AU667104B2 - Equine herpesvirus glycoproteins - Google Patents
Equine herpesvirus glycoproteins Download PDFInfo
- Publication number
- AU667104B2 AU667104B2 AU40547/93A AU4054793A AU667104B2 AU 667104 B2 AU667104 B2 AU 667104B2 AU 40547/93 A AU40547/93 A AU 40547/93A AU 4054793 A AU4054793 A AU 4054793A AU 667104 B2 AU667104 B2 AU 667104B2
- Authority
- AU
- Australia
- Prior art keywords
- ehv4
- ehv1
- derivatives
- type
- eliciting
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired
Links
Landscapes
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Description
OPI DATE 30/12/93 APPLN. ID 40547/93 I1l |llllili IIIllII AOJP DATE 10/03/94 PCT NUMBER PCT/AU93/00253 IliI liIllilI iI I lii AU9340547 (51) International Patent Classification 5 C07K 7/10, 13/00, 15/12 C12N 15/38, C12P 21/08 C12Q 1/68, G01N 33/569 A61K 39/27 (11) International Publication Number: (43) International Publication Date: WO 93/24528 9 December 1993 (09.12.93) (21) International Application Number: (22) International Filing Date: Priority data: PL2716 1 June 19 PCT/AU93/00253 28 May 1993 (28.05.93) 92(01.06.92) (71) Applicant (for all designated States except US): THE UNI- VERSITY OF MELBOURNE [AU/AU]; Grattan Street, Parkville, VIC 3052 (AU), (72) Inventors; and Inventors/Applicants (for US only): CRABB, Brendan, Scott [AU/AU]; 12/57 Ascot Street, Ascot Vale, VIC 3032 STUDDERT, Michael, Justin [AU/AU]; 13 Highland Street, Balwyn, VIC 3103 (AU), (74) Agent: CARTER SMITH BEADLE; Qantas House, 2 Railway Parade, Camberwell, VIC 3124 (AU).
(81) Designated States: AT, AU, BB, BR, CA, CH, CZ, DE, DK, ES, FI, GB, HU, JP, KP, KR, KZ, LK, LU, MG, MN, MW, NL, NO, NZ, PL, PT, RO, RU, SD, SE, SK, UA, US, VN, European patent (AT, BE, CH, DE, DK, ES, FR, GB, GR, IE, IT, LU, MC, NL, PT, SE), OAPI patent (BF, BJ, CF, CG, CI, CM, GA, GN, ML, MR, NE, SN, TD, TG).
Published With international search report.
S671 04 (54) Title: EQUINE HERPESVIRUS GLYCOPROTEINS (57) Abstract Disclosed are serological assays based on unique sequence type-specifice gG proteins and polypeptides capable of distinguishing the closely related EHV4 and EHVI viruses, The assays are capable of clearly and unambiguously distinguishing animals infected with EHV4 or EHVI and thereby distinguishing the EHV4 infectiont equine rhinopheumonitis, causing "snotty noses" from the more dramatic consequences of EHVI infection; equine abortion, which often results in an "abortion storm" and high loss of livestock. Further disclosed are the unique type-specific epitopes of EHV4 and EHV1, recombinantly derived novel nucleic acid sequences and proteins which are useful in providing assay reagents, antibodies, vaccines, probes and associated peripherals for diagnosis and control.
i i WO 93/24528 PCT/AU93/00253 -1- TITLE EQUINE HERPESVIRUS GLYCOPROTEINS INTRODUCTION TO INVENTION This invention relates to Equine Herpesvirus and in particular to type-specific glycoproteins thereof and diagnostic tests and clinical applications associated with the characterization of such glycoproteins.
BACKGROUND OF INVENTION Equine rhinopheumonitis and equine abortion are commonly recognised diseases of horses caused by two distinct but antigenically related viruses that are designated equine herpesvirus 4 and equine herpesvirus 1, known as EHV4 and EHVI respectively. Because the viruses are related antigenically it has not been possible to date by serological examination (blood test), to determine whether a horse has been infected with either or both EHV4 or EHV1. For example, if a horse had been infected with EHV4 as a foal it would develop antibodies in its serum that would react with not only EHV4 but with EHV1 as well, so one would not know that such a foal had been infected with only EHV4.
However, since 1981 it has been repeatedly shown that the restriction endonuclease fingerprints of the two viruses are distinctly different with respiratory isolates and fetal isolates almost invariably typing as EHV4 at. -SHV1 respectively. The availability of specific monoclonal antibodies (MAbs) directed to either EHV4 or EHV1 has also allowed consistent and specific typing of WO 93/24528 PCT/AU93/00253 -2isolates of the two viruses.
The major significance in developing a specific antibody test relates to the fact that both these herpesviruses are believed, after primary infection, to establish a persistent, latent and life-long infection. Either virus may from time to time be reactivated from the latent state (just as is the case with recurrent coli sores in humans infected with herpes simplex virus); the virus, reactivated from the latent state, will usually cause recurrent disease in the host horse but more importantly such a horse will either directly or indirectly by contact act as a source of infection for other horses. In this way, for EHV4, there is usually in the annual foal crop born on a farm an annual round of respiratory disease ("snotty" noses). Such an occurrence is almost an accepted part of breeding horses. Occasionally foals become severely affected and require treatment or die because of severe secondary complications such as bacterial pneumonia.
While the natural history of EHV1 is less clearly understood, there is an assumption that the virus does establish persistent, lifelong latent, infections.
Upon reactivation there may be a further bout of respiratory disease. However, a far more serious consequence for other horses infected by contact with the first horse (index case) occurs on breeding farms when a pregnant mare in a paddock reactivates the virus and transmits it to other in-contact pregnant mares. The index case mare may herself abort or cause abortion in one or more in contact mares. An aborted foetus and the foetal membranes and fluids are heavily infected with EHV1 and contaminate the site where abortion occurs.
WO 93/24528 PCT/AU93/00253 -3- Other mares in the paddock, being naturally curious, come to the site of abortion and sniff the foetus and membranes. In this way, often close to 100% of the mares in the paddock become infected and abort within 10 or 20 days causing what is commonly known as an "abortion storm". Such outbreaks of EHV1 abortion are of considerable economic importance to the equine, particularly thoroughbred and standardbred, industries worldwide.
There is a need for accurate, type-specific serological surveillance of horses for the presence of EHV4 and/or EHV1 antibodies to assist in our understanding of the epidemiology of these viruses, particularly EHV1. Presently, however, EHV1 or EHV4 antibodies in polyclonal serum cannot be differentiated because of the extensive antigenic cross-reactivity between the two viruses. The availability of such a specific serological test would also have profound implications in the control, perhaps eradication, of EHV1 and hi the selection of candidate horses for vaccination.
The antibody responses of the horse to these viruses is largely directed to the envelope glycoproteins. EHV1 homologues to nine of the ten recognized herpes simplex virus 1 (HSV1) glycoproteins have been identified from DNA sequence analyses; gB, gC, gD, gE, gG, gH, gI, gK, and gL. The remaining HSV1 glycoprotein, gJ, has a positional counterpart in the US region of EHV1, gene 71, although these two genes do not show any significant homology. Also, EHV1 possesses at least three other glycoproteins designated gp2, gpl0, which are the homologues of the HSV1 tegument proteins VP13/14 and gp21/22a. In the case of EHV4, which unlike EHV1 has only WO 93/24528 PCT/AU93/00253 -4been partially sequenced, glycoprotein genes encoding gB, gC, gG and gH homologues have been identified which show amino acid identities of 89%, 79%, 58% and 85% respectively with their EHV1 counterparts. Homologous EHV4 and EHV1 genes map to collinear positions in their respective genomes.
EHV1 glycoproteins gp2, gplO, gC (gpl3), gB (gpl4), gD (gpl8) and gp21/22a have been definitively identified by SDS-PAGE as have EHV4 glycoproteins gp2, gplO, gC (gpl3), gB (gpl4), gD (gpl8) and gG. Using combinations of EHV1/EHV4 MAbs and polyclonal post-EHV1 only or post-EHV4 only horse sera it has been shown that each of the glycoproteins possesses both type-common and type-specific epitopes The two exceptions are gp21/22a which has been relatively poorly studied and EHV4 gG which appears to elicit a type-specific serological response.
To date, glycoprotein G (gG) homologues of other herpesviruses have been used as a basis for diagnostic testing and clinical application. In particular, gG (alternatively called gX) of pseudorabies virus (PRV) has been used in the development of gG deletion mutant vaccines linked to a diagnostic test for PRV of pigs.
Also gG of human herpes simplex viruses (HSV) 1 and 2 are different enough to allow tests such as ELISA to be developed for the detection of antibodies to cither HSV1 or 2 in the serum of humans.
However, in spite of these data for PRV and HSV 1 and 2 it could not have been predicted that the same glycoprotein, namely glycoprotein G of EHV4 and EHV1, WO 93/24528 PCT/AU93/00253 would serve a role in diagnosis and vaccine development. For PRV, only a single virus is involved, so the question of distinguishing between two viruses is not relevant, For HSV 1 and 2, while two viruses are involved, the gG proteins are different in very different ways from EHV4 and EHV1 gGs. In particular, the molecular sizes of unglycosylated HSV1 and HSV2 gGs differ greatly with HSV1 at 26K and, HSV2 at 77K, whereas the sizes of unglycosylated EHV4 and EHV1 gG differ only slightly at 44K and 45K respectively. It is reasoned that the type-specificity of the entire HSV1 and 2 gG proteins resulted from a major deletion in the case of the HSV1 gG gene whereby some 1383 nucleotides have been "lost" from a total gene (in the case of HSV2) of 2097 nucleotides. The loss of more than half the coding sequence of HSV1 gG results in a non glycosylated protein of only 26K vs 77K for HSV2 gG. While it is recognised that a positive ELISA is required for the differentiation of humans infected with either HSV1 or 2 it could have been reasoned that if the two genes were of approximately the same size then the two gGs would be cross-reactive. For EHV4 and EHV1 it is shown that while the two gGs are approximately the same size they are still type-specific. This could not have been predicted from prior art (HSV) material or from sequence data alone. On the later point the fact that EHV4 and EHV1 gG are 58% similar at the amino acid level it could in fact have been predicted that cross-reactive epitopes would almost certainly have existed and hence gG could not have been used in the concurrently described invention to differentiate the two equine viruses. The findings of the current invention are based on the analysis of a specifically selected set of horse serums for which the previous infection/vaccination history of particular horses was known, Detailed analysis of these serums show that cross-reactive epitopes are either not present or are not important in eliciting an WO 93/24528 PCT/AU93/00253 -6antibody response in the natural host. Such a highly distinctive property of these epitopes was quite unexpected and has allowed the development of the instant invention.
OBJECT AND STATEMENT OF INVENTION One object of this invention is to characterize a protein or protein set or derivatives thereof that are capable of applications in the diagnosis and differentiation of EHV4 and EHV1.
A second object of this invention is to provide immunological agents associated with the control of EHV4 and EHV1.
A third object of this invention is to provide diagnostic methods, tests, reagents and peripherals associated with the diagnosis and differentiation of EHV4 and EHV1.
Accordingly the invention provides, in one broad aspect, envelope glycoproteins of equine herpesvirus capable of distinguishing equine herpesvirus 4 and equine herpesvirus 1.
The glycoproteins are preferably type-specific to EHV4 and EHVi invoking minimal or negligible cross-reaction and incorporating minimal or negligible type-common epitopes between EHV4 and EHV1.
WO 93/24528 WO 9324528PCF/AU93/00253 -7- The glycoproteins most preferably belong to the glycoprotein set G, known as gG, being EHV4 gG pertaining to EHV4 and EHV1 gG pertaining to EHV1.
EHV4 gG is secreted into the medium of infected cell cultures.
EHVI gO has not been observed as a secreflon into the medium of infected cells.
The EHV4 gG glycoprotein preferably comprises a 405 amino acid sequence corresponding to an unglycosylated Mr value of 44 kilodaltons.
The EHrV1 gG glycoprotein preferably comprises a 411 amino acid sequence corresponding to an unglycosylated Mr value of 45 kilodaltons.
