AU723853B2 - Methods for altering fertility - Google Patents
Methods for altering fertility Download PDFInfo
- Publication number
- AU723853B2 AU723853B2 AU59422/98A AU5942298A AU723853B2 AU 723853 B2 AU723853 B2 AU 723853B2 AU 59422/98 A AU59422/98 A AU 59422/98A AU 5942298 A AU5942298 A AU 5942298A AU 723853 B2 AU723853 B2 AU 723853B2
- Authority
- AU
- Australia
- Prior art keywords
- subunit
- antibodies
- fsh
- protein
- linker
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired
Links
- 238000000034 method Methods 0.000 title claims description 88
- 230000035558 fertility Effects 0.000 title description 97
- 108010062540 Chorionic Gonadotropin Proteins 0.000 claims description 213
- 102000011022 Chorionic Gonadotropin Human genes 0.000 claims description 213
- 108090000623 proteins and genes Proteins 0.000 claims description 184
- 102000004169 proteins and genes Human genes 0.000 claims description 174
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 claims description 145
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 claims description 145
- 229940028334 follicle stimulating hormone Drugs 0.000 claims description 137
- 229940088597 hormone Drugs 0.000 claims description 106
- 239000005556 hormone Substances 0.000 claims description 106
- 102000006771 Gonadotropins Human genes 0.000 claims description 55
- 108010086677 Gonadotropins Proteins 0.000 claims description 55
- 239000002622 gonadotropin Substances 0.000 claims description 55
- 150000001413 amino acids Chemical class 0.000 claims description 54
- 229940015047 chorionic gonadotropin Drugs 0.000 claims description 45
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 36
- 125000000539 amino acid group Chemical group 0.000 claims description 20
- 238000004519 manufacturing process Methods 0.000 claims description 18
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 17
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 15
- 239000005557 antagonist Substances 0.000 claims description 13
- 239000000556 agonist Substances 0.000 claims description 12
- 239000002773 nucleotide Substances 0.000 claims description 8
- 125000003729 nucleotide group Chemical group 0.000 claims description 8
- 238000012258 culturing Methods 0.000 claims description 2
- 239000003643 water by type Substances 0.000 claims description 2
- 108010073521 Luteinizing Hormone Proteins 0.000 description 247
- 102000009151 Luteinizing Hormone Human genes 0.000 description 244
- 229940040129 luteinizing hormone Drugs 0.000 description 237
- 229940084986 human chorionic gonadotropin Drugs 0.000 description 168
- 235000018102 proteins Nutrition 0.000 description 142
- 230000000694 effects Effects 0.000 description 138
- 230000027455 binding Effects 0.000 description 79
- 210000004027 cell Anatomy 0.000 description 61
- 108020004705 Codon Proteins 0.000 description 56
- 230000015572 biosynthetic process Effects 0.000 description 56
- 229940024606 amino acid Drugs 0.000 description 53
- 235000001014 amino acid Nutrition 0.000 description 53
- 102000023108 LH Receptors Human genes 0.000 description 47
- 108010011942 LH Receptors Proteins 0.000 description 47
- 230000016087 ovulation Effects 0.000 description 43
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 42
- 239000013598 vector Substances 0.000 description 41
- 102000003864 Human Follicle Stimulating Hormone Human genes 0.000 description 40
- 108010082302 Human Follicle Stimulating Hormone Proteins 0.000 description 40
- 238000011161 development Methods 0.000 description 40
- 230000018109 developmental process Effects 0.000 description 40
- 230000028327 secretion Effects 0.000 description 37
- 102000005962 receptors Human genes 0.000 description 35
- 108020003175 receptors Proteins 0.000 description 35
- 230000001965 increasing effect Effects 0.000 description 30
- 241000282414 Homo sapiens Species 0.000 description 29
- 238000013459 approach Methods 0.000 description 29
- 102000003886 Glycoproteins Human genes 0.000 description 28
- 108090000288 Glycoproteins Proteins 0.000 description 28
- 230000003472 neutralizing effect Effects 0.000 description 26
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Natural products NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 25
- 239000013604 expression vector Substances 0.000 description 25
- 238000011282 treatment Methods 0.000 description 25
- 108091026890 Coding region Proteins 0.000 description 24
- 241001465754 Metazoa Species 0.000 description 24
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 24
- 230000006870 function Effects 0.000 description 24
- 230000002163 immunogen Effects 0.000 description 24
- 238000003556 assay Methods 0.000 description 23
- 230000021595 spermatogenesis Effects 0.000 description 23
- 238000006467 substitution reaction Methods 0.000 description 23
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 22
- 235000009582 asparagine Nutrition 0.000 description 22
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 21
- VOXZDWNPVJITMN-ZBRFXRBCSA-N 17β-estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 VOXZDWNPVJITMN-ZBRFXRBCSA-N 0.000 description 21
- 239000000427 antigen Substances 0.000 description 21
- 108091007433 antigens Proteins 0.000 description 21
- 102000036639 antigens Human genes 0.000 description 21
- 229960005309 estradiol Drugs 0.000 description 21
- 229930182833 estradiol Natural products 0.000 description 21
- 108091008146 restriction endonucleases Proteins 0.000 description 21
- 229960003604 testosterone Drugs 0.000 description 21
- 241000283690 Bos taurus Species 0.000 description 20
- 229940011871 estrogen Drugs 0.000 description 20
- 239000000262 estrogen Substances 0.000 description 20
- 230000005764 inhibitory process Effects 0.000 description 20
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 19
- 229960001230 asparagine Drugs 0.000 description 19
- 230000003053 immunization Effects 0.000 description 19
- 230000002401 inhibitory effect Effects 0.000 description 19
- 108020004414 DNA Proteins 0.000 description 18
- 206010033266 Ovarian Hyperstimulation Syndrome Diseases 0.000 description 18
- 230000009471 action Effects 0.000 description 18
- 239000003098 androgen Substances 0.000 description 18
- 238000002360 preparation method Methods 0.000 description 18
- 238000012360 testing method Methods 0.000 description 18
- 229960005486 vaccine Drugs 0.000 description 18
- 230000004071 biological effect Effects 0.000 description 17
- 238000002649 immunization Methods 0.000 description 17
- 239000000047 product Substances 0.000 description 17
- 230000002829 reductive effect Effects 0.000 description 17
- 241000124008 Mammalia Species 0.000 description 16
- 230000013595 glycosylation Effects 0.000 description 16
- 238000006206 glycosylation reaction Methods 0.000 description 16
- 241000282412 Homo Species 0.000 description 15
- 239000004471 Glycine Substances 0.000 description 14
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 14
- 230000007717 exclusion Effects 0.000 description 14
- 239000012634 fragment Substances 0.000 description 14
- 150000002482 oligosaccharides Polymers 0.000 description 14
- 230000035935 pregnancy Effects 0.000 description 14
- 238000003786 synthesis reaction Methods 0.000 description 14
- 210000004246 corpus luteum Anatomy 0.000 description 13
- 238000013461 design Methods 0.000 description 13
- 229940094892 gonadotropins Drugs 0.000 description 13
- 230000035772 mutation Effects 0.000 description 13
- 230000027758 ovulation cycle Effects 0.000 description 13
- 239000000243 solution Substances 0.000 description 13
- 241000894007 species Species 0.000 description 13
- 230000010009 steroidogenesis Effects 0.000 description 13
- 210000001550 testis Anatomy 0.000 description 13
- 238000006243 chemical reaction Methods 0.000 description 12
- 230000002611 ovarian Effects 0.000 description 12
- 239000000186 progesterone Substances 0.000 description 12
- 229960003387 progesterone Drugs 0.000 description 12
- 210000002966 serum Anatomy 0.000 description 12
- 108060003951 Immunoglobulin Proteins 0.000 description 11
- 241000700159 Rattus Species 0.000 description 11
- 102000018358 immunoglobulin Human genes 0.000 description 11
- 208000000509 infertility Diseases 0.000 description 11
- 230000036512 infertility Effects 0.000 description 11
- 231100000535 infertility Toxicity 0.000 description 11
- 235000013930 proline Nutrition 0.000 description 11
- 238000001243 protein synthesis Methods 0.000 description 11
- 238000010561 standard procedure Methods 0.000 description 11
- 230000014616 translation Effects 0.000 description 11
- 102000053602 DNA Human genes 0.000 description 10
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 10
- 239000004473 Threonine Substances 0.000 description 10
- 239000002299 complementary DNA Substances 0.000 description 10
- 150000001875 compounds Chemical class 0.000 description 10
- 230000028993 immune response Effects 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 10
- 230000001939 inductive effect Effects 0.000 description 10
- 210000004698 lymphocyte Anatomy 0.000 description 10
- 210000004379 membrane Anatomy 0.000 description 10
- 239000012528 membrane Substances 0.000 description 10
- 239000000178 monomer Substances 0.000 description 10
- 239000008188 pellet Substances 0.000 description 10
- 201000010065 polycystic ovary syndrome Diseases 0.000 description 10
- 238000012163 sequencing technique Methods 0.000 description 10
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 9
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 9
- 210000002503 granulosa cell Anatomy 0.000 description 9
- 210000002332 leydig cell Anatomy 0.000 description 9
- 102000008175 FSH Receptors Human genes 0.000 description 8
- 108010060374 FSH Receptors Proteins 0.000 description 8
- 230000000890 antigenic effect Effects 0.000 description 8
- 239000011230 binding agent Substances 0.000 description 8
- 239000000872 buffer Substances 0.000 description 8
- 230000007423 decrease Effects 0.000 description 8
- 229940072221 immunoglobulins Drugs 0.000 description 8
- 102000004196 processed proteins & peptides Human genes 0.000 description 8
- 238000012216 screening Methods 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 108010073583 AGCGCT-specific type II deoxyribonucleases Proteins 0.000 description 7
- 241000588724 Escherichia coli Species 0.000 description 7
- 108020005038 Terminator Codon Proteins 0.000 description 7
- 229940030486 androgens Drugs 0.000 description 7
- 229940046836 anti-estrogen Drugs 0.000 description 7
- 230000001833 anti-estrogenic effect Effects 0.000 description 7
- 239000000328 estrogen antagonist Substances 0.000 description 7
- 230000008217 follicular development Effects 0.000 description 7
- 229940027941 immunoglobulin g Drugs 0.000 description 7
- 238000002703 mutagenesis Methods 0.000 description 7
- 231100000350 mutagenesis Toxicity 0.000 description 7
- 229920001542 oligosaccharide Polymers 0.000 description 7
- 230000011599 ovarian follicle development Effects 0.000 description 7
- 239000002245 particle Substances 0.000 description 7
- 239000007858 starting material Substances 0.000 description 7
- 150000003431 steroids Chemical class 0.000 description 7
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 6
- 108010057021 Menotropins Proteins 0.000 description 6
- 230000000903 blocking effect Effects 0.000 description 6
- 238000010367 cloning Methods 0.000 description 6
- 229940124462 contraceptive vaccine Drugs 0.000 description 6
- JGMOKGBVKVMRFX-HQZYFCCVSA-N dydrogesterone Chemical compound C1=CC2=CC(=O)CC[C@@]2(C)[C@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 JGMOKGBVKVMRFX-HQZYFCCVSA-N 0.000 description 6
- 229960004913 dydrogesterone Drugs 0.000 description 6
- 230000002708 enhancing effect Effects 0.000 description 6
- 239000000833 heterodimer Substances 0.000 description 6
- 238000000338 in vitro Methods 0.000 description 6
- 210000004914 menses Anatomy 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- 108010028837 GTGCAC-specific type II deoxyribonucleases Proteins 0.000 description 5
- 206010036049 Polycystic ovaries Diseases 0.000 description 5
- 241000288906 Primates Species 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 230000029087 digestion Effects 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- 238000012544 monitoring process Methods 0.000 description 5
- 210000001672 ovary Anatomy 0.000 description 5
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 239000012064 sodium phosphate buffer Substances 0.000 description 5
- 210000002700 urine Anatomy 0.000 description 5
- 102000014914 Carrier Proteins Human genes 0.000 description 4
- 206010062767 Hypophysitis Diseases 0.000 description 4
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 4
- 150000001508 asparagines Chemical class 0.000 description 4
- 230000037396 body weight Effects 0.000 description 4
- 210000004899 c-terminal region Anatomy 0.000 description 4
- 150000001720 carbohydrates Chemical group 0.000 description 4
- 230000008878 coupling Effects 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 4
- 125000000404 glutamine group Chemical class N[C@@H](CCC(N)=O)C(=O)* 0.000 description 4
- XLXSAKCOAKORKW-AQJXLSMYSA-N gonadorelin Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 XLXSAKCOAKORKW-AQJXLSMYSA-N 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 230000029849 luteinization Effects 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 238000002823 phage display Methods 0.000 description 4
- 230000001817 pituitary effect Effects 0.000 description 4
- 210000003635 pituitary gland Anatomy 0.000 description 4
- 229920001184 polypeptide Polymers 0.000 description 4
- 230000002028 premature Effects 0.000 description 4
- 230000001850 reproductive effect Effects 0.000 description 4
- 230000019491 signal transduction Effects 0.000 description 4
- 230000009870 specific binding Effects 0.000 description 4
- 230000004936 stimulating effect Effects 0.000 description 4
- 230000000638 stimulation Effects 0.000 description 4
- 210000001685 thyroid gland Anatomy 0.000 description 4
- 239000001226 triphosphate Substances 0.000 description 4
- 235000011178 triphosphate Nutrition 0.000 description 4
- 125000002264 triphosphate group Chemical class [H]OP(=O)(O[H])OP(=O)(O[H])OP(=O)(O[H])O* 0.000 description 4
- 238000002255 vaccination Methods 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 241000282693 Cercopithecidae Species 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 239000000579 Gonadotropin-Releasing Hormone Substances 0.000 description 3
- 102000018997 Growth Hormone Human genes 0.000 description 3
- 108010051696 Growth Hormone Proteins 0.000 description 3
- 108091006905 Human Serum Albumin Proteins 0.000 description 3
- 102000008100 Human Serum Albumin Human genes 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 206010028980 Neoplasm Diseases 0.000 description 3
- 108010002747 Pfu DNA polymerase Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 101000857870 Squalus acanthias Gonadoliberin Proteins 0.000 description 3
- -1 TSH Proteins 0.000 description 3
- 239000007983 Tris buffer Substances 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 230000003325 follicular Effects 0.000 description 3
- 229940035638 gonadotropin-releasing hormone Drugs 0.000 description 3
- 239000000122 growth hormone Substances 0.000 description 3
- 230000003054 hormonal effect Effects 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 230000000938 luteal effect Effects 0.000 description 3
- 230000035800 maturation Effects 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 230000009245 menopause Effects 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- 239000013641 positive control Substances 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 102220024935 rs199473369 Human genes 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 102000008186 Collagen Human genes 0.000 description 2
- 108010035532 Collagen Proteins 0.000 description 2
- 238000001712 DNA sequencing Methods 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 210000004198 anterior pituitary gland Anatomy 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 108010066058 beta Subunit Luteinizing Hormone Proteins 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 230000008512 biological response Effects 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 239000013553 cell monolayer Substances 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 229920001436 collagen Polymers 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 230000002124 endocrine Effects 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 238000002523 gelfiltration Methods 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 230000009125 negative feedback regulation Effects 0.000 description 2
- 238000006386 neutralization reaction Methods 0.000 description 2
- 230000003169 placental effect Effects 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 239000000583 progesterone congener Substances 0.000 description 2
- 238000002708 random mutagenesis Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 238000010187 selection method Methods 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 230000002195 synergetic effect Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 150000003588 threonines Chemical class 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 230000001052 transient effect Effects 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- DNXHEGUUPJUMQT-UHFFFAOYSA-N (+)-estrone Natural products OC1=CC=C2C3CCC(C)(C(CC4)=O)C4C3CCC2=C1 DNXHEGUUPJUMQT-UHFFFAOYSA-N 0.000 description 1
- ZVEUWSJUXREOBK-DKWTVANSSA-N 2-aminoacetic acid;(2s)-2-amino-3-hydroxypropanoic acid Chemical group NCC(O)=O.OC[C@H](N)C(O)=O ZVEUWSJUXREOBK-DKWTVANSSA-N 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 101100107610 Arabidopsis thaliana ABCF4 gene Proteins 0.000 description 1
- 0 C[C@](C1)(CC2C(C3)C1C3C2)*1CC=CC1 Chemical compound C[C@](C1)(CC2C(C3)C1C3C2)*1CC=CC1 0.000 description 1
- 101100538958 Caenorhabditis elegans hlh-8 gene Proteins 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102220547697 Carcinoembryonic antigen-related cell adhesion molecule 3_L73T_mutation Human genes 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 108010005054 Deoxyribonuclease BamHI Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102100040977 Follitropin subunit beta Human genes 0.000 description 1
- 108010033155 GGGCCC-specific type II deoxyribonucleases Proteins 0.000 description 1
- 108010022868 GGWCC-specific type II deoxyribonucleases Proteins 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- 102000001895 Gonadotropin Receptors Human genes 0.000 description 1
- 108010040490 Gonadotropin Receptors Proteins 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 101000893054 Homo sapiens Follitropin subunit beta Proteins 0.000 description 1
- 101000965689 Homo sapiens Lutropin subunit beta Proteins 0.000 description 1
- 102000002265 Human Growth Hormone Human genes 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 239000000854 Human Growth Hormone Substances 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- 102100040947 Lutropin subunit beta Human genes 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 241000422980 Marietta Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 208000001132 Osteoporosis Diseases 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 241000609499 Palicourea Species 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108010076039 Polyproteins Proteins 0.000 description 1
- 208000002500 Primary Ovarian Insufficiency Diseases 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 230000010799 Receptor Interactions Effects 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108091006629 SLC13A2 Proteins 0.000 description 1
- 101100068078 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GCN4 gene Proteins 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 102000011923 Thyrotropin Human genes 0.000 description 1
- 108010061174 Thyrotropin Proteins 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 206010000210 abortion Diseases 0.000 description 1
- 231100000176 abortion Toxicity 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000003388 anti-hormonal effect Effects 0.000 description 1
- 230000009833 antibody interaction Effects 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 230000006472 autoimmune response Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 230000001593 cAMP accumulation Effects 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 239000003433 contraceptive agent Substances 0.000 description 1
- 230000002254 contraceptive effect Effects 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 230000037029 cross reaction Effects 0.000 description 1
- 230000001351 cycling effect Effects 0.000 description 1
- 108700003318 deglycosylated luteinizing hormone Proteins 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 210000005081 epithelial layer Anatomy 0.000 description 1
- JKKFKPJIXZFSSB-CBZIJGRNSA-N estrone 3-sulfate Chemical compound OS(=O)(=O)OC1=CC=C2[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CCC2=C1 JKKFKPJIXZFSSB-CBZIJGRNSA-N 0.000 description 1
- 230000012173 estrus Effects 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 230000006408 female gonad development Effects 0.000 description 1
- 230000004720 fertilization Effects 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 150000002333 glycines Chemical class 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 210000002149 gonad Anatomy 0.000 description 1
- 230000002710 gonadal effect Effects 0.000 description 1
- 229940121381 gonadotrophin releasing hormone (gnrh) antagonists Drugs 0.000 description 1
- 238000000265 homogenisation Methods 0.000 description 1
- 239000003668 hormone analog Substances 0.000 description 1
- 108091008039 hormone receptors Proteins 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000002989 hypothyroidism Effects 0.000 description 1
- 208000003532 hypothyroidism Diseases 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 239000012133 immunoprecipitate Substances 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 208000021267 infertility disease Diseases 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000003563 lymphoid tissue Anatomy 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000002175 menstrual effect Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 210000000287 oocyte Anatomy 0.000 description 1
- 210000004681 ovum Anatomy 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 239000006174 pH buffer Substances 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 230000007310 pathophysiology Effects 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 229940063238 premarin Drugs 0.000 description 1
- 206010036601 premature menopause Diseases 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000006259 progesterone secretion Effects 0.000 description 1
- 150000003148 prolines Chemical class 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 230000000541 pulsatile effect Effects 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 230000027272 reproductive process Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 210000000717 sertoli cell Anatomy 0.000 description 1
- 230000001568 sexual effect Effects 0.000 description 1
- 238000002764 solid phase assay Methods 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 238000013223 sprague-dawley female rat Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 229960000874 thyrotropin Drugs 0.000 description 1
- 230000001748 thyrotropin Effects 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 238000006257 total synthesis reaction Methods 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 210000002993 trophoblast Anatomy 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/59—Follicle-stimulating hormone [FSH]; Chorionic gonadotropins, e.g.hCG [human chorionic gonadotropin]; Luteinising hormone [LH]; Thyroid-stimulating hormone [TSH]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/26—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against hormones ; against hormone releasing or inhibiting factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Endocrinology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Reproductive Health (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Description
AUSTRALIA
PATENTS ACT 1990 COMPLETE SPECIFICATION FOR A STANDARD PATENT
ORIGINAL
*0 0* 9 Name of Applicant: Actual Inventor: WASHINGTON UNIVERSITY William R. MOYLE SHELSTON WATERS MARGARET STREET SYDNEY NSW 2000 "METHODS FOR ALTERING FERTILITY" Address of Service: :o.
t Invention Title: Details of Original Application No. 18787/95 dated 17th February, 1995 The following statement is a full description of this invention, including the best method of performing it known to us:la METHODS FOR ALTERING FERTILITY BACKGROUND OF THE INVENTION Field of the Invention The present invention relates to methods for enhancing fertility by reducing the activities and/or levels of circulating glycoprotein hormones having lutropin (LH) activity. The molecules of the invention are antibodies or other binding agents that reduce the biological activities of LH. The present invention also relates to novel methods for devising and/or selecting antibodies to specific portions of proteins including LH and human chorionic gonadotropin (hCG) to 10 permit their biological activities to be reduced to desired degrees. The present invention further relates to novel glycoprotein hormone agonists and antagonists that reduce the activities of hormones with LH activities and/or increase the activities of hormones with follitropin activity.
