AU4475400A - Protein-protein interactions - Google Patents
Protein-protein interactions Download PDFInfo
- Publication number
- AU4475400A AU4475400A AU44754/00A AU4475400A AU4475400A AU 4475400 A AU4475400 A AU 4475400A AU 44754/00 A AU44754/00 A AU 44754/00A AU 4475400 A AU4475400 A AU 4475400A AU 4475400 A AU4475400 A AU 4475400A
- Authority
- AU
- Australia
- Prior art keywords
- complex
- set forth
- protein
- complex set
- proteins
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 230000004850 protein–protein interaction Effects 0.000 title description 17
- 108090000623 proteins and genes Proteins 0.000 claims description 401
- 102000004169 proteins and genes Human genes 0.000 claims description 359
- 239000012634 fragment Substances 0.000 claims description 318
- 230000003993 interaction Effects 0.000 claims description 203
- 238000000034 method Methods 0.000 claims description 140
- 102000007474 Multiprotein Complexes Human genes 0.000 claims description 88
- 108010085220 Multiprotein Complexes Proteins 0.000 claims description 88
- 239000002773 nucleotide Substances 0.000 claims description 60
- 125000003729 nucleotide group Chemical group 0.000 claims description 60
- 239000003814 drug Substances 0.000 claims description 33
- 241001465754 Metazoa Species 0.000 claims description 31
- 229940079593 drug Drugs 0.000 claims description 29
- 230000027455 binding Effects 0.000 claims description 22
- 238000003158 yeast two-hybrid assay Methods 0.000 claims description 20
- 230000000694 effects Effects 0.000 claims description 16
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 16
- 230000015572 biosynthetic process Effects 0.000 claims description 15
- 230000014509 gene expression Effects 0.000 claims description 15
- 230000035772 mutation Effects 0.000 claims description 15
- 238000010171 animal model Methods 0.000 claims description 14
- 238000003556 assay Methods 0.000 claims description 11
- 238000012216 screening Methods 0.000 claims description 11
- 238000003745 diagnosis Methods 0.000 claims description 10
- 229940000406 drug candidate Drugs 0.000 claims description 10
- 238000000338 in vitro Methods 0.000 claims description 10
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 10
- 229920001184 polypeptide Polymers 0.000 claims description 9
- 230000009471 action Effects 0.000 claims description 7
- 230000004071 biological effect Effects 0.000 claims description 6
- 239000000284 extract Substances 0.000 claims description 6
- 150000003384 small molecules Chemical class 0.000 claims description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 5
- 238000002156 mixing Methods 0.000 claims description 5
- 102000039446 nucleic acids Human genes 0.000 claims description 4
- 108020004707 nucleic acids Proteins 0.000 claims description 4
- 150000007523 nucleic acids Chemical class 0.000 claims description 4
- 230000002018 overexpression Effects 0.000 claims description 3
- 230000002401 inhibitory effect Effects 0.000 claims description 2
- 230000001737 promoting effect Effects 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 3
- 235000018102 proteins Nutrition 0.000 description 285
- 102000008467 protein O-GlcNAc transferase activity proteins Human genes 0.000 description 184
- 108040002385 protein O-GlcNAc transferase activity proteins Proteins 0.000 description 184
- 150000001413 amino acids Chemical class 0.000 description 152
- 235000001014 amino acid Nutrition 0.000 description 150
- 101150110386 SLC2A4 gene Proteins 0.000 description 129
- 238000001086 yeast two-hybrid system Methods 0.000 description 88
- 210000004027 cell Anatomy 0.000 description 83
- 102000004899 14-3-3 Proteins Human genes 0.000 description 51
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 49
- 230000006870 function Effects 0.000 description 46
- 102100038644 Four and a half LIM domains protein 2 Human genes 0.000 description 38
- 101001031714 Homo sapiens Four and a half LIM domains protein 2 Proteins 0.000 description 37
- 241000252233 Cyprinus carpio Species 0.000 description 32
- 239000003795 chemical substances by application Substances 0.000 description 32
- 208000035475 disorder Diseases 0.000 description 32
- 101150107888 AKT2 gene Proteins 0.000 description 30
- 230000006377 glucose transport Effects 0.000 description 30
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 28
- 102000003993 Phosphatidylinositol 3-kinases Human genes 0.000 description 28
- 102000043859 Dynamin Human genes 0.000 description 26
- 108700021058 Dynamin Proteins 0.000 description 26
- YWXYYJSYQOXTPL-SLPGGIOYSA-N isosorbide mononitrate Chemical compound [O-][N+](=O)O[C@@H]1CO[C@@H]2[C@@H](O)CO[C@@H]21 YWXYYJSYQOXTPL-SLPGGIOYSA-N 0.000 description 26
- 102100028641 Vesicle-associated membrane protein-associated protein A Human genes 0.000 description 25
- 101710117541 Vesicle-associated membrane protein-associated protein A Proteins 0.000 description 25
- 230000037361 pathway Effects 0.000 description 25
- 102000005604 Myosin Heavy Chains Human genes 0.000 description 24
- 108010084498 Myosin Heavy Chains Proteins 0.000 description 24
- 230000019491 signal transduction Effects 0.000 description 24
- 102100037664 Poly [ADP-ribose] polymerase tankyrase-1 Human genes 0.000 description 22
- 108010017601 Tankyrases Proteins 0.000 description 22
- 102000028589 Rab4 Human genes 0.000 description 21
- 108050007312 Rab4 Proteins 0.000 description 21
- 101000964898 Homo sapiens 14-3-3 protein zeta/delta Proteins 0.000 description 20
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 20
- 102100035730 B-cell receptor-associated protein 31 Human genes 0.000 description 19
- 101710113110 B-cell receptor-associated protein 31 Proteins 0.000 description 19
- 206010012601 diabetes mellitus Diseases 0.000 description 19
- 230000001105 regulatory effect Effects 0.000 description 19
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 18
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 18
- 201000010099 disease Diseases 0.000 description 17
- 101710137189 Amyloid-beta A4 protein Proteins 0.000 description 15
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 15
- 101710151993 Amyloid-beta precursor protein Proteins 0.000 description 15
- 108091006300 SLC2A4 Proteins 0.000 description 15
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 15
- 238000012360 testing method Methods 0.000 description 15
- 238000010396 two-hybrid screening Methods 0.000 description 15
- 108010019965 Spectrin Proteins 0.000 description 14
- 102000005890 Spectrin Human genes 0.000 description 14
- 210000004556 brain Anatomy 0.000 description 14
- 101000626163 Homo sapiens Tenascin-X Proteins 0.000 description 13
- 108091006296 SLC2A1 Proteins 0.000 description 13
- 102100024549 Tenascin-X Human genes 0.000 description 13
- 210000000170 cell membrane Anatomy 0.000 description 13
- 208000024827 Alzheimer disease Diseases 0.000 description 12
- 101001090688 Homo sapiens Lymphocyte cytosolic protein 2 Proteins 0.000 description 12
- 102100034709 Lymphocyte cytosolic protein 2 Human genes 0.000 description 12
- 101150066312 RAB2A gene Proteins 0.000 description 12
- 230000033001 locomotion Effects 0.000 description 12
- 101000589016 Homo sapiens Myomegalin Proteins 0.000 description 11
- 102100032966 Myomegalin Human genes 0.000 description 11
- 108091008611 Protein Kinase B Proteins 0.000 description 11
- 230000004913 activation Effects 0.000 description 11
- 108090000915 Aminopeptidases Proteins 0.000 description 10
- 102000004400 Aminopeptidases Human genes 0.000 description 10
- 102000015735 Beta-catenin Human genes 0.000 description 10