The EHV4 gG is preferably characterized by the following amino acid sequence:
MLAVGATLCLLSFLTGATGRLAPDDLCYAEPRKTGPMPRSKPKHQPLLFEAPKVALTA
ESKGCQLI LLDPPIDMGYRLEDKINAS IAWFFDFGNCRMPIAYREYYDCVGNAIPSPE TCDGYSFTLVKTEGWEFTIVNSLLLPGIYDSGSFIYSALDi'NDVLTGRVI LNVEN
DTNYPCGMTHGLTADGNINVDETTHTTPHPRAVGCFPELINFDAWENVTFEEMGIPDP
NSFLDDESDYPNTMDCYSWDLYTYPKSLKQAEGPQTLLIGAVGLRI LAQAWKFVENET
YSQHTRTYTRDAKEVDVTQPSPVQADSVLAKKRTSMKNNPIYSEGKPHAKPFSTIDSI
HTEGMKNNPVYSESLMLNVQHSDS ITTGGVLHGLQDCDNQLICTVYICLALIGLAHVP or subset, nces thereof capable of eliciting a type-specific response Including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives.
The EI-) gG gene is characterized by a coding region comprising the WO 93/24528 WO 9324528PCr/AU93/00253 following nucleotide sequence:-
ATTTGGGGTGGAGACGGCGTGGGCCGATACTGTATAAAGTTGTACTACTTACCAGCCC
AGTCAGTGTGCTGTAGTGCCACCACCTGTAAAGCTGTGATAAGCTGCAGGC-8 rATGTT
GGCTGTGCGGAGCAACTCTGTGTTTACTGAGTTTCCTAACTGGCGCTACTGGACGGCTA
GCTCCTGACGACCTCTGCTATGCAGAACCCCGCAAAACCGGTCCCATGCCCCGCTCAA
AACCTAAACACCAACCCCTACTATTTGAAGCCCCAAAGGTTGCTCTTACGGCAGAGTC
AAAGGGTTGTCAACTAATATTGTTAGACCCTCCAATAGACATGGGCTATCGCTTAGAG
GACAAGATAAACGCTTCCATTGCTTGGTTTTTTGACTTTGGTAATTGTCGAATGCCCA
TCGCATACAGAGAGTACTATGATTGCGTTGGCAACGCAATCCCATCTCCAGAAACATG
TGATGGTTACTCATTTACACTTGTTAAAACAGAGGGTGTAGTTGAGTTTACCATCGTA
AACATGAGCTTACTGTTGCAGCCTGGAATATACGACAGTGGAAGTTTTATATACAGCG
CCCTTCTAGATATGGATGTATTGACTGGACGCGTAATTTTGAACGTGGAGAACGACAC
TAACTATCCATGCGGAATGACTCACGGCCTCACTGCGGATGGCAACATCAACGTAGAT
GAAACCACGCACACAACCCCACATCCACGTGCTGTCGGGTGTTTTCCAGAACTCATTA
ACTTCGATGCATGGGAAAACGTTACATTCGAAGAAATGGGGATACCAGACCCAAACTC
ATTTCTTGATGATGAGAGTGATTACCCGAATACAATGGACTGTTACTCGTGGGATTTA
TACACATATCCCAAAAGCCTGAAGCAGGCAGAGGGGCCCCAAACCTT(7,TTAATAGGTG
CAGTTGGACTCAGAATACTCGCGCAAGCATGGAAGTTTGTTGAAAATGAAACCTACAG
CCAGCATACACGTACGTACACACGTGATGCTAAGGAAGTTGATGTTACACAGCCAAGT
CCTGTACAGGCTGATTCTGTCCTCGCCAAGAAACGCACATCTATGAAGAATAACCCTA
TTTATTCAGAGGGGAAGCCTCATGCTAAACCGTTCAGCACGATAGACAGCATCCACAC
GGAAGGGATGAAGAATAACCCTGTTTATTCAGAGAGCCTCATGCTAAACGTCCAGCAC
AGTGACAGCATCACCACCGGGGGTGTGTTGCATGGCCTCCAAGACTGCGACAACCAGC
TCAAAACTGTGTATATTTGCCTAGCTCTTATTGGACTCGCACATGTGCCATGATAGGA
CTAATAGTTTACATTTTTGTGCTAAGGTCAAAAATATCTTCCCACAATTTATCGCGCT
CACA.AAATGTAAAACATAGAAACTATCATCGACTTGAGTACGTTGCATAATACATGTC
AAAATAAAAGTTAAAAATTAAACATTGTTGTCTGTAATAACTGAGTGTGGTTTTAAAA
AATACTAAATCGCGGCAATGTT
or degeneracy equivalents or subsequences thereof coding for amino acid WO 93/24528 PCI'/AU93/002S3 -9sequences or epitopes capable of eliciting a type-specific response.
The ERV1 gG Is preferably characterized by the following amino acid sequence:-
MLTVLAALSLLSLLTSATGRLAPDELCYAEPRRTGSPPNTQPERPPVIFEPPTIAIKA
ESKGCELILLDPPIDVSYRREDKVNASIAWFFDFGACRMPIAYREYYGCIGNAVPSPE
TCDAYSFTLIRTEGIVEFTIVNMSLLFQPGIYDSGNFIYSVLLDYHI FTGRVTLEVE
DTNYPCGMIHGLTAYGNINVDETMDNASPHPRAVGCFPEPIDNEAWANVTFTELGIPD
PNSFLDDEGDYPNISDCHSWESYTYPNTLRQATGPQTLLVGAVGLRILAQAWKFVGDE
TYDTIRAEAKNLETHVPSSAAESSLENQSTQEESNSPEVAHLRSVNSDDSTHTGGASN
GIQDCDSQLKTVYACLALIGLGTCAMIGLIVYICVLRSKLSSRNFSRAQNVKHRNYQR
LEYVA
or subsequences thereof capable of eliciting a type-specific respon-? Including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or Syntheffcally made derivatives.
Preferably the epitopes responsible for eliciting the type-specific response are encompassed by EHV4 gG amino acids 287-382 and ERVI gG amino acids 288-350 (as herein defined), Most preferably the EHV4 epitope is characterized by the following amino acid sequence:
ENETYSQHTRTYTRDAKEVDVTQPSPVQADSVLAIKRTSMKNNPIYSEGKPHAKPFST
IDSIHTEGMKNNPVYSESLMLNVQHSDSITTGGVLHGL
WO 93/24528 PCT/AU93/00253 or subsequences thereof capable of eliciting a type-specific response including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives, An alternative EHV4 epitope is characterized by the following amino acid sequence
KTGPMPRSKPKHQPLLFEAPKVALT
or subsequences thereof capable of eliciting a type-specific response including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives.
The invention further provides EHV4 discontinuous epitopes characterized by a discontinuous combination of the above detailed epitopes or derivatives of these 2 regions, either alone or together, with other regions of the EHV4 gG molecule.
The invention further provides plasmid vector pEG4var (as herein defined).
Most preferably the EHV1 epitope is characterized by the following amino acid sequence GDETYDT3RAEAKNLETHVPSSAAESSLENQSTQEESNSPEVAHLRSVNSDDSTHTGG
ASNGI
or subsequences thereof capable of eliciting a type-specific response including WO 93/24528 PCT/AU93/00253 -11 naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives.
An alternative EHV1 epitope is characterized by the following amino acid sequence.
RTGSPPNTQPERPPVIFEPPTIAIK
or subsequences thereof capable of eliciting a type-specific response including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives.
The invention further provides EHV1 discontinuous epitopes characterized by a discontinuous combination of the above detailed epitopes or derivatives of these 2 regions, either alone or together, with other regions of the EHV gG molecule.
The invention further provides a plasmid vector pEGlvar (as herein defined).
The invention further provides vaccines for the immunization of horses against EHV4 and/or EHV1.
Among the various vaccine types possible are deletion mutant vaccines characterized by the deletion of EHV4 gG amino acids 287-382 and/or deletion of EHV1 gG amino acids 288-350 or subsequences thereof or amino acids located elsewhere in the gG that are either directly or indirectly capable of WO 93/24528 PCT/AU93/00253 -12eliciting a type-specific response.
The vaccine may alternatively be an insertion mutant vaccine utilizing the promotor of gG. In a preferred form DNA coding for equine influenza virus haemagglutinin antigen or other equine virus antigens including equine influenza neurimidase or nucleoprotein antigens or derivatives thereof are inserted into EHV4 or EHV1 "downstream" of the gG promotor. In another preferred form DNA coding for any one, or a combination of, equine arteritis virus, equine rhinovirus and equine adenovirus is inserted into the EHV4 or EHV1 "downstream" of the gG promotor. Alternatively, the gG deleted gene location could be used for insertion and expression of foreign genes driven by other foreign promoters.
Numerous alternative vaccine products are included in the scope of the invention.
The invention further provides an immunological test kit characterized by antigens in the form of envelope glycoproteins capable of distinguishing horses infected with equine herpesvirus 4 andequine herpesvlrus 1. The antigens can be any of the envelope glycoproteins or epitopes as hereinbefore described but are most preferably EHV4 gG amino acids 287-382 and EHV1 gG amino acids 288-350. Any subsequences of the above epitopes capable of eliciting typespecific responses are also particularly preferred as capture antigens.
0 WO 9)3/24528 PCT/AU93/00253 -13- The invention further provides numerous immunological tests and methods utilizing the unexpected highly distinctive properties of the above described EHV4 and EHV1 epitopes.
In particular the invention provides an immunological test method comprising at least the following steps:a) Antibody contained in horse serum is added to a filter paper disc and allowed to react with EHV4 gG or EHV1 gG capture antigens; b) Following washing a second anti-species antibody conjugated to an enzyme marker is added to the filter paper and allowed to react with any specifically bound horse antibody; c) After a further washing, an enzyme substrate capable of generating a signal is added.
The invention further provides a method of testing for EHV4 and EHV1 infected horses comprising the detection of wild type EHV4 and/or EHV1 characterized by the presence of EHV4 gG and/or EHV1 gG.
The method also allows the testing for a horse vaccinated against EHV4 and/or EHV1 by the detection of EHV4 and/or EHV1 characterized by the absence of EHV4 gG and or EHVI gG.
WO~V 93/24528 PCT/AU93/00253 -14- The method also allows the testing for a horse not infected with or vaccinated against EHV4 or EHV1 by the detection of the absence of EHV4 gG and EHV1 gG antibodies. The testing methods may use EHV4 gG and EHVI gG antigens in combination with other equine herpesvirus glycoproteins.
In another aspect, the invention provides antibodies to the above described envelope glycoproteins capable of distinguishing equine herpesvirus 4 and equine herpesvirus 1. The antibodies are most preferably monoclonal and raised against the EHV4 gG epitope comprising the amino acid sequence 287 382, or subsequences thereof capable of eliciting a type-specific response.
Similar monoclonal antibodies may be raised against the EHV1 gG epitope comprising the amino acid sequence 285 350, or subsequences thereof capable of eliciting a type-specific response.
In yet another aspect, the invention provides nucleic acid hybridization probes to the EHV4 and EHV1 gG epitope nucleotide sequences.
DETAILED DESCRIPTION OF THE INVENTION The invention will now be more fully described with reference to Figures 1 to 13 as follows:- FIlure 1 Identification and characterisation of proteins found in the supernatant of EHV4 and EHV1 infected cell cultures. EHV4 S/N WO 93/24528 PCT/AU93/00253 15 proteins (E4 S/N) or EHV4 purified virion proteins (E4 VP) were separated on a 10% polya.rylamide gel and transferred to PVDF membranes. Mock infected cell culture supernatant (Mo S/N) was included as a control. The S/N proteins were probed with either a pool of monospecific, polyclonal post-EHV4 horse sera or a pool of 4 monoclonal antibodies (MAbs) directed to EHV4 gp2, gpOl, gpl4 or gpl8. The lane to the far right represents an flourograph of a PVDF membrane containing 14 C]glucosamine labelled EHV4 virion proteins.