Description of the Background The disclosures referred to herein to illustrate the background of the invention and to provide additional detail with respect to its practice are incorporated herein by reference and, for convenience, are numerically referenced in the following text and respectively grouped in the appended bibliography.
The glycoprotein hormone family consists of three a,B heterodimeric glycoproteins found in the anterior pituitary gland where they are made. The glycoprotein hormones are luteinizing hormone (also known as lutropin or LH), follicle stimulating hormone (follitropin or FSH), and thyroid stimulating -2hormone (also known as thyrotropin or TSH). The hormones from humans are known as hLH, hFSH, and hTSH, respectively. In some species, a glycoprotein hormone structurally similar to LH called chorionic gonadotropin or CG, is made by the placenta and released into the circulation. In humans, this glycoprotein hormone is termed hCG. In primates, significant quantities of all the hormones are also found as excretion products in urine. After menopause, when the secretion of LH and FSH from the anterior pituitary is greatly increased, significant quantities of LH and FSH are found in the urine. Gonadotropin extracts of urine from menopausal women are termed human menopausal gonadotropins (hMG). Unlike hCG, which interacts like LH with LH receptors but only weakly with FSH receptors, hMG interacts with both LH and FSH receptors. The dual activity of hMG is due to the presence of hLH, hFSH, and their metabolites in the urinary extract. Urines from pregnant and menopausal women are major sources of gonadotropin activities and have important commercial uses.
Gonadotropins such as FSH, LH, and, in some species, CG play a major role in the reproductive process while the structurally related hormone, TSH, is important for thyroid function Both LH and FSH are essential for puberty and normal reproductive function. Lack of sufficient FSH, LH, or hCG at appropriate times results in infertility or termination of pregnancy. Excessive amounts of these hormones can result in premature puberty or hyperstimulation of the gonads. In the male, FSH is essential for the onset and maintenance of spermatogenesis Immunoneutralization of FSH leads to a diminution in spermatogenesis and a loss in fertility. In the female, FSH is essential for follicular development leading to the production of the female gamete at ovulation.
Polycystic ovarian disease is a common cause of infertility in women and is a condition characterized by incomplete follicular development. Fertility can usually be restored by administration of FSH or hMG. Fertility can also often be restored by treatments with antiestrogens, compounds that inhibit the negative feedback effect of estrogens on FSH secretion thereby allowing FSH levels to rise. In males, LH is required for puberty and, in its absence, there is a failure to acquire the sexual attributes and fertility of an adult. LH is primarily responsible for the synthesis of androgens in the testis. These steroids have a beneficial influence on spermatogenesis and abnormally high levels of androgens can maintain spermatogenesis once it has been initiated In females, LH is essential for ovulation and formation of the corpus luteum. LH also has a synergistic influence with FSH on follicle development and is well-known to promote the synthesis of follicular androgens. These androgens serve as precursors for FSH-stimulated estrogen formation. LH may also augment the effect of FSH on granulosa cells, -3particularly in the later stages of follicle maturation when the granulosa cells have acquired LH receptors. hCG made by the trophoblast is important for maintenance of progesterone secretion from the corpus luteum during early human pregnancy.
The clinical activities of these hormones and their uses are reviewed extensively in several standard textbooks including that by Yen and Jaffe The differences in the effects of FSH and LH and the complex endocrine interactions between the two hormones cause them to have synergistic actions on follicular development and estradiol synthesis For example, normal ovarian estrogen production is due to the effect of LH on androgen formation and the influence of FSH on the conversion of androgens to estradiol. In turn, estradiol can suppress FSH secretion from the pituitary gland. During the normal menstrual cycle, FSH levels decline as the follicle enlarges and secretes increasing amounts of :i estradiol. When estradiol levels reach a sufficient amount during the follicular 15 phase, they can trigger an increase in LH secretion from the pituitary gland that causes ovulation. The ratio of LH/FSH activity as well as the absolute hormone levels in blood are important for reproductive functions such as follicle maturation and ovulation of the proper number of oocytes during the menstrual and estrus cycles.
While the secretion of both LH and FSH can be inhibited by steroid Shormones, the secretion of FSH is usually more sensitive than that of LH to negative feedback regulation by estrogens. Indeed, in many species, high levels of estrogens can increase the secretion of LH, particularly if progesterone levels are 25 low. Administration of anti-estrogens, compounds that disrupt the normal negative feedback regulation of estradiol on FSH secretion, often leads to increased FSH release and increased gamete production. Clinically, anti-estrogens are widely used to increase the probability of ovulation in women having polycystic ovarian disease.
Unfortunately, since the negative effects of estradiol on FSH secretion are partly responsible for controlling the number of follicles that develop to the point of ovulation, disruption of the normal estrogen-FSH negative feedback loop can result in inappropriate numbers of ova being shed. A mechanism that results in increased FSH secretion without eliminating the negative feedback control of FSH secretion would have a valuable use in increasing fertility.
Purified FSH is capable of stimulating follicle development in women, particularly when some endogenous LH is also present. The ratio of FSH/LH is highest at the time of the menstrual cycle when follicular development is initiated. However, both hormones are essential for fertility.
Immunoneutralization of LH leads to infertility in males and females (10-12).
Likewise immunoneutralization of CG, a hormone which acts via LH receptors was shown to block fertility in primates (13-16). Antibodies to LH have not been shown previously to stimulate fertility.
Monoclonal antibodies to hCG (termed hCG-mAb) have been shown to inhibit the binding of hCG to its receptor in vitro Depending on the location of their epitopes, hCG-mAbs have differing abilities to inhibit binding of hCG to LH receptors. B105 and B110 are examples of monoclonal antibodies that recognize epitopes on hCG and LH that remain exposed when the hormones bind to LH receptors Complexes of the hormones with these monoclonal antibodies "bind to LH receptors, albeit with lower affinity than the free hormones.
,Consequently, these antibodies inhibit binding of the hormones to LH receptors.
However, the maximal degree of inhibition observed in the presence of excess antibody is less than 100% and lower than that of antibodies which form complexes with the hormones that do not bind to LH receptors. In the presence of sufficient B105 or B110, the amount of hormone needed to induce a biological response is increased. Thus, even a massive excess of either antibody sufficient to bind *'virtually all the free hCG or LH in the assay is incapable of preventing a response to either hormone when the concentrations of the hormone-antibody complexes exceed a threshold level.
As discussed earlier, immunoneutralization of LH was shown several years ago to prevent fertility. This phenomena occurs because the antisera that 25 were used in these studies neutralized the biological activity of LH. However, when appropriate antisera or antibodies like B105 or B110 are used, the biological activity of LH is not eliminated. Rather it is reduced by a predetermined amount.
When this happens, androgen synthesis is reduced. Since androgens are precursors of estrogens, estrogen synthesis is also reduced. The decline in estradiol has a larger impact on FSH secretion than on LH secretion. The secretion of FSH will be enhanced and this will lead to an increased ratio of FSH/LH and enhanced follicular development. In females, this ratio of FSH/LH will lead to increased follicle development. In males, this ratio of FSH/LH will lead to increased Sertoli cell function and increased spermatogensis.
An approach to increasing fertility that is based on reducing LH levels has not been used previously. In part, this is due to the many reports that antibodies to LH inhibit fertility and because methods for making and selecting antibodies that reduce but do not neutralize LH activity were previously unknown.
Thus, one would not expect that this approach to fertility would be successful. As will be discussed later, this approach to increasing fertility has several advantages relative to current techniques, principly in women who make and release LH and FSH from their pituitary glands. Since reducing LH levels does not disrupt the normal endocrine feedback relationships between estradiol and FSH on pituitary function, it has a much less likely chance to induce ovarian hyperstimulation than existing techniques. This means that there will be less need for expensive and demanding patient monitoring. In addition, only one or at most a few treatments will be required to induce fertility.
Another novel method for increasing fertility is to employ an LH antagonist during the follicular phase of the menstrual cycle. For several years it is known that the oligosaccharide chains on the glycoprotein hormones are essential for their abilities to elicit signal transduction Glycoprotein hormones lacking 15 carbohydrate residues have impaired abilities to elicit a biological response. These analogs can be used to block binding of LH to its receptors. This will reduce the activity of circulating LH and thereby improve fertility. Deglycosylated gonadotropins have been found to have short biological half-lives and were found not to be useful for their original intended use, namely to inhibit fertility by reducing luteal progesterone synthesis and causing abortion. By moving the carbohydrate residues to alternate portions of the hormone by removing glycosylation signals the amino acid sequences Asparagine-X-Threonine or Asparagine-X-Serine, where X is any amino acid except Proline) from one site and by creating glycosylation signals at alternate sites of the a- and B-subunits, it is 25 possible to design analogs with reduced agonist activity that have sufficiently long half-lives to be useful. In addition, by preparing single chain gonadotropins in which the a- and B-subunits are covalently linked, it is possible to increase the stability of the hormones in circulation. This is because the receptor binding activities and the plasma half-lives of the heterodimeric gonadotropins are greater than either of the subunits. Covalent linkage prevents the dissociation of the two subunits in circulation.
While stimulation of fertility is important to restore fertility to infertile couples, inhibition of fertility is often desirable as a method of family planning. In addition, inhibition of fertility would be useful in the commercial production of livestock since it would eliminate the need for castration or it would prevent the development of heat in cattle held in the feedlot. Inhibition of fertility in other animals including dogs and cats would also be desirable as a replacement for spaying or castrating them. Inhibition of fertility in horses would also be preferable to gelding, particularly if it can be reversed. As noted above, fertility can be inhibited by administration of neutralizing antibodies to LH or FSH. It can also be inhibited by using a vaccine to induce the formation of these antibodies.
Due to the action of hCG in maintaining pregnancy, treatments that lead to diminished hCG secretion or activity would also be expected to cause infertility. In women, it would be more desirable to inhibit fertility by inhibiting hCG rather than hLH or hFSH. This is because treatments that neutralized hLH or hFSH would cause cessation of ovarian function and hasten the onset of problems associated with menopause. In cattle and other domestic animals, it would be more important to inhibit LH to prevent puberty or to disrupt heat. As noted earlier, appropriate antibodies to chorionic gonadotropin are able to inhibit fertility in primates and women and the development of antibodies to hCG has been recognized to be an important potential method of contraception for many years Since hCG is produced by a large number of human cancers and since antibodies to hCG can 15 disrupt these tumors, immunization would also have a beneficial impact on cancer therapy or prevention (19).
Several attempts have been made to devise such an hCG-based contraceptive vaccine taking into account the differences between hCG and the other glycoprotein hormones (14,18). Unfortunately, development of the vaccine has been hampered by the structural homologies between all the glycoprotein hormones. The preferred immunogen must be highly antigenic yet not induce antibodies that crossreact with the other glycoproteins such as human FSH, LH, or TSH. Based on the knowledge of glycoprotein hormone activities outlined above, a vaccine that induced antibodies that interacted with LH, FSH, or TSH would also cause infertility and/or inhibition of thyroid function. Unfortunately, neutralization of LH or FSH would also result in cessation of normal menstrual cycles and the loss of estrogen production that is associated with fertility in women. Termination of ovarian function would be likely to result in premature development of osteoporosis and other problems associated with menopause. Inhibition of thyroid function would lead to hypothyroidism. Similarities in the structures of hCG and hLH have made it particularly difficult to design an appropriate immunogen that does not generate crossreacting antibodies. Most efforts have been devoted to making antibodies against the unique C-terminus of the hCG -subunit since this portion of the molecule is not found in hLH However, this region is not very antigenic. Efforts to devise immunogens have also employed peptides obtained from the B-subunit conjugates of the B-subunit with other proteins or heterodimers containing hCG B-subunits conjugates, and ovine a-subunits (18).
Unfortunately, most of these immunogens are not very effective and a better immunogen is needed to make this method practical.
The difficulty of devising a vaccine based on hCG can be appreciated by an understanding of the structures of the glycoprotein hormones. All of the glycoprotein hormones contain a common a-subunit. While the conformation of parts of the a-subunit differ in all the hormones and can be recognized by selected monoclonal antibodies portions of the a-subunit have the same conformation in each glycoprotein hormone. Thus, many antibodies to the a-subunit recognize LH, FSH, hCG, and TSH. Since anti-a-subunit antibodies are often capable of blocking the activities of the hormones an immunogen which induced a response to the a-subunit is likely to have unwanted side effects. Therefore, most strategies for devising a contraceptive vaccine are directed at the hormone specific B-subunit of hCG.
The B-subunit of hCG is most closely related to the B-subunit of hLH. Many antibodies directed against the intact hCG B-subunit will also combine with the LH B-subunit. While the B-subunits of the other hormones differ considerably from that of hCG, some of the residues in all the B-subunits are identical and there is the possibility, albeit small, that some anti-B-subunit antibodies will crossreact with these hormones as well. The carboxy terminal 31 amino acids of the hCG B-subunit (CTP) are unrelated to any of the residues in the other glycoprotein hormones. In theory, antibodies to this region cannot elicit any crossreaction with the other hormones. As expected, when this region is used as an 25 immunogen, antibodies are developed that do not crossreact with any of the other glycoprotein hormones. Unfortunately, the antibodies that are produced to synthetic CTP peptides do not bind with high affinity to hCG. In part, this is due to the observation that this region of hCG contains four potential serine-linked glycosylation sites and is highly glycosylated. Furthermore, much of this region of hCG is not essential for interaction with LH receptors. Thus, the antibodies directed against the CTP of hCG bind to hCG receptor complexes and are primarily of the nonneutralizing type. Consequently, they do not inhibit hCG action similar to antibodies like B101 (22) that prevent hCG from binding to LH receptors.
Efforts have also been made to devise antibodies against other portions of the hCG B-subunit. One region that has been investigated extensively is that found between cysteine residues 38 and 57. This portion of the protein is known to form a large loop and studies have shown that this loop is capable of stimulating steroidogenesis (23,24). Thus, one would anticipate that antibodies against this loop would be of the neutralizing type. Indeed, B101, an antibody which has been shown to recognize residues within this loop (22,25,26) is capable of neutralizing hCG activity. The problem with using this loop structure is that the antibodies that are produced are often of low affinity. In addition, since hCG and hLH are similar in this region of the molecule there are only three amino acids that differ), immunization with this loop is expected to cause the production of antibodies against hLH. Indeed, B101, an antibody that binds to this region of the molecule has an unacceptably high affinity for hLH.
Recent efforts at identifying the tertiary structure of the glycoprotein hormones have depended on characterizing the binding sites of panels of monoclonal antibodies Antibodies have been identified that prevent the biological activity of hCG or that only partially neutralize its biological activity. As outlined in example 7 of the present specification, these and similar antibodies can 15 be used to devise immunogens that have the potential to neutralize hCG but not hLH using the positive and a negative selection procedure outlined in examples 6 and 7 set out below. While the hormone has been crystallized and a crystal structure would be valuable in determining the types of immunogens that would S: give a high titer immune response to particular parts of the molecule, difficulties in solving the crystal structure have precluded this approach. Thus, at the present state of the knowledge of hCG structure, there is no good method that could be used to predict the type of immunogen that would be most effective.
Another useful method for increasing fertility is to increase the levels 25 of FSH activity. One way of accomplishing this is to administer small doses of long-acting follitropins. These can be made by coupling molecules with follitropin activity to molecules with long plasma half-lives immunoglobulins) or by preparing single-chain gonadotropin analogs having follitropin activity (Tables 1 and Alone, or in combination with antibodies to LH and/or LH antagonists, these hormones facilitate follicle development in women with polycystic ovarian disease.
BRIEF DESCRIPTION OF THE FIGURES Figure 1 is a graph illustrating the influence of antibodies and antisera on the binding of radiolabeled hLH to LH receptors.
-9- Figure 2 is a graph illustrating the influence of antibodies and antisera on the ability of hLH to induce steroidogenesis in vitro.
Figure 3 is a graph illustrating the influence of antibodies and antisera on the ability of hLH to induce steroidogenesis in vivo.
Figure 4 shows vectors that can be used in template/exclusion selection strategies.
Figure 5 shows the types of immunogens that have increased antigenicity for use in active immunization against LH, hCG, or FSH.
Figure 6 illustrates the coding sequence for single chain gonadotropin analog #1 and primers (underlined).
Figure 7 illustrates the coding sequence for single chain gonadotropin analog #2 and primers (underlined).
Figure 8 illustrates the coding sequence for single chain gonadotropin 20 analog #3 and primers (underlined).
Figure 9 illustrates the coding sequence for single chain gonadotropin analog 4 and primers (underlined).
q S 9 r.
C. i ci Figure 10 illustrates the coding gonadotropin analog #5 and primers (underlined).
Figure 11 illustrates the coding gonadotropin analog #6 and primers (underlined).
Figure 12 illustrates the coding gonadotropin analog #7 and primers (underlined).
Figure 13 illustrates the coding gonadotropin analog #8 and primers (underlined).
sequence for single chain sequence for single chain sequence for single chain sequence for single chain Figure 14 illustrates the coding sequence gonadotropin analog 9 and cassette (underlined).
for single chain Figure 15 illustrates the coding sequence for single chain gonadotropin analog and cassette (underlined).
Figure 16 illustrates the preparation of an alpha-subunit coding region lacking oligosaccaride signal sequences.
Figure 17 illustrates the preparation of a beta-subunit coding region lacking asnlinked oligosaccaride signal sequences.
Figure 18 illustrates the coding sequence for single chain gonadotropin analog #la.
SUMMARY OF THE INVENTION According to a first aspect the present invention consists in a DNA or RNA molecule that encodes a single-chain protein which is an agonist or antagonist of a hormone selected from the group consisting of luteninizing hormone follicle stimulating hormone (FSH), and chorionic gonadotropin (CG) which single-chain protein has an amino acid sequence of the formula p-(linker)-a or 15 cc-(linker)-P wherein p is the p subunit of LH, FSH or CG or a variant thereof; *"linker" refers to a peptide linker containing 1-16 amino acids; and a represents the amino acid sequence of the a subunit common to LH, FSH and CG or a variant thereof.
20 According to a second aspect the present invention consists in an expression system when used for the production of a single-chain protein which is an agonist or antagonist of a hormone selected from the group consisting of luteninizing hormone follicle stimulating hormone (FSH), and chorionic gonadotropin (CG) which -11single-chain protein has an amino acid sequence of the formula 3-(linker)-ac or ac-(linker)-3 wherein 13 is the 13 subunit of LH, FSH or CG or a variant thereof; "linker" refers to a peptide linker containing 1-16 amino acids; and ac represents the amino acid sequence of the ac subunit common to LH, FSH and CG or a variant thereof which expression system comprises a first nucleotide sequence encoding said single-chain protein operably linked to control sequences capable of effecting the expression of said first nucleotide sequence.
According to a third aspect the present invention consists in the expression system of the second aspect which further contains a second nucleotide sequence encoding a signal peptide operably linked to the protein encoded by the first nucleotide sequence.
i According to a fourth aspect the present invention consists in recombinant host 15 cells modified to contain the expression system of the second or third aspects.
According to a fifth aspect the present invention consists in a method to produce a single-chain protein which is an agonist or antagonist of a hormone selected from the group consisting of LH, FSH and CG which method comprises culturing the cells of the fourth aspect under conditions wherein said protein is produced and 20 optionally recovering the protein from the culture.
20 optionally recovering the protein from the culture.
-12- According to a sixth aspect the present invention consists in a single-chain protein which is an agonist or antagonist of a hormone selected from the group consisting of LH, FSH and CG produced by the method of the fifth aspect.
According to a seventh aspect the present invention consists in a single-chain protein which is an agonist or antagonist of a hormone selected from the group consisting of luteninizing hormone follicle stimulating hormone (FSH), and chorionic gonadotropin (CG) which single-chain protein has an amino acid sequence of the formula P-(linker)-a or 10 a-(linker)-p wherein p is the 3 subunit of LH, FSH or CG or a variant thereof; "linker" refers to a peptide linker containing 1-16 amino acids; and a represents the amino acid sequence of the a subunit common to LH, FSH and CG or a variant thereof.
Preferably, the DNA or RNA molecule of the first aspect encodes a single-chain protein with a formula as set forth in Table 1 or wherein p is the P-subunit of chorionic gonadotropin, a is a vertebrae a-subunit, and the linker contains 1-16 amino acid residues.
Preferably, the expression system of the second aspect encodes a single-chain protein with a formula as set forth in Table 1 or wherein p is the p-subunit of chorionic gonadotropin, a is a vertebrae a-subunit, and the linker contains 1-16 amino acid residues.
-13 Preferably, the recombinant host cells of the fourth aspect encode a single-chain protein with a formula as set forth in Table 1 or wherein P is the P-subunit of chorionic gonadotropin, a is a vertebrae a-subunit, and the linker contain 1-6 amino acid residues.
Preferably, the method of the fifth aspect produces a single-chain protein with a formula as set forth in Table 1 or wherein P is the p-subunit of chorionic gonadotropin, a is a vertebrae a-subunit, and the linker contains 1-16 amino acid residues.
Preferably, the protein of the seventh aspect having a formula as set forth in Table 1 or wherein P is the P-subunit of chorionic gonadotropin, a is a vertebrae asubunit, and the linker contains 1-16 amino acid residues.
10 Unless the context clearly requires otherwise, throughout the description and the o• claims, the words 'comprise', 'comprising', and the like are to be construed in an inclusive sense as opposed to an exclusive or exhaustive sense; that is to say, in the sense of "including, but not limited to".