- 108060000903 Beta-catenin Proteins 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 10
- 101000818893 Homo sapiens 14-3-3 protein beta/alpha Proteins 0.000 description 10
- 101000585019 Homo sapiens Striatin-3 Proteins 0.000 description 10
- 101000836148 Homo sapiens Transforming acidic coiled-coil-containing protein 2 Proteins 0.000 description 10
- 102000004877 Insulin Human genes 0.000 description 10
- 108090001061 Insulin Proteins 0.000 description 10
- 108010019040 Soluble N-Ethylmaleimide-Sensitive Factor Attachment Proteins Proteins 0.000 description 10
- 102000006384 Soluble N-Ethylmaleimide-Sensitive Factor Attachment Proteins Human genes 0.000 description 10
- 102100024510 Src-like-adapter 2 Human genes 0.000 description 10
- 101710172336 Src-like-adapter 2 Proteins 0.000 description 10
- 102100029955 Striatin-3 Human genes 0.000 description 10
- 102100027044 Transforming acidic coiled-coil-containing protein 2 Human genes 0.000 description 10
- 230000004190 glucose uptake Effects 0.000 description 10
- 229940125396 insulin Drugs 0.000 description 10
- 239000013612 plasmid Substances 0.000 description 10
- 238000003160 two-hybrid assay Methods 0.000 description 10
- 102100036912 Desmin Human genes 0.000 description 9
- 108010044052 Desmin Proteins 0.000 description 9
- 102100032274 E3 ubiquitin-protein ligase TRAIP Human genes 0.000 description 9
- 102100023226 Early growth response protein 1 Human genes 0.000 description 9
- 102000008016 Eukaryotic Initiation Factor-3 Human genes 0.000 description 9
- 108010029251 MAP kinase kinase kinase 6 Proteins 0.000 description 9
- 102100026889 Mitogen-activated protein kinase kinase kinase 6 Human genes 0.000 description 9
- 102100034779 TRAF family member-associated NF-kappa-B activator Human genes 0.000 description 9
- 101710140983 TRAF family member-associated NF-kappa-B activator Proteins 0.000 description 9
- 102100033080 Tropomyosin alpha-3 chain Human genes 0.000 description 9
- 101710091952 Tropomyosin alpha-3 chain Proteins 0.000 description 9
- 230000001413 cellular effect Effects 0.000 description 9
- 239000002299 complementary DNA Substances 0.000 description 9
- 210000005045 desmin Anatomy 0.000 description 9
- 238000001727 in vivo Methods 0.000 description 9
- 230000006916 protein interaction Effects 0.000 description 9
- 102000007345 Chromogranins Human genes 0.000 description 8
- 108010007718 Chromogranins Proteins 0.000 description 8
- 108010069112 Complement System Proteins Proteins 0.000 description 8
- 102000000989 Complement System Proteins Human genes 0.000 description 8
- 102100029674 E3 ubiquitin-protein ligase TRIM9 Human genes 0.000 description 8
- 102100036448 Endothelial PAS domain-containing protein 1 Human genes 0.000 description 8
- 102100036001 G-protein coupled receptor-associated sorting protein 1 Human genes 0.000 description 8
- 101000760079 Homo sapiens 14-3-3 protein epsilon Proteins 0.000 description 8
- 101000760084 Homo sapiens 14-3-3 protein eta Proteins 0.000 description 8
- 101001049697 Homo sapiens Early growth response protein 1 Proteins 0.000 description 8
- 101000851937 Homo sapiens Endothelial PAS domain-containing protein 1 Proteins 0.000 description 8
- 101100503886 Homo sapiens GPRASP1 gene Proteins 0.000 description 8
- 101100426088 Homo sapiens TRIM9 gene Proteins 0.000 description 8
- UORJNBVJVRLXMQ-UHFFFAOYSA-N aprobarbital Chemical compound C=CCC1(C(C)C)C(=O)NC(=O)NC1=O UORJNBVJVRLXMQ-UHFFFAOYSA-N 0.000 description 8
- 238000011161 development Methods 0.000 description 8
- 230000018109 developmental process Effects 0.000 description 8
- 108020001507 fusion proteins Proteins 0.000 description 8
- 102000037865 fusion proteins Human genes 0.000 description 8
- 230000002163 immunogen Effects 0.000 description 8
- 230000007246 mechanism Effects 0.000 description 8
- 230000032258 transport Effects 0.000 description 8
- 102000006462 Adaptor Protein Complex beta Subunits Human genes 0.000 description 7
- 108010083807 Adaptor Protein Complex beta Subunits Proteins 0.000 description 7
- 230000004568 DNA-binding Effects 0.000 description 7
- 108010044191 Dynamin II Proteins 0.000 description 7
- 102100021238 Dynamin-2 Human genes 0.000 description 7
- 108091052347 Glucose transporter family Proteins 0.000 description 7
- 108091000080 Phosphotransferase Proteins 0.000 description 7
- 108010083809 Talin Proteins 0.000 description 7
- 102000006463 Talin Human genes 0.000 description 7
- 238000013459 approach Methods 0.000 description 7
- 102000020233 phosphotransferase Human genes 0.000 description 7
- 239000000047 product Substances 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 7
- 230000028973 vesicle-mediated transport Effects 0.000 description 7
- 210000005253 yeast cell Anatomy 0.000 description 7
- 101000810330 Arabidopsis thaliana Eukaryotic translation initiation factor 3 subunit E Proteins 0.000 description 6
- 101100522278 Caenorhabditis elegans ptp-1 gene Proteins 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- 102100024977 Glutamine-tRNA ligase Human genes 0.000 description 6
- 241000699670 Mus sp. Species 0.000 description 6
- 108700008625 Reporter Genes Proteins 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- 108010051239 glutaminyl-tRNA synthetase Proteins 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 210000003205 muscle Anatomy 0.000 description 6
- 230000009261 transgenic effect Effects 0.000 description 6
- 108700020469 14-3-3 Proteins 0.000 description 5
- 102000003730 Alpha-catenin Human genes 0.000 description 5
- 108090000020 Alpha-catenin Proteins 0.000 description 5
- 102000018711 Facilitative Glucose Transport Proteins Human genes 0.000 description 5
- 102100039556 Galectin-4 Human genes 0.000 description 5
- 101000939460 Homo sapiens Ubiquitin-associated protein 2-like Proteins 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 241000283973 Oryctolagus cuniculus Species 0.000 description 5
- 230000022131 cell cycle Effects 0.000 description 5
- 230000033077 cellular process Effects 0.000 description 5
- 238000012512 characterization method Methods 0.000 description 5
- 239000013604 expression vector Substances 0.000 description 5
- 230000010189 intracellular transport Effects 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 210000000663 muscle cell Anatomy 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 239000000758 substrate Substances 0.000 description 5
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 102000058061 Glucose Transporter Type 4 Human genes 0.000 description 4
- 102000004366 Glucosidases Human genes 0.000 description 4
- 108010056771 Glucosidases Proteins 0.000 description 4
- 102000003505 Myosin Human genes 0.000 description 4
- 108060008487 Myosin Proteins 0.000 description 4
- 102000001253 Protein Kinase Human genes 0.000 description 4
- 102100023536 Solute carrier family 2, facilitated glucose transporter member 1 Human genes 0.000 description 4
- 102000040945 Transcription factor Human genes 0.000 description 4
- 108091023040 Transcription factor Proteins 0.000 description 4
- 102100029817 Ubiquitin-associated protein 2-like Human genes 0.000 description 4
- 230000033228 biological regulation Effects 0.000 description 4
- 102100035161 c-Myc-binding protein Human genes 0.000 description 4
- 101710193923 c-Myc-binding protein Proteins 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 238000007796 conventional method Methods 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 230000028023 exocytosis Effects 0.000 description 4
- 239000008103 glucose Substances 0.000 description 4
- 230000003834 intracellular effect Effects 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 230000011278 mitosis Effects 0.000 description 4