The EHV4 secreted proteins detected by the polyclonal sera are indicated by arrows and the major EHV4 glycopruteins are indicated at the right. (b) Flourographs of 1 4 C]glucosamine labelled E4 VP or S/N proteins after separation on a large polyacrylamnide gel (16 x 16 x 0.75cm). Labelling of the major glycoproteins and the secreted products is as above. Western blot of EHV4 S/N proteins probed with sera derived from SPF foals that were either immunized with EHV1 (SPF foal experimentally infected with EHV1 (SPF foal 2a) and later cross-challenged with EHV4 (SPF foal 2b) or immunized with EHV4 (SPF foal 3) and with sera from two previously seronegative horses that were experimentally infected with EHV4 (post-EHV4 infection horses 1 and 2; E4 Abl and E4 Ab2). A pool of sera taken from the three SPF foals prior to immunization or infection is included (pre). Western blot of S/N from cell line grown EHV1 (El S/N) or mock infected cell cultures (Mo S/N) both probed with either a pool of post-EHV1 sera which includes sera from foal 1 and foal 2a (El) or a pool of post-EHV4 sera which includes sera from foal 3 and post-EHV4 infection horse 2 (E4).
WOB 93/245288 PCT/AU93/00253 -16- Eigure 2 Strategy for determining the nucleotide sequence of the US region EHV4 DNA located near the internal repeat structure. EHV4 genome showing unique long (UL) and unique short (US) regions as well as the internal and terminal repeat sequences that bracket the US region (IRs and TRs respectively). Eco RI retriction endonuclease map of the EHV4 genome. Expansion of the Eco RI G fragment showing Sma I and Hind III cleavage sites. The approximate locations of sequences covered by deletion clones are indicated by the arrows. (d) Location and orientation of the five major open reading frames (ORFs). The ORFs are given HSV designations (in brackets) if homology w'as established.
Figur3 Nucleotide sequence and predicted amino acid sequence of ORF4 and flanking regions. Amino acids are given in single letter code and are numbered, from the first methionine residue, on the right. The TATA box, Pst 1 site, polyadenylation signal and GT-rich region following the polyadenylation signal are underlined sequentially. Potential asparagine (N)-linked glycosylation sites (N-X-SfT) are indicated by asterisks and the proposed proteolytic cleavage site at amino acid residue 19 is indicated by a slash Eigureg Expression of EHV4 gG in E. coli. Western blots of EHV4 glycoprotein G-glutathione S-transferae fusion protein (gG) which was produced in E. coli transformed with a EHV4 gG pGEX-3X recombinant plasmid and prepared by purification using glutathione-agarose beads. GST only (gst) was included as a control and was prepared by transformation of E. coli with parental plasmid pGEX. The PVDF membranes were probed with either a pool of post- WO 93/24528 PCT/AU93/00253 -17- EHV4 sera (E4-Ab) which included sera from an SPF foal immunized with EHV4 (SPF foal 3) and a previously seronegative horse that was experimentally infected with EHV4 (post-EHV4 infection horse 2) or a pool of post-EHV1 sera (E1-Ab) which included sera from SPF foals that were either immunized (SPF foal 1) or experimentally infected with EHV1 (SPF foal 2a). The 70K gG-GST fusion protein is arrowed. Western blots of gG-GST fusion protein GST only (gst) and EHV4 secreted proteins derived from the supernatant of EHV4 infected cell cultures probed with antibody from post-EHV4 infection horse 2 that had been affinity purified from selected portions of Western blots that contained either the gG-GS' fusion protein (gG-Ab) or the 63K EHV4 secreted protein (63K-Ab). The 70K gG-GST fusion protein and the 63K secreted protein are arrowed.
Alignment of the amino acid sequences of EHV4.405/76 gG with EHV1.Ab4p gG as determined by Telford et al (1992). The amino acid numbers arc indicated on the right. Predicted signal sequence and transmembrane sequence at the N- and C-termini respectively are indicated by the dashed lines. Potential N-linked glycosylation sites are indicated by the balloons with the filled balloon indicating a site conserved in the gG homologues of PRV, HSV2 and ILTV. The cystcine residues conserved between EHV4 gG and EHV1 gG and also in the gG homologues of PRV, HSV2 and ILTV are boxed. A near perfect repeated sequence in EH'v ,G is indicated by the arrows. Hydropathic analysis of EHV4 gG (top panel) and EHV1 gG (bottom panel) amino acids according to the algorithm by Hopp and Woods The X-axis represents the amino acid number and the Y-axis WO 93/24528r PCT/AU93/00253 18 considered hydrophilic and likely to comprise antigenic sites. The most variable regions of the two sequences are overlined and the amino acid numbers shown.
Figur6 Strategy for cloning EHV4 gG and EHV1 gG The Eco RI restriction endonuclease map of the EHV4 genome and the Barn HI restriction endonuclease map of the EHV1 genome are shown at the top of panels and (B) respectively. The Eco RI G fragment of the EHV4 genome and the Barn HI D fragment of the EHV1 genome are expanded. Sma I Hind III and Pst I (P) cleavage sites are indicated for EHV4 Eco RI G while Pst I cleavage sites are indicated for EHV1 Barn HI D. The location and orientation of the known open reading frames contained within these fragments are indicated by the arrows. The EHV1 ORFs are numbered according to the designations of Telford et al while their EHV4 homologues are given the same numbers but distinguished using a prime. HSV designations are given (in brackets) if homology has been established. The bottom of each panel shows a schematic representation of the various gG molecules expressed by the recombinant plasmids pEG4.1 and pEG4var and pEG1.1, pEG1.2 and pEGlvar Predicted signal sequences and transmembrane domains are indicated by the open and closed boxes respectively and the C-terminal variable regions of EHV4 gG (amino acids 287-382) and EHV1 gG (amino acids 288-350) are shown by the cross-hatching.
Eigur a Coomassic brilliant blue staining of GST-gG fusion proteins expressed in E. coil transformed with parental pGEX, pEG4.1, pEG1.1 or pEG1.2 following SDS-PAGE. Two samples were prepared for each clone comprising the pellet WO 93/24528 PCT/AU93/00253 -19remaining after solubilization of the E. coli (left strip) and the purified GST-fusion protein (right strip). The location of the GST-fusion proteins at 27K (pGEX), (pEG4.1), 60K (pEG1.1) and 72K (pEGL are indicated by the asterisks.
Figur..i Western blot of GST-gG fusion proteins expressed in E. coli transformed with parental pGEX, pEG4.1, pEG1.1 or pEG1.2. Membranes were probed with pooled SPF foal 3 and post-EHV4 No.2 horse sera (post-EHV4-Ab) or pooled SPF foal 1 and SPF foal 2a horse sera (post-EHV1-Ab). All samples were run on the same SDS-PAGE gel. Approximate Mr values of GST-gG fusion proteins produced by pEG4.1 (EHV4 gG), pEG1.l (EHV1 gG (aal-310)) or pEG1.2 (EHV1 gG) are indicated to the right.
Eigure 9 Coomassie brilliant blue (Coomassie) and Western blot of GST-gG fusion proteins expressed in E. coli transformed with parental pGEX, pEG4var or pEGlvar. Membranes were probed with pooled SPF foal 3 and post-EHV4 No.2 horse sera (EHV4 only-Ab) or pooled SPF foal 1 and SPF foal 2a horse sera (EHV1 only-Ab) and pooled SPF foal preexposure sera (preexposure-Ab). Approximate Mr values of GST fusion proteins produced by pGEX (GST only), pEG4var (E4 gG aa287-382) or pEGlvar (El gG aa288-350) are indicated to the right. ltm gm of fusion protein was loicd to each lane.
Eigurs.Ia Titration curves showing reactivity in ELISA of SPF foai 1, SPF foal 2a, SPF foal 3 and post-TzHV4 No.2 horse sera with the recombinant proteins GST only (open circles), GST-EHV4 gG (amino acids 287-382; open squares) and GST- WO 93/24528 PCT/AU93/00253 20 EHV1 gG (amino acids 288-350; closed squares) produced by E. coli transformed with pGEX, pGE4var, or pEGlvar respectively.
Eigure11 The four numbered circles are spots on the filter paper impregnated with the designated antigen. In this format a horse immunized with an EHV4 and/or EHV1 gG gene deleted virus would not contain antibody to either gG so there would be no colour charge in the upper two dots. However, the horse would contain antibody to many (all) other antigens of EHV4 and EHV1 and hence the lower left whole EHV4 (or EHV1) spot would give a colour change-indicative of a vaccinated but not an infected horse. An example of this type of test is marketed by Agritech Systems Inc under the trade mark "CITE".
FigurUc2 This test could also be formatted in, for example, the familiar 96-well microprocedure plate (four wells of which are represented) in which alternate triplet wells would contain EHV4 gG, EHV1 gG and either EHV4 or EHVI whole virus absorbed to the bottom of the well. Appropriate other negative and positive control wells or spots, in the case of the filter paper test, could be included to further validate the test. The fourth well shown contains an uninfected cell lysate as an example of a negative control. An example of this type of test is marketed by Agritech Systems Inc under the trade mark "PETCHEK".
SUMMARY OF DETAILED DESCRIPTION Equine herpesvirus 4 (EHV4) glycoproteins of Mr 63K and 250K were identified in WO8 93/24528 PCT/AU93/00253 21 the supernatant of infected cell cultures. The 63K glycoprotein was type-specific, that is, it reacted with monospecific sera from horses that had been immunized or infected with EHV4, but not with monospecific sera from horses immunied or infected with EHV1, a closely related alphaherpesvirus. It was proposed that the secreted protein may, in fact, be the homologue of similarly secreted glycoproteins of herpes simplex virus 2 glycoprotein G (HSV2 gG) and pseudorabies virus (PRV) gX, which is the homologue of HSV2 gG notwithstanding the highly similar nature of EHV4 and EHV1 glycoprotein when compared to the HSV and PRV glycoproteins which would teach away from the expectation of such a result. The US region of the EHV4 genome, toward the internal repeat structure, was sequenced. Four open reading frames (ORFs) were identified of which ORF4 showed 52% similarity to the gene encoding PRV gX in a 650 nucleotide region. ORF4 coded for a primary translation product of 405 amino acids which has a predicted size of 44 kilodaltons The amino acid sequence of ORF4 showed 28% identity with PRV gX and 16% identity with HSV2 gG, although significantly greater identity was observed in the N-terminal region including the conservation of 4 cysteine residues. Accordingly, we designate ORF4 as EHV4 gG. The predicted amino acid sequence of the EHV4 gG showed characteristics of an envelope glycoprotein. Expression of the entire EHV4 gG gene in the bacterial expression vector pGEX-3X produced a type-specific fusion protein of Mr 70K of which the gG portion comprises 43K. Antibody that was affinity purified from selected portions of Western blots containing the 70K gG fusion protein reacted with the 63K secreted glycoprotein. Conversely, antibody affinity purified to the 63K secreted product reacted with the 70K gG fusion protein. These results showed that the EHV4 63K secreted glycoprotein was EHV4 gG, the third WO 93/24528 PCT/AU93/00253 22 alphaherpesvirus gG homologue known to be, at least in part, secreted. The antigenicity of full and partial length EHV4 gG and EHV1 gG molecules expressed in E. coli.was determined. Fusion proteins comprising full length EHV4 gG (405 amino acids) or EHV1 gG (411 amino acids) reacted strongly and type-specifically with pooled post-EHV4 only or -EHV1 only horse sera respectively. A fusion protein containing amino acids 1-310 of EHV1 gG was not immunoreactive with the post-EHV1 horse sera thereby localising the immunoreactive epitope(s) to the Cterminal portion of the molecule. It was postulated that the type-specific epitopes were located within the highly variable regions comprising amino acids 287-382 of EHV4 gG and 288-350 of EHV1 gG. Fusion proteins expressing these variable regions reacted strongly and type-specifically with a panel of post-EHV4 and/or post-EHV1 horse sera. These fusion proteins, which were easily purified and produced in large amounts, provided the basis for the development of diagnostic' serologica! assays such as ELISA to distinguish EHV4-, EHV1- and dual-infected horses.