DETAILED DESCRIPTION OF THE INVENTION 15 The present invention relates to methods for enhancing fertility by reducing the activities and/or levels of circulating glycoprotein hormones having lutropin (LH) activity. The molecules of the invention are antibodies or other binding agents that reduce the biological activities of LH. The binding agents can be administered or produced in response to immunization. Since molecules with lutropin activity are essential for fertility, blocking their activities would be expected to decrease rather than increase fertility. However, lutropins are usually 14found to enhance the production of steroids that can reduce the secretion of follitropins (FSH), hormones that have important roles in fertility. Consequently, reduction in the activities of lutropins leads to an increase in the levels of follitropins and/or the ratios of follitropin/lutropin. When LH activity is reduced but not abolished, the increase in FSH activity and/or the ratio of FSH/LH leads to enhanced production of gametes and elevated fertility in humans and animals. The present invention also relates to novel methods for devising and/or selecting antibodies to specific portions of proteins including LH and human chorionic gonadotropin (hCG) to permit their biological activities to be reduced to desired degrees. Examples are presented herein illustrating how to devise antibodies and immunogens against specific portions of selected gonadotropins, including those antibodies and immunogens that are very similar in structure. Some of these 0 antibodies and immunogens will have uses for suppressing fertility and other 9. antibodies and immunogens will have uses for enhancing fertility.
The present invention also relates to the preparation of molecules which can bind to LH and FSH receptors and have either fertility enhancing or fertility inhibiting actions depending on the time of administration. Some of these are molecules that will bind to LH receptors and block the action of LH. When S 20 these are administered in the follicular phase, they will suppress LH activity thereby suppressing androgen and estrogen secretion. Consequently, FSH levels will rise and fertility will be enhanced. When they are given after ovulation during the to luteal phase of the menstrual cycle, they will suppress the activity of hCG and cause pregnancy to terminate. Other molecules bind to FSH receptors and have FSH *4 25 activity. These are long acting analogs of FSH and when given in small amounts, they will stimulate follicular maturation. Because they will stimulate estrogen synthesis, the estrogen levels will rise and the secretion of pituitary FSH levels will fall. Provided these are administered in limiting amounts, they will not induce ovarian hyperstimulation. These will also have direct effects on stimulating fertility in males. In addition, the present invention relates to the preparation of molecules that have the ability to inhibit the actions of FSH and both FSH and LH. These molecules will be useful for treating women who have hyperactive ovarian tissue, often as the result of gonadotropin therapy. Hyperstimulation of the ovary is potentially fatal and these analogs bind to FSH receptors or to both FSH and LH receptors to suppress further ovarian development.
In accord with the present invention, methods are provided to improve fertility in humans and animals by the novel method of inhibiting the activity of lutropin using passive or active immunization. Previous studies have shown that blocking the actions of LH will lead to inhibition of fertility. Here it is shown that appropriate LH antibodies can be used to restore or stimulate fertility.
This approach should reduce the risk of hyperstimulation and permit a more normal regulation of fertility with less monitoring. Several methods are provided for producing and testing the antibodies or antisera needed to promote fertility.
Other methods are available to alter the FSH/LH ratio including methods of administering FSH or giving antiestrogens. However, the procedure outlined here based on the use of anti-LH has important advantages over these other methods. The degree of maximal inhibition can be carefully determined for each antibody by in vitro testing. Thus, regardless of the amount of antibody administered, one could prevent inhibiting the activity of LH below a predetermined level by appropriate choice of antibody. For example, B105 would reduce the effective hLH levels by a factor of approximately 4 whereas B110 will 15 reduce the effective hLH levels by a factor of approximately 2. Reducing LH levels will permit FSH levels to rise. As FSH levels rise, they will cause follicular development and the production of estrogens. When these levels have reached the physiological concentrations characteristic of appropriate follicle development, they will negatively inhibit the secretion of more FSH. Thus, the treatment described here retains the valuable aspects of self-regulation that are missing in existing methods that depend on administration of FSH or anti-estrogens to stimulate ofertility. Furthermore, unlike ovulation induction with GnRH (gonadotropin releasing hormone) or GnRH analogs, the method based on anti-LH does not require the pulsatile infusion of a hormone or hormone analog. This treatment offers the potential advantage of a single or at most a few treatments over several days. This will be particularly important in regulating ovulation in humans or animals. In humans, this method should be most appropriate for treatment of polycystic ovarian disease which is often characterized by inappropriately high levels of LH. As LH levels are reduced, FSH levels will rise and follicle development will occur. However, as follicle development occurs, the rising levels of estrogens will block the secretion of additional FSH. Thus, the tendency to promote the development of too many follicles with its dangerous potential consequences will be minimized.
Methods are also provided here for producing a specific immunogen which is based on use of template and exclusion antibodies. Use of these antibodies will enable one to devise a specific immune response to particular domains of a protein. This method will have uses in inducing or inhibiting fertility as illustrated here. Since antibodies against hCG can inhibit tumor growth, this method should 16also be useful to devise vaccines needed to inhibit development or progression of hCG-secreting tumors. The method should also have use in any system in which a specific immunogen is needed.
There is nothing unique about the structure of antibodies which makes them useful for inducing fertility other than the fact that they bind hLH or other LH. Thus, one would expect that portions of antibodies which retain the ability to bind LH would also have similar activity. These would include Fab fragments, (Fab') 2 fragments, single chain antibodies, or any molecule that bound to hLH or LH which reduced its biological activity. The Fab fragment is a portion of an antibody that contains the antigen binding site and is generated by papain digestion. The F(ab') 2 fragment is a portion of an antibody that contains two antigen binding sites and is generated by pepsin digestion.
15 Preferably, the methods for enhancing fertility are carried out during the follicular phase of the mammal, and more preferably during the follicular phase of the menstrual cycle.
The glycoprotein hormone to be regulated in the present invention is a reactant in a reaction between binding counterparts. The binding counterparts are proteins which have a specific binding affinity for each other. One binding counterpart is a bindable agent which is selected from the group consisting of an antigen and a hapten. The preferred bindable agent is an antigen. The other binding counterpart is a binding agent which is selected from the group consisting 25 of an antibody and a specific binding protein. The preferred binding agent is an antibody.
Antigens are substances which are capable under appropriate conditions of inducing the formation of antibodies and of reacting specifically in some detectable manner with the antibodies so induced. Antigens may be soluble substances, such as toxins and foreign proteins, or particulate substances, such as bacteria or tissue cells. In general, antigens are high molecular weight substances such as simple and conjugated proteins and carbohydrates.
Antibodies are immunoglobulin molecules which have a specific amino acid sequence which permit it to interact only with the antigen which induced its synthesis in lymphoid tissue or with an antigen closely related to that antigen.
Immunoglobulins are proteins made up of two light chains and two heavy chains.
17- The binding agent may also be a specific binding protein such as an unattached receptor protein or a transport protein. Receptor proteins include proteins which remain attached to cells such as antibodies and unattached proteins which are released to blood serum and retain their specific binding affinity.
Transport proteins are proteins that move substances in and out of cells and across epithelial layers in biological systems.
The binding agents may be substances from natural sources or may be substances prepared by synthetic or recombinant means. In a preferred embodiment, the bindable agent is an antibody selected from the group consisting of recombinant proteins and synthetic peptides.
S
The compounds of the present invention can be administered to mammals, animals or humans, in amounts effective to provide the desired activity. Since the activity of the compounds and the degree of the desired therapeutic effect vary, the dosage level of the compound employed will also vary.
The actual dosage administered will also be determined by such generally recognized factors as the body weight of the patient and the individual hypersensitiveness of the particular patient. Thus, the unit dosage for a particular patient (man) can vary from as low as about 0.l 1g per kg of body weight, which the practitioner may titrate to the desired effect. A preferred minimum dose for titration is lttg/kg body weight.
The present invention is further illustrated by the following examples "00* 25 which are not intended to limit the effective scope of the claims. All parts and percentages in the examples and throughout the specification and claims are by weight of the final composition unless otherwise specified.
EXAMPLES
Binding agents that reduce the biological activities of luteinizing hormone and human chorionic gonadotropin to permit their biological activities to be reduced to desired degrees.
Example I Use of anti-LH antibodies to induce fertility 18- Because some anti-hormone antibodies inhibit the biological activity of the hormones either by preventing the hormone from binding to receptors or by increasing its metabolism, they will be useful for reducing the level of active hormone in circulation. Antibodies to LH are capable of increasing the ratio of biologically active FSH to LH in circulation. In part, this is because they reduce the activity of LH. In addition, since LH is a hormone that stimulates the synthesis of steroid substrates that can be converted to estrogens the decline in LH activity will be accompanied by a decline in estrogens. The decline in estrogen levels will reduce the inhibition of FSH secretion and levels of FSH will rise. As a consequence, in the female, follicular development will be enhanced. In the male, spermatogenesis will be augmented. Not all antibodies have the ability to reduce LH levels in a nonneutralizing fashion. Antibodies that neutralize the actions of LH completely will curtail fertility unless administered in a limiting fashion the total amount of antibody given is less than the total amount of circulating LH).
S 15 Nonneutralizing antibodies are preferred for enhancing fertility since they can be given in excess of the total amount of LH. Thus, even although most LH may be bound to the antibodies, the LH activity is reduced but not neutralized. Because there is more than sufficient LH for follicle development, the partial reduction in LH activity does not prevent follicle development. In addition, the increased 6 20 estrogens that are made as the follicle increases its development will mimic the normal feedback control of FSH secretion to prevent ovarian hyperstimulation.
Administration of 10 xg 10 mg of high affinity antibody Ka 5 x 10 7
M
1 will be sufficient to induce fertility in women having polycystic ovarian disease.
Identification and characterization of appropriate antibodies is illustrated in example 25 2.
0 Example 2 Identification and selection of the best LH antibodies Not all antibodies that inhibit LH activity will be equally useful for treatment of infertility. For example, high excess concentrations of antibodies like B101 that bind to hCG and LH (albeit with lower affinity) can prevent the hormones from binding to LH receptors When present in excess, antibodies that prevent binding of LH or hCG to its receptors "neutralize" the biological activity of the hormone. While neutralization of LH would be followed by a decline in androgen and estrogen levels and a rise in FSH levels, since LH is needed for fertility, the reduction of LH activity below the minimal level needed for fertility would prevent fertility as long as an excess of the antibody was present.
19- Indeed, neutralizing antibodies or antigens that elicit the production of neutralizing antibodies have been shown to inhibit fertility in animals It would be possible to administer limited amounts of neutralizing antibodies to reduce LH concentrations to a predetermined level or to reverse the inhibitory effect of a neutralizing antibody by adriiinistering an anti-idiotypic antibody. However, due to the variations between individuals it would be difficult to determine how much antibody would be needed to obtain the desired effect unless nearly complete inhibition of LH activity were desired or unless measurements of FSH and/or gonadal function determining plasma steroid levels) were performed. While these are feasible, the need to make these measurements reduces the attractiveness for using antibodies that completely neutralize LH activity to augment fertility.
:Neutralizing antibodies could also be given to prevent the action of LH temporarily until FSH levels had risen. Then the excess neutralizing antibody could be removed by administration of an anti-idiotypic antibody to neutralize anti-LH 15 antibodies to restore fertility or by overcoming the effect of the antibody using LH or CG or by using an amount of antibody that would be sufficiently degraded to permit the action of the LH midcycle surge. However, this approach is more complex than use of nonneutralizing antibodies, illustrated below.
The preferred antibodies inhibit the activity of LH but fail to completely block its action even when given at concentrations sufficient to bind all the LH present in circulation. These antibodies are usually capable of binding to S the free hormone as well as to hormone-receptor complexes. They inhibit hormone action by lowering the affinity of the hormone for its receptor, reducing the activity of bound hormone, and/or increasing hormone clearance. Examples of such C• antibodies include B105 and B 10. These antibodies reduce the biological activities of the hormones to different extents (17) and can be purchased from Columbia University, New York, NY or UMDNJ-Robert Wood Johnson Medical School, Piscataway, NJ. Other commercially available antibodies include 518B7 (available from Dr. Janet Roser, University of California at Davis, Davis, CA) and ZMCG7 (available from Pierce Chemical Co., 3747 North Meridian Road, Rockford, IL).
Because complexes of these antibodies with hCG can bind to receptors, the degree of inhibition is limited even in the presence of a massive antibody excess. The amount of inhibition can be determined from simple in vitro assays prior to their use in vivo. For example, a massive excess of B110 was shown to reduce the activity of hCG by only about half whereas a massive excess of B105 reduced the activity of hCG by about three-quarters. Each of these antibodies binds to hLH and would be expected to have the same influence on hLH activity.
The identification of appropriate antibodies from a panel of monoclonal antibodies made against hLH can be made as follows. These antibodies can be obtained by standard procedures (22,27-32) by immunizing mice with hLH, hCG, or LH from other species, LH or hCG fragments, partially or fully deglycosylated LH or hCG, or LH or hCG analogs capable of eliciting an immune response to the desired species of LH. These antibodies could also be obtained by selection of manmade antibodies (33-36). This same strategy could be used to identify antibodies to LH from virtually any other species. It could also be used to identify antisera which have similar properties. These antisera could be made in response to LH or hCG analogs or they could be obtained by immunoadsorption or removal of undesirable antibody components.
"n Antibodies having the desired inhibitory characteristics can be identified by measuring their abilities to inhibit the binding of LH to LH receptors.
15 This type of assay can be performed by one skilled in the art of measuring receptor binding and the following example refers to how one would select for antibodies to hLH. Clearly, this would also be applicable to any species of LH for which antibodies were available. Since hLH binds well to rodent LH receptors, one need -not use human LH receptors in the assay, although human LH receptors would also 20 work. A simple first step is to monitor the influence of the antibody on the binding of radiolabeled hLH to rat ovarian luteal LH receptors. The radiolabeled hLH can be prepared by incubating 10 /g hLH with 500 JCi of Na 125 I for 30 seconds at 4°C in a small glass tube that has been coated with 1.5 jAg lodo-Gen (Pierce Chemical 12 5 I-hLH and unreacted 125I are separated by gel filtration. The 25 receptors can be prepared by administering 50 IU of pregnant mares serum gonadotropin also known as PMSG or equine CG (obtained from Sigma Chemical Co., St. Louis MO) to female Sprague-Dawley rats that are 23-26 days old. The PMSG stimulates follicle development. Approximately 56-65 hours later the animals are given 25 IU of hCG (also obtained from Sigma Chemical Co.) to cause the formation of corpora lutea. The highly luteinized ovaries are removed one week later and homogenized in a buffer containing 40 mM Tris (pH 7.4) and 5 mM MgCl 2 A crude nuclear and membrane fraction of the homogenate is collected by centrifuging the homogenate at 1000 x g for 20 minutes at 4"C. This is washed once by resuspending it in the Tris MgCl 2 buffer and resedimenting it at 1000 x g for 20 minutes at 4 0 C. The final pellet (termed the "ovarian homogenate pellet") is resuspended in the Tris MgCl 2 buffer using a volume of 2 ml per each ovary present at the start of homogenization. An amount of ovarian homogenate pellet approximately equal to 1/20 of an ovary roughly 5 mg of material in 100 l of buffer) is added to tubes that contain approximately 1-2 ng radioiodinated hLH -21 approximately 100,000 cpm) and differing amounts of antibody ranging from 1 pg to 10 Ag or more). After the tubes have incubated sufficient time to permit the radiolabeled LH to bind to the receptors 30-60 min at 37"C or overnight at room temperature), the receptor bound and free radiolabels are separated by diluting the reaction mixture to 2 ml with 0.9% NaCI solution, centrifuging the mixture, and aspirating the supernate. The amount of radiolabeled hLH bound to rat ovarian LH receptors is determined by analyzing the pellet in a gamma counter. One would expect to observe the types of inhibition shown in Figure 1. Some antibodies will completely inhibit the binding of radiolabeled hLH to the same extent as a massive excess of unlabeled hLH or hCG whereas others will not inhibit binding or may even potentiate binding when present in vast molar excess relative to radiolabeled hLH. Both these types of antibodies are less desirable than those antibodies which suppress hLH binding to an intermediate level Figure Thus, the most useful antibodies will inhibit the binding of the 15 radiolabeled LH but not to the same extent as a massive excess of unlabeled LH.
Antibodies that inhibit the binding of radiolabeled LH to the same extent as a massive excess of unlabeled LH will also be useful but greater care will be needed to be certain that the antibody will not suppress LH activity too much when used in vivo. If too much LH activity is neutralized in the LH surge, infertility will result.
Another useful procedure to identify antibodies having the desired ability to reduce LH activity is to perform an in vitro test to determine if the antibodies inhibit the effect of hLH on steroid biosynthesis. In this assay one can utilize testes from male rodents. A typical example using hLH is illustrated in 25 Figure 2. A crude rat Leydig cell suspension is prepared using collagenase as described (37) and the cells are incubated with varying amounts of LH and the antibodies to be tested. After approximately 2-4 hours at 37"C, the testosterone content in the tubes is measured by radioimmunoassay. When increasing concentrations of hLH are incubated with the Leydig cells, they cause enhanced production of testosterone and will give rise to a typical dose response curve in which hLH concentrations of 1-10pM will be sufficient to elevate steroid production by approximately 50% of the maximal level (see Figure 2, curve A).
The most useful antibodies are identified by their abilities to inhibit LH induced steroidogenesis. When different monoclonal antibodies are added to LH before the hormone is added to the cells, some will be found to reduce the ability of LH to stimulate testosterone formation. The most useful inhibitory antibodies will shift the dose response curve to less sensitive values (see Figure 2, curves B and C).
While the degree of the shift will initially be dependent on the concentration of antibody, a massive excess of antibody more than 100-fold greater than the -22maximal amount of hLH used) will not prevent LH-induced testosterone formation.
The least useful antibodies will prevent the stimulation of testosterone formation when the antibody is present in 100-fold molar excess (see Figure 2, curve D).
This type of assay will detect antibodies that inhibit LH activity by reducing its binding to LH receptors and it will also detect antibodies that inhibit the activity of bound LH. Examples of useful antibodies include B05, B110, 518B7, and ZMCG7, noted above. These will need to be modified as described below before they can be used repeatedly in women.
Once antibodies or antisera have been selected and found to satisfy the criteria described above and illustrated in Figures 1 and 2, they should be tested for their abilities to inhibit the actions of LH in vivo. Male rats are given a large excess of antibody 100 g or more). Twenty minutes later some of the rats are treated with vehicle alone (control) and others are given hLH or LH similar or 15 equal in structure to that from the animal for which the antibody is to be used. One hour later, the plasma testosterone levels are measured by radioimmunoassay.
A
typical example is illustrated in Figure 3. The most useful antibodies or antisera will reduce the potency of hLH but will not prevent its activity even when present ,in excess of the total amount of LH given. This assay will detect antibodies that 20 reduce hormone activity by inhibiting LH binding to receptors, inhibiting the activity of bound LH, and/or increasing LH clearance. Regardless of the cause of inhibition in vivo, the most useful antibodies or antisera will not prevent the activity of high levels of LH even when they are present in excess of circulating LH. This can be monitored by measuring the ability of the serum to bind radioiodinated hLH 25 after administration of the antibody. A serum sample (0.01 1 l1) is diluted to l with a solution containing 0.9% NaC1, 1 mg/ml bovine serum albumin, and 0.02 M sodium phosphate buffer (pH To this is added 25 pl of radioiodinated LH (approximately 50 nCi containing approximately 1 ng). The resulting solution is incubated 30 minutes at 370 C. A goat antimouse immunoglobulin G (IgG) solution (available from Cappel, Organon Teknia Corp, West Chester, PA) containing 2 Mg IgG in 50 /l of the NaCl-albumin solution described above is added and the resulting solution incubated 90 minutes at 37* C. or overnight at 4° C. To this solution is added 100 il of 1% IgGsorb (obtained from The Enzyme Center, Inc., 36 Franklin St., Malden, MA) reconstituted in water. This suspension is mixed for 30 minutes at 220 C and then diluted by addition of 3 ml of the NaClalbumin solution that is ice cold. The mixture is centrifuged for 10 minutes at 2000 x g at 4* C. The supernate is aspirated and radioactivity in the pellet is measured in a gamma counter. As a negative control, one uses serum from an animal that has not been actively or passively immunized. As a positive control, one uses 0.1 1 -23ng of the antibody that was originally injected into the animal. The radioactivity measured in the pellet from the negative control is subtracted from that in the positive control and from that in pellets of the serum samples that are being tested.
When the resulting values for the postive control and the serum samples are compared, serum that contains antibody in excess of LH will be able to immunoprecipitate at least 1%-10% of the radioiodinated LH as the positive control.
Administration of antibodies to hLH in humans will reduce the effective concentrations of circulating LH. The maximum amount of reduction depends on the location of the binding site of the antibody on LH. Reduction in LH activity lowers the secretion of ovarian and testes hormones and thereby reduces the feedback inhibition of FSH. Consequently, FSH levels rise and fertility is enhanced. Antibodies to hLH that crossreact with LH from other species or 15 antibodies that have been selected for their abilities to bind to LH from other species and reduce but not abolish hormone activity will have similar effects in the other species. The most appropriate antibodies for use in humans will be those that have framework and constant regions that are similar to human immunoglobulins and that are themselves not antigenic or only weakly antigenic when injected into humans. Suitable antibodies can be prepared by "humanizing" mouse monoclonal antibodies replacing the mouse framework and constant regions with similar sequences found in human immunoglobulins. Procedures to accomplish this are well-known in the art (38-40). Other methods of making suitable antibodies include immunization of primates such as the Cynomolgus monkey (41) followed by 25 isolating and cloning of single lymphocytes The immunoglobulins in these primates have similar framework regions as human immunoglobulins. Monoclonal antibodies prepared from these animals should serve as a good starting point for antibodies that can be used in humans.