- 210000004165 myocardium Anatomy 0.000 description 4
- 230000026731 phosphorylation Effects 0.000 description 4
- 238000006366 phosphorylation reaction Methods 0.000 description 4
- 108010008361 protein phosphatase 5 Proteins 0.000 description 4
- 238000012163 sequencing technique Methods 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- 230000014616 translation Effects 0.000 description 4
- 239000013598 vector Substances 0.000 description 4
- VMSLCPKYRPDHLN-UHFFFAOYSA-N (R)-Humulone Chemical compound CC(C)CC(=O)C1=C(O)C(CC=C(C)C)=C(O)C(O)(CC=C(C)C)C1=O VMSLCPKYRPDHLN-UHFFFAOYSA-N 0.000 description 3
- 102100023818 ADP-ribosylation factor 3 Human genes 0.000 description 3
- 102100027652 COP9 signalosome complex subunit 2 Human genes 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 108010078791 Carrier Proteins Proteins 0.000 description 3
- 108091000069 Cystinyl Aminopeptidase Proteins 0.000 description 3
- 102000030900 Cystinyl aminopeptidase Human genes 0.000 description 3
- 108010089790 Eukaryotic Initiation Factor-3 Proteins 0.000 description 3
- 108010001515 Galectin 4 Proteins 0.000 description 3
- 102100034051 Heat shock protein HSP 90-alpha Human genes 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- 101000684275 Homo sapiens ADP-ribosylation factor 3 Proteins 0.000 description 3
- 101000726004 Homo sapiens COP9 signalosome complex subunit 2 Proteins 0.000 description 3
- 101001016865 Homo sapiens Heat shock protein HSP 90-alpha Proteins 0.000 description 3
- 101001130437 Homo sapiens Ras-related protein Rap-2b Proteins 0.000 description 3
- 108010001127 Insulin Receptor Proteins 0.000 description 3
- 102100036721 Insulin receptor Human genes 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 108010021466 Mutant Proteins Proteins 0.000 description 3
- 102000008300 Mutant Proteins Human genes 0.000 description 3
- 101710204040 Myosin-3 Proteins 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 102100037667 TNFAIP3-interacting protein 1 Human genes 0.000 description 3
- 101710149776 TNFAIP3-interacting protein 1 Proteins 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 239000006035 Tryptophane Substances 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 238000001042 affinity chromatography Methods 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 230000003542 behavioural effect Effects 0.000 description 3
- 108091008324 binding proteins Proteins 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 230000003197 catalytic effect Effects 0.000 description 3
- 230000003915 cell function Effects 0.000 description 3
- 238000000749 co-immunoprecipitation Methods 0.000 description 3
- 238000009510 drug design Methods 0.000 description 3
- 238000007877 drug screening Methods 0.000 description 3
- 230000012202 endocytosis Effects 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- 230000008506 pathogenesis Effects 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical group OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 238000000159 protein binding assay Methods 0.000 description 3
- 108060006633 protein kinase Proteins 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 230000006798 recombination Effects 0.000 description 3
- 238000005215 recombination Methods 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 230000005945 translocation Effects 0.000 description 3
- 210000003956 transport vesicle Anatomy 0.000 description 3
- 229960004799 tryptophan Drugs 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- 240000000073 Achillea millefolium Species 0.000 description 2
- 108700028939 Amino Acyl-tRNA Synthetases Proteins 0.000 description 2
- 102000052866 Amino Acyl-tRNA Synthetases Human genes 0.000 description 2
- 101000779312 Arabidopsis thaliana Beta-adaptin-like protein A Proteins 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 102100030981 Beta-alanine-activating enzyme Human genes 0.000 description 2
- 102100025905 C-Jun-amino-terminal kinase-interacting protein 4 Human genes 0.000 description 2
- 108010041397 CD4 Antigens Proteins 0.000 description 2
- 102000000905 Cadherin Human genes 0.000 description 2
- 108050007957 Cadherin Proteins 0.000 description 2
- 101000709520 Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) Atypical response regulator protein ChxR Proteins 0.000 description 2
- 102000005853 Clathrin Human genes 0.000 description 2
- 108010019874 Clathrin Proteins 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 102000042092 Glucose transporter family Human genes 0.000 description 2
- 101150009006 HIS3 gene Proteins 0.000 description 2
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 2
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 2
- NTYJJOPFIAHURM-UHFFFAOYSA-N Histamine Chemical compound NCCC1=CN=CN1 NTYJJOPFIAHURM-UHFFFAOYSA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000773364 Homo sapiens Beta-alanine-activating enzyme Proteins 0.000 description 2
- 101001076862 Homo sapiens C-Jun-amino-terminal kinase-interacting protein 4 Proteins 0.000 description 2
- 101000608765 Homo sapiens Galectin-4 Proteins 0.000 description 2
- 101900141355 Human T-cell leukemia virus 1 Protein Tax-1 Proteins 0.000 description 2
- 108010063296 Kinesin Proteins 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 101710192141 Protein Nef Proteins 0.000 description 2
- 102000002727 Protein Tyrosine Phosphatase Human genes 0.000 description 2
- 101100394989 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) hisI gene Proteins 0.000 description 2
- 101710172711 Structural protein Proteins 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 102000035181 adaptor proteins Human genes 0.000 description 2
- 108091005764 adaptor proteins Proteins 0.000 description 2
- 210000001789 adipocyte Anatomy 0.000 description 2
- 230000032683 aging Effects 0.000 description 2
- 238000000429 assembly Methods 0.000 description 2
- 230000000712 assembly Effects 0.000 description 2
- 239000013060 biological fluid Substances 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 230000005754 cellular signaling Effects 0.000 description 2
- 125000003636 chemical group Chemical group 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 229930193282 clathrin Natural products 0.000 description 2
- 230000000875 corresponding effect Effects 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- 210000004748 cultured cell Anatomy 0.000 description 2
- 230000001351 cycling effect Effects 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 230000008570 general process Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000003119 immunoblot Methods 0.000 description 2
- 230000001965 increasing effect Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000031146 intracellular signal transduction Effects 0.000 description 2
- 150000002611 lead compounds Chemical class 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 230000004118 muscle contraction Effects 0.000 description 2
- 230000004220 muscle function Effects 0.000 description 2
- 210000004898 n-terminal fragment Anatomy 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 238000001243 protein synthesis Methods 0.000 description 2
- 108020000494 protein-tyrosine phosphatase Proteins 0.000 description 2
- 230000026304 regulation of glucose transport Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 2
- 235000004400 serine Nutrition 0.000 description 2