MA
T
ERTALS AND METHODS Cells and viruses Virus strains EHV4.405/76 and EHV1.438/77 at passages 5 and 3 were grown in equine fetal kidney (EFK) cells respectively as described elsewhere Purification of virions was also carried out as described previously. Infected cell culture supernatant was prepared by infecting cells as described previously except that after virus WO 93/24528 PCT/AU93/00253 23 adsorption the cells were washed twice with Hank's balanced salt solution before the addition of serum free maintenance medium. The supernatant was collected at 16h post infection, clarified at 2,500 X g for 10mins then centrifuged at 100,000 X g for and stored at -20 0 C until required.
Antibodies MAbs 1G12, 13A9, 3F6 and 20C4, directed against EHV4 gp2, gplO, gpl4 (gB, large subunit) and gpl8 (gD) respectively, were provided by G. P. Allen (University of Kentucky, Lexington, KY, USA). Monospecific antisera to EHV4 and EHV1 were obtained from colostrum-deprived, SPF foals after a series of immunizations and challenges with either EHV1 (foal 1) or EHV4 (foal Post-EHV4 only and post- EHVI only horse scra were obtained from colostrum-dcprived, specific-pathogcn-free (SPF) foals after a series of immunizations and challenges with either EHV1 (foal 1 serum) or EHV4 (foal 3 serum). Another post-EHV1 only horse serum was obtained from a third SPF foal that was experimentally infected with EHV1 (foal 2a serum).
This foal was later cross-challenged with EHV4 (foal 2b serum). Post-EHV4 only sera were also obtained from three previously seronegative horses that were experimentally infected with EHV4, termed post-EHV4 Nos. 1, 2 and 3. Sera were also obtained from two mares that had aborted as a result of EHV1 infection either weeks (post abortion marc 1) or 1 year (post abortion mare 2; see Table A serum was also obtained from a foal which had been ,cnerimcentally infected intrauterinally with EHV2 and which possessed high aibody titers to this virus.
WO 93/24528 PCT/AU93/00253 24 Western blots Sodium doedecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE) and electrophorctic transfer of viral proteins to Immobilon polyvinylidene fluoride (PVDF; Milipore) membranes were carried out as described previously The PVDF membranes were cut into strips and probed in either 2ml wells or small trays, depending on the size of the membrane strip, with either, MAbs diluted 1/1000 in antibody diluent (phosphate-buffered saline (pH 7.5) containing 0.05 Tween- (PBST) with 5 mg/ml bovine serum albumin (BSA 5 and 5% goat serum), polyclonal sera diluted 1/100 or affinity purified antibody (as described below) for 1 h at room temperature. Membranes were then washed for 15mins "with PBST. The primary antibody was detected with either a 1/1000 dilution of affinity purified rabbit anti-mouse IgG (Dako Immunoglobulins) or a 1/300 dilution of an affinity purified goat anti-horse IgG (Kirkegaard and Perry Laboratories Inc.), both conjugated with horseradish peroxidase, where appropriate. The blots were washed again with PBST and developed using a 3'diaminobcnzidine (DAB) substrate (Sigma).
ELISA.
ELISA's were carried out in 96 well polyvinyl chloride microtitre plates (Nunc- Immunoplate Maxisorp). The plates were washed 4 times between each step with PBST and incubated with volumes of 100pI/well on a shaker for lh unless otherwise stated. Wells were coated with approximately 0lg/ml purified virus, glutathione-S transferase (GST; see below) fusion protein or cell culture supernatant WO 93/24528 PCT/AU93/00253 25 diluted 1/5 in 0.05 M carbonate-bicarbonate .buffer (pH 9.6) overnight at 4°C.
Unoccupied sites were blocked by incubation for 2h with BSAPBS containing goat serum (200 p.l/well). Serial dilutions of polyclonal horse sera were then made in the wells using BSAsPBST containing 5% goat serum as diluent. Horseradish peroxidase-conjugated affinity purified goat anti-horse IgG (Kirkegaard and Perry Laboratories Inc.), diluted 1/1000 in antibody diluent, was added to each well. Plates were developed using a soluble TMB substrate (Sigma) and read spectrophotometrically, after 15mins incubation at room temperature without shaking, at 450 nm using a Titertek Multiskan MC3 (Flow Laboratories).
DNA cloning and sequencing Cloning of the subfragments of the EHV4 Eco RI G fragment has been described previously. E. coli strain DH5a was used to maintain the clones HS (2 kb) and G19 (3.4 kb). In order to determine the complete sequence of the clones a nested set of deletions was generated for each strand using the Erase-a-base system (Promega).
After religation, the deleted plasmid DNA was used to transform competent E. coli The relevant deletion clones were selected and sequenced using the dideoxy chain termination method using modified T7 DNA polymerase (Pharmacia, Uppsala, Sweden) and ["S]-dATP (Amersham). bequencing reactions were electrophoresed in 6% polyacrylamide wedge gels. In addition, internal oligonucleotide sequencing primers were synthesized and used to fill in gaps in the sequence.
WO 93/24528 PCT/AU93/00253 26 DNA sequence analysis DNA sequence data analysis was performed using the Geneworks software package (IntelliGenetics, Mountain View, California, USA). Sequence similarity searches were made in the GenBank database using the FAST A programs of Pearson and Lipman (1988).
Preparation of EHV4 gG and EHVI gG recombinant plasmids.
The bacterial expression plasmids pGEX-3X or pGEX-2T (AMRAD, Hawthorn Australia) were used to express the EHV4 gG and EHV1 gG genes from strains 405/76 and 438/77 respectively. Restriction cndonuclease digestion and ligation of DNA as well as CaCI2 transformation of competent E. coli were carried out according to Sambrook et al. For the derivation of clones pEG4var and pEGlvar (see below) transformation was performed using the Gene-Pulser Electroporator (Bio-Rad). The EHV1.438/77 Barn HI D fragment, which encompasses much of the EHV1 US region (Fig. was cloned into pUC-19 following purification of the fragment from an agarose gel slice using Prep A Gene matrix and buffers (Bio-Rad). The nucleotide sequence of the first and last 200-300 bases of each recombiiant expression plasmid was determined to ensure correct identity, orientation and frame of the cloned gene (data not shown). The following recombinant plasmids (see also Fig. 6) were constructed: pEG4.1 which was derived from a pUC-18 deletion clone, designated 18S/E, WO 93/24528 PCr/AU93/00253 27 which was derived in the course of DNA sequencing by utilizing a Pst I site located just upstream from the start of the gG gene. The plasmid contained a 1.4 kilobase pair insert within which was the entire EHV4 gG gene (1,215 nucleotides) plus three nucleotides upstream from the gG initiation codon and 201 nucleotides downstream from the gG gene (Figs. 2, 3 and After digestion of 18S/E with Bam HI and Eco RI, the insert was excised from an agarose gel following electrophoresis, purified using Prep A Gene matrix and buffers (BioRad), and ligated into the Bam HI/Eco RI site of the bacterial expression plasmid pGEX-3X such that the 5'-end of the gG gene was adjacent to and in frame with the 3'-end of the fusion protein glutathione Stransferase (GST).
(ii) pEG1.1 contains a 933bp insert encompassing the first 930bp of the EHV1 gG gene plus three base pairs upstream from the initiation codon. This plasmid was derived from an EHV1.438/77 Bam HI D clone utilizing Pst I sites located at either end of the insert, creating blunt ends with Klenow enzyme and dNTP's and ligating into the Sma I site of pGEX-3X.
(iii) pEG1.2 contains the entire EHV1 gG gene of 1,233bp. The insert was derived by polymerase chain reaction (PCR) amplification of the EHV1 gG gene using Vent polymerase (New England Biolabs) at 35 bycles of 940 x 20scc, 480 x 20scc, 720 x 2min. The EHV1.438/77 Bam HI D plasmid which includes the entire gG gene (Fig. 6) was used as template DNA and the synthetic oligonucleotide primers, which encompassed the first and last 17 nucleotides the EHV1 gG gene and included Bar HI sites (in bold type below) plus a 2 base overhang, were as follows: forward WO 93/24528 PCT/AU93/00253 28 cgggatccatgttgactgtcttagc-3'; reverse 5'-cgggatcctaagcaacgtactcaag-3'. It was not possible to clone the 1.23 kb PCR product directly into the Bam HI site of pGEX-2T presumably because the Bar HI recognition sites close to the end of the fragment were not readily digested. As a result, the fragment was blunt ended using Klenow DNA polymerase (Pharmacia) and dNTP's followed by phosphorylation using polynucleotide kinase and then cloned into the Sma I site of pUC-19 Digestion of the pUC-19/EHV gG clone with Bam HI released the 1.23kb fragment which was then cloned into the Bam HI site of pGEX-2T.
(iv) pEG4var contains nucleotides encoding EHV4 gG amino tPids 287 to 382 and was constructed by PCR amplification (35 cycles of 940 x 20sec, 500 x 20scc, 720 x 30sec) using pEG4.1 DNA as template and the following primers: forward gaaaatgaaacctacag-3'; reverse 5'-tggaggccatgcaacac-3'. The fragment obtained was cloned directly into the Sma I site of pGEX-3X.
pEGlvar contains the nucleotides encoding EHV1 gG amino acids 288-350 and was constructed by PCR amplification as described above for pEG4var except that EHV1 Bam HI D was used as template DNA and the primers were as follows: forward 5' agtgacgaaacatacga-3'; reverse 5'-tggatgccgttcgacgc-3'.
GST-fusion protein preparations STh6 pGEX plasmid was chosen for expression because of the ease with which the GST-fusion protein can be affinity purified by utilizing agarose beads coated with covalently attached reduced glutathione (Sigma), a strong ligand for GST. Several colonies containing the recombinant plasmid were isolated and protein was prepared WO 93/24528 PCT/AU93/00253 29 by a small-scale GST-fusion protein purification method based on that of Smith and Johnson (1988). Briefly, single colonies were inoculated into 5ml broth cultures and incubated for 4h at 37°C after which time 5pl of a 1M IPTG stock solution was added and the cultures further incubated for 2h. The bacteria (1.5ml of culture) were pelleted by centrifugation at 12, 00Og for 2mins, washed once with 1.5ml PBS and made up to 0.5ml with PBS containing 1% Triton X-100. The cells were sonicated at a low setting (2 x 10secs) and centrifuged as above. Glutathione agarose beads of a 50% suspension in PBS; Sigma) were then added to the supernatant and the mixture left at 4 0 C for 15mins with intermittent mixing. The beads were centrifuged at 12, 000g for 30secs, washed 3 times with 1.5 ml of PBS and finally resuspended in 20 0 .l of sample buffer prior to SDS-PAGE.
Affinity purification of antibody from selected portions of Western blots Antibody was affinity purified from selected portions of Western blots by eluting antibody at low pH based on the method of Beall and Mitchell (1986). Briefly, proteins were separated by SDS-PAGE after first loading either EHV4 supernatant, diluted 1/2 in double strength reducing buffer (200.1l), or recombinant gG protein (2001l) into a 5cm well. Following the transfer of proteins to PVDF membranes, selected portions of the membranes were cut such that the protein of interest was contained in the cut out portion. To isolate the 63K secreted protein a section containing proteins from 50K-70K was cut out and to isolate the 70K recombinant GST-jG protein a section containing proteins from 65K-75K was cut out. Cut out membrane portions were blocked to prevent non-specific binding by incubating for WO 93/24528 PCT/AU93/00253 30 lh in BSA,PBST containing 5% goat serum. EHV4 antiserum diluted 1/10 in BSA,PBST containing 10% goat serum and 10% fetal bovine serum (with total volume of 2ml) was then added to the cut out membrane for 2h with constant rocking.
The membranes wero washed extensively for 30mins with PBST. Antibody was eluted from each membrane using 2ml cf 0.1M glycine, 0.15M NaCI (pH 2.6) for 3 mins. The eluate was adjusted to pH7.5 by addition o" 300[.l Tris-HCI (pH diluted 2-fold in BSAPBST containing 5% goat serum and either stored at -70°C or used immediately, with no further dilution, to probe Western blots.
