PHE 262 122.520 -13.777 -1.705 1.00 30.00 1956 CG PHE 262 122.500 -12.741 -2.787 1.00 30.00 1957 CD1 PHE 262 121.529 -12.780 -3.784 1.00 30.00 1958 CD2 PHE 262 123.485 -11.766 -2.848 1.00 30.00 1959 CEI PHE 262 121.537 -11.868 -4.831 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 1960 1961 1962 1963 1964 1965 1966 1967 1968 l0 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 CE2 Cz

C

0

N

CA

CB

CG

CD2 ND1 CEl NE2

C

0

N

CA

CB

CG

CD1

CEI

CD2 CE2 Cz

OH

C

0

N

CA

C

0

N

CA

CB

OG

C

0

N

CA

CB

CG

CD

OE1 OE2

C

0

N

CA

CB

CG

ODI

OD2

C

PHE

PHE

PHE

PHE

HIS

HIS

HIS

HIS

HIS

HIS

HIS

HIS

HIS

HIS

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

TYR

GLY

GLY

GLY

GLY

SER

SER

SER

SER

SER

SER

GLU

GLU

GLU

GLU

GLU

GLU

GLU

GLU

GLU

ASP

ASP

ASP

ASP

ASP

ASP

ASP

262 262 262 262 263 263 263 263 263 263 263 263 263 263 264 264 264 264 264 264 264 264 264 264 264 264 265 265 265 265 266 266 266 266 266 266 267 267 267 267 267 267 267 267 267 268 268 268 268 268 268 268 123.504 122. 522 124 .204 125.292 124 .041 125.169 125.890 126.766 128.031 126.321 127.272 128.320 124.764 123.792 125.517 125.240 124.353 123 .858 123.208 122 .759 124.046 123. 599 122. 957 122. 517 126.539 127.329 126.756 127 .957 127.758 128. 688 126. 554 126.245 124.791 124.555 127.172 127. 695 127 .356 128.213 128.339 129.504 130.824 131. 209 131.478 127. 654 128 .330 126.408 125.752 124.431 124.585 125.326 123.969 125.496 -10.847 -10.902 -14.975 -14 .793 -15. 018 -14 .811 -16.124 -16.043 -15.581 -16.373 -16.120 -15.637 -14.155 -14 .554 -13.143 -12.476 -11 244 -10.680 -11 502 -11.000 336 -8.821 659 170 -12.062 -11.286 -12 .590 -12.268 -12.388 -12.746 -12.070 -12.170 -11.766 -10. 416 -11 354 -10.312 -11.850 -11.214 -12.140 -11.844 -12.342 -11.920 -13.159 -9.848 -8.826 -9.840 -8.629 -9.012 -10.158 -10.006 -11.215 -7.504 -3.890 -4.889 -3.039 505 -4 .357 -5.255 -5.565 -6.778 -6.936 -8.041 -8.924 -8.280 -6.573 -7.200 -6.984 -8.248 -8.054 -9.370 -10.298 -11.520 698 -10.919 -11.824 -13.038 -8.929 -8 .380 -10.128 -10.868 -12.366 -13.089 -12 .839 -14.265 -14.537 -14 .184 -15.155 -14.759 -16.371 -17.359 -18.579 -19.507 -18.958 -17.846 -19.642 -17.791 -17.687 -18.255 -18 .748 -19.409 -20.377 -21.372 -20.137 -17.751 1.00 1 .00 1 .00 1 .00 1 .00 1.00 1.00 1.00 1.00 1 .00 1 .00 1 .00 1 .00 1 .00 1 .00 1 .00 1 .00 1.00 1 .00 1 .00 1.00 1 .00 1 .00 1.00 1.00 1.00 1.00 1 .00 1 .00 1.00 1 .00 1 .00 1.00 1.00 1.00 1.00 1.00 1.00 1 .00 1 .00 1.00 1.00 1.00 1.00 1.00 1 .00 1.00 1.00 1.00 1 .00 1.00 1.00 30 .00 30 .00 30.00 30.00 30 00 30.00 30.00 30 .00 30 .00 30 .00 30. 00 30 .00 30 .00 30 .00 30 .00 30 .00 30 .00 30. 00 30. 00 30 .00 30 .00 30 .00 30.00 30.00 30.00 30.00 30.00 30.00 30 .00 30 .00 30. 00 30 .00 30.00 30. 00 30. 00 30.00 30 .00 30 .00 30.00 30. 00 30. 00 30 .00 30 .00 30.00 30 .00 30.00 30.00 30.00 30.00 30.00 30.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/S E99/02192 52 2012 0 ASP 268 125.022 -6.433 -18.136 1.00 30.00 2013 N SER 269 125.798 -7.732 -16.480 1.00 30.00 2014 CA SER 269 125.566 -6.702 -15.470 1.00 30.00 2015 CB SER 269 125.150 -7.345 -14.149 1.00 30.00 2016 OG SER 269 125.212 -6.400 -13.095 1.00 30.00 2017 C SER 269 126.769 -5.813 -15.206 1.00 30.00 2018 0 SER 269 127.906 -6.274 -15.241 1.00 30.00 2019 N LEU 270 126.520 -4 .533 -14 .947 1.00 30.00 2020 CA LEU 270 127.618 -3.627 -14.628 1.00 30.00 2021 CB LEU 270 127.188 -2.157 -14.737 1.00 30.00 2022 CG LEU 270 