Example 3 Alternative methods for obtaining and selecting desired antibodies Many antibodies that are capable of partial inhibition of hLH activity have a propensity to bind to hLH or other LH molecules that have been adsorbed to plastic or other surfaces. Therefore, screening for desired antibodies is often facilitated by monitoring the abilities of the antibodies to bind to hLH or other LH that is adsorbed to plastic microtiter plates or to LH that is bound to LH receptor complexes. Screening for antibodies that bind to hLH that is adsorbed to a plastic -24surface can be accomplished as follows. The wells of a plastic microtiter plate are coated with 50 pl of a solution containing 0 or 1 pg hLH in 0.9% NaCI 0.02 M sodium phosphate buffer (pH This enables the hLH to be adsorbed to the surface of the microtiter plate. After 1 hour at 37 0 C, the solutions are removed and replaced with 200 C1 of 0.9% NaCI 0.02 M sodium phosphate buffer (pH 7.2) containing 200 pg bovine serum albumin for longer than 1 hour at 37*C. This fills most of the remaining adsorption sites. The albumin solution is removed and replaced with 50 0pl of 0.9% NaCl 0.02 M sodium phosphate buffer (pH 7.2) containing 50,000 100,000 dpm of the test monoclonal antibody labeled with 125I. Labeling of the monoclonal antibody is performed using lodo-Gen or other oxidizing agent (22,43) as described above for LH using 10 pg of antibody and 500 pCi of Na 12 5 I except that the reaction time is extended to 1-5 minutes. After S"1 hour at 37*C, the fluid is removed and the radioactivity that is attached to the surface of the microtiter plate is measured in a gamma counter. Antibodies that 15 have a high probability of being useful for inhibiting hLH activity will be found to be bound to the wells coated with hLH in amounts greater than those to the wells not coated with hLH. This assay will also detect other types of antibodies as well and a further screen of the positive antibodies should be performed as outlined below or as in example 2.
While binding to LH-receptor complexes does not quarantee that an antibody will be useful for partially neutralizing LH activity, many of the preferred antibodies bind to LH-receptor complexes. Thus, it is possible to initially screen for desirable antibodies by measuring their abilities to bind to LH-receptor 25 complexes. This assay is essentially the same as the Bio-IRMA that has been described previously (44) and can be performed in a sequential or simultaneous fashion. In the simultaneous Bio-IRMA, 0.025pCi 0. 1pCi of the radioiodinated test antibody prepared as described above) is added to a rat ovarian homogenate prepared as described above), and increasing amounts of LH including 0, 0.01, 0.1, 1.0, 10, 100, and 1000 ng. After 1 hour at 37*C, the membraneous part of the homogenate is sedimented into a pellet by centrifugation at 1000 x g for 10-20 minutes, the supernate is aspirated, and the radioactivity in pellet determined in a gamma counter. Antibodies that bind to LH receptor complexes will be detected by their increased ability to bind to membranes incubated with at least one of the LH concentrations over the assay blank no LH added). In the sequential Bio-IRMA, the membranes are incubated with the LH first for 1 hour at 37°C, washed by centrifugation and aspiration as described above and then incubated with 50,000 100,000 dpm of radioiodinated antibody. After an additional 1 hour incubation at 37°C, the bound and free antibody fractions are separated by centrifugation and aspiration as described above and the pellet is counted in a gamma counter. Most useful antibodies will bind to the LH-receptor complexes. However, this procedure is only a useful screening method and a more conclusive test of an antibody involves use of an in vitro biological assay such as that based on testosterone formation that is described in Example 2.
The propensity of the most useful antibodies to bind to surfaces that contain LH or to complexes of LH and LH receptors can also facilitate isolation of lymphocytes following immunization of monkeys or mice using a panning procedure. In this procedure, lymphocytes are added to plastic surfaces that have been coated with human serum albumin or other protein that prevents nonspecific binding by exposing them to solutions containing 1 mg/ml of human serum albumin in 0.9% NaCI 0.02M sodium phosphate buffer (pH 7.2) for longer than 1 hour at 37*C. The lymphocytes that do not bind to these surfaces are then added to 15 surfaces that are coated by exposing them to hLH and then to human serum albumin as above. The amount of hLH used is not critical so long as sufficient material has become adsorbed to the plastic. This can be achieved using 20-50/g of hLH/ml.
However, lesser and greater amounts will also work. The lymphocytes that attach to surfaces coated with LH are selected and either fused with myeloma cells to 20 prepare hybridomas transformed with Epstein-Barr or other virus, subjected to cloning in lambda phage or single cells are selected for polymerase chain reaction cloning The antibodies that are produced are subjected to screening as outlined in example 2. These strategies enhance the percentage of antibodies that will be desirable.
Many antibodies that are capable of partial inhibition of LH can also be selected through a process that depends on their abilities to bind to LH that is bound to LH receptors. Following immunization of mice or monkeys with hLH, the spleen cells and other lymphocytes are isolated and layered on eukaryotic cell monolayers that express LH receptors. These cell monolayers can be prepared by transfecting cells with expression vectors capable of expressing rat human porcine or other LH receptor cDNA by methods which are standard in the art (48,49). Lymphocytes that adhere to the monolayers are discarded.
Lymphocytes that do not adhere to the monolayers are added to similar monolayers of cells expressing LH receptors containing hLH or other LH. These can be prepared by adding 100 ng of hLH or other LH to the monolayers overnight at 4"C and washing off the hormone that did not become bound. Lymphocytes that adhere to these cells are selected and either fused with myeloma cells to prepare hybridomas transformed with Epstein-Barr or other virus, or subjected to -26polymerase chain reaction cloning The antibodies that are produced are subjected to screening as outlined in example 2. These strategies will also enhance the percentage of antibodies that will be desirable. Although this receptor-based strategy is more tedious than a strategy based on screening of lymphocytes on plastic surfaces coated with LH, it will yield a higher percentage of useful antibodies.
e *ft fto ft°ft •t ot f ft fto* -27 Example 4 Use of antibody to treat polycystic ovarian syndrome Polycystic ovarian syndrome (PCO) is characterized by incomplete follicle development and an inability of a woman to ovulate normally. The ovary contains many small immature follicles, few if any of which progress to the point of ovulation in the absence of clinical intervention. These woman often have elevated androgens and a high ratio of LH/FSH relative to normally cycling fertile women.
There are two major procedures for induction of ovulation in women with PCO.
These include the administration of FSH to boost follicle development or antiestrogens to facilitate the secretion of FSH from the anterior pituitary gland. While both treatments are capable of inducing ovulation, they have a risk of inducing multiple ovulations since they bypass the normal negative estrogen feedback loop 15 which regulates FSH secretion. As a result, women treated with these agents are usually monitored carefully to prevent hyperstimulation, a potentially lethal sideeffect of treatment.
*Administration of 10 .g 10 mg of a nonneutralizing antibody to LH that causes a transient and self-limiting rise in FSH secretion will induce ovulation with less risk of hyperstimulation than treatment with gonadotropin. The effect is transient because the antibody will be metabolized or otherwise cleared from the circulation and its effectiveness will be lost within 1-2 weeks after administration.
The treatment is self-limiting because the negative feedback effect of estradiol on 25 FSH secretion will not be eliminated. Thus, as FSH levels rise and stimulate follicle development, estradiol secretion will rise and inhibit further increases in FSH secretion.
Example One or two dose treatment induction of ovulation.
There are no good methods that can be used to induce ovulation in women with PCO that involve only a single or double treatment. Most treatments for this syndrome require multiple treatments with FSH, FSH plus LH or hCG, hMG, anti-estrogens, GnRH, or various combinations of these agents. Some approaches have also employed GnRH antagonists to reduce the circulating levels of both LH and FSH so that ovulation could be induced by treatment with exogenous hormones. A single administration of a high concentration of the preferred -28antibody of the type described here can induce ovulation. This is because the antibody can be given safely in massive excess and, since antibodies have long plasma half-lives, the antibody will continue to be effective in increasing FSH levels for several days. Because of the natural feedback effect of estradiol on FSH secretion, FSH secretion will be controlled by the estrogens made by the follicle as the follicle develops. By the time that the dominant follicle has been selected and estradiol levels have increased, much of the antibody will have been cleared from circulation. The antibody will not interfere with the actions of LH surge needed for ovulation for one or more of several reasons. First, the amount LH released is in excess of the amount needed for ovulation. Second, the antibody will only reduce the activity of LH, not neutralize it. And third, by the time of the LH surge much of the antibody will have been cleared from circulation. Thus, treatment with the antibody will be followed by follicle development and ovulation.
15 Example 6 Antigens that induce appropriate inhibitory antisera.
Administration of appropriate antibodies illustrated in Example 1 can be used to augment fertility. However, since this is a "passive" immunization, it will require repeated administration of antibody to keep the levels of antibody high for more than several days or weeks. Short term elevation days) is sufficient for inducing ovulation in women or increasing the number of ovulations in animals in one or a few cycles. When it is desired to partially suppress the activity of LH 25 and thereby augment fertility for longer periods or several cycles, it is useful to induce an immune response that causes the active formation of antibodies against LH. To obtain the most useful antibodies, it is necessary to design an immunogen capable of inducing a response to a portion of the LH molecule similar to that recognized by B105, B110, or other antibodies that form complexes with LH that retain some LH activity. The most appropriate immunogens are derived from the LH B-subunit since this subunit is unique to LH. The a-subunit is common to LH, TSH, and FSH. Its conformation appears to differ slightly in the hormones (21) and, therefore, useful antibodies against the a-subunit can also be made. However, antibodies to the alpha-subunit have the potential of inhibiting the actions of all three hormones. If the immune response is directed against hFSH, it may not enhance fertility and may cause infertility. When it is desirable to actively immunize women against hLH to enhance fertility, care must be taken to prevent the induction of antibodies to hCG. Antibodies to hCG have the potential to reduce fertility (see below). This is usually not a problem with passive immunization -29described above since the administered antibodies to LH are usually cleared from circulation prior to the time that hCG is needed for fertility.
Antigens capable of inducing the formation of antibodies against a portion of LH that does not neutralize its activity the desired immune response) contain a sequence derived from a portion of the LH B-subunit. Often this is a region of the beta-subunit that remains exposed after LH binds to LH receptors. To be most antigenic the immunogens should also contain sequences that are foreign to the person or animal to be immunized. If the entire LH B-subunit is used for immunization, one can get the production of antibodies that completely inhibit LH activity. High titers of neutralizing antibodies may result in infertility or have other negative consequences such as inducing premature menopause or loss of testis size or function. The best choice of LH beta-subunit residues that should be included in the immunogen are those that remain exposed when the hormone binds to LH receptors. These include the portion of the hormone near residues 74-77, a region of the hormone that is recognized by antibodies that bind to hLH or hCG Bsubunits and hLH- or hCG-receptor complexes (26,50). Regions of the B-subunit that should not be used for immunization include sequences near residues 89-92 and 47-51. These are the locations of the binding sites for antibodies that neutralize 20 activity.
The design of a minimal synthetic antigen includes residues of hLH 8 B-subunit exposed when LH is bound to LH receptors. Some of these include Pro73-Arg74-Gly75-Val76-Asp77-Pro78-Val79-Val80-Ser81. Synthetic peptides containing these sequences can be coupled to large carrier molecules and used for immunization using methods well-known in the art (14-16,51-53). The nonneutralizing antibodies produced will combine with hLH and inhibit its biological activity.
Often the ability of small peptide antigens to elicit a high titer immune response is low. The following illustrates how to create an antigen which will be more effective in eliciting antibodies to regions of hLH that remain exposed when the hormone binds to LH receptors. A similar approach could be used to design immunogens for any protein including other vertebrate LH. The best immunogens are well-known to be those that differ substantially from proteins found in an animal yet retain the tertiary configuration of the epitope or epitopes for which an immune response is desired. An appropriate immunogen can be made by modifying the hLH B-subunit such that i) it retains the ability to bind to B105 and/or other antibodies that partially inhibit the actions of hLH, ii) it loses the ability to bind to antibodies that neutralize LH activity, and iii) it is antigenic.
Appropriate immunogens can also be designed starting with a protein other than the LH beta-subunit and modifying it to acquire the ability to bind to B105 and/or other antibodies that partially inhibit the actions of hLH. Antibodies that partially inhibit the actions of hLH are termed "template" antibodies and they are used to monitor and/or positively select for retention of desired epitopes. Good examples of template antibodies are those that are found to be effective in increasing fertility as outlined in example 2. Other antibodies which are termed "exclusion" antibodies are used to select against antigen analogs containing undesirable epitopes.
Examples of "exclusion" antibodies are those which completely neutralize the biological activity of hLH and/or which prevent it from binding to its receptor.
There are two overall different strategies which will be termed "A" and for building the antigens using a positive/negative selection strategy based 15 on template and exclusion antibodies. In approach one starts with the LH 8subunit and uses random mutagenesis to make substitutions in regions of the molecule outside the epitope recognized by the "template" antibody. The new molecules that are produced are expressed (see below) and their abilities to bind the template antibody are monitored. Those that continue to bind to the template 20 antibody and have mutations in the other regions of the molecule are utilized in a second round of mutagenesis on a different portion of the molecule. This process is continued until all regions of the protein except the one involved in the antibody binding site B105) have been modified. The final analogs will bind to template antibodies but not to exclusion antibodies. In a variant of this procedure, one begins with a hormone chimera that binds to the template antibody. Such chimeras can be prepared starting with a different species of LH known not to bind template antibodies or to induce a neutralizing immune response to hLH. Examples of this type of immunogen are chimeras of the B-subunits of human LH and bovine LH. These include bovine LH B-subunit that has been modified by substituting proline 74 with arginine, the residue found in the human LH B-subunit at this position. Residues of hLH are substituted for homologous regions of the different species of LH to create the binding site for the template antibodies. The homologous regions are identified by aligning the sequences of hLH and the other LH by the positions of their highly conserved cysteine residues as shown by Pierce and Parsons In approach one uses a framework molecule that is not related or only weakly similar to the structure of glycoprotein hormone B-subunits. This can include any protein containing loop structures such as those found in the -31 immunoglobulin folds or between the helices in four helix bundle proteins. The sequence of hLH between residues 65-85 is substituted for one of the loops by standard mutagenesis procedures. When this protein is made in a suitable E. coli expression vector one of the T7 vectors obtainable from Novagen), it can be tested for its ability to bind to monoclonal antibodies that bind to hLH-receptor complexes. Since only a portion of the residues which form the epitope will be present in the expressed protein, its affinity will be lower than that of hLH for the antibody.
To improve the selectivity and affinity of the proteins made in approaches or one can use either a bacterial or bacteriophage expression system (34,36,55-58). In either case one prepares libraries of mutant analogs and selects the mutant having the highest affinity for B105, B110, or other similar template antibody that is found to be useful in example 2. In addition, one can also 15 use negative selection using neutralizing antibodies or antisera found not be useful in example 2. This will minimize the ability of the antigen to elicit undesirable antibodies when used in a vaccine.
The following description applies to a selection method based on 20 phage display but could be readily adapted by one skilled in the art of making and screening libraries to nearly any expression system. One system which is amenable to selection is that based on protein blotting Several different phage display systems can also be used. One involves using a vector pX-M13gIll) similar to phGH-M13gIII When approach discussed earlier is used, this new vector termed pA-M13gI contains either hLH B-subunit or an hLH-LH B-subunit chimera in place of the growth hormone coding sequences of phGH-M13gil (Figure When approach discussed earlier is used, the growth hormone coding sequences of phGH-M13gIII are replaced with a gene encoding a molecule unrelated to hLH B-subunit except for the inclusion of the hLH beta subunit coding sequences near residue 74 to give a new vector termed pB-M13gIII. The coding sequence of the region of the vector encoding the sequences also contains restriction sites that permit cassette or other types of mutagenesis to permit introduction of random sequences. When random sequences are introduced into the coding regions of pA-M13gII or pB-M13gII vectors and the vectors used to transform E. coli, a library of mutants will be created. These mutant proteins can be expressed on the surface of M13 phagemid particles as gene III fusion proteins by adding the helper phage M13K07 to the E. coli. These phagemid particles will bind to the antibody in proportion to the affinities of the modified proteins or for the antibody. One convenient method to select for phagemid particles that -32 bind to template antibodies is to use a solid phase assay protocol. In this assay, the template antibody is used to coat a surface as described (22) and then a solution containing the phagemid particles is added. Phagemid particles that do not bind to the surface can be discarded. Those particles that do bind to the antibody on the surface can be removed from the antibody by the addition of low pH buffers pH3) and used to retransform E.coli. When a negative selection is desired, one can substitute the exclusion antibodies for the template antibodies on the surface. In this case the particles that attach to the surface are discarded. This process is repeated several times and then the coding regions of several genes for the and proteins are subjected to DNA sequencing. In this way one can identify sequences that are critical for template antibody binding. In addition, if exclusion antibodies are used, one can select against undesirable epitopes. Also, one can identify substitutions in other portions of the molecule that have little or no effect on the conformation of the desired antibody binding region. When molecules 15 encoded by these sequences are used to immunize animals or humans, they will elicit the formation of antibodies that crossreact with hLH. Since these antibodies will recognize a portion of the molecule known to be exposed after hLH binds to its receptors, they will be able to inhibit the actions of hLH but not completely prevent its biological activity.
In some cases template antibodies and exclusion antibodies may not be available. In these cases one can create template antisera and exclusion antisera which can be substituted for the antibodies using the following strategy. Rat ovarian corpora lutea are prepared by treatment of female rats with PMSG and hCG 25 as described earlier. These corpora lutea are incubated with hLH to permit the hormone to bind to the LH receptors in the membranes. Then the membranes are washed to remove the free hLH and the membranes are incubated with the antisera.
Antibodies which become bound to the hLH which is bound to the membrane LH receptors are then separated from the remainder of the antisera by washing the membranes. These antibodies are released by treatment of the membranes at a pH below 5. This treatment releases both the antibodies and the hLH from the receptors. The antibodies are separated from hLH by gel filtration or other method and then can be used as templates. Antibodies remaining in the serum depleted of template antibodies can serve as exclusion antibodies.
-33 Example 7 Development of an immunogen to elicit neutralizing antibodies to hCG.
The preferred immunogens for preventing fertility will elicit the production of antibodies against hCG but not hLH. These can be made using the template/exclusion procedure described in example 6 employing different antibodies. Template antibodies that can be used include B107 and B109 available from Columbia University. These antibodies bind hCG with high affinity and have very low affinity for the free hCG 8-subunit or for hLH. Because they are specific for the heterodimer form of hCG the biologically active form of the molecule), because they do not bind to most other inactive forms of hCG in the circulation, and because they are neutralizing, immunogens that can be recognized by these antibodies with high affinity Ka 5 x 10 7
M"
1 will elicit the 15 formation of neutralizing antibodies to hCG. Portions of the 8-subunit that should be preferentially retained in this immunogen include residues 43-53 and 91-92. In addition, other useful template antibodies are HCZ107 and HC0514 available from Hybritech, San Diego, CA. These antibodies bind to both hCG and its free 6subunit with high affinity and neutralize the activity of the hormone. Both have 20 low affinity for hLH. Residues critical for the interaction of HCZ107 with hCG include those near 114 and residues critical for the interaction of HC0514 with hCG include those near 77.
Example 8 Enhancement of immunological activity.
During active immunization against LH or chorionic gonadotropin one is creating a site-directed autoimmune response. Thus, it is essential to use proteins that are highly antigenic. This can be facilitated by using the template/exclusion approach described in example 6 to make the immunogen as foreign as possible. In addition, it is desirable to make the molecule multivalent to increase the chances that it will interact with the immune system. One good method to make the molecule multivalent is to add residues to either the C-terminus or the N-terminus that will cause the formation of an a-helix that can form a coiledcoil with other molecules. The rules for designing peptide sequences that form coiled coils are well-known in the art (60,61). In addition, it is also possible to use naturally occuring sequences from proteins known to form coiled-coils such as those found in the hemagglutinin protein of influenza virus, laminin, GCN4, or any -34of several other proteins. It is also possible to add residues to the C-terminus or the N-terminus that will result in the formation of a triple helix similar to that found in collagen. These triple helices will enable three or more molecules of antigen to combine. Other strategies for increasing the antigenicity of the immunogen can also be employed including coupling the immunogens end-to-end to make a polyprotein. As outlined (Figure 5) it is possible to design a protein having any number of repeating units using this strategy.
The preferred antibodies that give a non-neutralizing inhibition of LH activity usually interact with the free 8-subunit and the heterodimer well. Thus, in preparing immunogens to elicit the formation of these antibodies it is usually convenient to start with the free B-subunit. In contrast, many preferred antibodies that give a neutralizing inhibition of hCG activity bind the a, B-heterodimer better than the free hCG B-subunit. To elicit the formation of these antibodies, it is often 15 useful to start with an immunogen that is a fusion protein prepared by coupling the C-terminus of the peptide comprised of the hCG B-subunit residues 1-114 to the Nterminus of a flexible protein linker composed of six repeating units of glycine and serine. The C-terminus of this fusion protein is then coupled to the N-terminus of the bovine a-subunit residues 1-96. This provides a single polypeptide that has the 20 overall conformation of the B-subunit residues found in hCG and which can be used for immunization directly or which can be used as the starting compound in example 6. Administration of the antigen can be performed in any fashion that is well-known in the art. This includes injection, injection in adjuvants, and coupling the antigen to a virus.
Example 9 Reversal of the effect of hCG.
Vaccination of women with hCG to induce infertility has several desirable properties including 1) the antibodies will function only if fertilization has occurred, 2) the treatment will be long-term occur for many menstrual cycles), and 3) the women will not need to take pills or have implants. In addition, the vaccination will be reversible using progestins that are known to prevent rejection of the fetus by the uterus. These include many progestational compounds such as dydrogesterone This compound is commercially available from Solvay Pharmaceuticals, 901 Sawyer Road, Marietta, Georgia, and has the desired property of not crossreacting with progesterone in immunoassays. Thus, treatment with dydrogesterone does not prevent accurate measurement of progesterone levels.
35 Women who are actively immunized against hCG will continue to have normal menstrual cycles and should ovulate at the expected time during the midpoints of their menstrual cycle. In the procedure for inducing fertility, it is desirable to know when ovulation has occurred. However, it can also be assumed that it has occurred by day 18 of the menstrual cycle. At ovulation, progesterone is produced by the corpus luteum under the influence of LH. The progesterone causes the increase in the basal body temperature that is associated with ovulation and is a known method of monitoring ovulation. Another method for monitoring the LH surge is to measure LH in urine using one of the over the counter ovulation detection kits.