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 235000008521 threonine Nutrition 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 230000001131 transforming effect Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 102000003390 tumor necrosis factor Human genes 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- CXENHBSYCFFKJS-OXYODPPFSA-N (Z,E)-alpha-farnesene Chemical compound CC(C)=CCC\C(C)=C\C\C=C(\C)C=C CXENHBSYCFFKJS-OXYODPPFSA-N 0.000 description 1
- 101710112812 14-3-3 protein Proteins 0.000 description 1
- 101150029062 15 gene Proteins 0.000 description 1
- LKDMKWNDBAVNQZ-UHFFFAOYSA-N 4-[[1-[[1-[2-[[1-(4-nitroanilino)-1-oxo-3-phenylpropan-2-yl]carbamoyl]pyrrolidin-1-yl]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-oxobutanoic acid Chemical compound OC(=O)CCC(=O)NC(C)C(=O)NC(C)C(=O)N1CCCC1C(=O)NC(C(=O)NC=1C=CC(=CC=1)[N+]([O-])=O)CC1=CC=CC=C1 LKDMKWNDBAVNQZ-UHFFFAOYSA-N 0.000 description 1
- 101150088993 62 gene Proteins 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 208000036762 Acute promyelocytic leukaemia Diseases 0.000 description 1
- 102000002659 Amyloid Precursor Protein Secretases Human genes 0.000 description 1
- 108010043324 Amyloid Precursor Protein Secretases Proteins 0.000 description 1
- 102000014303 Amyloid beta-Protein Precursor Human genes 0.000 description 1
- 108010079054 Amyloid beta-Protein Precursor Proteins 0.000 description 1
- 241000384062 Armadillo Species 0.000 description 1
- 102000016904 Armadillo Domain Proteins Human genes 0.000 description 1
- 108010014223 Armadillo Domain Proteins Proteins 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- 108700040618 BRCA1 Genes Proteins 0.000 description 1
- 101150072950 BRCA1 gene Proteins 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 102100034798 CCAAT/enhancer-binding protein beta Human genes 0.000 description 1
- 101100322915 Caenorhabditis elegans akt-1 gene Proteins 0.000 description 1
- 101100162366 Caenorhabditis elegans akt-2 gene Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102000016362 Catenins Human genes 0.000 description 1
- 108010067316 Catenins Proteins 0.000 description 1
- 102000003908 Cathepsin D Human genes 0.000 description 1
- 108090000258 Cathepsin D Proteins 0.000 description 1
- 108090000617 Cathepsin G Proteins 0.000 description 1
- 102000004173 Cathepsin G Human genes 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102100031608 Centlein Human genes 0.000 description 1
- 101710096681 Centlein Proteins 0.000 description 1
- 102100039219 Centrosome-associated protein CEP250 Human genes 0.000 description 1
- 101710110151 Centrosome-associated protein CEP250 Proteins 0.000 description 1
- 102000010792 Chromogranin A Human genes 0.000 description 1
- 108010038447 Chromogranin A Proteins 0.000 description 1
- 108090000317 Chymotrypsin Proteins 0.000 description 1
- 108010028778 Complement C4 Proteins 0.000 description 1
- 239000000055 Corticotropin-Releasing Hormone Substances 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 206010012289 Dementia Diseases 0.000 description 1
- 102100030072 Doublesex- and mab-3-related transcription factor 3 Human genes 0.000 description 1
- 101100054052 Drosophila melanogaster 14-3-3epsilon gene Proteins 0.000 description 1
- 108010051542 Early Growth Response Protein 1 Proteins 0.000 description 1
- 208000002197 Ehlers-Danlos syndrome Diseases 0.000 description 1
- 102100030013 Endoribonuclease Human genes 0.000 description 1
- 101710199605 Endoribonuclease Proteins 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 101710127218 Four and a half LIM domains protein 2 Proteins 0.000 description 1
- 230000010190 G1 phase Effects 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 102000058063 Glucose Transporter Type 1 Human genes 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 101000797917 Homo sapiens 1,5-anhydro-D-fructose reductase Proteins 0.000 description 1
- 101000723543 Homo sapiens 14-3-3 protein theta Proteins 0.000 description 1
- 101000945963 Homo sapiens CCAAT/enhancer-binding protein beta Proteins 0.000 description 1
- 101000864825 Homo sapiens Doublesex- and mab-3-related transcription factor 3 Proteins 0.000 description 1
- 101001001462 Homo sapiens Importin subunit alpha-5 Proteins 0.000 description 1
- 101100522008 Homo sapiens PSME3 gene Proteins 0.000 description 1
- 101000718497 Homo sapiens Protein AF-10 Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102100035692 Importin subunit alpha-1 Human genes 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000012411 Intermediate Filament Proteins Human genes 0.000 description 1
- 108010061998 Intermediate Filament Proteins Proteins 0.000 description 1
- 108010062228 Karyopherins Proteins 0.000 description 1
- 102000011781 Karyopherins Human genes 0.000 description 1
- 108010081657 Ki antigen Proteins 0.000 description 1
- 102000010638 Kinesin Human genes 0.000 description 1
- 102000019293 Kinesin-like proteins Human genes 0.000 description 1
- 108050006659 Kinesin-like proteins Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- 108010047294 Lamins Proteins 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 101710159527 Maturation protein A Proteins 0.000 description 1
- 101710091157 Maturation protein A2 Proteins 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 1
- 102100036961 Nuclear mitotic apparatus protein 1 Human genes 0.000 description 1
- 101710104794 Nuclear mitotic apparatus protein 1 Proteins 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 108091007960 PI3Ks Proteins 0.000 description 1
- 241000237988 Patellidae Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108010089430 Phosphoproteins Proteins 0.000 description 1
- 102000007982 Phosphoproteins Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 102100026531 Prelamin-A/C Human genes 0.000 description 1
- 102000015499 Presenilins Human genes 0.000 description 1
- 108010050254 Presenilins Proteins 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 101710132632 Protein C4 Proteins 0.000 description 1
- 229940096437 Protein S Drugs 0.000 description 1
- 102000000705 Secretogranin II Human genes 0.000 description 1
- 108010002533 Secretogranin II Proteins 0.000 description 1
- 102100030057 Seizure protein 6 homolog Human genes 0.000 description 1
- 101710082510 Seizure protein 6 homolog Proteins 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 101710113029 Serine/threonine-protein kinase Proteins 0.000 description 1
- 101000995910 Solanum lycopersicum Protein NP24 Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- AUYYCJSJGJYCDS-LBPRGKRZSA-N Thyrolar Chemical class IC1=CC(C[C@H](N)C(O)=O)=CC(I)=C1OC1=CC=C(O)C(I)=C1 AUYYCJSJGJYCDS-LBPRGKRZSA-N 0.000 description 1
- 108050005627 Transcription factor AP-2 beta Proteins 0.000 description 1
- 102100033348 Transcription factor AP-2-beta Human genes 0.000 description 1
- 108010080432 Tumor Necrosis Factor Receptor-Associated Peptides and Proteins Proteins 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 101710159648 Uncharacterized protein Proteins 0.000 description 1
- 101710102828 Vesicle-associated protein Proteins 0.000 description 1
- 102000005456 Vesicular Transport Adaptor Proteins Human genes 0.000 description 1
- 108010031770 Vesicular Transport Adaptor Proteins Proteins 0.000 description 1
- 102000014378 Vesicular Transport Proteins Human genes 0.000 description 1
- 108010079145 Vesicular Transport Proteins Proteins 0.000 description 1
- 102000003970 Vinculin Human genes 0.000 description 1
- 108090000384 Vinculin Proteins 0.000 description 1
- 238000002441 X-ray diffraction Methods 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001780 adrenocortical effect Effects 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 238000011948 assay development Methods 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 210000003651 basophil Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 238000002306 biochemical method Methods 0.000 description 1