127.051 -1.524 -16.126 1.00 30.00 2023 CD1 LEU 270 126.647 -0.079 -15.954 1.00 30.00 2024 CD2 LEU 270 128.363 -1.617 -16.901 1.00 30.00 2025 C LEU 270 127.999 -3.948 -13.191 1.00 30.00 2026 0 LEU 270 127.828 -5.081 -12.729 1.00 30.00 2027 N GLY 271 128.494 -2.960 -12.466 1.00 30.00 2028 CA GLY 271 128.873 -3.236 -11.096 1.00 30.00 2029 C GLY 271 127.784 -3.716 -10.140 1.00 30.00 2030 0 GLY 271 126.767 -4.294 -10.529 1.00 30.00 2031 N GLY 272 128.047 -3.449 -8.863 1.00 30.00 2032 CA GLY 272 127.168 -3.797 -7.767 1.00 30.00 2033 C GLY 272 127.994 -3.615 -6.505 1.00 30.00 2034 0 GLY 272 129.220 -3.694 -6.556 1.00 30.00 2035 N PHE 273 127.349 -3.353 -5.375 1.00 30.00 2036 CA PHE 273 128.086 -3.185 -4.119 1.00 30.00 2037 CB PHE 273 128.670 -1.771 -4.031 1.00 30.00 2038 CG PHE 273 127.626 -0.701 -4.090 1.00 30.00 2039 CD1 PHE 273 127.256 -0.010 -2.935 1.00 30.00 2040 CD2 PHE 273 126.947 -0.436 -5.283 1.00 30.00 2041 CEl PHE 273 126.223 0.920 -2.964 1.00 30.00 2042 CE2 PHE 273 125.914 0.492 -5.318 1.00 30.00 2043 CZ PHE 273 125.550 1.168 -4.159 1.00 30.00 2044 C PHE 273 127.132 -3.449 -2.951 1.00 30.00 2045 0 PHE 273 126.010 -3.898 -3.162 1.00 30.00 2046 N THR 274 127.578 -3.172 -1.728 1.00 30.00 2047 CA THR 274 126.747 -3.400 -0.544 1.00 30.00 2048 CB THR 274 127.368 -4.510 0.406 1.00 30.00 2049 OGI THR 274 128.705 -4.150 0.778 1.00 30.00 2050 CG2 THR 274 127.401 -5.860 -0.276 1.00 30.00 2051 C THR 274 126.522 -2.132 0.285 1.00 30.00 2052 0 THR 274 127.349 -1.209 0.292 1.00 30.00 2053 N TYR 275 125.374 -2.076 0.955 1.00 30.00 2054 CA TYR 275 125.055 -0.957 1.837 1.00 30.00 2055 CB TYR 275 123.820 -0.200 1.340 1.00 30.00 2056 CG TYR 275 123.494 1.048 2.139 1.00 30.00 2057 CD1 TYR 275 124.186 2.244 1.939 1.00 30.00 2058 CEI TYR 275 123.905 3.386 2.711 1.00 30.00 2059 CD2 TYR 275 122.514 1.017 3.123 1.00 30.00 2060 CE2 TYR 275 122.229 2.139 3.897 1.00 30.00 2061 CZ TYR 275 122.921 3.319 3.692 1.00 30.00 2062 OH TYR 275 122.608 4.404 4.485 1.00 30.00 2063 C TYR 275 124.817 -1.618 3.201 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 53 2064 0 TYR 275 124.151 -2.649 3.290 1.00 30.00 2065 N VAL 276 125.414 -1.052 4.246 1.00 30.00 2066 CA VAL 276 125.313 -1.602 5.598 1.00 30.00 2067 CB VAL 276 126.714 -2.058 6.147 1.00 30.00 2068 CG1 VAL 276 126.596 -2.523 7.620 1.00 30.00 2069 CG2 VAL 276 127:291 -3.176 5.266 1.00 30.00 2070 C VAL 276 124.766 -0.555 6.544 1.00 30.00 2071 0 VAL 276 125.162 0.607 6.484 1.00 30.00 2072 N GLU 277 123.871 -0.982 7.429 1.00 30.00 2073 CA GLU 277 123.261 -0.081 8.393 1.00 30.00 2074 CB GLU 277 121.884 0.349 7.886 1.00 30.00 2075 CG GLU 277 121.353 1.621 8.500 1.00 30.00 2076 CD GLU 277 119.977 1.975 7.989 1.00 30.00 2077 OEi GLU 277 119.756 1.890 6.764 1.00 30.00 2078 0E2 GLU 277 119.118 2.343 8.809 1.00 30.00 2079 C GLU 277 123.139 -0.810 9.731 1.00 30.00 2080 0 GLU .277 122.320 -1.712 9.888 1.00 30.00 2081 N ILE 278 123.967 -0.426 10.692 1.00 30.00 2082 CA ILE 278 123.957 -1.036 12.016 1.00 30.00 2083 CB ILE 278 125.390 -1.204 12.561 1.00 30.00 2084 CG2 ILE 278 125.353 -1.878 13.934 1.00 30.00 2085 CG1 ILE 278 126.237 -2.009 11.572 1.00 30.00 2086 CD1 ILE 278 127.717 -1.793 11.760 1.00 30.00 2087 C ILE 278 123.194 -0.142 12.987 1.00 30.00 2088 0 ILE 278 123.539 1.022 13.169 1.00 30.00 2089 N GLY 279 122.158 -0.696 13.607 1.00 30.00 2090 CA GLY 279 121.369 0.068 14.552 1.00 30.00 2091 C GLY 279 121.449 -0.525 15.942 1.00 30.00 2092 0 GLY 279 122.274 -1.396 16.205 1.00 30.00 2093 N SER 280 120.583 -0.051 16.832 1.00 30.00 2094 CA SER 280 120.543 -0.523 18.212 1.00 30.00 2095 GB SER 280 119.455 0.236 18.982 1.00 30.00 2096 OG SEP. 280 119.239 -0.327 20.268 1.00 30.00 2097 C SER 280 120.289 -2.026 18.331 1.00 30.00 2098 0 SEP. 280 120.825 -2.685 19.224 1.00 30.00 2099 N LYS 281 119.481 -2.561 17.421 1.00 30.00 2100 CA LYS 281 119.124 -3.970 17.458 1.00 30.00 2101 GB LYS 281 117.613 -4.112 17.253 1.00 30.00 2102 CG LYS 281 116.776 -3.451 18.343 1.00 30.00 2103 CD LYS 281 117.091 -4.039 19.712 1.00 30.00 2104 CE LYS 281 116.171 -3.493 20.796 1.00 30.00 2105 NZ LYS 281 116.429 -4.137 22.121 1.00 30.00 2106 C LYS 281 119.859 -4.887 16.488 1.00 30.00 2107 0 LYS 281 120.420 -5.907 16.900 1.00 30.00 2108 N GLU 282 119.855 -4.553 15.203 1.00 30.00 2109 CA GLU 282 120.540 -5.402 14.237 1.00 30.00 2110 GB GLU 282 119.533 -6.283 13.493 1.00 30.00 2111 CG GLU 282 118.810 -5.602 12.339 1.00 30 .00 2112 CD GLU 282 117.700 -4.680 12.798 1.00 30.00 2113 CEl GLU 282 116.703 -5.180 13.365 1.00 30.00 2114 0E2 GLU 282 117.820 -3.456 12.588 1.00 30.00 2115 C GLU 282 121.397 -4.669 13.207 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 54 2116 0 GLU 282 121.368 -3.440 13.082 1.00 30.00 2117 N MET 283 122.169 -5.463 12.474 1.00 30.00 2118 CA MET 283 123.031 -4.971 11.414 1.00 3'0.00 2119 CB MET 283 124.435 -5.552 11.558 1.00 30.00 2120 CG MET 283 125.332 -5.228 10.386 1.00 30.00 2121 SD MET 283 126.841 -6.204 10.356 1.00 30.00 2122 CE MET 283 127.318 -6.048 8.590 1.00 30.00 2123 C MET 283 122.418 -5.457 10.109 1.00 30.00 2124 0 MET 283 122.173 -6.649 9.945 1.00 30.00 2125 N SER 284 122.160 -4.543 9.185 1.00 30.00 2126 CA SER 284 121.571 -4.929 7.910 1.00 30.00 2127 CB SER 284 120.336 -4.072 7.631 1.00 30O.00 2128 OG SER 284 119.431 -4.151 8.715 1.00 30.00 2129 C SER 284 122.557 -4.825 6.740 1.00 30.00 2130 0 SER 284 123.428 -3.946 6.712 1.00 30.00 2131 N ILE 285 122.414 -5.736 5.783 1.00 30.00 2132 CA ILE 285 123.275 -5.747 4.610 1.00 30.00 2133 CB ILE 285 124.279 -6.950 4.592 1.00 30.00 2134 C02 ILE 285 125.247 -6.785 3.415 1.00 30.00 2135 CG1 ILE 285 125.045 -7.063 5.915 1.00 30.00 2136 CD1 ILE 285 124.275 -7.786 6.995 1.00 30.00 2137 C ILE 285 122.429 -5.876 3.351 1.00 30.00 2138 0 ILE 285 122.011 -6.974 2.989 1.00 30.00 2139 N THR 286 122.159 -4.770 2.677 1.00 30.00 2140 CA THR 286 121.394 -4.875 1.452 1.00 30.00 2141 CB THR 286 120.231 -3.824 1.415 1.00 30.00 2142 OGi THR 286 120.273 -3.086 0.191 1.00 30.00 2143 CG2 THR 286 120.298 -2.895 2.637 1.00 30.00 2144 C THR 286 122.383 -4.734 0.290 ,1.00 30.00 2145 0 THR 286 123.282 -3.903 0.323 1.00 30.00 2146 N TYR 287 122.245 -5.607 -0.703 1.00 30.00 2147 CA TYR 287 123.121 -5.622 -1.870 1.00 30.00 2148 CB TYR 287 123.404 -7.067 -2.317 1.00 30.00 2149 CG TYR 287 124.246 -7.905 -1.354 1.00 3.10.00 2150 CD1 TYR 287 123.770 -8.253 -0.089 1.00 30.00 2151 CEl TYR 287 124.536 -9.013 0.786 1.00 30.00 2152 CD2 TYR 287 125.521 -8.345 -1.718 1.00 30.00 2153 CE2 TYR 287 126.297 -9.106 -0.846 1.00 30.00 2154 CZ TYR 287 125.800 -9.436 0.406 1.00 30.00 2155 OH TYR 287 126.573 -10.177 1.275 1.00 30.00 2156 C TYR 287 122.465 -4.859 -3.004 1.00 30.00 2157 0 TYR 287 121.387 -5.227 -3.476 1.00 30.00 2158 N VAL 288 123.135 -3.800 -3.443 1.00 30.00 2159 CA VAL 288 122.636 -2.944 -4.502 1.00 30.00 2160 CB VAL 288 122.691 -1.478 -4.052 1.00 30.00 2161 CG1 VAL 288 121.973 -0.582 -5.053 1.00 30.00 2162 CG2 VAL 288 122.089 -1.354 -2.671 1.00 30.00 2163 C VAL 288 123.425 -3.090 -5.799 1.00 30.00 2164 0 VAL 