After day 20 the woman desiring to become pregnant begins taking dydrogesterone (3-6mg three times a day) and 0.625-1.25 mg Premarin (Ayerst Limited, New York, NY). This is sufficient to mimic the secretion of luteal progesterone that would be caused by hCG if it were not neutralized as the result of vaccination.
Dydrogesterone treatment is continued to prevent menses for 6 weeks. At that time 15 dydrogesterone therapy is terminated. If serum progesterone levels are low, pregnancy has not occurred, menses will ensue, and another attempt at pregnancy can be made. If serum progesterone levels are high, progesterone levels will be high due to pregnancy and placental production of progesterone. Termination of dydrogesterone will not halt the pregnancy. The serum level of progesterone can 20 also be monitored using standard radioimmunoassay techniques.
Example Suppression of Male Fertility by Vaccination with FSH Immunoneutralization of FSH has been shown to block fertility in monkeys and would be expected to block fertility in men It has been extremely difficult to develop a highly-specific hFSH vaccine capable of eliciting high titer neutralizing antibodies to FSH for use in any species due to the highly conserved nature of the FSH B-subunit. Methods that have been described for development of antibodies to hCG can also be applied for development of antibodies to hFSH.
Thus, one starts with molecules in which hFSH -subunit residues 1-111 are substituted for hCG B-subunit residues 1-114 or 1-117. As a template antibody one can use FSG761 (Hybritech). Since neutralizing antibodies are desired, a preferred starting molecule will also contain the bovine a-subunit polypeptide coupled to the hFSH B-subunit polypeptide through a glycine-serine linker. The use of this vaccine in men will prevent fertility.
-36 Example 11 Details Of The Test Approach Of The Present Invention For hCG 1. One obtains neutralizing antibodies either by making monoclonals or by purchasing them. One can also obtain neutralizing antisera by immunizing rabbits or other animals against hCG. It will also be useful to obtain antibodies or antisera against hLH.
2. These antibodies or antisera are used as positive and negative templates to screen libraries of hCG B-subunit mutants. These libraries can be made by random mutagenesis of the hCG B-subunit in particular regions of the molecule. Note that it is preferable to use an hCG B-subunit that is missing the Cterminus or that has a different sequence for this part of the molecule to avoid selecting for immunogens that are non-neutralizing. One convenient procedure involves the use of phage display techniques also listed below. However phage display is not essential for the technique to work.
3. The mutants are permitted to bind to the negative selection antibodies first. In the present example, namely development of an hCG vaccine, this would involve binding to the antibodies to LH or the antisera to LH to remove mutants that are structurally identical to LH.
o 4. The mutants that did not bind to the negative selection antibodies are then permitted to bind to the positive selection antibodies, namely those that were made by hCG immunization. During the positive selection process, free hCG B-subunit is also added to eliminate antibodies that bind the free subunit and to limit the selection process for those antibodies that are dimer specific. The mutants that do not bind to the positive selection antibodies are discarded. In the case of phage expressed proteins, the phage are eluted from the positive selection antibodies and used to infect E. coli.
This process is repeated for several rounds to eliminate potential immunogens that are capable of binding to the hLH antibodies and to further exclude those that have low affinity for hCG antibodies. The DNA sequences encoding the immunogens are sequenced. Immunogens that differ the most from hCG yet retain the ability to bind to hCG specific antibodies or antisera with high affinity are used further.
-37- 6. If needed, a second round of mutagenesis is performed to increase the number of differences between the potential immunogen and hCG.
The goal is to devise an immunogen that differs from hLH and as much as possible from hCG yet retains the key aspects of hCG structure that enable it to elicit high titer neutralizing antibodies. These include the regions of the -subunit other than the C-terminus that differ most from hLH B-subunit.
7. Once the major unique antigenic determinants have been selected, the immunogen is made multivalent. There are several methods for accomplishing this. One is to fuse the determinant to a protein that itself is multivalent or that forms multimers immunoglobulins). Another is to fuse residues to the protein that form coiled-coils and that will promote association. Where possible these are from natural proteins that are known to elicit an immune response flu).
8.A. It is essential to get titers high against the intact hCG molecule if it is desired to prevent fertility. This may require combining hCG with a molecule that is similar to an a-subunit. The a-subunit of other mammalian glycoproteins is suitable as a starting material.
8.B. A molecule that is also a suitable starting point is one that has the desirable properties of being a single polypeptide and that retains the structure of the heterodimer. In this case, it is desirable to also make mutations in the portion of the molecule derived from the cc-subunit.
8.C. The immunogens can be produced using any convenient method such as expression in E. coli, yeast, or mammalian cells. It is not required that the immunogens be glycosylated. The immunogens can also be DNA or RNA. They can also be integrated into the coats of viruses.
8.D. It is also not required to start with the hCG B-subunit. One can start with any protein. The key is to use the template strategy to select the proteins that one wants. For example, one can start with a four helix bundle and incorporate the amino acid sequences from portions of the hCG B-subunit that are near residues 38-57 and 91-92. One can also start with an immunoglobulin, including one that is an antiidiotypic monoclonal antibody to an hCG-specific antibody.
-38- Figure 1 is a graph illustrating the influence of antibodies and antisera on the binding of radiolabeled hLH to LH receptors. Figure 1 illustrates the influence of three different types of antibodies or antisera on the binding of hLH to LH receptors. Antibody has little or no effect on the binding of the hormone to receptors. Its main potential inhibitory influence in vivo would be on the metabolism of the hormone. Antibody has the ability to partially block the binding of hLH to LH receptors. Thus, although the antibody would be inhibitory in vivo, even a very large excess of this antibody relative to LH would be unable to reduce its activity below 40% as shown here. Note that different antibodies can be produced that have different abilities to block the activities of LH B105 and B110), Antibody is an example of the general type of antibody that is most useful in vivo. Antibody is a neutralizing antibody since at high concentrations it can prevent the activity of hLH. Due to its potential to prevent LH activity, an excess of this antibody would inhibit fertility.
:Figure 2 is a graph illustrating the influence of antibodies and antisera on the ability of hLH to induce steroidogenesis in vitro. Figure 2 illustrates the effects of three antibodies on the ability of LH to induce testosterone synthesis steroidogenesis) from rat testes Leydig cell suspensions. Curve "A" 20 illustrates the ability of hLH to induce steroidogenesis in the absence of antibodies.
Curve illustrates the ability of hLH to induce steroidogenesis in the presence of a massive excess of antibody that can reduce hLH activity by approximately 3-fold.
Curve illustrates the ability of hLH to induce steroidogenesis in the presence of a massive excess of antibody that can reduce hLH activity by approximately 25 fold. Curve illustrates the ability of hLH to induce steroidogenesis in the presence of a massive excess of antibody that can neutralize hLH activity. The decision to use antibody and/or in vivo will depend on the ratio of LH/FSH and the extent that one desires to suppress LH activity. When hLH levels are high and need to be reduced the most, antibody would be preferred. When hLH/hFSH ratios are only slightly elevated, antibody would be preferred. Use of antibody at very high doses would result in infertility. It is anticipated that many useful antibodies will be found having the ability to reduce the activity of hLH or other LH on ovarian cells as well as testes cells.
Figure 3 is a graph illustrating the influence of antibodies and antisera on the ability of hLH to induce steroidogenesis in vivo. Figure 3 illustrates the effects of three different antibodies on testosterone formation in males when massive amounts of the antibodies are administered i.v. prior to different amounts of hLH also given i.v. In all the examples illustrated, the quantity of antibody -39administered greatly exceeds that of hLH on a molar basis. Similar effects would be expected for the antibodies on steroidogenesis in females. Curve shows the effect of hLH on steroidogenesis in the absence of antibody. Curve illustrates the effect of a massive amount of antibody which can inhibit the activity of hLH by 40% at most. Curve illustrates the influence of a massive amount of antibody which can inhibit the activity of hLH by 95% at most. Curve illustrates the effects of a massive amount of a neutralizing antibody.
Figure 4 shows vectors that can be used in template/exclusion selection strategies. These vectors are similar in design as that described by Bass et al. (34) and are made by replacing the coding sequences for human growth hormone with those of the a-subunits of hLH or an hLH chimera using polymerase chain reaction mutagenesis procedures that are standard in the art such as the SOEing procedure described by Ho, et al. Similar vectors for the generation of immunogens to hCG and hFSH could be made by replacing the growth hormone sequence with the coding sequences of the hCG 8-subunit residues 1-114, hFSH Bsubunit residues 1-111, the coding sequences of the hCG B-subunit residues 1-114 coupled 5' of the coding sequences for amino acids glycine-serine-glycine-serineglycineserine-glycine-serin e-glycine-serine-glycine-serine- coupled 5' of the coding sequences for the bovine a-subunit, or the coding sequences of the hFSH B-subunit residues 1-111 coupled 5' of the coding sequences for amino acids glycine-serine- Sglycine-serine-glycine-serineglycineserineglycineserine-glycine-serine-coupled of the coding sequences for the bovine a-subunit. In this Figure the "lac p" represents the lac promoter, stII represents the leader secquence, "hLH beta" 25 represents the human LH beta subunit coding sequence from codon 1 to codon 114, "M13 gene III" represents the coding sequence of the M13 gene protein codons 198-410 in the same reading frame as the stlI and human LH beta codons. "Amp resistance: is the gene from the pBR322 that encodes the 8-lactamase enzyme, "322 ori" is the origin of replication from pBR322, and "fl ori" is the origin of replication from M13. Mutations would be made in the "hLH beta" portion of this vector. In addition, the "hLH beta" codons could be replaced with the codons for the other proteins described in the text.
Figure 5 shows the types of immunogens that have increased antigenicity for use in active immunization against LH, hCG, or FSH. Some of these have the heptad repeat known to form a coiled-coil (panel Others have a repeat known to form a triple helix (panel These give enhanced antigenicity because they are polymeric. Other methods of making polymeric immunogens include preparing fusion proteins with either the C-terminus (panel C) or the Nterminus of immunoglobulins (panel A single chain immunogen comprised of a fusion protein of the bovine a-subunit and the B-subunits of hCG and hFSH would have enhanced antigenicity in humans.
Illustration A: The codons for two or more heptad repeats are inserted in frame between codon 114 and the termination codon of the LH or analog B-subunit. Design of the heptad repeat is similar to that described in reference Each repeat contains 7 amino acids labeld in order B, C, D, E, F, G" that have the following properties. Amino acids a and d are hydrophobic and are leucine, isoleucine, or valine. Amino acids E and G are charged amino acids. Amino acid E should have the opposite charge as amino acid G to form homodimers. Thus if E is a glutamate, then G should be a lyslne. Amino acids can be nearly any type that favors helix formation. Thus, they should contain few if any prolines or glycines.
Illustration B: The codons for 6 or more triplet amino acid repeats are inserted in frame between codon 114 and the termination codon of the B-unit.
These triplets encode amino acids glycine, X, Y wherer X and Y are any amino acid known to be part of the collagen sequence that forms a triple helix.
Illustration C: The codons for the IgG heavy chain are inserted immediately 5'of codon 1 of the B-subunit. When these genes are co-expressed with lamda or kappa IgG light chain, they will cause the production of an IgG containing two B-subunits at its C-terminus.
Illustration D: The codons for the IgG heavy chain region lacking the variable and first constant region are inserted in frame between codon 114 and the termination codon of the B-subunit.
Illustration E: Codons for a glycine-serine repeat sequence GS repeat) such as the sequence serine-glycine-serine-glycine-serineglycine-serine-glycine-serine-glycine-serine-glycine are inserted in frame between codon 114 and the termination codon of a B-subunit analog. The last codon of this analog becomes 126. Next, codons 1-96 for the bovine or other a-subunit or codons 1-92 of the human a-subunit are inserted in frame between codons 126 and the termination codon of the B-subunit construct containing the poly-glycine-serine tail. This forms a single subunit gonadotropin that conveys the structure of the glycoprotein hormone heterodimer.
-41- Illustration F: Codons for the human, bovine, other vertebrate asubunit, or analog sequence are added between the last codon and the termination codon of a gene coding for a heptad repeat containing only positively charged amino acids at positions E and G in the heptade repeat Heptad repeat #1) using methods known to any expert skilled in standard recombinant DNA techniques for preparing and expressing genes. When this gene is expressed in bacterial, or yeast, or other eukaryotic cells or organisms it will produce a protein having the positively charged heptad repeat at its amino terminus and an a-subunit or a-subunit analog at its carboxy terminus. Codons for a heptad repeat encoding negatively charged amino acids at positions E and G Heptad repeat are added between the last codon and the termination codon for a B-subunit analog.
When this gene is expressed in bacteria or yeast or other eukaryotic cells or organisms, it will produce a protein having a B-subunit or analog at its amino terminus and the negatively charged heptad repeat at its carboxy terminus.
*ti Illustration G: This shows the heterodimer that is formed when the proteins having the form described in illustration F are mixed. The sequences of heptad repeat #1 and heptad repeat #2 are chosen to foster the formation of ""heterodimers and reduce the formation of homodimers.
Illustration H: Multimers are formed when the compounds in illustrations F and G are mixed due to the combination of the a- and -subunits and the heptad repeats. In illustrations A H, the and refer to the amino terminus and the carboxy terminus of the proteins. The refers to a single unit 25 that can be repeated several times. Note also that while the heptad repeats illustrated here are identical, use of identical repeats is not essential. There are large numbers of proteins that contain non-identical heptad repeats that are able to form homodimers or heterodimers Single chain gonadotropins with lutropin and/or folliotropin activity.
Example 12 Preparation and use of Analog #1 Table a single chain gonadotropin with lutropin activity. (See Figure 6) The coding sequences for analog #1 listed in Table 1 can be synthesized using the block ligation approach described (54) or they can be prepared starting with the coding sequences for the hCG B-subunit and the human -42a-subunit. These can be cloned from a human placental cDNA library. The sequences encoding the signal peptide from the human a-subunit are deleted and the coding sequences for the proteins are spliced together using the SOEing technique (63) as follows: Primer #1 (100 ng) having the sequence
ATGAAATCGACGGAATCAGACTCGAGCCAAGGATGGAGATGTTCCAGGG
GCTGCT-3' and primer #2 (100 ng) having the sequence 3'-
GGGAGCCTGTGGGGCTAGGAGGGGTTCCTAGGCCATCGCCTAGACCAT
are mixed with the hCG B-subunit cDNA (1 jig) which serves as a template and PCR is performed for 25 temperature cycles of 94C (30 seconds), 50 0 C seconds), 72*C (60 seconds) using Pfu DNA polymerase purchased from Strategene, LaJolla, CA and dioxynucleotide triphosphates and PCR buffer as described Primer #3 (100 ng) having the sequence GGATCCGGTAGCGGATCTGGTAGCGCTCCTGATGTGCAGGATTGCCCA-3' and primer #4 (100 ng) having the sequence 3'- 15 ACGTCATGAACAATAATAGTGTTTAGAATTCCATGGCCTAGGTAGAGTTC GATTAGGCCT-5' are mixed with human a-subunit cDNA (11g) which serves as a template and PCR is performed for 25 temperature cycles of 94C (30 seconds), (60 seconds), 72*C (60 seconds) using Pfu DNA polymerase and dioxynucleotide triphosphates and PCR buffer as described These two PCR 20 reactions give products that serve as intermediate templates in a third (final) PCR reaction that gives the desired constructs in a form suitable for cloning. The final PCR reaction is performed by mixing 1 /l of the products from the first two PCR reactions along with primer #5 having the sequence ATGAAATCGACGGAATCAGACTCGAGCCAAGG-3' and primer #6 having the 25 sequence 3'-ATTCCATGGCCTAGGTAGAGTTCGATTAGGCCT-5' for temperature cycles of 94°C (30 seconds), 50*C (60 seconds), 72°C (60 seconds) using Pfu DNA polymerase, additional dioxynucleotide triphosphates, and PCR buffer. The final PCR product is digested with restriction enzymes XhoI and BglII and ligated into pSVL (an expression vector obtained from Pharmacia, Piscataway, NJ) that has been digested with XhoI and BamHI to create a vector that will direct the synthesis of Analog 1. The XhoI site of the PCR product will ligate to the XhoI site of pSVL and the BglII site of the PCR product will ligate to the BamHI site of pSVL. The XhoI site will be regenerated and the BglII and BamHI sites will be eliminated. The sequences of the coding regions between the XbaI and KpnI sites, Figure 6) of several constructs are determined until one is found that encodes a protein having the desired amino acid sequence illustrated in Figure 6.
This is done to eliminate the possible errors that arise as the result of PCR and other DNA manipulation and is a standard precaution to be certain that the desired sequence is obtained. The expressed protein is expected to lack amino acid residues -43 MEMFQGLLLLLLLSMGGTWA that are the part of the signal sequence found in hCG B-subunit and which are removed by the cell during protein synthesis. This vector is expressed in COS-7 cells as described (64) and the protein released into the medium is tested for its ability to inhibit the binding of radioiodinated hCG to monoclonal antibodies or to antisera prepared against hCG. The protein made by the COS-7 cells will compete with radioiodinated hCG for binding to one or more of the following antibodies: B101 (obtained from Columbia University), B105 (obtained from Columbia University), B107 (obtained from Columbia University), B109 (obtained from Columbia University), A201 (obtained from Columbia University), HCU061 (obtained from Hybritech), HCZ107 (obtained from Hybritech), or HC0514 (obtained from Hybritech), ZMCG18 (obtained from Pierce), ZMCG13 (obtained from Pierce), or ZMCG7 (obtained from Pierce) or 518B7 (obtained from Dr. Janet Roser, University of California at Davis). The protein released into the medium will compete with radiolabeled hCG for binding to :i 15 receptors on corpora lutea as described by Campbell, Dean-Emig, and Moyle (64).
It would be expected to stimulate testosterone formation in a Leydig cell assay performed similar to that described by Moyle et al. (37) and to stimulate ovulation in female animals and to stimulate testosterone formation in male mammals. This analog would also be expected to be a good starting point for use in a contraceptive S 20 vaccine using the template approach outlined in Example 11. This analog is shown in Table 1 as Analog #1 and contains a linker sequence of GSGSGSGS. This linker can be modified by digesting the expression vector with Apal and Eco47Il Sendonuclease restriction enzymes, discarding the short piece, ligating a cassette of synthetic double stranded DNA with the desired amino acid codons containing any 25 number of glycine or serine codons or other amino acid codons into the ApaI/Eco47Im site by standard methods, sequencing the region between the ApaI/Eco47III to confirm the desired mutations have been made, and expressing the protein in COS-7 cells. This can be done to optimize the activity of the single chain gonadotropin. The protein is expected to function as a monomer or to combine to form active homodimers. In addition, several copies of the protein would be expected to combine to form multimers.
Example 13 Preparation and use of Analog a single chain gonadotropin with lutropin activity. (See Figure 7) The coding sequences for Analog #2 listed in Table 1 can be synthesized using the block ligation approach described (54) or they can be -44prepared by PCR using primers #1 and #7 and the expression construct described in Example 12 and in Figure 6 as a template. The sequence of primer #7 is 3'- The final PCR product is digested with restriction enzymes Xhol and BamHI and ligated with the large fragment of DNA obtained by digesting the expression construct described in Example 12 with Xhol and BamHI. The sequences of the coding regions between the XhoI and BamHI sites of several constructs are determined until one is found that encodes a protein having the amino acid sequence described in Figure 7 is obtained. This will insure that cloning artifacts are not present in the region that has been altered. The expressed protein is expected to lack amino acid residues MEMFQGLLLLLLLSMGGTWA that are the part of the signal sequence found in hCG B-subunit and which are removed by the cell during protein synthesis. This vector is expressed in COS-7 cells and the protein released into the medium is tested for its ability to inhibit the binding of radioiodinated hCG to monoclonal 15 antibodies or to antisera prepared against hCG. The protein made by the COS-7 cells will compete with radioiodinated hCG for binding to one or more of the following antibodies: B101 (obtained from Columbia University), B105 (obtained from Columbia University), B107 (obtained from Columbia University), B109 (obtained from Columbia University), A201 (obtained from Columbia University), HCU061 (obtained from Hybritech), or HC0514 (obtained from Hybritech), ZMCG18 (obtained from Pierce), ZMCG13 (obtained from Pierce), or ZMCG7 (obtained from Pierce) or 518B7 (obtained from Dr. Janet Roser, University of California at Davis). The protein released into the medium will compete with radiolabeled hCG for binding to receptors on corpora lutea as described by 25 Campbell, Dean-Emig, and Moyle It would be expected to stimulate testosterone formation in a Leydig cell assay performed similar to that described by Moyle et al. (37) and to stimulate ovulation in female animals and to stimulate testosterone formation in male mammals. This analog would also be expected to be a good starting point for use in a contraceptive vaccine using the template approach outlined in Example 11. This analog is shown in Table 1 as Analog #2 and contains a linker sequence of GSGSGSGS. This linker can be modified by digesting the expression vector with SstIl and Eco47III endonuclease restriction enzymes, discarding the short piece, ligating a cassette of synthetic double stranded DNA with the desired amino acid codons containing any number of glycine or serine codons or other amino acid codons into the SstII/Eco47m site by standard methods, sequencing the region between the SstI/Eco47II to confirm the desired mutations have been made, and expressing the protein in COS-7 cells. This can be done to optimize the activity of the single chain gonadotropin. The protein is expected to function as a monomer or to combine to form active homodimers. In addition, several copies of the protein would be expected to combine to form multimers.