- 229920001222 biopolymer Polymers 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000005013 brain tissue Anatomy 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000021164 cell adhesion Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000004656 cell transport Effects 0.000 description 1
- 230000008614 cellular interaction Effects 0.000 description 1
- 230000019522 cellular metabolic process Effects 0.000 description 1
- 230000004715 cellular signal transduction Effects 0.000 description 1
- 230000021572 chromosome movement towards spindle pole Effects 0.000 description 1
- 229960002376 chymotrypsin Drugs 0.000 description 1
- 210000002314 coated vesicle Anatomy 0.000 description 1
- 230000024203 complement activation Effects 0.000 description 1
- 238000010205 computational analysis Methods 0.000 description 1
- 230000001143 conditioned effect Effects 0.000 description 1
- 208000018631 connective tissue disease Diseases 0.000 description 1
- 230000008602 contraction Effects 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- IDLFZVILOHSSID-OVLDLUHVSA-N corticotropin Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)NC(=O)[C@@H](N)CO)C1=CC=C(O)C=C1 IDLFZVILOHSSID-OVLDLUHVSA-N 0.000 description 1
- 229960000258 corticotropin Drugs 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000005546 dideoxynucleotide Substances 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000000763 evoking effect Effects 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 208000007345 glycogen storage disease Diseases 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 239000000185 hemagglutinin Substances 0.000 description 1
- 108060003552 hemocyanin Proteins 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 229960001340 histamine Drugs 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 239000012510 hollow fiber Substances 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 238000003125 immunofluorescent labeling Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 230000016507 interphase Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 208000017169 kidney disease Diseases 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- 210000005053 lamin Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 238000003159 mammalian two-hybrid assay Methods 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 230000013011 mating Effects 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000002297 mitogenic effect Effects 0.000 description 1
- 238000000302 molecular modelling Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 210000003365 myofibril Anatomy 0.000 description 1
- 210000000885 nephron Anatomy 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 210000002241 neurite Anatomy 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 230000000955 neuroendocrine Effects 0.000 description 1
- 230000000324 neuroprotective effect Effects 0.000 description 1
- 230000000508 neurotrophic effect Effects 0.000 description 1
- 210000000633 nuclear envelope Anatomy 0.000 description 1
- 210000004492 nuclear pore Anatomy 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 102000027450 oncoproteins Human genes 0.000 description 1
- 108091008819 oncoproteins Proteins 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 230000036542 oxidative stress Effects 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000008194 pharmaceutical composition Substances 0.000 description 1
- 230000000865 phosphorylative effect Effects 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 244000062804 prey Species 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000000306 recurrent effect Effects 0.000 description 1
- 230000022983 regulation of cell cycle Effects 0.000 description 1
- 230000033339 regulation of endocytosis Effects 0.000 description 1
- 230000008844 regulatory mechanism Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 210000000518 sarcolemma Anatomy 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 210000004739 secretory vesicle Anatomy 0.000 description 1
- 230000008054 signal transmission Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 230000007727 signaling mechanism Effects 0.000 description 1
- 238000012306 spectroscopic technique Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 210000003699 striated muscle Anatomy 0.000 description 1
- 210000001768 subcellular fraction Anatomy 0.000 description 1
- 230000006918 subunit interaction Effects 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 150000003588 threonines Chemical class 0.000 description 1
- 239000005495 thyroid hormone Substances 0.000 description 1
- 229940036555 thyroid hormone Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 102000027257 transmembrane receptors Human genes 0.000 description 1
- 108091008578 transmembrane receptors Proteins 0.000 description 1
- 230000001228 trophic effect Effects 0.000 description 1
- 238000000539 two dimensional gel electrophoresis Methods 0.000 description 1
- 208000035408 type 1 diabetes mellitus 1 Diseases 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000003643 water by type Substances 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4711—Alzheimer's disease; Amyloid plaque core protein
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Toxicology (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Engineering & Computer Science (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Description
WO 00/65340 PCT/US00/10651 TITLE OF THE INVENTION PROTEIN-PROTEIN INTERACTIONS ) BACKGROUND OF THE INVENTION The present invention relates to the discovery of novel protein-protein interactions that are involved in mammalian physiological pathways, including physiological disorders or diseases. Examples of physiological disorders and diseases include non-insulin dependent diabetes mellitus (NIDDM), neurodegenerative disorders, such as Alzheimer's Disease (AD), and the like. Thus, the 5 present invention is directed to complexes of these proteins and/or their fragments, antibodies to the complexes, diagnosis of physiological generative disorders (including diagnosis of a predisposition to and diagnosis of the existence of the disorder), drug screening for agents which modulate the interaction of proteins described herein, and identification of additional proteins in the pathway common to the proteins described herein. 3 The publications and other materials used herein to illuminate the background of the invention, and in particular, cases to provide additional details respecting the practice, are incorporated herein by reference, and for convenience, are referenced by author and date in the following text and respectively grouped in the appended List of References. Many processes in biology, including transcription, translation and metabolic or signal 5 transduction pathways, are mediated by non-covalently associated protein complexes. The formation of protein-protein complexes or protein-DNA complexes produce the most efficient chemical machinery. Much of modern biological research is concerned with identifying proteins involved in cellular processes, determining their functions, and how, when and where they interact with other proteins involved in specific pathways. Further, with rapid advances in genome 0 sequencing, there is a need to define protein linkage maps, i.e., detailed inventories of protein interactions that make up functional assemblies of proteins or protein complexes or that make up physiological pathways.