288 124.644 -2.930 -5.822 1.00 30.00 2165 N GLU 289 122.728 -3.393 -6.885 1.00 30.00 2166 CA GLU 289 123.381 -3.528 -8.181 1.00 30.00 2167 CB GLU 289 122.439 -4.201 -9.174 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 2168 CG GLU 289 122.987 -4.310 -10.577 1.00 30.00 2169 CD GLU 289 122.177 -5.263 -11.422 1.00 30.00 2170 OE1 GLU 289 120.933 -5.234 -11.300 1.00 30.00 2171 0E2 GLU 289 122.777 -6.035 -12.206 1.00 30.00 2172 C GLU 289 123.719 -2.131 -8.664 1.00 30.00 2173 0 GLU 289 123.151 -1.154 -8.182 1.00 30.00 2174 N ALA 290 124.645 -2.027 -9.604 1.00 30.00 2175 CA ALA 290 125.010 -0.721 -10.130 1.00 30.00 2176 GB ALA 290 125.952 -0.879 -11.319 1.00 30.00 2177 C ALA 290 123.738 0.018 -10.553 1.00 30.00 2178 0 ALA 290 123.551 1.187 -10.216 1.00 30.00 2179 N SER 291 122.863 -0.688 -11.268 1.00 30.00 2180 CA SER 291 121.587 -0.156 -11.771 1.00 30.00 2181 GB SER 291 120.751 -1.293 -12.375 1.00 30.00 2182 OG SER 291 121.347 -1.801 -13.560 1.00 30.00 2183 C SER 291 120.716 0.617 -10.775 1.00 30.00 2184 0 SER 291 120.020 1.551 -11.159 1.00 30.00 2185 N GLY 292 120.735 0.225 -9.506 1.00 30.00 2186 CA GLY 292 119.934 0.920 -8.515 1.00 30.00 2187 C GLY 292 119.005 -0.015 -7.767 1.00 30.00 2188 0 GLY 292 118.585 0.284 -6.645 1.00 30.00 2189 N LYS 293 118.688 -1.151 -8.392 1.00 30.00 .2190 CA LYS 293 117.806 -2.161 -7.808 1.00 30.00 2191 GB LYS 293 117.471 -3.258 -8.829 1.00 30.00 2192 CG LYS 293 116.586 -2.862 -9.990 1.00 30.00 2193 CD LYS 293 116.208 -4.106 -10.789 1.00 30.00 2194 CE LYS 293 115.212 -3.795 -11.896 1.00 30.00 2195 NZ LYS 293 114.723 -5.037 -12.567 1.00 30.00 2196 C LYS 293 118.444 -2.859 -6.623 1.00 30.00 2197 0 LYS 293 119.606 -3.248 -6.690 1.00 30.00 2198 N SER 294 117.691 -3.017 -5.540 1.00 30.00 2199 CA SER 294 118.201 -3.755 -4.392 1.00 30.00 2200 GB SER 294 117.450 -3.376 -3.109 1.00 30.00 2201 OG SER 294 117.750 -2.043 -2.715 1.00 30.00 2202 C SER 294 117.899 -5.204 -4.777 1.00 30.00 2203 0 SER 294 116.743 -5.552 -4.989 1.00 30.00 2204 N LEU 295 118.929 -6.040 -4.894 1.00 30.00 2205 CA LEU 295 118.703 -7.424 -5.291 1.00 30.00 2206 GB LEU 295 119.598 -7.780 -6.484 1.00 30.00 2207 CG LEU 295 120.988 -7.173 -6.595 1.00 30.00 2208 CD1 LEU 295 121.874 -7.716 -5.496 1.00 30.00 2209 CD2 LEU 295 121.553 -7.510 -7.960 1.00 30.00 2210 C LEU 295 118.804 -8.494 -4.202 1.00 30.00 2211 0 LEU 295 118.556 -9.676 -4.460 1.00 30.00 2212 N PHE 296 119.152 -8.075 -2.988 1.00 30.00 2213 CA PHE 296 119.234 -8.987 -1.847 1.00 30.00 2214 GB PHE 296 120.343 -10.021 -2.023 1.00 30.00 2215 CG PHE 296 120.420 -11.019 -0.888 1.00 30.00 2216 GD1 PHE 296 119.628 -12.167 -0.893 1.00 30.00 2217 CD2 PHE 296 121.268 -10-.803 0. 194 1.00 30.00 2218 GEl PHE 296 119.682 -13.083 0.164 1.00 30.00 2219 CE2 PHE 296 121.326 -11.718 1.258 1.00 30.00 SUBSTITUTE SHEET (R ULE 26) WO 00/37620 PCT/SE99/02192 56 2220 CZ PHE 296 120.530 -12.857 1.240 1.00 30.00 2221 C PHE 296 119.491 -8.260 -0.539 1.00 30.00 2222 0 PHE 296 120.358 -7.392 -0.450 1.00 30.00 2223 N LYS 297 118.737 -8.626 0.486 1.00 30.00 2224 CA LYS 297 118.935 -8.029 1.794 1.00 30.00 2225 CB LYS 297 117.933 -6.903 2.049 1.00 30.00 2226 CG LYS 297 118.033 -6.324 3.451 1.00 30.00 2227 CD LYS 297 117.144 -5.106 3. 