EXAMPLE ONE Identification of secreted, type-specific glycoprotein(s) of EIV4 EHV4 and EHV1 infected cell culture supernatants were examined for the presence of secreted viral proteins. Fig. la shows a Western blot of EHV4 infected cell culture supernatant and mock infected cell culture supernatant probed with a pool of post- EHV4 horse sera, An immunodeminant region is evident in the EHV4 supernatant at approximately 200K and 63K while no such proteins were seen in the mock supernatant. The supernatant proteins were also probed with a pool of MAbs directed to gp2, gpl0, gpl4 (large gB subunit) and gpl8 (gD) (Fig. la). Only when the membranes were left in TMB substrate for a prolonged period could these proteins be visualized in the supernatant, indicating that they were all present in low abundance.
Nevertheless, gp2 appezred co-migratory with the larger of the secreted products while none of the other three glycoproteins was co-migratory with the 63K secreted WO 93/24528 PCT/AU93/00253 31 product. The small subunit of the gB heterodimer (62K), a major EHV4 glycoprotein which migrates to a position on an SDS-PAGE gel just above gpl8 (56K), has a Mr similar to the smaller secreted product (Fig. la). To examine the relationship between these two proteins and to determine if the secreted products were glycoproteins, ["C]glucosamine labelled virion proteins and supernatant proteins were subjected to SDS-PAGE on a large (16 cm X 16 cm X 0.75 mm), polyacylamide gel (Fig. lb). Glycoproteins at approximately 250K and 63K were evident in the EHV4 supernatant. A small amount of a glycoprotein co-migrating with gpl3 was also observed in the EHV4 supernatant suggesting either that this glycoprotein was also secreted, albeit at low levels, or that low levels of all the glycoproteins were present in the infected cell culture supernatant possibly as a result of lysis of some infected cells and that gpl3, being the most heavily labelled, was the only glycoprotein easily observed. Both the 250K and 63K products did not appear to exactly co-migrate with viral glycoproteins gp2 and small gB subunit (Fig. lb).
Unlike the small gB subunit, the 63K secreted product was identified as a rather diffuse glycoprotein band that did not label particularly well with [(C]glucosamine.
Furthermore, as the EHV4 gB heterodimer is derived from a single gene and is covalently linked by disulphide bonds, it is unlikely that the small gB subunit would be secreted in the absence of the harge gB subunit. It appeared likely, therefore, that both the 250K and 63K secreted products were previously undefined glycoproteins of EHV4.
The type-specificity of the secreted products was examined. In Western blot the smaller product (63K) was shown to be completely type-specific as it reacted strongly WO 93/24528 PCT/AU93/00253 32 with monospecific horse sera from SPF foals or previously seronegative horses that were either immunized or infected with EHV4 but not with sera from SPF foals that were either immunized or infected with EHV1 (Fig. 1c). Of particular note was the seroconversion of foal 2 from a negative to positive reaction in Western blot to the 63K secreted product after this foal, which was initially infected with EHV1 (foal 2a serum), was cross-challenged with EHV4 (foal 2b serum). The 250K secreted product appeared less immunodominant than the 63K secreted product. However, this may be misleading as the 250K secreted product may not have transferred to the PVDF membranes as efficiently as the 63K secreted product.
The ELISA data presented in Table 1 shows that: The monospecific horse sera, mostly obtained from SPF-foals (described above), showed significant ELISA titres of between 103.6 (4,000) and 104.3 (20,000) when tested against the virus to which they were exposed; either EHV1 or EHV4. Each serum contained antibody which was cross-reactive with the heterologous virus such that its ELISA titre against either virus was very similar. The EHV4 secreted product(s) produced an EHV4 specific response in ELISA i. when the EHV4 supernatant was used to coat the wells of ELISA plates post-EHV4 sera showed titres of between 500 and 1000 whereas post- EHV1 sera showed titres of between 20 and 40. This not only confirmed the Western blot results (Fig. 1c) but indicated that any discontinuous epitopes on the secreted product(s), that would be presented in this type of assay but not in Western blot, were also type specific; The EHV1 supernatant did not react significantly with any serum indicating that EHV1 did not secrete a protein that was detectable with these immune -reagents.
WO 93/24528 PCT/AU93/00253 33 DNA sequence analysis Clones carrying fragments of the US region close to the internal repeat region of the EHV4 genome were sequenced (Fig. Analysis of 5451 nucleotides showed four complete major ORFs, two rightward and two leftward, and one partial ORF in the rightward orientation (Fig. Similarty searches of the GenBank database revealed that ORF2 was most homologous to HSV1 US2, ORF3 to PRV US1 (protein kinase) and its homologue HSV1 US3, ORF4 to PRV US2 and ORF5 to HSV1 No statistically significantly homologous gene was observed for ORF1.
Analysis of ORF4, the gene showing similarity to the PRV gX gene, is described below while the other genes are not discussed further in this manuscript.
The sequence of ORF4 and flanking regions is shown in Fig. 3. Examination of the flanking sequences of the ORF4 gene revealed; A TATA box, TATAAA, beginning 79 nucleotides upstream from the initiation codon (position -79) aligns well with the PRV gX TATAAA which is at position -65 (Rea et al., 1985) A poly (A) signal AATAAA located 124 nucleotides downstream from the termination codon (c) A GT-rich region beginning 168 nucleotides downstream from the termination codon.
The coding region comprises 1215 nucleotides coding for 405 amino acids. The Nterminus of the predicted amino acid sequence has some features characteristic of a membrane insertion (signal) sequence including hydrophobic amino acids from Leu-2 to Gly-19 (Fig. 3) followed by a potential peptidase cleavage site between Gly-19 and Arg-20 (Fig. However, there is no positively charged residue(s) to the left of WO 93/24528 PCT/AU93/00253 34 the hydrophobic amino acids which is common for herpesvirus glycoprotein signal sequences. The predicted cleavage site is preceded by a helix breaking residue, Gly- 16, which is usual for signal sequences. Further evidence for this location of the cleavage site is shown by comparison of the 9 amino acids of ORF4 which directly follow the predicted cleavage site with the corresponding 9 amino acids of PRV gX, the protein which showed most similarity to ORF4 (see below), in which 6 amino acids directly align including Cys-27 (EHV4) with Cys-28 (PRV). The C-terminal 18 amino acids are hydrophobic in nature and this region may comprise the glycoprotein transmembrane domain (Fig. The sequence contains 5 potential asparagine-linked (N-linked) glycosylation sites, which require the motiff Asn-X- Ser/Thr where X is not a proline residue, occurring at positions 83, 138, 174, 221 and 288 (Fig. 3).
Only two proteins in the GenPept protein database showed significant identity with the predicted amino acid sequence of ORF4, PRV gX (the HSV gG homologue) and HSV2 gG. ORF4 showed 28% overall amino acid identity with PRV gX although significantly greater identity was apparent toward the N-terminus. The similarity of the two sequences was further evidenced by the conservation of 5 cysteine residues, 4 located in the N-terminal region, and by the occurrence of 8 separate regions of to 6 identical residues. There was also a limited identity observed between ORF4 and HSV2 gG but again greater identity was observed toward the N-terminus including conservation of the same 4 cysteine residues as conserved with PRV gX.
The EHV4 gG N-linked glycosylation site at position 138 was conserved in both PRV gX and HSV2 gG, suggesting that this site at least is probably utilized, while those WO 93/24528 PCT/AU93/00253 35 at positions 83 and 221 were conserved in PRV gX only. On a basis of the similarity observed between ORF4 with PRV gX and with HSV2 gG, ORF4 was designated EHV4 gG.
Expression of the EHV4 gG gene to identify 63K secreted product as EHV4 gG A 1.4 kilobase pair subfragment which contained the entire gG gene (1215 base pairs) as well as five base pairs upstream and 201 base pairs downstream of the gG gene was cloned into pGEX-3X ensuring that the gG gene was in frame with the GST fusion protein gene. The resulting pGEX-EHV4-gG recombinant clone was termed pEG4.1. The fusion protein subsequently expressed by pEG4.1 transformed cells was, after purification on glutathione-agarose beads, identified in Western blot using a pool of post-EHV4 horse sera (Fig. 4a). This protein had a Mr of 70K; the gG portion constitutes 43K as the Mr of GST is 27K. The 70K fusion protein did not react in Western blot with a pool of post-EHV1 SPF-foal sera (Fig. 4a). A corresponding band was not observed in the control preparations from cells transformed with pGEX only.
To determine if the EHV4 63K secreted product described earlier was in fact gG, antibody was affinity purified from selected portions of Western blots that contained either the 63K secreted product or the 70K EHV4 GST-gG fusion protein. Using these two affinity purified antibody preparations to probe Western blots it was shown that both antibody preparations reacted strongly with the 63K EHV4 secreted product and the 70K EHV4 gG fusion protein (Fig. 4b). This confirmed that gG was the 63K WO 93/24528 PCT/AU93/00253 36 product found in the cell culture medium of infected cells. It was also apparent that the 250K secreted product was not related to the 63K secreted product as neither antibody preparation reacted with this glycoprotein (Fig. 4b). A glycoprotein at 63K was also detected on Western blots of purified EHV4 virions using both affinity purified antibody preparations (data not shown).
Comparison of the sequences of EHV4 gG and EHV1 gG.
The nucleotide sequences of EHV1 gG from two different strains, EHV1.Ab4p, and EHV1.KyA, and the EHV4 gG sequence of strain EHV4.405/76 (described here) and have not been compared. The two EHV1 gG sequences differed from each other in three nucleotides all located toward the 3'-terminus of the gene and all resulting in frame shifts (data not shown). A missing guanosine at the first position of codon 335 in EHV1.KyA gG results in a different codon usage from EHV1.Ab4p gG until an additional adenosine in EHV1.KyA gG at the first position of codon 356 restores the two sequences to identical codon usage. Also, a missing cytidine at the third position of codon 374 in EHV.1KyA gG produces a stop codon whereas EHV1.Ab4p gG reads to codon 411. Therefore the two published sequences of EHV1 gG not only differ in their amino acids at positions 335-356 but are of different lengths with EHV1.KyA gG possessing 373 and EHV1.Ab4p gG 411 amino acids.
In an attempt to reconcile these differences we determined the nucleotide sequence of the and 3'--termini (approximately 3u0 nucleotides at each end) of recombinant plasmid pEG1.2 which contains the entire EHV1 gG gene derived from our prototype WO 93/24528 PCT/AU93/00253 37 EHV1 strain 438/77 (data not shown). The sequence obtained, which covered all the ambiguous nucleotides, was identical to that of the EHV1.Ab4p gG sequence.
Furthermore, the size of the GST-fusion protein produced by pEG1.2 (72K) was slightly larger than the GST-fusion protein produced by pEG4.1 (70K), an expression plasmid containing the entire EHV4.405/76 gG gene which codes for a protein of 405 amino acids (Fig. This is consistent with EHV1.438/77 gG, like its EHV1.Ab4p counterpart, comprising 411 amino acids.
A comparison of the pre icted amino acid sequences. of EHV4.405/76 gG and EHV1.Ab4p gG is shown rig. Sa. These glycoproteins show an overall identity of 58% with the C-terminal region generally showing considerably more divergence than the N-terminal region. Amino acids 1-286 of EHV4 gG and 1-287 of EHV1 gG show an identity of 75% whereas the apparently corresponding C-terminal regions of EHV4 gG, amino acids 287-382, and EHV1 gG, amino acids 288-350, have diverged widely.and exhibit little amino acid identity (Fig. 5a). Another region of considerable diversity is a 25 amino acid region, residues 32-57 of both viruses, in which only 9 amino acids are identical. The nucleotide sequences of EHV4 gG and EHV1 gG also show considerable divergence in the two above mentioned variable regions (data not shown). Using the protein algorithm of Hopp and Woods both divergent regions are predicted to encompass antigenic sites (Fig. EHV4 gG and EHV1 gG each has 9 cysteine residues in their respective predicted extracellular domains all which are conserved between the two viruses. Four cystcine residues located toward the N-terminus are conserved with pseudorabics virus (PRV) WO 93/24528 PCT/AU93/00253 38 gG HSV2 gG and infectious laryngotracheitis virus (ILTV) gG (gX) (Fig. Sa).