WO 00/65340 PCT/US00/10651 2 Recent advances in human genomics research has led to rapid progress in the identification of novel genes. In applications to biological and pharmaceutical research, there is a need to determine functions of gene products. A first step in defining the function of a novel gene is to determine its interactions with other gene products in appropriate context. That is, since proteins 5 make specific interactions with other proteins or other biopolymers as part of functional assemblies or physiological pathways, an appropriate way to examine function of a gene is to determine its physical relationship with other genes. Several systems exist for identifying protein interactions and hence relationships between genes. There continues to be a need in the art for the discovery of additional protein-protein 0 interactions involved in mammalian physiological pathways. There continues to be a need in the art also to identify the protein-protein interactions that are involved in mammalian physiological disorders and diseases, and to thus identify drug targets. SUMMARY OF THE INVENTION 5 The present invention relates to the discovery of protein-protein interactions that are involved in mammalian physiological pathways, including physiological disorders or diseases, and to the use of this discovery. The identification of the interacting proteins described herein provide new targets for the identification of useful pharmaceuticals, new targets for diagnostic tools in the identification of individuals at risk, sequences for production of transformed cell lines, cellular 0 models and animal models, and new bases for therapeutic intervention in such physiological pathways Thus, one aspect of the present invention is protein complexes. The protein complexes are a complex of (a) two interacting proteins, (b) a first interacting protein and a fragment of a second interacting protein, (c) a fragment of a first interacting protein and a second interacting protein, or Z5 (d) a fragment of a first interacting protein and a fragment of a second interacting protein. The fragments of the interacting proteins include those parts of the proteins, which interact to form a complex. This aspect of the invention includes the detection of protein interactions and the production of proteins by recombinant techniques. The latter embodiment also includes cloned sequences, vectors, transfected or transformed host cells and transgenic animals. 30 A second aspect of the present invention is an antibody that is immunoreactive with the above complex. The antibody may be a polyclonal antibody or a monoclonal antibody. While the antibody is immunoreactive with the complex, it is not immunoreactive with the component parts WO 00/65340 PCT/US00/10651 of the complex. That is, the antibody is not immunoreactive with a first interactive protein, a fragment of a first interacting protein, a second interacting protein or a fragment of a second interacting protein. Such antibodies can be used to detect the presence or absence of the protein complexes. A third aspect of the present invention is a method for diagnosing a predisposition for physiological disorders or diseases in a human or other animal. The diagnosis of such disorders includes a diagnosis of a predisposition to the disorders and a diagnosis for the existence of the disorders. In accordance with this method, the ability of a first interacting protein or fragment thereof to form a complex with a second interacting protein or a fragment thereof is assayed, or the genes encoding interacting proteins are screened for mutations in interacting portions of the protein molecules. The inability of a first interacting protein or fragment thereof to form a complex, or the presence of mutations in a gene within the interacting domain, is indicative of a predisposition to, or existence of a disorder. In accordance with one embodiment of the invention, the ability to form a complex is assayed in a two-hybrid assay. In a first aspect of this embodiment, the ability to form a complex is assayed by a yeast two-hybrid assay. In a second aspect, the ability to form a complex is assayed by a mammalian two-hybrid assay. In a second embodiment, the ability to form a complex is assayed by measuring in vitro a complex formed by combining said first protein and said second protein. In one aspect the proteins are isolated from a human or other animal. In a third embodiment, the ability to form a complex is assayed by measuring the binding of an antibody, which is specific for the complex. In a fourth embodiment, the ability to form a complex is assayed by measuring the binding of an antibody that is specific for the complex with a tissue extract from a human or other animal. In a fifth embodiment, coding sequences of the interacting proteins described herein are screened for mutations. A fourth aspect of the present invention is a method for screening for drug candidates which are capable of modulating the interaction of a first interacting protein and a second interacting protein. In this method, the amount of the complex formed in the presence of a drug is compared with the amount of the complex formed in the absence of the drug. If the amount of complex formed in the presence of the drug is greater than or less than the amount of complex formed in the absence of the drug, the drug is a candidate for modulating the interaction of the first and second interacting proteins. The drug promotes the interaction if the complex formed in the presence of the drug is greater and inhibits (or disrupts) the interaction if the complex formed in the presence of the WO 00/65340 PCT/US00/10651 4 drug is less. The drug may affect the interaction directly, i.e., by modulating the binding of the two proteins, or indirectly, e.g., by modulating the expression of one or both of the proteins. A fifth aspect of the present invention is a model for such physiological pathways, disorders or diseases. The model may be a cellular model or an animal model, as further described herein. In accordance with one embodiment of the invention, an animal model is prepared by creating transgenic or "knock-out" animals. The knock-out may be a total knock-out, i.e., the desired gene is deleted, or a conditional knock-out, i.e., the gene is active until it is knocked out at a determined time. In a second embodiment, a cell line is derived from such animals for use as a model. In a third embodiment, an animal model is prepared in which the biological activity of a protein complex 3 of the present invention has been altered. In one aspect, the biological activity is altered by disrupting the formation of the protein complex, such as by the binding of an antibody or small molecule to one of the proteins which prevents the formation of the protein complex. In a second aspect, the biological activity of a protein complex is altered by disrupting the action of the complex, such as by the binding of an antibody or small molecule to the protein complex which 5 interferes with the action of the protein complex as described herein. In a fourth embodiment, a cell model is prepared by altering the genome of the cells in a cell line. In one aspect, the genome of the cells is modified to produce at least one protein complex described herein. In a second aspect, the genome of the cells is modified to eliminate at least one protein of the protein complexes described herein. O A sixth aspect of the present invention are nucleic acids coding for novel proteins discovered in accordance with the present invention. A seventh aspect of the present invention is a method of screening for drug candidates useful for treating a physiological disorder. In this embodiment, drugs are screened on the basis of the association of a protein with a particular physiological disorder. This association is established in 5 accordance with the present invention by identifying a relationship of the protein with a particular physiological disorder. The drugs are screened by comparing the activity of the protein in the presence and absence of the drug. If a difference in activity is found, then the drug is a drug candidate for the physiological disorder. The activity of the protein can be assayed in vitro or in vivo using conventional techniques, including transgenic animals and cell lines of the present 0 invention.