640 1.00 30.00 2228 CE LYS 297 117.398 -4.442 4.990 1.00 30.00 2229 NZ LYS 297 116.591 -3.202 5.173 1.00 30.00 2230 C LYS 297 118.770 -9.093 2.857 1.00 30.00 2231 0 LYS 297 118.108 -10.106 2.633 1.00 30.00 2232 N THR 298 119.403 -8.858 3.999 1.00 30.00 2233 CA THR 298 119.336 -9.738 5.159 1.00 30.00 2234 CB THR 298 120.195 -11.014 4.980 1.00 30.00 2235 OGi THR 298 120.207 -11.758 6.203 1.00 30.00 2236 CG2 THR 298 121.604 -10.661 4.604 1.00 30.00 2237 C THR 298 119.867 -8.928 6.334 1.00 30.00 2238 0 THR 298 120.516 -7.901 6.139 1.00 30.00 2239 N SER 299 119.573 -9.353 7.553 1.00 30.00 2240 CA SER 299 120.074 -8.627 8.709 1.00 30.00 2241 CB SER 299 118.942 -7.877 9.419 1.00 30.00 2242 OG SER 299 118.130 -8.758 10.169 1.00 30.00 2243 C SER 299 120.734 -9.612 9.663 1.00 30.00 2244 0 SER 299 120.458 -10.819 9.626 1.00 30.00 2245 N LEU 300 121.628 -9.099 10.497 1.00 30.00 2246 CA LEU 300 122.320 -9.936 11.456 1.00 30.00 2247 CB LEU 300 123.828 -9.935 11.182 1.00 30.00 2248 CG LEU 300 124.269 -10.543 9.848 1.00 30.00 2249 CD1 LEU 300 125.713 -10.171 9.569 1.00 30.00 2250 CD2 LEU 300 124.085 -12.056 9.883 1.00 30.00 2251 C LEU 300 122.045 -9.438 12.862 1.00 30.00 2252 0 LED 300 122.064 -8.237 13.130 1.00 30.00 2253 N PRO 301 121.778 -10.365 13.784 1.00 30.00 2254 CD PRO 301 121.729 -11.825 13.589 1.00 30.00 2255 CA PRO 301 121.498 -10.008 15.175 1.00 30.00 2256 CB PRO 301 121.090 -11.345 15.792 1.00 30.00 2257 CG PRO 301 121.893 -12.338 15.000 1.00 30.00 2258 C PRO 301 122.686 -9.355 15.894 1.00 30.00 2259 0 PRO 301 123.832 -9.452 15.453 1.00 30.00 2260 N ARG 302 122.392 688 17.005 1.00 30.00 2261 CA ARG 302 123.403 -8.011 17.802 1.00 30.00 2262 CB ARG 302 122.704 -7.149 18.838 1.00 30.00 2263 CG ARG 302 123.605 -6.330 19.726 1.00 30.00 2264 CD ARG 302 122.719 -5.473 20.600 1.00 30.00 2265 NE ARG 302 123.449 -4.601 21.502 1.00 30.00 2266 CZ ARG 302 122.862 -3.884 22.451 1.00 30.00 2267 NH1 ARG 302 121.547 -3.947 22.605 1.00 30.00 2268 NH2 ARG 302 123.586 -3.107 23.244 1.00 30.00 2269 C ARG 302 124.345 -8.992 18.497 1.00 30.00 2270 0 ARG 302 125.529 -9.056 18.097 1.00 30.00 2271 OXT ARG 302 123.889 -9.685 19.431 1.00 30.00 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 57 2272 FE2 FER 401 141.993 -9.359 -5.779 1.00 30.00 2273 FE3 FER 401 140.139 -8.283 -8.062 1.00 30.00 2274 P P04 410 142.542 -10.658 -8.835 1.00 30.00 2275 01 P04 410 141.472 -11.541 -8.265 1.00 30.00 2276 02 P04 410 143.263 -9.966 -7.711 1.00 30.00 2277 03 P04 410 143.515 -11.497 -9.622 1.00 30.00 2278 04 P04 410 141.918 -9.633 -9.741 1.00 30.00 2279 CA NAG 411 153.692 0.595 -3.480 1.00 30.00 2280 CB NAG 411 154.437 1.922 -3.710 1.00 30.00 2281 CG NAG 411 154.997 2.522 -2.418 1.00 30.00 2282 OD1 NAG 411 154.719 2.024 -1.315 1.00 30.00 2283 ND2 NAG 411 155.778 3.608 -2.546 1.00 30.00 2284 Cl NAG 411 156.642 4.226 -1.276 1.00 30.00 2285 C2 NAG 411 157.916 4.702 -2.090 1.00 30.00 2286 N2 NAG 411 158.724 3.468 -2.158 1.00 30.00 2287 C7 NAG 411 159.035 2.767 -3.246 1.00 30.00 2288 07 NAG 411 158.697 3.082 -4.393 1.00 30.00 2289 C8 NAG 411 159.866 1.565 -2.833 1.00 30.00 2290 C3 NAG 411 158.760 5.825 -1.380 1.00 30.00 2291 03 NAG 411 159.415 6.562 -2.377 1.00 30.00 2292 C4 NAG 411 157.957 6.889 -0.596 1.00 30.00 2293 04 NAG 411 158.813 7.383 0.465 1.00 30.00 2294 C5 NAG 411 156.488 6.285 0.011 1.00 30.00 2295 05 NAG 411 155.813 5.361 -0.926 1.00 30.00 2296 C6 NAG 411 155.414 7.426 0.254 1.00 30.00 2297 06 NAG 411 155.083 8.095 -1.001 1.00 30.00 Non-amino acid residue names: FER: Iron ions NAG: N-acetylglucosamine, glycosylation P04: phosphate Non-standard atom names: FE2: Iron with charge +2 FE3: Iron with charge +3 SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 58 References 1. Griffith, J.P et al. Cell 82, 507-522 (1995).