The predicted extracellular domain also contains five and six potential N-linked glycosylation sites for EHV4 gG and EHV1 gG respectively. The three N-linked glycosylation sites at positions 83, 138 and 221/222 (EHV4/EHV1) that are conserved between EHV4 gG and EHV1 gG are also conserved in PRV gG (gX) while the site at position 138 is also conserved in HSV2 gG and ILTV gG (gX) (Fig. The C-terminal variable region of EHV4 gG (amino acids 287-382) also possesses a repeated sequence of 9 amino acids MKNNPXYSE, where X is an isoleucine in the first repeat and a valine in the second, which is separated by 18 amino acids (Fig. Expression of EHV4 gG- and EHV1 gG-fusion proteins.
E. coli transformed with recombinant pGEX plasmids pEG4.1, pEG1.1 or pEG1.2 express GST-fusion proteins associated with either entire EHV4 gG (405 amino acids), partial EHV1 gG (amino acids 1-310) or entire EHV1 gG (411 amino acids) respectively (Figs. 6, 7 and 8) The fusion proteins were purified and assessed for their capacity to bind to antibody in pools of post-EHV4 only or post-EHV1 only horse scra (Figs. 7 and 8; Table It was evident from Coomassic Brilliant Blue stained SDS-PAGE gels that pEG4.1, pEG1.1 and pEG1.2 produced stable fusion proteins of approximately 70K, 60K and 72K respectively (Fig. However, unlike GST alone these recombinant GST-fusion proteins were largely insoluble and remained in the cell pellet after solubilization (Fig. Nevertheless, adequate WO 9 3/24528 PCT/AU93/00253 39 amounts of the fusion proteins were purified for Western blot analysis.
Pooled post-EHV4 only horse sera reacted strongly with pEG4.1 fusion protein but not with pEG1.1 or pEG1.2 fusion proteins (Fig. Conversely, pooled post-EHV1 only horse sera showed strong reactivity with pEG1.2 but not with pEG1.1 or pEG4.1.
Therefore, it was apparent that EHV4 gG- and EHV1 gG-fusion proteins possessed strong type-specific, presumably continuous epitope(s). It also appeared as though these epitope(s) were located in the C-terminal regions of the glycoproteins as pEG1.1, which expressed amino acids 1-310 of EHV1 gG, was not antigenic whereas pEG1.2, which expressed amino acids 1-411 of the same protein, was a strong antigen. The insolubility of pEG4.1, pEG1.1 and pEG1.2 fusion proteins meant that relatively large amounts (approximately 501 of one small-scale fusion protein preparation) of purified GST-fusion protein was required. As a result some contaminating E. coli protein bands were evident in the Western blot shown in Fig. 8.
It was considered most likely that these type-specific, continuous epitope(s) were located in the C-terminal variable regions of EHV4 gG (amino acids 287-382) and EHV1 gG (amino acids 288-350). To show this as well as to produce more soluble antigens that are able to be purified in large amounts two pGEX-3X clones, termed pEG4var and pEGlvar, which express the corresponding variable regions of EHV4 gG and EHV1 gG respectively were constructed. The GST-gG fusion proteins produced by pEG4var and pEGlvar were highly soluble as reflected by the case of purification from E. coli lysates (Fig. These antigens were also strongly type-specific in Western blot using pooled post-EHV4 only or post-EHV1 only horse sera thereby confirming that the location of type-specific epitopes was within these variable WO 93/24,L28 PCTI/AU93/00253 40 regions (Fig. 9).
An ELISA was developed using the recombinant gG antigens produced by pEG4var and pEGlvar. Fig. 10 shows the titration curves obtained for the four polyclonal horse sera used as the pooled sera to produce the Western blots described above.
Post-EHV4 only (foal 3 and post-EHV4 No. 2) or post-EHV1 only (foal 1 and foal 2a) horse sera showed a type-specific serological response against the GST-EHV4 gG or -EHV1 gG fusion proteins respectively. The slight reactivity observed at low dilutions for foal 3 and post-EHV4 No. 2 sera against GST-EHV1 gG and GST-only was probably due to reactivity against contaminating E. coli proteins which would be present at low (and variable) levels in the antigen preparations as no cross-reactivity was observed for these sera with GST-EHV1 gG or GST-only in Western blot (Fig. 9).
Several other horse sera were tested in ELISA for reactivity to the GST-gG fusion proteins produced by pEG4var or pEGlvar and the titres obtained are shown in Table 2. From the data shown in Table 2 it was evident that: The post-EHV4 or post-EHV1 only horse sera showed significant ELISA titres of between 4,000 and 21,000 when tested against the virus to which the horses were exposed. Each serum contained antibody which was cross-reactive with the heterologous whole virus such that its ELISA titer against either virqs was very similar. The GST-EHV4 gG and -EHV1 gG fusion proteins reacted type-specifically against all the known post-EHV4 only and post-EHVI only sera te-ted; low levels of cross-reactivity were not significantly different from the reactivity to GST-only. SPF foal 2, which WO 93/24528 PC/AU93/00253 41 was initially experimentally infected with EHV1 (foal 2a serum) and consequently reacted against GST-EHV1 gG only seroconverted after cross challenge with EHV4 (foal 2b serum) to become reactive against both GST-EHV4 gG and GST-EHV1 gG.
It was also noted that cross-challenge with EHV4 did not boost the response to GST-EHV1 gG, indeed antibody to GST-EHV1 gO act;Asly showed a 4-fold decrease. The two post-EHV1 abortion mare sera, w.,ia were obtained 5 weeks (abortion mare 1) and one year (abortion mare 2) after abortion, reacted strongly against both GST-EHV1 gG and GST-EHV4 gG. Exposure to different virus strains of EHV4 and EHV1 d'd not affect the serological response to their respective GST-gG antigens, which is particularly relevant in the case of EHV1.849/89 which was isolated from abortion mare 2 and which is an intratypic variant EHV1.IB electropherotype As can be seen from the above description, examination of the supernatant of EHV4 infected cell cultures revealed the presence of two previously unidentified, secreted glycoproteins, one at 250K and the other at 63K. The 63K product was shown to unexpectedly elicit a type-specific antibody csponse in the horse, the first EHV4 or EHV1 antigen known to produce such a response. There were two lines of evidence suggesting the 63K secreted product may be the EHV4 homologue of HSV gG: (a) gG homologues in PRV and HSV2 are also, at least in part, secreted into the cell culture medium and gG homologues of other herpcsviruses have proved to be relatively divergent glycoproteins and therefore perhaps more likely to produce a type-specific antibody response than other glycoproteins. These data led us to sequence the US region of the EHV4 genome adjacent to the internal repeat structure, WO 93/24528 PCT/AU93/00253 42 the location of gG homologues in PRV, HSV1 and HSV2.
The nucleotide sequence of four complete ORFs and one partial ORF were determined: ORF1 for which no homologue was found, ORF2 which showed similarity to HSV1 US2 which codes for an as yet unidentified protein, ORF3 which showed similarity to PRV US1 and HSV1 US3 genes which code in both cases for a protein kinase and ORF4 which showed most similarity to PRV US2 which codes for gX, the homologue of HSV gG. Although the predicted amino acid sequence of ORF4 showed only 28% and 16% identity PRV gX and HSV2 gG respectively, significantly greater identity was apparent toward the N-terminus including the conservation of 4 cysteine residues across the three glycoproteins. PRV gX and HSV2 gG were the only two sequences in the GenPept database to show significant similarity to ORF4. This gene was, therefore, considered to code for EHV4 gG.
Evidence is accumulating that glycoprotein G homologues have some unusual features not found in other alphaherpesvirus glycoproteins. Perhaps the most striking of these is their considerable heterogeneity, particularly toward the C-terminus of the molecules. It is apparent that the genes have diverged widely both by point mutation and by the deletion and/or insertion of segments of DNA. HSV1 gG in particular appears to have suffered a large internal deletion. Consequently the sizes of the predicted amino acids sequences arn widely disparate compared to other alphaherpesvirus glycoprotein gene homologues; HSV1 gG comprises 238 amino acids, HSV2 gG 699, PRV gG (gX) 498, EHV4 gG 405, EHV1 gG 411 and ILTV gG (gX) 298.
WO 93/24528 PCT/AU93/00253 43 The gG homologues of EHV4 and EHV1 show only 58% amino acid identity; considerably less than the next most divergent of the sequenced EHV4/EHV1 glycoproteins, gC, which shows 79% identity and which possess both shared and unique epitopes It is perhaps not surprising then that EHV4 gG and EHV1 gG have proved to be the only EHV4/EHV1 antigens that are type-specific. Significantly, the epitopes responsible for eliciting a strong type-specific response in the natural host are localized to the apparently corresponding, C-terminal variable regions of EHV4 gG (amino acids 287-382) and EHV1 gG (amino acids 288-350), regions which appear to have few constraints on either the number or type of amino acid except perhaps that the amino acids in this region tend to be hydrophilic. Discontinuous epitopes, that are probably not formed in the E. coli expressed products, may be present on native gG molecules. Indeed another variable region comprising amino acids 32-57 of both EHV4 gG and EHV1 gG, which does not appear to be antigenic in the E. coli expressed molecules, may comprises part of a discontinuous epitope.
Such epitopes are largely type-specific since secreted EHV4 gG, as present in cell culture supernatant, reacts type-specifically with polyclonal horse sera in ELISA.
Another feature of the gG homologues is that all, except HSV1 gG and EHV1 gG, have been shown to be secreted, at least in part, into the growth medium. HSV1 gG does not appear to be secreted and this is probably due to a large internal deletion which results in the loss of the proteolytic cleavage site. In the case of EHV1 gG, a secreted protein has not been detected in the infected cell culture supernatants from several different strains of EHV1 using ELISA or Western blot analyses. This does not mean, however, that a secreted form of EHV1 gG, does not exist. It is possible, WO 93/24528 PCr/AU93/00253 44 as is predicted to be the case with EHV4 gG, that the proteolytic cleavage site is located within the C-terminal variable region, amino acids 288-350; a region which possesses a strong, perhaps the immunodominant, epitope(s). Proteolytic cleavage of EHV1 gG may either destroy such an epitope(s) or leave the epitope(s) present in the virion associated species such that the secreted species does not possess any strorng epitopes easily detectable in ELISA or Western blot. The complete lack of reactivity of an EHV1 gG fusion protein expressing amino acids 1-310, which includes some of the variable region, lends some support to such a proposal.
Application of glycoprotein G to a diagnostic test and vaccine development.
The overall rational and methods for diagnostic testing and vaccine development used in the instant invention are well documented in the art and shall not be repeated in the instant specification. For example:- Australian Patent 591145, US Patent 5,041536, and WO 92/21751 disclose diagnostic kits, test methods and vaccination utilizing single virus types. Such methodology is generally applicable to the instant invention and the above documents are incorporated by herein reference.
WO 90/13652 and WO 90/13573 disclose diagnostic kits, test methods and vaccination utilizing dual virus types having a broad divergence.
Such methodology is generally applicable to the instant invention and WO 93/24528 Pd;/AU93/00253 45 the above documents are herein incorporated by reference.
However, the instant invention differs from the specific disclosures above by allowing, for the first time, the diagnosis and selective treatment of two very closely related viruses which up until recently have remained virtually indistinguishable.
It is evident since EHV4 gG and EHV1 gG are type specific, that the genes coding for these glycoprotein could be deleted using recombinant DNA techniques from vaccine strains of the two viruses such as that developed based on EHV4.405/76 and as described in U.S. Patent No. 5,084,271 although any strain of EHV4 or EHV1 could be used. The deletion of the genes for gG would mean that a horse immunized with such vaccines would not make antibodies to the gGs, whereas a horse infected with wild type EHV4 and/or EHV1 ie., viruses containing the gene coding for gG, would make such antibodies. In this way horses immunized with a gG deletion mutant virus vaccine could be distinguished from horses infected or immunized with a gG containing virus.
The data obtained since the priority date for EHV4 gG as presented herein confirms directly that EHV1 gG is type specific, and that EHV1 vaccine with a deleted gG gene would not produce antibodies to gG when administered to a horse, and that therefore a horse immunized with an EHV1 gG deletion mutant virus can be distinguished from a horse infected with wild type EHV1 a strain containing an intact gG gene.