WO 00/65340 PCT/US00/10651 5 DETAILED DESCRIPTION OF THE INVENTION The present invention is the discovery of novel interactions between proteins described herein. The genes coding for some of these proteins may have been cloned previously, but their potential interaction in a physiological pathway or with a particular protein was unknown. 5 Alternatively, the genes coding for some of these proteins have not been cloned previously and represent novel genes. These proteins are identified using the yeast two-hybrid method and searching a human total brain library, as more fully described below. According to the present invention, new protein-protein interactions have been discovered. The discovery of these interactions has identified several protein complexes for each protein-protein S interaction. The protein complexes for these interactions are set forth below in Tables 1-73, which also identify the new protein-protein interactions of the present invention. TABLE 1 Protein Complexes of Glut4/CARP Interaction 5 Glucose Transporter 4 (Glut4) and Clone C-193 (CARP) A fragment of Glut4 and CARP Glut4 and a fragment of CARP A fragment of Glut4 and a fragment of CARP ) TABLE 2 Protein Complexes of Glutl/DRAL(FHL2) Interaction Glucose Transporter 1 (Glutl) and DRAL(FHL2) A fragment of Glutl and DRAL(FHL2) Glutl and a fragment of DRAL(FHL2) 5 A fragment of Glutl and a fragment of DRAL(FHL2) TABLE 3 Protein Complexes of Glutl/Myosin Heavy Chain Interaction Glucose Transporter 1 (Glutl) and myosin heavy chain 0 A fragment of Glutl and myosin heavy chain Glutl and a fragment of myosin heavy chain A fragment of Glutl and a fragment of myosin heavy chain WO 00/65340 PCT/US00/10651 6 TABLE 4 Protein Complexes of Glutl/HSS Interaction Glucose Transporter 1 (Glutl) and human sperm surface protein (HSS) A fragment of Glutl and HSS 5Glutl and a fragment of HSS A fragment of Glutl and a fragment of HSS TABLE 5 Protein Complexes of OGTase/Mvosin Heavy Chain Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and myosin heavy chain A fragment of OGTase and myosin heavy chain OGTase and a fragment of myosin heavy chain A fragment of OGTase and a fragment of myosin heavy chain 5 TABLE6 Protein Complexes of IRAP/14-3-3 Beta Interaction Insulin-Regulated Membrane-Spanning Aminopeptidase (IRAP) and 14-3-3 beta A fragment of IRAP and 14-3-3 beta IRAP and a fragment of 14-3-3 beta 0 A fragment of IRAP and a fragment of 14-3-3 beta TABLE 7 Protein Complexes of IRAP/HSS Interaction Insulin-Regulated Membrane-Spanning Aminopeptidase (IRAP) and human sperm surface 5 protein (HSS) A fragment of IRAP and HSS IRAP and a fragment of HSS A fragment of IRAP and a fragment of HSS 0 TABLE8 Protein Complexes of PI-3K110/Complement Protein C4 Interaction PI-3 Kinase p110 subunit (PI-3K110) and Complement Protein C4 A fragment of PI-3K110 and Complement Protein C4 PI-3K110 and a fragment of Complement Protein C4 5 A fragment of PI-3K110 and a fragment of Complement Protein C4 WO 00/65340 PCT/US00/10651 7 TABLE 9 Protein Complexes of PI-3K1 10O/Tenascin XB Interaction PI-3 Kinase p 1 10 subunit (PI-3K110) and Tenascin XB A fragment of PI-3K110 and Tenascin XB 5 PI-3K110 and a fragment of Tenascin XB A fragment of PI-3K110 and a fragment of Tenascin XB TABLE 10 Protein Complexes of PI-3K110 O/GAA Interaction ) PI-3 Kinase p 1 10 subunit (PI-3K110) and Alpha Acid Glucosidase (GAA) A fragment of PI-3K110 and GAA PI-3K110 and a fragment of GAA A fragment of PI-3K110 and a fragment of GAA 5 TABLE 11 Protein Complexes of MM-1/C-Napl1 Interaction C-myc Binding Protein (MM-1) and C-Napl A fragment of MM-1 and C-Nap 1 MM-1 and a fragment of C-Napl 0 A fragment of MM-1 and a fragment of C-Nap 1 TABLE 12 Protein Complexes of MM- I/Beta Spectrin Interaction C-myc Binding Protein (MM-1) and Beta Spectrin 5 A fragment of MM-1 and Beta Spectrin MM-1 and a fragment of Beta Spectrin A fragment of MM-1 and a fragment of Beta Spectrin TABLE 13 0 Protein Complexes of MM- 1/KIAA0477 Interaction C-myc Binding Protein (MM-1) and KIAA0477 A fragment of MM-1 and KIAA0477 MM-1 and a fragment of KIAA0477 A fragment of MM-1 and a fragment of KIAA0477 5 WO 00/65340 PCT/US00/10651 8 TABLE 14 Protein Complexes of Dvnamin/CALM Interaction Dynamin and Calthrin Assembly Protein (CALM) A fragment of Dynamin and CALM Dynamin and a fragment of CALM A fragment of Dynamin and a fragment of CALM TABLE 15 Protein Complexes of Dvnamin/Psme3 Interaction ) Dynamin and Proteosome Activator Subunit Psme3 (Psme3) A fragment of Dynamin and Psme3 Dynamin and a fragment of Psme3 A fragment of Dynamin and a fragment of Psme3 5 TABLE 16 Protein Complexes of Naflb/I-TRAF Interaction Nef-Associated Factor 1 beta (Nafl b) and I-TRAF A fragment of Nafl b and I-TRAF Nafl b and a fragment of I-TRAF 0 A fragment of Naflb and a fragment of I-TRAF TABLE 17 Protein Complexes of Aktl/NuMA1 Interaction Akt kinase 1 (Aktl) and NuMAl 5 A fragment of Akt 1 and NuMAl Aktl and a fragment of NuMAl A fragment of Aktl and a fragment of NuMAl TABLE 18 0 Protein Complexes of Akt2/NuMA1 Interaction Akt kinase 2 (Akt2) and NuMA1 A fragment of Akt2 and NuMAl Akt2 and a fragment of NuMAl A fragment of Akt2 and a fragment of NuMAl 5 WO 00/65340 PCT/US00/10651 9 TABLE 19 Protein Complexes of Akt2/BAP31 Interaction Akt kinase 2 (Akt2) and BAP31 A fragment of Akt2 and BAP31 5 Akt2 and a fragment of BAP31 A fragment of Akt2 and a fragment of BAP31 TABLE 20 Protein Complexes of Akt2/Beta Adaptin Interaction 0 Akt kinase 2 (Akt2) and beta adaptin A fragment of Akt2 and beta adaptin Akt2 and a fragment of beta adaptin A fragment of Akt2 and a fragment of beta adaptin 5 TABLE21 Protein Complexes of OGTase/Desmin Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and desmin A fragment of OGTase and desmin OGTase and a fragment of desmin 0 A fragment of OGTase and a fragment of desmin TABLE 22 Protein Complexes of OGTase/Alpha-karvopherin Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and alpha-karyopherin 5 A