Example 14 Preparation and use of Analog a single chain gonadotropin with lutropin activity. (See Figure 8) The coding sequences for analog #3 listed in Table 1 can be synthesized using the block ligation approach described (54) or they can be prepared in the fashion as described for Analog #2 in Example 13 except that primers #1 and #7 are replaced with primers #8 and #9 and that the hLH B-subunit cDNA is used as a template in place of the hCG B-subunit cDNA. The hLH 8subunit cDNA can be obtained by screening a human pituitary library. The sequence of primer #8 is
ATGAAATCGACGGAATCAGACTCGAGCCAAGGAATGGAGATGCTCCAGG
GGCTGCT-3' and the sequence of primer #9 is 3'-
GTGGGGAACTGGACACTGGTGGGGGTTCCTAGGCCATCGCCTAGACCATC
S* The final PCR product is digested with restriction enzymes XhoI and BamHI 20 and subcloned into the XhoI/BamHI sites of the expression vector created as described in Example 12. The sequences of the coding regions between the XhoI and BamHI sites of several constructs are determined until one is found that encodes a protein having the amino acid sequence shown in Figure 8. The expressed protein is expected to lack amino acid residues MEMLQGLLLLLLLSMGGAWA that are 25 the part of the signal sequence found in hLH B-subunit and which are removed by the cell during protein synthesis. This vector is expressed in COS-7 cells and the protein released into the medium is tested for its ability to inhibit the binding of radioiodinated hCG to monoclonal antibodies or to antisera prepared against hCG.
The protein made by the COS-7 cells will compete with radioiodinated hCG for binding to one or more of the following antibodies: B101 (obtained from Columbia University), B105 (obtained from Columbia University), A201 (obtained from Columbia University), HCU061 (obtained from Hybritech), ZMCG7 (obtained from Pierce) or 518B7 (obtained from Dr. Janet Roser, University of California at Davis). The protein released into the medium will compete with radiolabeled hCG for binding to receptors on corpora lutea as described by Campbell, Dean-Emig, and Moyle It would be expected to stimulate testosterone formation in a Leydig cell assay performed similar to that described by Moyle et al. (37) and to stimulate ovulation in female animals and to stimulate testosterone formation in male mammals. This analog would also be expected to be a good starting point for -46use in designing vaccines to enhance or inhibit fertility using the template procedure outlined earlier. This analog is shown in Table 1 as Analog #3 and contains a linker sequence of GSGSGSGS. This linker can be modified by digesting the expression vector with BamHI and Eco47I endonuclease restriction enzymes, discarding the short piece, ligating a cassette of synthetic double stranded DNA with the desired amino acid codons containing any number of glycine or serine codons or other amino acid codons into the BamHI/Eco47m site by standard methods, sequencing the region between the BamHI/Eco47M to confirm the desired mutations have been made, and expressing the protein in COS-7 cells. This can be done to optimize the activity of the single chain gonadotropin. The protein is expected to function as a monomer or to combine to form active homodimers. In addition, several copies of the protein would be expected to combine to form multimers.
C.
15 Example Preparation and use of Analog a single chain gonadotropin with follitropin activity. (See Figure 9) 20 The coding sequences for analog #4 listed in Table 1 can be synthesized using the block ligation approach described (54) or they can be prepared in the fashion as described for Analog #2 in Example 13 except that primers #1 and #7 are replaced with primers #10 and #11 and that the hFSH 6subunit cDNA is used as a template in place of the hCG B-subunit cDNA. The 25 hFSH B-subunit cDNA can be obtained from a human pituitary gland library. The sequence of primer #10 is
ATGAAATCGACGGAATCAGACTCGAGCCAAGGATGAAGACACTCCAGTT
TTTCTTCC-3' and the sequence of primer #11 is 3'- The final PCR product is digested with restriction enzymes Xhol and BamHI and subcloned into the XhoI/BamHI sites of the expression vector created as described in Example 12. The sequences of the coding regions between the Xbal and BamHI sites of several constructs are determined until one is found that encodes a protein having the amino acid sequence illustrated in Figure 9. The expressed protein is expected to lack amino acid residues MKTLQFFFLFCCWKAICC that are the part of the signal sequence found in hFSH B-subunit and which are removed by the cell during protein synthesis. The vector is expressed in COS-7 cells and the protein made by the cells will compete with radioiodinated hFSH for binding to one or more of the following antibodies: ZMFS1 (obtained from Pierce), A201 (obtained -47from Columbia University), HCU061 (obtained from Hybritech), FSG761 (obtained from Hybritech), FSR093.3 (obtained from Hybritech), FSH107 (obtained from Hybritech), FSB061 (obtained from Hybritech), FSM210 (obtained from Hybritech), and FSM268 (obtained from Hybritech). The protein released into the medium will compete with hFSH for binding to receptors on bovine testes as described by Campbell, Dean-Emig, and Moyle It would be expected to stimulate estradiol formation in a granulosa cell assay performed similar to that described by Skaf et al (65) and to stimulate follicle development and spermatogenesis in female and male mammals. This analog is also a useful starting compound to select for an immunogen that elicits antibodies to FSH and is part of a contraceptive vaccine. This analog is shown in Table 1 as Analog #4 and contains a linker sequence of GSGSGSGS. This linker can be modified by digesting the expression vector with Apal and Eco47m endonuclease restriction enzymes, discarding the short piece, ligating a cassette of synthetic double stranded DNA 15 with the desired amino acid codons containing any number of glycine or serine codons or other amino acid codons into the BamHI/Eco47M site by standard methods, sequencing the region between the ApaI/Eco47III to confirm the desired mutations have been made, and expressing the protein in COS-7 cells. This can be done to optimize the activity of the single chain gonadotropin. The protein is 20 expected to function as a monomer or to combine to form active homodimers. In addition, several copies of the protein would be expected to combine to form multimers.
Example 16 Preparation and use of Analog a single chain gonadotropin with FSH activity that is structurally more similar to hCG than hFSH. (See Figure The coding sequences for analog #5 listed in Table 1 can be synthesized using the block ligation approach described (54) or they can be prepared in the fashion as described for Analog #2 in Example 13 except that primer #7 is replaced with primer #12. The sequence of primer #12 is 3'-
CGACAGTCGACAGTTACACGTGAGACGCTGTCGCTGTCGTGACTAACATG
ACACGCTCCGGACCCCGGGTCGATGACGAGGAAACCACTrACTTTCTTC CTAGGCCATCG-5'. The final PCR product is digested with restriction enzymes Xhol and BamHI and subcloned into the XhoI/BamHI sites of the expression vector created as described in Example 12. The sequences of the coding regions between the Xbal and BamHI sites of several constructs are determined until one is found that encodes a protein having the amino acid sequence illustrated in Figure 10. The -48expressed protein is expected to lack amino acid residues MEMLQGLLLLLLLSMGGAWA that are the part of the signal sequence found in hCG B-subunit and which are removed by the cell during protein synthesis. This vector is expressed in COS-7 cells and the protein released into the medium is tested for its ability to inhibit the binding of radioiodinated hCG to monoclonal antibodies or to antisera prepared against hCG. The protein made by the COS-7 cells will compete with radioiodinated hCG for binding to one or more of the following antibodies: B101 (obtained from Columbia University), B105 (obtained from Columbia University), B107 (obtained from Columbia University), B109 (obtained from Columbia University), A201 (obtained from Columbia University), HCU061 (obtained from Hybritech), or HC0514 (obtained from Hybritech), ZMCG18 (obtained from Pierce), ZMCG13 (obtained from Pierce), or ZMCG7 (obtained from Pierce) or 518B7 (obtained from Dr. Janet Roser, University of California at Davis). The protein released into the medium will compete with 15 hFSH for binding to receptors on bovine testes as described by Campbell, Dean- Emig, and Moyle It would be expected to stimulate estradiol formation in a granulosa cell assay performed similar to that described by Skaf et al (65) and to stimulate follicle development and spermatogenesis in female and male mammals.
This analog is shown in Table 1 as Analog #5 and contains a linker sequence of 20 GSGSGSGS. This linker can be modified by digesting the expression vector with ApaI and Eco47III endonuclease restriction enzymes, discarding the short piece, ligating a cassette of synthetic double stranded DNA with the desired amino acid codons containing any number of glycine or serine codons or other amino acid codons into the BamHI/Eco47III site by standard methods, sequencing the region 25 between the ApaI/Eco47III to confirm the desired mutations have been made, and expressing the protein in COS-7 cells. This can be done to optimize the activity of the single chain gonadotropin. The protein is expected to function as a monomer or to combine to form active homodimers. In addition, several copies of the protein would be expected to combine to form multimers.
Example 17 Preparation and use of Analog a single chain gonadotropin with FSH and LH activities that is structurally more similar to hCG than hFSH. (See Figure 11) The coding sequences for analog #6 listed in Table 1 can be synthesized using the block ligation approach described (54) or they can be prepared in the fashion as described for Analog #2 in Example 13 except that -49primer #7 is replaced with primer #13. The sequence of primer #13 is 3'-
ACGGCGGCGTCGTGGTGACTGACGTGACACGCTCCGGACCCCGGGTCGA
The final PCR product is digested with restriction enzymes Xhol and BamHI and subcloned into the XhoI/BamHI sites of the expression vector created as described in Example 12.
The sequences of the coding regions between the XbaI and BamHI sites of several constructs are determined until one is found that encodes a protein having the amino acid sequence illustrated in Figure 11. The expressed protein is expected to lack amino acid residues MEMLQGLLLLLLLSMGGAWA that are the part of the signal sequence found in hCG-subunit and which are removed by the cell during protein synthesis. This vector is expressed in COS-7 cells and the protein released into the medium is tested for its ability to inhibit the binding of radioiodinated hCG to monoclonal antibodies or to antisera prepared against hCG. The protein made by the COS-7 cells will compete with radioiodinated hCG for binding to one or more 15 of the following antibodies: B101 (obtained from Columbia University), B105 (obtained from Columbia University), B107 (obtained from Columbia University), B109 (obtained from Columbia University), A201 (obtained from Columbia University), HCU061 (obtained from Hybritech), or HC0514 (obtained from Hybritech), ZMCG18 (obtained from Pierce), ZMCG13 (obtained from Pierce), or 20 ZMCG7 (obtained from Pierce) or 518B7 (obtained from Dr. Janet Roser, University of California at Davis). The protein released into the medium will compete with hFSH for binding to receptors on bovine testes as described by Campbell, Dean-Emig, and Moyle It would be expected to stimulate estradiol formation in a granulosa cell assay performed similar to that described by Skaf et al 25 (65) and to stimulate follicle development and spermatogenesis in female and male mammals. The protein released into the medium will compete with radiolabeled hCG for binding to receptors on corpora lutea as described by Campbell, Dean- Emig, and Moyle It would be expected to stimulate testosterone formation in a Leydig cell assay performed similar to that described by Moyle et al. (37) and to stimulate ovulation in female animals and to stimulate testosterone formation in male mammals. This analog is shown in Table 1 as Analog #6 and contains a linker sequence of GSGSGSGS. This linker can be modified by digesting the expression vector with Apal and Eco47III endonuclease restriction enzymes, discarding the short piece, ligating a cassette of synthetic double stranded DNA with the desired amino acid codons containing any number of glycine or serine codons or other amino acid codons into the BamHI/Eco47III site by standard methods, sequencing the region between the ApaI/Eco47III to confirm the desired mutations have been made, and expressing the protein in COS-7 cells. This can be done to optimize the activity of the single chain gonadotropin. The protein is expected to function as a monomer or to combine to form active homodimers. In addition, several copies of the protein would be expected to combine to form multimers.
Example 18 Preparation and use of Analog a single chain gonadotropin with FSH and LH activities that is structurally more similar to hCG than hFSH.
The coding sequences for analog #7 listed in Table 1 can be synthesized using the block ligation approach described (54) or they can be prepared in the fashion as described for Analog #2 in Example 13 except that primer #7 is replaced with primer #14. The sequence of primer #14 is 3'-
*ACGGCGGCGTCGTGGTGACTGACGTGACACGCTCCGGACCCCGGGTCGA
15 TGACGAGGAAACCACTTCCTAGGCCATCG-5'. The final PCR product is digested with restriction enzymes XhoI and BamHI and subcloned into the XhoI/BamHI sites of the expression vector created as described in Example 12.
The sequences of the coding regions between the XbaI and BamHI sites of several constructs are determined until one is found that encodes a protein having the amino 20 acid sequence illustrated in Figure 12. The expressed protein is expected to lack amino acid residues MEMLQGLLLLLLLSMGGAWA that are the part of the signal sequence found in hCG B-subunit and which are removed by the cell during protein synthesis. This vector is expressed in COS-7 cells and the protein released into the medium is tested for its ability to inhibit the binding of radioiodinated hCG to 25 monoclonal antibodies or to antisera prepared against hCG. The protein made by the COS-7 cells will compete with radioiodinated hCG for binding to one or more of the following antibodies: B101 (obtained from Columbia University), B105 (obtained from Columbia University), B107 (obtained from Columbia University), B109 (obtained from Columbia University), A201 (obtained from Columbia University), HCU061 (obtained from Hybritech), or HC0514 (obtained from Hybritech), ZMCG18 (obtained from Pierce), ZMCG13 (obtained from Pierce), or ZMCG7 (obtained from Pierce) or 518B7 (obtained from Dr. Janet Roser, University of California at Davis). The protein released into the medium will compete with hFSH for binding to receptors on bovine testes as described by Campbell, Dean-Emig, and Moyle It would be expected to stimulate estradiol formation in a granulosa cell assay performed similar to that described by Skaf et al and to stimulate follicle development and spermatogenesis in female and male mammals. The protein released into the medium will compete with radiolabeled hCG for binding to receptors on corpora lutea as described by Campbell, Dean- -51 Emig, and Moyle It would be expected to stimulate testosterone formation in a Leydig cell assay performed similar to that described by Moyle et al. (37) and to stimulate ovulation in female animals and to stimulate testosterone formation in male mammals. This analog is shown in Table 1 as Analog #17 and contains a linker sequence of GSGSGSGS. This linker can be modified by digesting the expression vector with Apal and Eco47III endonuclease restriction enzymes, discarding the short piece, ligating a cassette of synthetic double stranded DNA with the desired amino acid codons containing any number of glycine or serine codons or other amino acid codons into the BamHI/Eco47III site by standard methods, sequencing the region between the ApaI/Eco47III to confirm the desired mutations have been made, and expressing the protein in COS-7 cells. This can be done to optimize the activity of the single chain gonadotropin. The protein is expected to function as a monomer or to combine to form active homodimers. In addition, several copies of the protein would be expected to combine to form 15 multimers.
13) The coding sequences for analog #8 listed in Table 1 can be 25 synthesized using the block ligation approach described (54) or they can be prepared in the fashion as described for Analog #2 in Example 13 except that primer #7 is replaced with primer #15. The sequence of primer #15 is 3'-
ACGGCGGCGTCGTGGTGACTGACGTGACACGCTCCGGACCCCGGGTCGA
The final PCR product is digested with restriction enzymes Xhol and BamHI and subcloned into the Xho/Bam sites of the expression vector created as described in Example 1 The 20 Preparation and use of Analog ion, a single chain gonadotropin wites of several constructs are determined until one is found that encodes a protein having the amino acid sequence illustrated in Figure 13. The expressed protein is expected to lack amino activities that is structurally more similar to hCG that are the part of the igure sequence found in hCG 3-subunit and which are removed by the cell during protein synthesis. This vector is expressed in COS-7 cells and the protein released into the medium is tested for its ability to inhibit the binding of radioiodinated hCG to monoclonal antibhe codies or to antisera prepa analog listed inhCG. The protein made1 can b 25 synthesized using the block ligation approach described (54) or they can be prepared in the fashion as described for Analog #2 in Example 13 except that primer #7 is replaced with primer #15. The sequence of primer #15 is 3'-
ACGGCGGCGTCGTGGTGACTGACGTGACACGCTCCGGACCCCGGGTCGA
The final PCR product is digested with restriction enzymes XhoI and BamHI and subcloned into the XhoI/BamHI sites of the expression vector created as described in Example 12.
The sequences of the coding regions between the XbaI and BamHI sites of several constructs are determined until one is found that encodes a protein having the amino acid sequence illustrated in Figure 13. The expressed protein is expected to lack amino acid residues MEMLQGLLLLLLLSMGGAWA that are the part of the signal sequence found in hCG B-subunit and which are removed by the cell during protein synthesis. This vector is expressed in COS-7 cells and the protein released into the medium is tested for its ability to inhibit the binding of radioiodinated hCG to monoclonal antibodies or to antisera prepared against hCG. The protein made by -52the COS-7 cells will compete with radioiodinated hCG for binding to one or more of the following antibodies: B101 (obtained from Columbia University), B105 (obtained from Columbia University), B107 (obtained from Columbia University), B109 (obtained from Columbia University), A201 (obtained from Columbia University), HCU061 (obtained from Hybritech), or HC0514 (obtained from Hybritech), ZMCG18 (obtained from Pierce), ZMCG13 (obtained from Pierce), or ZMCG7 (obtained from Pierce) or 518B7 (obtained from Dr. Janet Roser, University of California at Davis). The protein released into the medium will compete with hFSH for binding to receptors on bovine testes as described by Campbell, Dean-Emig, and Moyle It would be expected to stimulate estradiol formation in a granulosa cell assay performed similar to that described by Skaf et al and to stimulate follicle development and spermatogenesis in female and male mammals. The protein released into the medium will compete with radiolabeled hCG for binding to receptors on corpora lutea as described by Campbell, Dean- :i 15 Emig, and Moyle It would be expected to stimulate testosterone formation in a Leydig cell assay performed similar to that described by Moyle et al. (37) and to stimulate ovulation in female animals and to stimulate testosterone formation in male mammals. This analog is shown in Table 1 as Analog #8 and contains a linker sequence of GSGSGSGS. This linker can be modified by digesting the S 20 expression vector with Apal and Eco47III endonuclease restriction enzymes, discarding the short piece, ligating a cassette of synthetic double stranded DNA with the desired amino acid codons containing any number of glycine or serine codons or other amino acid codons into the BamHI/Eco47I site by standard methods, sequencing the region between the ApaI/Eco47III to confirm the desired 25 mutations have been made, and expressing the protein in COS-7 cells. This can be i done to optimize the activity of the single chain gonadotropin. The protein is expected to function as a monomer or to combine to form active homodimers. In addition, several copies of the protein would be expected to combine to form multimers.
Example Preparation and use of Analog a single chain gonadotropin with follitropin activity. (See Figure 14) The coding sequences for analog #9 listed in Table 1 can be synthesized using the block ligation approach described (54) or they can be prepared by digesting the construct described in Example 15 used to express Analog 4 with the restriction enzymes Apal and BamHI. The small piece is replaced with a -53 cassette of synthetic DNA to give the sequence illustrated in Figure 14. The coding sequence between the Apal and BamHI sites of several constructs is determined until one is found that encodes a protein having the amino acid sequence illustrated in Figure 14. The expressed protein is expected to lack amino acid residues MKTLQFFFLFCCWKAICC that are the part of the signal sequence found in hFSH B-subunit and which are removed by the cell during protein synthesis. The vector is expressed in COS-7 cells and the protein made by the cells will compete with radioiodinated hFSH for binding to one or more of the following antibodies: ZMFS1 (obtained from Pierce), A201 (obtained from Columbia University), HCU061 (obtained from Hybritech), FSG761 (obtained from Hybritech), FSR093.3 (obtained from Hybritech), FSH107 (obtained from Hybritech), FSB061 (obtained from Hybritech), FSM210 (obtained from Hybritech), and FSM268 (obtained from Hybritech). The protein released into the medium will compete with hFSH for binding to receptors on bovine testes as described by Campbell, 15 Dean-Emig, and Moyle It would be expected to stimulate estradiol formation in a granulosa cell assay performed similar to that described by Skaf et al (65) and to stimulate follicle development and spermatogenesis in female and male mammals. This analog is also a useful starting compound to select for an immunogen that elicits antibodies to FSH and is part of a contraceptive vaccine.
20 This analog is shown in Table 1 as Analog #9 and contains a linker sequence of GSGSGSGS. This linker can be modified by digesting the expression vector with Apal and Eco47III endonuclease restriction enzymes, discarding the short piece, ligating a cassette of synthetic double stranded DNA with the desired amino acid codons containing any number of glycine or serine codons or other amino acid 25 codons into the BamHI/Eco47II site by standard methods, sequencing the region between the ApaI/Eco47I to confirm the desired mutations have been made, and expressing the protein in COS-7 cells. This can be done to optimize the activity of the single chain gonadotropin. The protein is expected to function as a monomer or to combine to form active homodimers. In addition, several copies of the protein would be expected to combine to form multimers.
Example 21 Preparation and use of Analog #10, a single chain gonadotropin with follitropin activity. (See Figure The coding sequences for Analog #10 listed in Table 1 can be synthesized using the block ligation approach described (54) or they can be prepared by digesting the construct described in Example 15 used to express Analog -54- 4 with the restriction enzymes Apal and BamHI. The small piece is replaced with a cassette of synthetic DNA to give the sequence illustrated in Figure 15. The coding sequence between the Apal and BamHI sites of several constructs is determined until one is found that encodes a protein having the amino acid sequence illustrated in Figure 15. The expressed protein is expected to lack amino acid residues MKTLQFFFLFCCWKAICC that are the part of the signal sequence found in hFSH B-subunit and which are removed by the cell during protein synthesis. The vector is expressed in COS-7 cells and the protein made by the cells will compete with radioiodinated hFSH for binding to one or more of the following antibodies: ZMFS1 (obtained from Pierce), A201 (obtained from Columbia University), HCU061 (obtained from Hybritech), FSG761 (obtained from Hybritech), FSR093.3 (obtained from Hybritech), FSH107 (obtained from Hybritech), FSB061 (obtained from Hybritech), FSM210 (obtained from Hybritech), and FSM268 (obtained from Hybritech). The protein released into the medium will compete 15 with hFSH for binding to receptors on bovine testes as described by Campbell, Dean-Emig, and Moyle It would be expected to stimulate estradiol formation in a granulosa cell assay performed similar to that described by Skaf et al (65) and to stimulate follicle development and spermatogenesis in female and male mammals. This analog is also a useful starting compound to select for an 20 immunogen that elicits antibodies to FSH and is part of a contraceptive vaccine.