Accordingly not only does an immunological test where an enzyme linked WO 93/124528 PCT/AU93/00253 46 immunosorbent assay (ELISA), in which EHV4 gG and EHV1 gG are used as the antigens to distinguish horses that have been infected with either EHV4 or EHV1 or both viruses, the same test in a somewhat modified format can be used to distinguish horses that have been immunized with EHV4 or EHV1 or combined vaccines to both viruses in which the individual viruses EHV4 and EHV1, contain a deletion in the gG gene.
Figures 11 and 12 suggest some of the many possible formats for the ELISA test kits that can be used. In Figure 12 it is shown that antibody pontained in horse serum is first added to the filter paper disc and allowed to react with the designated impregnated antigens. Following washing a second anti-species antibody, such as goat anti-horse IgG antibody, that is conjugated to an enzyme is added to the filter paper and allowed to react with any bound horse antibody. After further washing substrate to the enzyme is added. If EHV4 gG and/or EHV1 gG antibody is present in the serum the EHV4 gG and/or EHV1 gG spot will show a colour change, indicating the horse has been infected with EHV4 and/or EHV1 or immunized with EHV4 and/or EHV1 strains containing the gG gene. If the horse has been infected with both viruses, both gG spots will show a colour change and if the horse has been infected with neither virus neither spot will show a colour change. The test procedure and rationale as disclosed in the FIV test product, CITE®, is incorporated by reference.
As illustrated in Figure 12, the test can equally be formatted in familiar 96-well microprocedure trays in which the gG antigens to EHV4 (well 1) and EHV1 (well 2) WO 93/24528 PCT/AU93/00253 47 are coated onto the bottom of alternate wells in the tray. Such a 96-well format, which includes appropriate control wells, such as whole EHV4 or EHV1 virus (well 3) and uninfected cell lysate (well is suitable for mass screening of serums from large horse populations. The test procedure and rationale as disclosed in the FIV test product, PETCHEK®, is incorporated herein by reference.
With the development of vaccines based on the deletion of EHV4 gG and EHV1 gG genes, in addition to having the two gG's as capture antigens, it is necessary for either the individual filter paper for testing individual horse serums or the 96-well or other formatted ELISAs to have a capture antigen to show that the horse has been immunized. Vaccines for the control of both EHV4 and EIV1 are combined vaccines i.e. they contain a mixture of both viruses, the antigen used can be either whole virus e.g. EHV4 or EHV1. The whole viruses are known to contain many cross reactive epitopes.
The invention also provides a basis for making recombinant DNA vaccines by inserting into the gG gene location genes encoding important antigens from other equine pathogens such as those from equine influenza virus, equine arteritis virus, equine rhinovirus and equine adenovirug among others. It is also claimed that the gG insertion site could be useful for the insertion of other protein genes to be delivered to horses such as those encoding adjuvants. The insertion of such other genes into the gG gene could follow deletion of part of 'the gG gene to make a gG negative mutant virus. It is evident particularly from t'he seemingly large amount of EHV4 gG secreted into the medium of infected cultures that the gG gene possesses a strong WO 93/24528 PCT/AU93/00253 48 promoter which is favourable for high level expression of foreign genes.
Since modifications within the spirit and scope of the invention may be readily effected by persons skilled in the art, it is to be understood that the invention is not limited to the particular embodiment described, by way of example, herein above, WO 93/24528 PrA9/05 PCr/AU93/00253 -49 TABLE 1.
REACTIVITY OF INFECTED CELL CULTURE SUPERNATANTS IN ELISA ELISA Titres Serum EHV4/EHVla mock SON EHY4 S/N EHVI S/N SPF foal pre bleed (pool) <1.51<1.5 <10 <10 SPF foal 1 (post El) 3.6/4.3 <10 40 SPF foal 2a (post El) 2.8/3.6 <10 20 SPF foal 2b (post El&E4) 4.3/4.3 <10 500 SPF foal 3 (post E4) 3.8/4.1 <10 630 post E4 serum No. 3 4. 1/4. 1 <10 1000 a Purified EHV4 or EEIV 1 (10 gig/l in coating buffer) was used to coat wells. Titres were determined from a titration curve and expressed as loglo of the reciprocal of the highest dilution of sera that gave an absorbance reading of at least twice the baseline reading.
b Either mock, EHV4 (E4) or EHV I (EI) infected cell culture supernatant was used to coat wells (diluted 1:5 in coating buffer). Titres are expressed as the reciprocal of the highest dilution of sera than gave an absorbance of at least twice the baseline reading.
SUBSTTUTE SHEET WO 93/24528 WO 9324528PCI'/AU93/00253 50 TABLE 2. Reactivity of EH-V4 gG and EI-IVI gG OST-fusion proteins in ELISA Immunising or infecting ELISA titersb virus staana Horse serum EHV4 EHV1 EHV4c EfV1I GST onlyd GSTE14 gG GST-El gG (aa287-382) (aa288-350) SPF foal pre (pool) SPF foal 1 UP foal 2a SPF foal 2b SPF foal 3 post-E4 No. 1 post-E4 No. 2 post-184 No. 3 abortion mare 1 abortion mare 2 post EHV2 foal 43 43 43 405(76 405(76 39/67 3 9/67 3 9/67 <30 8/77 4,000 8M7 630 VI77 21,000 6,300 13,000 6,300 13,000 8/89 40,000 9/89 NDC
ND
<30 21,000 4,000 21,000 13,000 21,000 6,300 13,000 63,000
ND
ND
<10 30 15, 3,000 1,500 30,000 30,000 15,000 3,000 10,000 30 10,000 1,000 250 150 150 300 150 1,500 3,000 84 84 OSPF foals 1 and 3 were imnmunised with inactivated virus before challenge with the homologous live virus while all other horses received live virus via either experimental (SPF foal 2, post-E4 horses, post EHV2 foal, or natural infection7 fabortion mares). The immunisation and experimental infection protocols are described in references 23, 64 and the virus strains are described in references 56, 58.
b Titers wvere determined from a titration curve and expressed as the reciprocal of the high~est dilution of serum that gave an absorbance reading of at least twice the baseline reading.
C Purified whole EHV4 or EHV I (10 jg/mIn) was used to coat wells.
d (3ST-fusion proteins prepared from E. coi transformed with parental pOEX (GST only), pt-G~ar (E4 gG aa287-382) and p'EG Ivar (131 gG aa'288-350) were used to coat wells at 0.54ig/ml.
Not eterinedSUBSTITUTE SHEET
Claims (28)
1. A substantially pure envelope glycoprotein/of equine herpesvirus (EHV) capable of distinguishing equine herpesvirus 4 (EHV4) from equine herpeisvirus 1 (EHV1) and therefore adapted to distinguish horses that have been infected with either EHV4 or EHV1 or horses infected with both EHV4 and EHV1 or horses infected with neither EHV4 or EHV1.
2. An envelope glycoprotein according to claim 1 which is type-specific to EHV4 and EHV1.
3. An envelope glycoprotein according to claim 1 or 2 which belongs to the glycoprotein G set (gG).
4. An envelope glycoprotein according to any one of claims 1 to 3 derived from EHV4 (EHV4 gG). An envelope glycoprotein according to anyone of claims 1 to 3 derived from EHV1 (EHV1 gG).
6. EHV4 gG according to claim 4 comprising a 405 amino acid sequence and corresponding to an unglycosylated Mr value of 44 kilodaltons,
7. EHV1 gG according to claim 5 comprising a 411 amino acid sequence and corresponding to an unglycosylated Mr value of 45 kilodaltons, uMAWSLirmCLt 1 i~bU 1"4 AMEiNDED SHEET IPEA/AU m52 A substantially pure nucleotide sequence corresponding to the coding region of EIV4 gG according to claim 7 comprising the following nucleotide sequence,- ATTTG GGGTGG AGACGGCG TG GGCCGATACTGTATAAAGT TG TACTA C TTA CCAGCC C AGTCAGTGTGCTGTAGTGCCACCACrCTGTAAAGCTGTGATAAGCTGCAcGCATATGTT GGCTGTGGGAGCAACTCTGTGTTTACTGAGTTTCCTAACTGGCGCTACTGGACGGCTA GCTCCTGACGACCTCTGCTATGCAGAACCCCGCAAAACCGGTCCCATGCCCCGCTCAA AACCTAAACACCAACCCCTACTATTTGAAGCCCCAMAGGTTGCTCTTACGGCAGAGTC AAAGGQTTGTCAACTAATATTGTTAGACCCTCCAATAGACATGGGCTATCGCTITAGAG GACAAGATAAACGCTTCCATTGCTTGGTTTTTTGACTTTGGTAATTGTCGAATGCCCA T'CGCATACAGAGAGTACTATGATTGCGTTGGCAACGCAATCCCATCTCCAGAAACATG TGATGGTTACTCATTTACACTTGTTAAAACAGAGGGTGTAGTTGAGTTTACCATCGTA AACATGAGCTTACTGTTGCAGCCTGGAATATACGACAGTGGMAGTTTTATATACAGCG r CCTTCTAGATATGGATGTATTGACTGGACGCGTAATTTTGACGTGGAGAACGACAC TAACTATCCATGCGGAATGACTCACGGCCTCACTGCGGATGGCMCATCAACGTAGAT GAJU\CCACGCACACAACCCCACIhrCCACGTGCTGTCGGGTGTTTTCCAGAACTCATTA ACTTCGATGCATGGGAAAACGTTACATITCGkAGAAATGGGGATACCAGACCCAAJACTC ATTT CTTG ATGATG AGAG TGAT TACCCG AATA CMTGGACT T TACTCG TGGG AT TTA TACACATATCCCAMAGCCTGMGCAGCAGAGGGGCCCCAAACCTTGTTAATAGGTG CAGTTGGACTCAGAATACTCGCGCAAGCATGGAAGTTTGTTGAAAATGAAACCTACAG CCAGCAI'ACACGTACGTACACACGTGATGCTAAGGAAGTTGATGTTACACAGCCAAGT CCTGTACAGGCTGATTCTGTCCTCGCCAAGAAACGCACATCTATGAAGAATAACCCTA TTTATTCAGAGGGGAAGCCTCATCCTAAACCGTTCAGCACGATAGACAGCATCCACAC GGAAGGGATGAAGAATAACCCTGTTTATTCAGAGAGCCTCATGCTAMACGTCCAGCAC AGTGACAGCATCACCACCCGGG>GTGTGTTGCATGGCCTCCAaGCACTGCGACAACCAGC TCAAAACTGTGTATATTGCCTAGCTCTTATTGGACTCGCACATGTGCCATGATAGGA CTAATAGTTTACATTTTTGTGCTAAGGTCAAAAATACTTCCCACAATTTATCGCGCT CACAAATTAAAACAAGAAACTATCATCGACTTGAkGTACOTTGCATrAATACATGTC AAATAAAAGTTAAAAAT~hAChPTGTTCGTCTGTAATMGCTGAGTGTGG;TTTTAAAA AATACTAAATCGCGOCAATrGTT or degencraqe equivalents or subsequences thereof coding for amino acid sequences or epitopes caipable of' eliciting a type-specific response. MAW,PPl0l684 CL iuyt6 4 jifivay W6 53
9. EH-1 gG according to claim 6 comprising the following amino acid sequence: MLTVLAALSLLS LLTSATGRLAPDELCYAEPRRTGSPPNTQPERPPVIFEPPTIA KA ESKGCELILLDPPIDVSYRREDKVNASIAWFFDFGACRMPIAYREYYGCIGNAVPSPE TCDAYSFTLIRTEGIVEFTIVNMSLLFQPGIYDSGNFIYSVLLDYHIFTGRVTLEVEK DTNYPCGMIGLTAYGNINVDETMDNASPHPRAVGCFPEPIDNEAWANVTFTELGI PD PNSFLDDEGDYPN ISDClHSWESYTYPNTLRQATGPQTLLVGAVGLRI LAQAWKFVGDE TYDTIRAEAKNLETHVPSSAAESSLENQSTQEESNSPEVAHLRSVNSOS THTGGASN GIQDCDSQLKTVYACLALIGLGTCAMIGLIVYICVLRSKLSSRNFSRAQNVKHRNYQR LEYVA or subsequences thereof capable of eliciting a type-specific response including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives. An EHV4 epitope capable of eliciting a type-specific response contained within EHV4 gG amino acids 287-382 (as hereindefined in Fig
11. An EIV4 epitope according to claim 10 having the following amino acid sequence: ENETYSQHTRTYTRDAKEVDVTQPSPVQADSVLAKKRTSMKNNPIYSEGKPHAKPFST X DSIHTEGMKNNPVYSESLMLNVQHSDSITTGGVILHGL J*I. 10 or subsequences thereof capable of eliciting a type-specific response including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives. g12. An EHV4 epitope capable of eliciting a type-specific reaponse encompassed by the following amino acid sequence: 15 KTPMPRSKPKQPLLFEAPVALT 61 1 or subsequences thereof capable of eliciting a type-specific response including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives. MA P14a8 CL 4 Janny 1996 54
13. An EHV4 discontinuous epitope characterised by a discontinuous combination of the epitopes according to claim 11 and 12 or derivatives of these 2 regions, either alone or together, with other regions of the EHV4 gG molecule.