2. Kissinger, C.R et al. Nature 378, 641-644 (1995).

3. Goldberg, J et al. Nature 376, 745-753 (1995).

4. Egloff, M.P et al.. J. Mol. Biol. 254, 942-959 (1995).

Ek-Rylander, B et al. J. Biol. Chem. 266, 24684-24689, (1991).

6. Hayman, A.R et al. J. Biol. Chem. 269, 1294-1300 (1994).

7. Cassady, et al. Gene 56, 109-116 (1993).

8. Koonin, Protein Sci. 3, 356-358 (1994).

9. Vincent, J.B. et al.. FEBS Lett. 263, 265-268 (1990).

Lohse, D.L, et al. Structure 3, 987-990 (1995).

11. Rusnak, et al. J. Bioinorg. Chem. 1, 388-396 (1996).

12. Mertz, et al.. J. Biol. Chem. 272, 21296-21302 (1997).

13. Huang, H-B et al. Proc. Natl. Acad. Sci. USA 94, 3530-3535 (1997).

14. Zhang, et al.. Biochemistry 35, 6276-6282 (1996).

Andersson, K.K. et al. Adv. Inorg. Chem. 43, 359-408 (1995).

16. Ek-Rylander, et al.. Biochem. J. 321, 305-311 (1997).

17. Strater, et al.. Science 268, 1489-1492 (1995).

18. Schlosnagle, et al. J. Biol. Chem. 249, 7574-7579 (1974).

19. Antanaitis, B.C. Aisen, Adv. Inorg. Biochem. 5, 111-136 (1983).

Averill, B.A.,et al. J. Am. Chem. Soc. 109, 3760-3767 (1987).

21. Doi, K etal. Struct. Bonding 70, 1-26 (1988).

22. Dietrich, M et al.. Eur. J. Biochem. 199, 105-113 (1991).

23. Vincent, J.B. et al.. FASEB. J. 4, 3009-3014 (1990).

24. Andersson, et al.. pp 55-80. (1992) CRC Press, Boca Raton.

Beck, et al.. J. Am. Chem. Soc. 110, 3317-3318 (1988).

SUBSTITUTE SHEET (RULE 26) WO 00/37620 PCT/SE99/02192 59 26. Vincent, J.B et Biochemistry 30, 3025-3034 (1991).

27. Wang, et al. Biochemistry'31. 5263-5268 (1992).

28. Beck, J.L et al.. Biochim. Biophys. Acta 791, 357-363) (1984).

29. Wang, et al. Biochemistry 35. 13946-13954 (1996).

30. Battistuzzi, et al. Biochem. J. 323, 593-596 (1997).

31. KlabundeT., et al. J. Mol. Biol. 259, 73 7-748 (1996).

32. Klabunde, T et al.. FEBS Letters 367, 56-60 (1995).

33. Otwinowski, Z et al. Methods Enzyrno/., 276, 307-326 (1996).

34. Otwinowski, Z. Proceedings of the CCP4 study, weekend. Daresbury Laboratory, Warrington, UK, 80-86 (1991).

Zhang, K.Y.J. et al.. Acta Cryst., A46, 377-3)81 (1990).

36. La Fortelle, E. de et al. Methods Enzymol., 276, 472-494 (1997).

37. Abrahams J. P. et al.. Acta Cryst. D52, 30-42 (1996).

38. Jones, et al.. Acta Cryst., A47, 110-119 (1991).

39. Briinger, A. et al. Acta Cryst D54, 905-921 (1998).

Morris, et al. Struct. Funct. and Genet., 12, 345-364 (1992).