This analog is shown in Table 1 as Analog #10 and contains a linker sequence of GSGSGSGS. This linker can be modified by digesting the expression vector with Apal and Eco47III endonuclease restriction enzymes, discarding the short piece, ligating a cassette of synthetic double stranded DNA with the desired amino acid codons containing any number of glycine or serine codons or other amino acid .codons into the BamHI/Eco47II site by standard methods, sequencing the region between the ApaI/Eco47III to confirm the desired mutations have been made, and expressing the protein in COS-7 cells. This can be done to optimize the activity of the single chain gonadotropin. The protein is expected to function as a monomer or to combine to form active homodimers. In addition, several copies of the protein would be expected to combine to form multimers.
Example 22 Preparation of an a-subunit analog lacking glycosylation sites. (See Figure 16) Analogs 1-10 are expected to contain 4 asparagine-linked oligosaccharides since they contain 4 sets of codons for the sequence Asparagine-X- Threonine/Serine where X is any amino acid except proline. Removal of the asparagine-linked oligosaccharides, particularly those of the a-subunit, has been shown to reduce hormone efficacy. The asparagine-linked glycosylation signals can be removed from the a-subunit portion of the single chain gonadotropins using PCR as described here. PCR primer 16 having the sequence:
TGCTTCTCTAGAGCATATCCCACTCCACTAAGGTCCAAGAAGACGATGTT
GGTCCAAAAGCAAGTCACCT-3' and PCR primer 17 having the sequence: 3'-
CAAAGTTTCACCTCGTTGTGTGCCGCACGGTGACGTCATGAACAATAATA
are used in a PCR reaction with a the vector that is capable of directing the expression of Analog 1 and that was described in Example 12 and Figure 6. After 25 cycles in the conditions described in Example 12, the PCR product and the expression vector are digested with XbaI and KpnI. The small fragment produced by digestion of the vector is discarded and the digested PCR product is ligated into the vector in its place. This produces an expression vector that encodes Analog 11, an analog that contains only 2 Asnlinked glycosylation signals but that is expected to retain its affinity for antibodies Iand antisera that bind to hCG. It is also expected to retain its affinity for LH receptors as shown by its ability to compete with hCG for binding to membranes from rat corpora lutea. However, it is expected to have a reduced ability to induce 20 signal transduction, expecially when its ability to elicit cyclic AMP accumulation is tested It is possible to create similar derivatives of Analogs 2-10 in which the oligosaccharides are removed from the portion of the protein derived from the asubunit by digesting each of the expression vectors with BamHI and KpnI, discarding the smaller piece, and ligating the small BamHI/KpnI fragment obtained 25 by digestion of Analog 11. Thus, Analog 2 would become Analog 12, Analog 3 would become Analog 13, Analog 4 would become Analog 14, Analog 5 would become Analog 15, Analog 6 would become Analog 16, Analog 7 would become Analog 17, Analog 8 would become Analog 18, Analog 9 would become Analog 19, and Analog 10 would become Analog 20. Note that it would also be possible to remove only one of the two glycosylation signals on the portion of the single chain gonadotropins derived from the a-subunit simply by changing the sequences of primers 16 and 17 during their synthesis and following the protocol outlined here.
Each of these analogs would exhibit the same antibody and receptor binding as their precursors. They would have reduced efficacy and as a consequence, they would inhibit signal transduction. Analogs 11, 12, and 13 would reduce the activity of LH and would stimulate fertility when given in the early part of the follicular phase of the menstrual cycle. They would reduce the activity of hCG and would prevent fertility when administered near the time of expected menses.
-56 Example 23 Preparation of Analog la lacking asparagine-linked oligosaccharides. (See Figures 17 and 18) The efficacy of gonadotropins is proportional to their content of carbohydrates and while Analogs 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20 have lower efficacy, it is possible to reduce their efficacy further by eliminating all oligosaccharide chains. The asparagine-linked oligosaccharide chains can be eliminated from Analog 11 by PCR SOEing (63) using primers 1 and 18 in one reaction and primers 2 and 19 in a second reaction. The expression vector for Analog 11 serves as a template in both reactions. The sequence of primer #18 is 5'-CGGGGTAGGTTCGGTGGGACCGACACCTCTTCCTCCCGACGGGG-3' and the sequence of primer #19 is 3'- 15 GTGGAGAAGGAGGGCTGCCCCGTGTGCATCACCGTCAACACCACCATC- After 25 temperature cycles at 94°C (30 sec), 55°C (60 sec), and 72*C sec), 1 1/l of each PCR reaction is mixed with primer #5 and additional primer #2, new buffer, enzyme, and deoxynucleotide triphosphates. The reaction product after 25 additional cycles is cut with XhoI and BamHI and substituted for the original DNA found between the XhoI/BamHI sites of the vector encoding Analog 11. This is accomplished by digesting the vector with XhoI and BamHI, discarding the small fragment and then ligating the large fragment with the XhoI/BamHI digested PCR product. Several clones are subjected to DNA sequencing until the one encoding the analog outlined in Figure 18 termed Analog la is obtained. When this is 25 expressed in COS-7 cells, the protein that is made will be recognized by the same antibodies and antisera as Analog 1. Analog la will also bind to lutropin receptors but will have reduced efficacy relative to hCG. Thus, it will be useful for reducing the function of LH or hCG. When administered early in the follicular phase of the menstrual cycle, Analog la will reduce androgen synthesis. As a consequence, estradiol synthesis will decline, FSH levels will rise and fertility will be stimulated.
Analog la will also be useful for inhibiting premature luteinization of the follicle.
When administered in the luteal phase at about the time of expected menses, the analog will block the actions of hCG and serve as a menses inducer and an inhibitor of fertility. Analog la will also serve as a good starting compound to design vaccines using the template strategy described earlier.
57 Example 24 Preparation of other gonadotropins lacking asparagine-linked oligosaccharides The coding vectors for Analogs 2a, 5a, 6a, 7a, and 8a are readily prepared from Analog la and Analogs 12, 15, 16, 17, and 18. Analog la is digested with KpnI and MstII and the small fragment discarded. The large fragment is ligated separately to the small fragment prepared by KpnI-MstlI digestion of the coding vectors for Analogs 12, 15, 16, 17, and 18. Analogs 2a, 5a, 6a, 7a, and 8a will bind the same antibodies and receptors as Analogs 2, 5, 6, 7, and 8, respectively. However, their abilities to elicit signal transduction will be reduced. Consequently, they will serve as inhibitors. Analog 2a will be effective primarily in blocking binding of hormones to LH receptors. Depending on the time that it is administered, Analog 2a will elicit fertility when given early in the 15 menstrual cycle) or will inhibit fertility when given near the time of implantation or expected menses). In this regard Analogs la and 2a will have similar activities. Analog 5a will be effective primarily in blocking binding of hormones to FSH receptors. Analog 5a will be useful for suppressing hyperovarian stimulation. Analogs 6a, 7a, and 8a will be inhibitors of binding to LH and FSH receptors. These will be useful for suppressing hyperovarian stimulation and for blocking premature luteinization.
The coding vectors for Analogs 3a and 4a can be made by SOEing PCR (63) in which Analogs 13 and 14 serve as templates. The strategy for design of the primers is similar as that described for the preparation of primers used to modify the expression vector for Analog la. When Analogs 3a and 4a are expressed in COS-7 cells, the proteins that are made will be recognized by the same antibodies and antisera as Analogs 3 and 4, respectively. Analog 3a will be useful for inhibiting the activity of hormones that bind to LH receptors. As such it will stimulate fertility when given early in the follicular phase. Analog 4a will be useful for inhibiting the activity of FSH. Analog 3a will be useful as a starting molecule for designing the vaccine to be used to increase fertility using the template strategy and antibodies that are able to partially neutralize the activity of LH. Analog 3a will also be useful as a starting molecule for designing the vaccine to prevent fertility using the template strategy and antibodies that are able to neutralize LH activity. Antibody 4a will also be useful as a starting molecule for designing the anti-FSH vaccine described earlier using the template strategy.
58 The coding vectors for Analogs 9a and 10a can be prepared from the coding vector for Analog 4a. The coding vector for Analog 4a is digested with Ball and KpnI and the small fragment discarded. The small Ball-KpnI fragments from the coding vectors for analogs 19 and 20 are ligated separately with the large Analog 4a fragment to produce coding vectors for Analogs 9a and 10a. When produced in COS-7 cells, Analogs 9a and 10a will have similar antibody and FSH receptor binding specificities as Analogs 9 and 10. Analogs 9a and 10a will have lower efficacy and will inhibit the activity of FSH. Thus, they will be useful for reducing ovarian hyperstimulation. They will also be useful starting vectors for the design of anti-FSH vaccines using the template strategy.
Example Typical procedure for introducing a glycosylation site in a gonadotropin.
Due to the positive influence of oligosaccharide residues on the stability of hormones in circulation, it is often useful to add extra oligosaccharide chains to the proteins. Addition of oligosaccharides can also be used to prevent unwanted antibody or receptor interactions. Surfaces of the protein that do not 20 interact with receptors are useful places to add oligosaccharide chains that are to be used to stimulate hormone function. This can have a valuable effect in modulating the activities of single chain glycoprotein hormones or of modulating the activities of the ca,B-heterodimeric glycoprotein hormones. For example, addition of a glycosylation signal to FSH B-subunit at residues 71-73 to cause the creation of an 25 asparagine-linked oligosaccharide at residue 71 will lead to a hormone that has higher activity. Conversely, addition of a glycosylation residue in this region of the protein after the other glycosylations have been removed will enhance its inhibitory activity. Methods for performing the mutagenesis are standard in the art and range from total synthesis of the coding sequences by block ligation of synthetic oligonucleotides (54) to SOEing PCR Several examples of mutagenesis by SOEing PCR have already been given.
Example 26 Use of sequences other than those derived from human subunits.
Analogs 1-20, Analogs lb-lOb and, in particular, Analogs 1A-lOa will serve as useful starting compounds for template directed vaccine design. For development of hormone-specific vaccines for use in humans, it is useful to make -59analogs similar to those listed in Table 1 with a nonhuman a-subunit in place of the human a-subunit. This is because the bovine a-subunit renders the proteins more dissimilar to the human hormones than the analogs listed in Table 1. The approach to designing single chain glycoprotein hormones is similar to that listed in Examples 12-21 except that the coding sequences for the nonhuman a-subunits are substituted for the human a-subunit sequences illustrated. Similarly, the glycosylation signals can be removed by altering the codons for asparagine or serine or threonine or inserting a proline between asparagine and the serine or threonine.
In addition, when using the template strategy to design immunogens it is often desirable to start with a nonhuman molecule that has little, if any affinity for the templates used in positive selection and to introduce residues that will result in selection. These analogs can be prepared by substituting the FSH, LH, or TSH B-subunit sequences from nonhuman sources in place of the human FSH, LH, and 15 hCG sequences illustrated in Examples 12-25 and Table 1.
S
Table 1 Structures of Single Chain Gonadotropins Analog Composition I n-hCGS(I-145)-Linker-hunma(I.92)-c 2 n-hCGB(1-1 14)-Linkcr-huniano(I-92)-c 3 n-hLHB(I-1 14)-Linker-hiimana(1.92)-c 4 n-hFSHO(1-1 I 1)-Linker-humana(1.92)-c n-hCG8(I-93)-hFSHII(88.1 1 I)-Linker-humanar(1-92)-c 6 n-hCG8(1.100)-hFSHJI(9S-1 I I)-Linker-humana(1-92)-c 7 n-hCGB(1-100)-hFSHB(9S.1O8).Linker-humana(I-92)-c 8 n-hCGB(1-100)-hFSHI3(95-103)-DDPR-Linker-humana(I-92..c 9. FH(-0)Lne-uma(-2n-hFSHB(I-108)-Linker-humana(1-92)-c la. 1 n-hFSB(1-14)-NL3XNkcr-humnkr-huan2)-cN5XN7 is la n-hCGO(1- 14)IN13X,N3OXI-Linker-humana(I.92)[N52X.N78X].c 15 3a n-hCGB(1-1 14)[N3X-Linker-human(.92)N52XN78X-c 3a n-hLSHB(- 14)NOXIN-Linker-human-2)[N2XN78X]-c
)Q-
n-hFSHI(1-1 I )N7X,N24X]-Linker8-uma-nke-hnl(-92)[N52X,N78X]-c 96a n-hCGB(1-3)N 13X,N3X-hFSHB(8- 1 )-Linker-humanc(-92)N52X,N78X-c a n-hCGB(1-100)[N13XN30X]-bFSHS(95-108 )-Linker-humanaf(1-92)[N52XN78X]-c 8a n-hCGB(l-100)(N13X,N3OX]-hFSHB(95-108)-D-Linker-humanI)[N 2)5X,N78X]-c .9a n-hFSHB(1-108)-Lirnkr-humang(I-92)-N52XN78X-c n-hFSHI(-104)[N7X.N24X]-Linker-humanca(1-92)-c lb n-hCG8(1-14S)fN13XN30XP78X.V71-Linker-huma(-92)N52X,N78X]-c 2b n-hCGB(I114)[N13X.N30X,778XV7T-Linkr-humancx(I-92)[NS2X,N78X]-c 3b n-hLHO(I114)[N3OX,P78X.V79T1-Linker-humanu(1-92)[N52X,N78X-c 4b n-hFSHB(l -11 1)[N7X.N24X,D71N,L73T1-Linker-huniancu(I-92)fN52X,N78XJ-c n-hCGB(1-93)[N 13X,N3OX,?78X.V79TJ-hFSHB(88-1IlI)-Linker-huniana(I-92)N52X.N78X]-c 6b n-hCGB(1-lOO)[NI 3X,N3OXP78XV7911-hFSHB(95-1 1 )-Linker-humanot41.92)[NS2XN78X]-c 7b n-hCGOI1-100)[N 13X.N3OXP78X.V7971].FSHB(95108)-Linker-huiana(-92)[N52X,N78X-c 8b n-hCGB(1-100)(NI 3XN3OX,P78X.V7971-hFSHS(95-1O3)-DDPR-Linker-humano(I- 92)(NSZX,N78X1-c 9b n-hFSHO(I-1O8)[N7X,N24X,D7INL73T]-Linker-hunana(1 -92)-(NS2X,N78X3-c n-FSHB(I-104)[N7XN24X.D71N,L73J-Linker-humamx(I-92)-NS2X,N78X]-c 61 Definitions of the letters and sequences in Table 1 refers to the N-terminus of the protein.
refers to the C-terminus of the protein.
"hCGI3(1- 145)" refers to the hCG B-subunit amino acid sequence residues 1-145: SKEPLRPRCRPINATLAVEKEGCPVCITVNTrICAGYCPTMTRVLQGVLPALP
QVVCNYRDVRFESILPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPK
DHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
:"hCGB( 14) refers to the hCG B-subunit amino acid sequence residues 1- 114: 15 SKEPLRPRCRPINATLAVEKEGCPVCITVNTrICAGYCPTMTRVLQGVLPALP
QVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPK
DHPLTCDDPR
"hCGB(1-93)" refers to the hCG B-subunit amino acid sequence residues 1-93:
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALP
QVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALC
"hLHB(1-1 14)" refers to the hLH B-subunit amino acid sequence residues 1-114:
SRIEPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLP
QVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKD
HPLTCDHPQ
hFSHB( 1-111) refers to the IIFSH B-subunit amnino, acid sequence residues 1 -111:
NSCELTNITIAVEKEGCGFCITINFTWCAGYCYTRDLVYKDPARPKIQKTCTF
KELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYC
SFGEMKE
62 Definitions of the letters and sequences in Table 1 (continued) "hFSHB(I-108)" refers to the 1IFSH B-subunit amino acid sequence residues 1-108: NSCELTNITIAVEKEGCGFCITINnrWCAGYCYTRDLVYKDPARPIjcQKTCTm
KELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYC
SFGE
"hFSHI3(1-104)" refers to the hFSH Bl-subunit ammno acid sequence residues 1-104:
NSCELTNITIAVEKEGCGFCMTIWCAGYCYTRDLVYKDPARPKIQKTCTF
KELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYC
"hFSHB(88-1 11)" refers to the hFSH B-subunit amino acid sequence residues 88- 111:
DSDTVRGLGPSYCSFGEMKE
"hFSHB(95-1 11)" refers to the hFSII B-subunit amino acid sequence residues 108: .9 9 TVRGLGPSYCSFGEMK "hFSHB(95-103)" refers to the hFSH B-subunit amino acid sequence residues 103:
TVRGLGPSY
"N13X" refers to the substitution of glutamine or other amino acid for hCG Bsubunit residue asparagine 13 and analogs "N3OX" refers to the substitution of glutamine or other amino acid for hCG or hLH B-subunit residue asparagine 30 and analogs -63- Definitions of the letters and sequences in Table 1 (continued) "N52X" refers to the substitution of glutamine or other amino acid for human asubunit residue asparagine 52 and analogs "N78X" refers to the substitution of glutamine or other amino acid for human asubunit residue asparagine 78 and analogs "P78X" refers to the substitution of any amino acid except proline for proline 78 in the B-subunits of hCG or hLH and analogs "V79T" refers to the substitution of threonine or serine for valine 79 in hCG or hLH B-subunits and analogs 15 "D71N" refers to the substitution of asparagine for aspartic acid 71 in hFSH Bsubunits and analogs "L73T" refers to the substitution of threonine or serine for leucine 73 in hFSH 8subunits and analogs "humana(1-92)" refers to the human a-subunit sequence residues 1-92
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKN
VTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
"Linker" refers to a sequence containing repeating glycine and serine amino acids such as GS, GSGS, GSGSGS, GSGSGSGS, GSGSGSGSGS or any other sequence of amino acids that permits the 6- and a-subunit sequences of the single chain gonadotropin to form a complex in which the a- and B-subunit portions combine with the B- and a-subunit portions of the same or other molecule.
"DDPR" refers to the amino acid sequence Asparagine-Asparagine-Proline- Arginine -64- Notes for Table 1: 1. The order of the components from left to right in the table is the order in which the components occur in the protein from the amino-terminus to the carboxy-terminus.
2. Due to the high conservation of sequence in all vertebrate gonadotropins that can be seen from the alignment of their cysteine residues, single chain gonadotropins can be prepared by substitution of any homologous residues for the corresponding portions of the hCG, hLH, and hFSH B-subunits.
3. The sequence of the other vertebrate gonadotropin a-subunits can be substituted for humana(1-92). This includes but is not limited to bovine asubunit residues 1-96.
4. As shown, the order of the components has the sequences derived from the B-subunit amino-terminal of the sequences derived from the a-subunit.
The order of the components in the table can be reversed such that the a-subunit sequences are amino-terminal of the B-subunit sequences.
5. The amino acid sequences are shown in the standard single letter code except as noted.
26. Coding sequences for all these analogs can be made by standard recombinant DNA methods that are well known in the art. One procedure for making these is that provided by Campbell et al. They can be expressed in eukaryotic cells by methods well known in the art using vectors that have been designed for eukaryotic expression and that are available from InVitrogen, San Diego, CA. Those that do not contain oligosaccharide chains can also be made in E. coli by methods well known in the art using vectors such as the pET vectors that can be obtained from Novagen.
7. The glycosylation sites at hCG B-subunit asparagines 13 and/or can be destroyed by substitution of the asparagine as illustrated and/or by substitution of residues 14 and/or 31 with a proline and/or by substitution of residues 15 and/or 32 with any other amino acid other than serine or threonine.
8. The glycosylation site at hLH B-subunit asparagine 30 can be destroyed by substitution of the asparagine as illustrated and/or by substitution of residue 31 with a proline and/or by substitution of residue 32 with any other amino acid other than serine or threonine.
9. The glycosylation sites at human a-subunit asparagines 52 and/or 78 can be destroyed by substitution of the asparagine as illustrated and/or by substitution of residues 53 and/or 79 with a proline and/or by substitution of residues 54 and/or 80 with any other amino acid other than serine or threonine.
The glycosylation sites at nonhuman a-subunit asparagines 56 and/or 82 can be destroyed by substitution of the asparagine with any other amino acid and/or by substitution of residues 57 and/or 83 with a proline and/or by substitution of residues 58 and/or 84 with any other amino acid other than serine or 15 threonine.
a 4 a. a -66 Table 2 Properties and uses of the analogs illustrated in Table 1.
Analog Activity 1 2 3 4 6 7 8 9 10 la 2a
LH
LH
LH
FSH
FSH
FSH and LH FSH and LH FSH and LH
FSH
FSH
Anti-LH Anti-U! I. i. a.
a a a a. 6 a a 9 a.
a. 4a 5a 6a 7a 30 8 9a 10a lb 35 2b 3b 4b 5b 6b 7b 8b 9b l~b Anfi-LH Anti-FSH Anti-FSH Anti-FSH and Anti-LH Anti-FSH and Anti-LH Anti-FSH and Antz-LH Anti-FSH Anti-FSH Anti-LH Anti-LH Anti-LH Anti-FSH Anti-FSH Anti-FSH and Anti-LH Anti-FSH and Anti-LH Anti-FSH and Anti-LH Anti-FSH Anti-FSH Induce ovulation; Increase male fertility Induce ovulation; Increase male fertility Induce ovulation; Increase male fertility Induce follicle development; Increase male fertility Induce follicle development; Increase male fertility Induce follicle development; Increase male fertility Induce follicle development. Increase male fertility Induce follicle development; Increase male fertility Induce follicle development, Increase male fertility Induce follicle development; Increase male fertility *Faciiate ovulation; Terminate pregnancy; Reduce androgen secretion *Faciitate ovulation; Terminate pregnancy; Reduce androgen ecretion Faciitate ovulation; Terminate pregnancy; Reduce androgen secretion Treat ovarian hyperstimulation; Reduce spernmatogenesis Treat ovarian hyperstimulation; Reduce spermnatogenesis Treat ovarian hyperstimulation; Reduce spermatogenesis Treat ovarian hyperstimulation; Reduce spermatogenesis Treat ovarian hyperstimulation; Reduce spermatogenesis Treat ovarian hyperstimulation; Reduce spermatogenesis Treat ovarian hyperstimulation; Reduce spermatogenesis *Faciitate ovulation; Terminate pregnancy; Reduce androgen secretion *Facjlirtte ovulation; Terminate pregnancy; Reduce androgen secretion *Facilitate ovulation; Terminate pregnancy;, Reduce androgen secretion Treat ovarian hyperstimulation; Reduce spermatogenesis Treat ovarian hyperstimulation; Reduce spenmatogenesis Treat ovarian hyperstimulation; Reduce spermatogenesis Treat ovarian hyperstimulation. Reduce spermatogenesis Treat ovarian hyperstimulation; Reduce spermatogenesis Treat ovarian hyperstimulation; Reduce spermatogenesis Treat ovarian hyperstimulation; Reduce spermatogenesis.