14. Plasmid vector pEG4var (as hereinbefore defined).
15. Host cells transformed with pEG4var.
16. An EHV1 epitope capable of eliciting a type-specific response contained within EHV1 gG amino acids 288-350 as hereindefined in Fig
17. An EHVI epitope according to claim 16 having the following amino acid sequence: GDETYDTIRAEAKNLETHVPSSAAESSLENQSTQEESNSPEVAHLRSVNSDDSTHTGG ASNGI or subsequences thereof capable of eliciting a type-specific response including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives.
18. An EHV1 epitope capable of eliciting a type-specific response encompassed by the following amino acid sequence: 15 RTGSPPNTQPERPPVIFEPPTIAIK 0S 9 or subsequences thereof capable of eliciting a type-specific response including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives. 19, An EHV1 discontinuous epitope characterised by a discontinuous 20 combination of the epitopes according to claims 17 and 18 or derivatives of these I regions, either alone or together, with other regions of the EHV1 gG molecule.
20. A plasmid vector pEGlvar (as hereinbefore defined).
21. Host cells transformed with pEGlvar. I 4 hJuy 199 55
22. A vaccine adopted for the selective immunization of horses against EHV4 and/or EHVI characterised in that it comprises viruses from which the gG gene, as hereindefined, have been deleted and into which other genes derived from related and/or unrelated viruses or agents have been inserted.
23. Vaccine according to claim 22 which is a deletion mutant vaccine characterized by the deletion of EHV4 gG amino acids 287-382 or subsequences thereof capable of eliciting a type-specific response.
24. Vaccine according to claim 22 which is a deletion mutant vaccine characterised by the deletion of EHV1 gG amino acids 288-350 or subsequences thereof or amino acids located elsewhere in the gG molecule that are either directly or indirectly capable of eliciting a type-specific response. A vaccine composition comprising an immunogenic amount of the EHV4 epitope according to any one of claims 10 to 13 in a physiologically acceptable vehicle,
26. A vaccine composition comprising an immunogenic amount of the EHV1 epitope according to any one of claims 16 to 19 in a physiologically acceptable vehicle.
27. Vaccine according to claim 22 which is an insertion mutant vaccine comprising a mutant of EHV4 or EHVI containing a heterologous gene coding for 20 equine influenza virus haemagglutinin antigens or other equine virus antigens including equine influenza neurimidase or nucleoprotein antigens or derivatives thereof inserted downstream of the gG promotor by recombinant DNA techniques.
28. Vaccine according to claim 22 which is an insertion mutant vaccine comprising a mutant of EHV4 or EHV1 containing a heterologous gene coding for any one or a combination of equine arteritis virus, equine rhinovirus and equine adenovirus inserted downstream of the gG promotor by recombinant DNA techniques. So 29. A vaccine for selective immunisation of horses against EHV4 and/or EHV1 characterised by the substitution of any one of the type-specific envelope glycoproteins according to claim I or 2 with a foreign gene or genes and further MAW PP416784 1CL S Januuy 1996 PCr/AU 9 3 0 02 RECEIVED 0 2 MAR 1994 56 or subsequences thereof capable of eliciting a type-specific response including naturally occurring derivatives, variants, genetically engineered derivatives, glycosylated forms of the proteins or synthetically made derivatives. An EHV1 discontinuous epitope characterized by a discontinuous combination of the epitopes according to claims 18 and 19 or derivatives of these 2 regions, either alone or together, with other regions of the EHV1 gG molecule. 21. A plasmid vector pEGlvar (as hereinbefore defined). 22. Host cells transformed with pEG1 var. 23. A vaccine adopted for the selective immunization of horses against EHV4 and/or EHV1 characterized in that it comprises viruses from which the gG gene, as hereindefined, have been deleted and into which other genes derived from related and/or unrelated virvses or agents have been inserted. 24. Vaccine according to clam 23 which is a deletion mutant vaccine characterized by the deletion of EHV4 gG amino acids 287 382 or subsequences thereof capable of eliciting a type-specific response. Vaccine according to claim 23 which is a deletion mutant vaccine characterized by the deletion of EHV1 gG amino acids 288 350 or subsequences thereof or amino acids located elsewhere in the gG molecule that are either directly or indirectly capable of eliciting a type-specific MAW.SMJ7142CUL 2 MAh 1 AMENDED SHEET TPA/AU 57
37. An immunological test method according to claim 32 for determining when a horse has been neither infected with nor vaccinated against EHV4 by testing for the absence of EHV4 gG antibodies.
38. An immunological test method according to claim 32 for determining when a horse has been neither infected with nor vaccinated against EHV1 by testing for the absence of EHV1 gG antibodies.
39- Antibodies to any one ofEHV epitopes as defined in claims 2 to 7, 9 to 13 and 16 to 19. Antibodies according to claim 39 which are monoclonal or polyclonal.
41. Hybridisation nucleic acid probes using the gG gene sequences at the C terminus of each gene that are specific for EHV1 and EH-V4.
42. Hybridisation probes according to claim 41 comprising a nucleotide sequence complimentary to the nucleotide sequence coding for the amino acid sequence of any one of the glycoproteins defined in claims 2 to 7, 9 to 13 or 16 to 19 or derivatives thereof. DATED: 4 January 1996 V. CARTER SMITH BEADLE Patent Attorneys for the Applicant: THE UNIVERSITY OF MELBOURNE 0* a MAW:PP.#16784.CL 4 Jn>r y 1W6 S'T/AU 93 0 0 2 53 RECEIVED 0 2 MAR 60 Antibodies to any one of EHV epitopes as defined in claims 2 to 8, 10 to 14 and 17 to 41. Antibodies according to claim 40 which are monoclonal or polyclonal. 42. Hybridization nucleic acid probes specific for EHV1 and EHV4 glycoprotein Gg gene that enables distinction to be made between wild type virus and Gg deleted vaccine virus.
43. Hybridization probes according to claim 42 comprising a nucleotide sequence complimentary to the nucleotide sequence coding for the amino acid sequence of any one of the glycoproteins defined in claims 2 to 8, 10 to 14 or 17 to 20 or derivatives thereof. 2 Ma h 1994 MAWSMaW74.CUL AMEDID) SHEUt IPEA/AU
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU40547/93A AU667104B2 (en) | 1992-06-01 | 1993-05-28 | Equine herpesvirus glycoproteins |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AUPL271692 | 1992-06-01 | ||
AUPL2716 | 1992-06-01 | ||
AU40547/93A AU667104B2 (en) | 1992-06-01 | 1993-05-28 | Equine herpesvirus glycoproteins |
PCT/AU1993/000253 WO1993024528A1 (en) | 1992-06-01 | 1993-05-28 | Equine herpesvirus glycoproteins |
Publications (2)
Publication Number | Publication Date |
---|---|
AU4054793A AU4054793A (en) | 1993-12-30 |
AU667104B2 true AU667104B2 (en) | 1996-03-07 |
Family
ID=25625243
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU40547/93A Expired AU667104B2 (en) | 1992-06-01 | 1993-05-28 | Equine herpesvirus glycoproteins |
Country Status (1)
Country | Link |
---|---|
AU (1) | AU667104B2 (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU8599191A (en) * | 1990-10-20 | 1992-04-30 | Bayer Aktiengesellschaft | Vaccines against equine herpesviruses and the preparation thereof |
AU4999193A (en) * | 1992-08-07 | 1994-03-03 | Syntro Corporation | Recombinant equine herpesviruses |
AU5721494A (en) * | 1993-01-06 | 1994-08-15 | Massey University | Antibodies specific for ehv-1 and the use of such antibodies in the detection of ehv-1 |
-
1993
- 1993-05-28 AU AU40547/93A patent/AU667104B2/en not_active Expired
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU8599191A (en) * | 1990-10-20 | 1992-04-30 | Bayer Aktiengesellschaft | Vaccines against equine herpesviruses and the preparation thereof |
AU4999193A (en) * | 1992-08-07 | 1994-03-03 | Syntro Corporation | Recombinant equine herpesviruses |
AU5721494A (en) * | 1993-01-06 | 1994-08-15 | Massey University | Antibodies specific for ehv-1 and the use of such antibodies in the detection of ehv-1 |
Also Published As
Publication number | Publication date |
---|---|
AU4054793A (en) | 1993-12-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Crabb et al. | Epitopes of glycoprotein G of equine herpesviruses 4 and 1 located near the C termini elicit type-specific antibody responses in the natural host | |
Crabb et al. | A type-specific serological test to distinguish antibodies to equine herpesviruses 4 and 1 | |
JP7083362B2 (en) | Senecavirus A immunogenic composition and its method | |
JP2738524B2 (en) | How to distinguish animals infected with the virus from vaccinated animals | |
JP2002176992A (en) | Hcmv glycoprotein | |
US6544526B1 (en) | Equine herpesvirus glycoproteins | |
JP4750024B2 (en) | Vectors expressing SARS immunogens, compositions containing such vectors or expression products thereof, and methods and assays for their production and use | |
Housawi et al. | The reactivity of monoclonal antibodies against orf virus with other parapoxviruses and the identification of a 39 kDa immunodominant protein | |
NZ240558A (en) | Recombinant feline coronavirus s proteins useful in diagnosis and vaccination against feline peritonitis virus disease | |
US5578448A (en) | Nucleic acids encoding wild-type measles virus consensus hemagglutinin and fusion polypeptides and methods of detection | |
Martínez-Torrecuadrada et al. | Antigenic profile of African horse sickness virus serotype 4 VP5 and identification of a neutralizing epitope shared with bluetongue virus and epizootic hemorrhagic disease virus | |
EP0655072B1 (en) | Immunological method for the detection of antibodies to equine herpesvirus type 1 and 4 glycoprotein G | |
EP0117063A1 (en) | Methods and materials for development of parvovirus vaccine | |
EP0359919A2 (en) | Recombinant mycoplasma hyopneumoniae antigen and uses therefor | |
JP2568384B2 (en) | Polypeptide for pseudorabies virus vaccine, method for producing the same, and vaccine containing the same | |
AU667104B2 (en) | Equine herpesvirus glycoproteins | |
US6592870B2 (en) | Method and kit using recombinant proteins in fusion of porcine reproductive and respiratory syndrome virus and for diagnosis | |
Rocha et al. | Antibody response to a fragment of the protein G of VHS rhabdovirus in immunised trout | |
US6177080B1 (en) | Polypeptides encoded by Kaposi sarcoma-associated herpes virus the use thereof in diagnosis and therapy | |
WO1991000352A1 (en) | Pestivirus nucleotide sequences and polypeptides | |
WO1987007301A1 (en) | Method of preparation and use for feline leukemia virus antigens | |
Sinclair et al. | Detection of antibodies against equine herpesvirus types 1 and 4 by using recombinant protein derived from an immunodominant region of glycoprotein B | |
Cloete et al. | Vaccinia virus expression of the VP7 protein of South African bluetongue virus serotype 4 and its use as an antigen in a capture ELISA | |
WO1992006989A1 (en) | Varicella-zoster virus antigen | |
RU2765658C9 (en) | Isolation of a new pestivirus causing congenital tremor a |