41. Ljusberg, Ek-Rylander, Andersson, G. Tartrate-resistant purple acid phosphatase is synthesized as a latent proenzyme and activated by cysteine proteinases. Submitted SUBSTITUTE SHEET (R ULE 26) WO 00/37620 PCT/SE99/021 92 1 -1 SEQUENCE LISTING <210> 1 <211> 306 <212> PRT <213> 20S RNA replicon <400> 1 Thr Ala Pro Ala Ser Thr Leu Arg Phe Val Ala Val Gly Asp Trp Gly Gly Val Pro Asn Ala Pro Phe His Thr Ala Arg Glu Met Ala Asn Ala Lys Glu Ile Ala Arg Thr Val Gin Ile Met Gly Ala Asp Phe Ile Met Ser Leu Gly Asp Asn Phe Tyr Phe Thr Gly Val His Asp Ala Asn Asp Lys Arg Phe Gin Glu Thr Phe Glu Asp Val Phe Ser Asp Arg Ala Leu Arg Asn Ile Pro Trp Tyr Val Leu Ala Gly Asn His Asp His Leu Gly Asn Val Ser Ala Gin Ile Ala Tyr Ser Lys Ile Ser Lys Arg Trp Asn Phe Pro Ser Pro Tyr Tyr Arg Leu Arg Phe Lys Val Pro Arg Ser Asn SUBSTITUTE SHEET (RULE 26) EDITORIAL NOTE APPLICATION NUMBER 14390/00 The following Sequence Listing pages 1 to 3 are part of the description. The claims pages follow on pages "60" to WO 00/37620 PCT/SE99/02192 120 Ile Thr Val Ala Ile Phe Met Leu Asp Thr Val Met Leu Cys Gly Asn 130 140 Ser Asp Asp Phe Val Ser Gin Gin Pro Glu Met Pro Arg Asp Leu Gly Val Ala Arg Thr Gin Leu Ser Trp Leu Lys Lys Gin Leu Ala Ala Ala Lys Glu Asp Tyr Val Leu Val Ala Gly His Tyr Pro Ile Trp Ser Ile 180 185 190 Ala Glu His Gly Pro Thr Arg Cys Leu Val Lys Asn Leu Arg Pro Leu 195 200 205 Leu Ala Ala Tyr Gly Val Thr Ala Tyr Leu Cys Gly His Asp His Asn 210 220 Leu Gin Tyr Leu Gin Asp Glu Asn Gly Val Gly Tyr Val Leu Ser Gly 225 230 240 Ala Gly Asn Phe Met Asp Pro Ser Val Arg His Gin Arg Lys Val Pro 250 Asn Gly Tyr Leu Arg Phe His Tyr Gly Ser Glu Asp Ser Leu Gly Gly 270 SUBSTITUTE SHEET (RULE 26) WO 00/37620 3 Phe Thr Tyr Val Glu Ile Gly Ser Lys Glu Met Ser Ilie ThrTyr Val 275 280 285 Glu Ala Ser Gly Lys Ser Leu Phe Lys Thr Ser Leu Pro Arg Arg Pro PCT/SE99/021 92 290 Arg Pro 305 SUBSTITUTE SHEET (RULE 26)

Claims (37)

1. A crystalline form of mammalian TRAP (tartrate-resistant and purple acid phosphatase), activated by cleavage prior to crystallization with a protease, and wherein the crystalline form of the mammalian TRAP has a crystal structure with atomic structural coordinates as given in Table 2.

2. A crystalline form of activated TRAP according to claim 1, which is human or rat TRAP.

3. A crystalline form of activated TRAP according to claim 1, comprising heavy metals.

4. A crystalline form of activated TRAP according to claim 1, having a conserved surface with a crystal structure which is created by atoms from the two metal ions and from the following amino acid residues: Aspl4, Asp52, Tyr55, Phe56, Asn91, His92, Hisl86, Tyrl87, Glul94, Hisl95, His221, His223, Phe244, Asp246.

5. A crystalline form of activated TRAP according to claim 3, wherein the heavy metals are Fe.

6. A crystalline form of activated TRAP according to claim 2, comprising heavy metals.

7. A crystalline form of activated TRAP according to claim 6, wherein the heavy metals are Fe.

8. A crystalline form of activated TRAP according to claim 2, having a conserved surface with a crystal structure which is created by atoms from the two metal ions and 30 from the following amino acid residues: Aspl4, Asp52, Tyr55, Phe56, Asn91, His92, Hisl86, Tyrl87, Glu194, Hisl95, His221, His223, Phe244, Asp246. P:\OPER\Pk\2427429) cinm I 13.doc-IIM)5)3 61

9. A crystalline form of activated TRAP according to claim 3, having a conserved surface with a crystal structure which is created by atoms from the two metal ions and from the following amino acid residues: Aspl4, Asp52, Tyr55, Phe56, Asn91, His92, Hisl86, Tyrl87, Gluel94, Hisl95, His221, His223, Phe244, Asp246. A crystalline form of activated TRAP according to claim 1, prepared in the presence of inorganic phosphate.

11. A crystalline form of activated TRAP according to claim 10, having a conserved surface with a crystal structure which is created by atoms from the two metal ions and from the following amino acid residues: Aspl4, Asp52, Tyr55, Phe56, Asn91, His92, Hisl86, Tyrl87, Gluel94, Hisl95, His221, His223, Phe244, Asp246.

12. A crystalline form of activated TRAP according to claim 10, grown using a reservoir containing 0.1M KH 2 P0 4

13. The crystalline form of mammalian TRAP (tartrate-resistant and purple acid phosphatase) according to claim 1, having a structure comprising a double beta sheet 20 sandwich surrounded on both sides by alpha helices.

14. A crystalline form of mammalian TRAP according to claim 13, wherein the beta sheets have seven strands each.

15. A crystalline form of mammalian TRAP according to claim 13, having a disulfide bridge between Cys142 and Cys200. P:\OPER\Pxk2427429 cais 113.doc-23/A4/03 62

16. A crystalline form of mammalian TRAP according to claim 13, comprising Fe2+ and Fe3+, wherein after cleavage of a 21 amino acid N-terminal signal peptide the mammalian TRAP comprises amino acid residues Tyr55, Asn91, Hisl86, Aspl4, Asp52, His221 and His223; wherein Tyr55, Asn91 and His186 coordinate the Fe2+, Aspl4 coordinates the Fe3+, and Asp52, His221 and His223 coordinate both the Fe2+ and the Fe3+.