-67- The compounds of the present invention can be administered to mammals, animals or humans, in amounts effective to provide the desired therapeutic effect. Since the activity of the compounds and the degree of the desired therapeutic effect vary, the dosage level of the compound employed will also vary. The actual dosage administered will also be determined by such generally recognized factors as the body weight of the patient and the individual hypersensitiveness of the particular patient.
Throughout this application, various publications have been referenced. The disclosures in these publications are incorporated herein by reference in order to more fully describe the state of the art.
:I 15 Appendium of References 1. Pierce JG, Parsons TF (1981) Glycoprotein hormones: structure and function. Ann Rev Biochem 50:465-495.
20 2. Yen SSC, Jaffe RB (1986) Reproductive Endocrinology: Physiology, Pathophysiology and Clinical Management. W.B.Saunders, Philadelphia.
*i 3. Moyle WR (1980) Biochemistry of gonadotropin receptors. In: 25 Oxford Reviews of Reproductive Biology Volume 2, edited by Finn CA. Oxford i University Press, New York, pp 123-204.
4. Hsueh AJW, Adashi EY, Jones PBC, Welsh TH,Jr. (1984) Hormonal regulation of the differentiation of cultured ovarian granulosa cells.
Endocr Rev 5:76-127.
Hodgen GD, Itskovitz J (1988) Recognition and maintenance of pregnancy. In: The physiology of reproduction, edited by Knobil E, Neill JD.
Raven Press, New York, pp 1995-2021.
6. DiZerega GS, Hodgen GD (1981) Folliculogenesis in the primate ovarian cycle. Endocr Rev 2:27-49.
-68- 7. Vaishnav MY, Moudgal NR (1991) Effect of specific FSH or LH deprivation on testicular function of the adult rat. Indian J Biochem Biophys 28:513-520.
8. Aravindan GR, Ravindranath N, Moudgal NR (1991) Use of DNA Flowcytometry in assessing gonadotropin regulation of spermatogenesis in monkeys. In: Perspectives in Primate Reproductive Biology, edited by Moudgal NR, Yoshinaga K, Rao AJ, Adiga PR. Wiley Eastern Limited, New Delhi, pp 189- 199.
9. Steinberger E (1971) Hormonal control of mammalian spermatogenesis. Physiol Rev 51:1-22.
00 10. Moudgal NR, Macdonald GJ, Greep RO (1972) Role of 15 endogenous primate LH in maintaining corpus luteum function of the monkey. J Clin Endocrinol Metab 35:113-116.
11. Moudgal NR (1976) Passive immunization with antigonadotropin antisera as a method of menstrual regulation in the primate. In: Immunization with 20 hormones in reproduction research, edited by Nieschlag E. North-Holland, Amsterdam, pp 233.
12. Moudgal NR, Sairam MR, Mahoney J (1985) On the immunogenicity of the beta subunit of ovine luteinizing hormone (oLH beta) and equine chorionic gonadotropin (eCG) in the chimpanzee (Pan troglodytes): effect of antiserum on monkey cycle and early pregnancy. Am J Reprod Immunol Microbiol 8:120-124.
13. Moudgal NR, Macdonald GJ, Greep RO (1971) Effects of HCG antiserum on ovulation and corpus luteum formation in the monkey (Macaca fascicularis). J Clin Endocrinol Metab 32:579-581.
14. Stevens VC (1990) Birth control vaccines and immunological approaches to the therapy of noninfectious diseases. Inf Dis Clin North Am 4:343-354.
Dunbar BS, Lo C, Powell J, Stevens VC (1989) Use of a synthetic peptide adjuvant for the immunization of baboons with denatured and deglycosylated pig zona pellucida glycoproteins. Fertil Steril 52:311-318.
-69- 16. Stevens VC (1986) Use of synthetic peptides as immunogens for developing a vaccine against human chorionic gonadotropin. Ciba Found Symp 119:200-225.
17. Moyle WR, Pressey A, Dean Emig D, Anderson DM, Demeter M, Lustbader J, Ehrlich P (1987) Detection of conformational changes in human chorionic gonadotropin upon binding to rat gonadal receptors. J Biol Chem 262:16920-16926.
18. Singh O, Rao LV, Gaur A, Sharma NC, Alam A, Talwar GP (1989) Antibody response and characteristics of antibodies in women immunized with three contraceptive vaccines inducing antibodies against human chorionic gonadotropin. Fertil Steril 52:739-744.
19. Kumar S, Talwar GP, Biswas DK (1992) Necrosis and inhibition of growth of human lung tumor by anti-cx-human chorionic gonadotropin antibody.
JNCI 84:42-47.
S* 20 20. Gaur A, Arunan K, Singh O, Talwar GP (1990) Bypass by an alternate 'carrier' of acquired unresponsiveness to hCG upon repeated immunization S with tetanus-conjugated vaccine. Int Immunol 2:151-155.
21. Hojo H, Ryan RJ (1985) Monoclonal antibodies against human a 25 follicle-stimulating hormone. Endocrinology 117:2428-2434.
22. Moyle WR, Ehrlich PH, Canfield RE (1982) Use of monoclonal antibodies to hCG subunits to examine the orientation of hCG in the hormonereceptor complex. Proc Natl Acad Sci USA 79:2245-2249.
23. Ryan RJ, Keutmann HT, Charlesworth MC, McCormick DJ, Milius RP, Calvo FO, Vutyavanich T (1987) Structure-function relationships of gonadotropins. Recent Prog Horm Res 43:383-429.
24. Keutmann HT, Charlesworth MC, Mason KA, Ostrea T, Johnson L, Ryan RJ (1987) A receptor-binding region in human choriogonadotropin/lutropin beta subunit. Proc Natl Acad Sci USA 84:2038-2042.
Moyle WR, Dean Emig DM, Lustbader JV, Keutmann HT (1988) Identification of an epitope on the B-subunit of human chorionic gonadotropin (hCG) near the receptor binding site. ICSU Short Rep 8:116.
26. Moyle WR, Matzuk MM, Campbell RK, Cogliani E, Dean Emig DM, Krichevsky A, Barnett RW, Boime I (1990) Localization of residues that confer antibody binding specificity using human chorionic gonadotropin/luteinizing hormone beta subunit chimeras and mutants. J Biol Chem 265:8511-8518.
27. Krichevsky A, Birken S, O'Connor J, Bikel K, Schlatterer J, Yi C, Agosto G, Canfield R (1991) Development and characterization of a new, highly specific antibody to the human chorionic gonadotropin-beta fragment.
Endocrinology 128:1255-1264.
0* 15 28. Ehrlich PH, Moustafa ZA, Krichevsky A, Birken S, Armstrong EG, Canfield RE (1985) Characterization and relative orientation of epitopes for monoclonal antibodies and antisera to human chorionic gonadotropin. Am J Reprod Immunol Microbiol 8:48-54.
20 29. Matteri RL, Roser JF, Baldwin DM, Lipovetsky V, Papkoff H (1987) Characterization of a monoclonal antibody which detects luteinizing hormones from diverse mammalian species. Domest Anim Endocrinol 4:157-165.
00 Ehrlich PH, Moyle WR, Canfield RE (1983) Monoclonal antibodies to gonadotropin subunits. Methods Enzymol 50:638-655.
0*0**0 31. Moyle WR, Anderson DM, Macdonald GJ, Armstrong EG (1988) Bioimmunoassay (BIA): A sandwich immunoassay scheme employing monoclonal antibodies and hormone receptors to quantify anaytes. J Receptor Res 8:419-436.
32. Fiedler R, Verbitskii MS (1990) Monoclonal antibodies to human chorionic gonadotropin and certain human and animal hormones of the adenohypophysis. Biomedical Science 1:251-255.
33. Winter G, Milstein C (1991) Man-made antibodies. Nature 349:293-299.
-71 34. Bass S, Greene R, Wells JA (1990) Hormone phage: an enrichment method for variant proteins with altered binding properties. Proteins 8:309-314.
35. Barrett RW, Cwirla SE, Ackerman MS, Olson AM, Peters EA, Dower WJ (1992) Selective enrichment and characterization of high affinity ligands from collections of random peptides on filamentous phage. Analytical Biochemistry 204:357-364.
36. Huse WD, Sastry L, Iverson SA, Kang AS, Alting-Mees M, Burton DR, Benkovic SJ, Lerer RA (1992) Generation of a large combinatorial library of the immunoglobulin repertoire in phage lambda. 1989 Biotechnology 24:517-523.
15 37. Moyle WR, Bahl OP, Marz L (1975) Role of the carbohydrate of human choriogonadotropin in the mechanism of hormone action. J Biol Chem 250:9163-9169.
2t. 38. Lesk AM, Tramontano A (1992) Antibody structure and 20 structural predictions useful in guiding antibody engineering. In: Antibody engineering: a practical guide, edited by Borrebaeck CAK. W.H.Freeman and Co., New York, pp 1-38.
39. Cheetham JC (1992) Engineering antibody affinity. In: Antibody 25 engineering: a practical guide, edited by Borrebaeck CAK. W.H.Freeman and Co., New York, pp 39-68.
Morrison SL, Johnson MJ, Herzenberg LA, Oi VT (1984) Chimeric human antibody molecules: mouse antigen-binding domains with human constant regions. Proc Natl Acad Sci USA 81:6851-6855.
41. Newman R, Alberts J, Anderson D, Carner K, Heard C, Norton F, Raab R, Reff M, Shuey S, Hanna N (1992) "Primitization" of recombinant antibodies for immunotherapy of human diseases: a mccaque/human chimeric antibody against human CD4. Biotechnology 10:1455-1460.
42. Danielsson L, Borrebaeck CAK (1992) Amplification of rearranged Ig variable region DNA from single cells. In: Antibody engineering: a -72practical guide, edited by Borrebaeck CAK. W.H.Freeman and Co., New York, pp 89-102.
43. Cruz RI, Anderson DM, Armstrong EG, Moyle WR (1987) Nonreceptor binding of human chorionic gonadotropin (hCG): detection of hCG or a related molecule bound to endometrial tissue during pregnancy using labeled monoclonal antibodies that bind to exposed epitopes on the hormone. J Clin Endocrinol Metab 64:433-440.
44. Moyle WR, Anderson DM, Macdonald GJ, Armstrong EG (1988) Bioimmunoassay (BIA): a sandwich immunoassay scheme employing monoclonal antibodies and hormone receptors to quantify analytes. J Recept Res 8:419-436.
45. McFarland KC, Sprengel R, Phillips HS, Kohler M, Rosemblit N, Nikolics K, Segaloff DL, Seeburg PH (1989) Lutropin-choriogonadotropin receptor: an unusual member of the G protein-coupled receptor family. Science 245:494-499.
20 46. Jia X, Oikawa M, Bo M, Tanaka T, Ny T, Boime I, Hsueh AJW (1991) Expression of human luteinizing hormone (LH) receptor: Interaction with LH and chorionic gonadotropin from human but not equine, rat, and ovine species.
Mol Endocrinol 5:759-768.
47. Loosfelt H, Misrahi M, Atger M, Salesse R, Vu Hai Luu Thi MT, Jolivet A, Guiochon Mantel A, Sar S, Jallal B, Gamier J, et al (1989) Cloning and sequencing of porcine LH-hCG receptor cDNA: variants lacking transmembrane domain. Science 245:525-528.
48. Maniatis T, Fritsch EF, Sambrook J (1989) Molecular cloning: a laboratory manual. Cold Sspring Harbor Laboratory, Cold Spring Harbor, NY.
49. Kriegler M (1990) Gene Transfer and Expression: A Laboratory Manual. Stockton Press, New York.
Cosowsky LN, Campbell RK, Papkoff HR, Moyle WR, Macdonald GJ (1991) Use of hormone chimeras to identify the binding site for a monoclonal antibody which binds to a highly conserved site on mammalian LH and LH receptor complexes. Biol Reprod 44, Supplement #1:70.
-73- 51. Stevens VC (1990) Birth control vaccines and immunological approaches to the therapy of noninfectious diseases. Infect Dis Clin North Am 4:343-354.
52. Jones WR, Bradley J, Judd SJ, Denholm EH, Ing RM, Mueller UW, Powell J, Griffin PD, Stevens VC (1988) Phase I clinical trial of a World Health Organisation birth control vaccine. Lancet 1:1295-1298.
53. Bidart JM, Bellet DH, Alberici GF, Van Besien F, Bohuon C (1987) The immune response to a synthetic peptide analogous to the 109-145 beta hCG carboxyl-terminus is directed against two major and two minor regions. Mol Immunol 24:339-345.
15 54. Campbell RK, Erfle H, Barnett RW, Moyle WR (1992) Assembly and expression of a synthetic gene encoding the bovine glycoprotein hormone a-subunit. Mol Cell Endocrinol 83:195-200.
55. Lowman HB, Bass SH, Simpson N, Wells JA (1991) Selecting 20 high-affinity binding proteins by monovalent phage display. Biochemistry 30:10832-10838.
56. Hoogenboom HR, Winter G (1992) By-passing immunisation.
Human antibodies from synthetic repertoires of germline VH gene segments 25 rearranged in vitro. J Mol Biol 227:381-388.
57. Fersht A, Winter G (1992) Protein engineering. Trends Biochem Sci 17:292-295..
58. Scott JK, Smith GP (1990) Searching for peptide ligands with an epitope library. Science 249:386-390.
59. Skerra A, Dreher ML, Winter G (1991) Filter screening of antibody Fab fragments secreted from individual bacterial colonies: specific detection of antigen binding with a two-membrane system. Anal Biochem 196:151- 155.
-74- Cohen, C. and Parry, D.A.D. (1990) a-Helical coiled coils and bundles: how to design an a-helical protein. Proteins: structure, function, and genetics 7: 1-15.
61. Hu, Newell, Tidor, and Sauer, R.T. (1993) Probing the roles of residues at the e and g positions of the GCN4 leucine zipper by combinatorial mutagenesis. Protein Science 2: 1072-1084.
62. King, R.J.B. and Whitehead, M.I. (1986) Assessment of the potency or orally administered progestins in women. Fertility and Sterility 46: 1062-1066.
63. Ho, Hunt, Horton, Pullen, J.K. and Pease, L.R. (1989) Site directed mutagenesis by overlap extension using the polymerase 15 chain reaction. Gene 77: 51-59.
64. Campbell RK, Dean Emig DM, Moyle WR (1991) Conversion of human choriogonadotropin into a follitropin by protein engineering. Proc Natl Acad Sci USA 88:760-764 65. Skaf R, Macdonald GJ, Sheldon RM, Moyle WR (1985) Use of antisera to follicle-stimulating hormone (FSH) to detect non-FSH factors in human serum which modulate rat granulosa cell steroidogenesis. Endocrinology 117:106- 113 The invention being thus described, it will be obvious that the same may be varied in many ways. Such variations are not to be regarded as a departure from the spirit and scope of the invention and all such modifications are intended to be included within the scope of the following claims.
Claims (6)
1. A DNA or RNA molecule that encodes a single-chain protein which is an agonist or antagonist of a hormone selected from the group consisting of luteninizing hormone follicle stimulating hormone (FSH), and chorionic gonadotropin (CG) which single-chain protein has an amino acid sequence of the formula p-(linker)-a or a-(linker)-p wherein p is the p subunit of LH, FSH or CG or a variant thereof; "linker" refers to a peptide linker containing 1-16 amino acids; and a represents the amino acid sequence of the a subunit common to LH, FSH and CG or a variant thereof.
2. An expression system when used for the production of a single-chain protein which is an agonist or antagonist of a hormone selected from the group consisting of luteninizing hormone follicle stimulating hormone (FSH), and chorionic 15 gonadotropin (CG) which single-chain protein has an amino acid sequence of the formula -(linker)-a or -(linker)-P wherein p is the p subunit ofLH, FSH or CG or a variant thereof; 20 "linker" refers to a peptide linker containing 1-16 amino acids; and a represents the amino acid sequence of the a subunit common to LH, FSH and CG or a variant thereof. -76- which expression system comprises a first nucleotide sequence encoding said single-chain protein operably linked to control sequences capable of effecting the expression of said first nucleotide sequence.
3. The expression system of claim 2 which further contains a second nucleotide sequence encoding a signal peptide operably linked to the protein encoded by the first nucleotide sequence.
4. Recombinant host cells modified to contain the expression system of claim 2 or 3. A method to produce a single-chain protein which is an agonist or antagonist of a hormone selected from the group consisting of LH, FSH and CG which method 10 comprises culturing the cells of claim 4 under conditions wherein said protein is S produced and optionally recovering the protein from the culture. A single-chain protein which is an agonist or antagonist of a hormone selected from the group consisting of LH, FSH and CG produced by the method of claim 5
7. A single-chain protein which is an agonist or antagonist of a hormone selected from the group consisting of luteninizing hormone follicle stimulating hormone (FSH), and chorionic gonadotropin (CG) which single-chain protein has an amino acid sequence of the formula p-(linker)-a or a-(linker)-p wherein p is the 0 subunit of LH, FSH or CG or a variant thereof; "linker" refers to a peptide linker containing 1-16 amino acids; and
77- a represents the amino acid sequence of the a subunit common to LH, FSH and CG or a variant thereof. 8. A DNA or RNA molecule of claim 1, wherein said encoded single-chain protein has a formula as set forth in Table 1 or wherein P is the P-subunit of chorionic gonadotropin, a is a vertebrae a-subunit, and the linker contains 1-16 amino acid residues. 9. The expression system of claim 2 wherein said encoded single-chain protein has a formula as set forth in Table 1 or wherein P is the p-subunit of chorionic gonadotropin, a is a vertebrae a-subunit, and the linker contains 1-16 amino acid residues. 10 10. The recombinant host cells of claim 4 wherein said encoded single-chain protein a a has a formula as set forth in Table 1 or wherein P is the p-subunit of chorionic gonadotropin, a is a vertebrae a-subunit, and the linker contains 1-16 amino acid residues. 11. The method of claim 5 wherein said single-chain protein has a formula as set forth in Table 1 or wherein P is the P-subunit of chorionic gonadotropin, aot is a vertebrae ota- subunit, and the linker contains 1-16 amino acid residues. 12. The protein of claim 7 wherein the single-chain protein has a formula as set forth in Table 1 or wherein P is the p-subunit of chorionic gonadotropin, a is a vertebrae a- subunit, and the linker contains 1-16 amino acid residues. 13. A DNA or RNA molecule according to Claim 1, and substantially as herein described with reference to any one of the examples. 14. An expression system according to Claim 2, and substantially as herein described with reference to any one of the examples. -78- A recombinant host cell according to Claim 4, and substantially as herein described with reference to any one of the examples. 16. A method to produce a single chain protein according to Claim 5, and substantially as herein described with reference to any one of the examples. 17. A single chain protein according to Claim 6 or Claim 7, and substantially as herein described with reference to any one of the examples. DATED this 18th Day of March, 1998 WASHINGTON UNIVERSITY 10 Attorney: IAN T. ERNST Fellow Institute of Patent Attorneys of Australia of SHELSTON WATERS a' e 6
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU59422/98A AU723853B2 (en) | 1994-02-18 | 1998-03-19 | Methods for altering fertility |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US199382 | 1994-02-18 | ||
AU18787/95A AU695111B2 (en) | 1994-02-18 | 1995-02-17 | Methods for altering fertility |
AU59422/98A AU723853B2 (en) | 1994-02-18 | 1998-03-19 | Methods for altering fertility |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU18787/95A Division AU695111B2 (en) | 1994-02-18 | 1995-02-17 | Methods for altering fertility |
Publications (2)
Publication Number | Publication Date |
---|---|
AU5942298A AU5942298A (en) | 1998-06-04 |
AU723853B2 true AU723853B2 (en) | 2000-09-07 |
Family
ID=3708443
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU59422/98A Expired AU723853B2 (en) | 1994-02-18 | 1998-03-19 | Methods for altering fertility |
Country Status (1)
Country | Link |
---|---|
AU (1) | AU723853B2 (en) |
-
1998
- 1998-03-19 AU AU59422/98A patent/AU723853B2/en not_active Expired
Also Published As
Publication number | Publication date |
---|---|
AU5942298A (en) | 1998-06-04 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20070253955A1 (en) | Methods for altering fertility | |
US6242580B1 (en) | Single-chain forms of the glycoprotein hormone quartet | |
JP6649385B2 (en) | Ligands that enhance the biological activity of gonadotropin | |
KR100706469B1 (en) | Disulfide crosslinked glycoprotein hormone analogs, and their preparation and use | |
CA1057742A (en) | Antigenic modification of polypeptides | |
US6486303B1 (en) | Method for making hormone heterodimers | |
AU723853B2 (en) | Methods for altering fertility | |
CA2219948C (en) | Single chain gonadotropins, dna encoding them and method of producing | |
AU701702B2 (en) | Modified human chorionic (beta-hCG) proteins and their medical use | |
Lund et al. | Immunological analysis of epitopes on hCG | |
Merz | Biochemical aspects of a contraception model based on immunological properties of proteohormones | |
AU2004204115A1 (en) | Low efficacy gonadotropin agonists and antagonists |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FGA | Letters patent sealed or granted (standard patent) |