17. A crystalline form of activated TRAP according to claim 1, prepared in the presence of salt.

18. A method for structure-based drug design for a specific modulator, activator or inhibitor of TRAP (tartrate-resistant and purple acid phosphatase) activity, comprising generating a compound structure using a crystalline form of mammalian TRAP activated by cleavage prior to crystallization with a protease, wherein the crystalline form of the mammalian TRAP has a crystal structure with atomic structural coordinates as given in Table 2.

19. The method according to claim 18, wherein the crystalline form of activated TRAP is human or rat TRAP. The method according to claim 18, wherein the crystalline form of activated TRAP comprises heavy metals.

21. The method according to claim 20, wherein the heavy metals are Fe.

22. The method according to claim 18, wherein the crystalline TRAP has a conserved surface with a crystal structure which is created by atoms from two metal ions and from the following amino acid residues: Aspl4, Asp52, Tyr55, Phe56, Asn91, His92, Hisl86, Tyrl87, Glu194, Hisl95, His221, His223, Phe244, and Asp246. P:\OPER\Pxk2427429 claims I13.doc-23A)4A)3 63

23. The method according to claim 18, wherein the crystalline form of activated TRAP is prepared in the presence of inorganic phosphate.

24. The method according to claim 18, wherein the crystalline form of activated TRAP is grown using a reservoir containing 0.1 M KH2P04. The method according to claim 18, wherein the crystalline form of activated TRAP has a structure comprising a double beta sheet sandwich surrounded on both sides by alpha helices.

26. The method according to claim 25, wherein the double beta sheet sandwich has seven strands for each beta sheet.

27. The method according to claim 18, wherein the crystalline form of activated TRAP has a disulfide bridge between Cysl42 and Cys200.

28. The method according to claim 18, wherein the crystalline form of activated TRAP comprises Fe2+ and Fe3+, wherein after cleavage of a 21 amino acid N-terminal signal peptide the mammalian TRAP comprises amino acid residues Tyr55, Asn91, Hisl86, 20 Aspl4, Asp52, His221 and His223, and wherein Tyr55, Asn91 and Hisl86 coordinate the Fe2+, Aspl4 coordinates the Fe3+, and Asp52, His221 and His223 coordinate both the Fe2+ and the Fe3+.

29. The method according to claim 18, wherein the crystalline form of activated TRAP is prepared in the presence of salt.

30. The method of claim 18, further comprising: generating a conserved surface of the crystalline form of activated TRAP on a computer screen; 30 generating compounds having a spatial structure; and determining if the compounds from step fit the conserved surface. PAOPERPAk2427429 W-ds I 13.dow23III4IO3 64

31. The method according to claim 30, wherein the crystalline form of activated TRAP is human or rat TRAP.

32. The method according to claim 30, wherein the crystalline form of activated TRAP comprises heavy metals.

33. The method according to claim 32, wherein the heavy metals are Fe.

34. The method according to claim 30, wherein the crystalline TRAP has a conserved surface with a crystal structure which is created by atoms from two metal ions and from the following amino acid residues: Aspl4, Asp52, Tyr55, Phe56, Asn91, His92, Hisl86, Tyrl87, Glu194, Hisl95, His221, His223, Phe244, and Asp246.

35. The method according to claim 30, wherein the crystalline form of activated TRAP is prepared in the presence of inorganic phosphate.

36. The method according to claim 30, wherein the crystalline form of activated TRAP is grown using a reservoir containing 0.1 M KH2PO4.

37. The method according to claim 30, wherein the crystalline form of activated TRAP has a structure comprising a double beta sheet sandwich surrounded on both sides by alpha helices.

38. The method according to claim 37, wherein the double beta sheet sandwich has seven strands for each beta sheet.

39. The method according to claim 30, wherein the crystalline form of activated TRAP :i has a disulfide bridge between Cys142 and Cys200. P:\OPER\Pxk\2427429 claims 113.doc-23/09/03 The method according to claim 30, wherein the crystalline form of activated TRAP comprises Fe2+ and Fe3+, wherein after cleavage of a 21 amino acid N-terminal signal peptide the mammalian TRAP comprises amino acid residues Tyr55, Asn91, His186, Aspl4, Asp52, His221 and His223, and wherein Tyr55, Asn91 and Hisl86 coordinate the Fe2+, Aspl4 coordinates the Fe3+, and Asp52, His221 and His223 coordinates the Fe2+ and the Fe3+.

41. The method according to claim 30, wherein the crystalline form of activated TRAP is prepared in the presence of salt. DATED this 2 3 r d day of September 2003 Biovitrum AB By DAVIES COLLISON CAVE Patent Attorneys for the Applicant 0* WO 00/37620 WO 0037620PCT/SE99/021 92 1 /6 1 TAPASTLRFVAVGDWGGVPNAPFHTAREMN\EIARTVQIMGADFIMSLGDNFYFTGVH 61 DADRQTEVSRLNPYVANDLNSQASIKWFSYR 120 121 RFKVPRSNITVAIFMLDTVMLCGNSDDFVSQQPEMPRDLGVARTQLSWLKKQLAAEDY 180 181 VLAHPWIEGTCVNRLAAGTYCHHLYQEGGVS 240 241 AGNFMDPSVRHQRKVPNGYLRFHYGSEDSLGGFTY'VEIGSKEMSITYVEASGKSLFKTSL 300 301 PRRPRP Figure I