fragment of OGTase and alpha-karyopherin OGTase and a fragment of alpha-karyopherin A fragment of OGTase and a fragment of alpha-karyopherin TABLE 23 0 Protein Complexes of OGTase/Glutaminyl tRNA Synthetase Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and glutaminyl tRNA synthetase A fragment of OGTase and glutaminyl tRNA synthetase OGTase and a fragment of glutaminyl tRNA synthetase A fragment of OGTase and a fragment of glutaminyl tRNA synthetase 5 WO 00/65340 PCT/US00/10651 10 TABLE 24 Protein Complexes of OGTase/Clone 25100 Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and clone 25100 A fragment of OGTase and clone 25100 OGTase and a fragment of clone 25100 A fragment of OGTase and a fragment of clone 25100 TABLE 25 Protein Complexes of PTP 1 b/VAP-A Interaction 3 PTP 1 b and VAMP-associated protein A (VAP-A) A fragment of PTP 1 b and VAP-A PTP 1 b and a fragment of VAP-A A fragment of PTP 1 b and a fragment of VAP-A 5 TABLE26 Protein Complexes of Rab4/Alpha-catenin-like Protein Interaction Rab4 and alpha-cantein-like protein A fragment of Rab4 and alpha-cantein-like protein Rab4 and a fragment of alpha-cantein-like protein 0 A fragment of Rab4 and a fragment of alpha-cantein-like protein TABLE 27 Protein Complexes of Rab4/Rab2 Interaction Rab4 and Rab2 5 A fragment of Rab4 and Rab2 Rab4 and a fragment of Rab2 A fragment of Rab4 and a fragment of Rab2 TABLE 28 0 Protein Complexes of Glut4/PN7065 Interaction Glucose Transporter 4 (Glut4) and Novel Protein Fragment PN7065 (PN7065) A fragment of Glut4 and PN7065 Glut4 and a fragment of PN7065 A fragment of Glut4 and a fragment of PN7065 5 WO 00/65340 PCT/US00/10651 11 TABLE 29 Protein Complexes of Glut4/PN7386 Interaction Glucose Transporter 4 (Glut4) and Novel Protein Fragment PN7386 (PN7386) A fragment of Glut4 and PN7386 Glut4 and a fragment of PN7386 A fragment of Glut4 and a fragment of PN7386 TABLE 30 Protein Complexes of OGTase/PN6931 Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and Novel Protein Fragment PN6931 (PN6931) A fragment of OGTase and PN6931 OGTase and a fragment of PN6931 A fragment of OGTase and a fragment of PN6931 5 TABLE 31 Protein Complexes ofNaflb/PN7582 Interaction Nef-Associated Factor 1 beta (Naflb) and Novel Protein Fragment PN7582 (PN7582) A fragment of Naflb and PN7582 0 Naflb and a fragment of PN7582 A fragment of Naflb and a fragment of PN7582 TABLE 32 Protein Complexes of OGTase/Talin Interaction 5 O-linked N-acetylglucosaminyltransferase (OGTase) and Talin A fragment of OGTase and Talin OGTase and a fragment of Talin A fragment of OGTase and a fragment of Talin 0 TABLE 33 Protein Complexes of OGTase/MOP2 Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and MOP2 A fragment of OGTase and MOP2 OGTase and a fragment of MOP2 5 A fragment of OGTase and a fragment of MOP2 WO 00/65340 PCT/US00/10651 12 TABLE 34 Protein Complexes of OGTase/Clone 25100 Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and Clone 25100 A fragment of OGTase and Clone 25100 5 OGTase and a fragment of Clone 25100 A fragment of OGTase and a fragment of Clone 25100 TABLE 35 Protein Complexes of OGTase/KIAA0443 Interaction 0 O-linked N-acetylglucosaminyltransferase (OGTase) and KIAA0443 A fragment of OGTase and KIAA0443 OGTase and a fragment of KIAA0443 A fragment of OGTase and a fragment of KIAA0443 5 TABLE36 Protein Complexes of OGTase/EGR1 Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and EGR1 A fragment of OGTase and EGR1 OGTase and a fragment of EGR1 0 A fragment of OGTase and a fragment of EGR1 TABLE 37 Protein Complexes of OGTase/Dvnamin II Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and Dynamin II 5 A fragment of OGTase and Dynamin II OGTase and a fragment of Dynamin II A fragment of OGTase and a fragment of Dynamin II TABLE 38 0 Protein Complexes of OGTase/INT-6 Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and INT-6 A fragment of OGTase and INT-6 OGTase and a fragment of INT-6 A fragment of OGTase and a fragment of INT-6 5 WO 00/65340 PCT/US00/10651 13 TABLE 39 Protein Complexes of OGTase/HSPCO28 Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and HSPCO28 A fragment of OGTase and HSPCO28 OGTase and a fragment of HSPCO28 A fragment of OGTase and a fragment of HSPCO28 TABLE 40 Protein Complexes of OGTase/BAP31 Interaction D O-linked N-acetylglucosaminyltransferase (OGTase) and BAP31 A fragment of OGTase and BAP31 OGTase and a fragment of BAP31 A fragment of OGTase and a fragment of BAP31 5 TABLE 41 Protein Complexes of OGTase/Interferon-Ind Prot Interaction O-linked N-acetylglucosaminyltransferase (OGTase) and Interferon-Ind Protein A fragment of OGTase and Interferon-Ind Protein OGTase and a fragment of Interferon-Ind Protein 0 A fragment of OGTase and a fragment of Interferon-Ind Protein TABLE 42 Protein Complexes of Glut4/Beta-Catenin Interaction Glucose Transporter 4 (Glut4) and Beta-catenin 5 A fragment of Glut4 and Beta-catenin Glut4 and a fragment of Beta-catenin A fragment of Glut4 and a fragment of Beta-catenin TABLE 43 0 Protein Complexes of Glut4/Alpha-SNAP Interaction Glucose Transporter 4 (Glut4) and Alpha-SNAP A fragment of Glut4 and Alpha-SNAP Glut4 and a fragment of Alpha-SNAP A fragment of Glut4 and a fragment of Alpha-SNAP 5 WO 00/65340 PCT/US00/10651 14 TABLE 44 Protein Complexes of Glut4/MAPKKK6 Interaction Glucose Transporter 4 (Glut4) and MAPKKK6 A fragment of Glut4 and MAPKKK6 5 Glut4 and a fragment of MAPKKK6 A fragment of Glut4 and a fragment of MAPKKK6 TABLE 45 Protein Complexes of Glut4/Tropomyosin 3 Interaction 0 Glucose Transporter 4 (Glut4) and Tropomyosin 3 A fragment of Glut4 and Tropomyosin 3 Glut4 and a fragment of Tropomyosin 3 A fragment of Glut4 and a fragment of Tropomyosin 3 5 TABLE46 Protein Complexes of Glutl/DRAL/FHL2 Interaction Glucose Transporter 1 (Glutl) and DRAL/FHL2 A fragment of Glutl1 and DRAL/FHL2 Glutl and a fragment of DRAL/FHL2 0 A fragment of Glutl and a fragment of DRAL/FHL2 TABLE 47 Protein Complexes of Glutl /MYSA Interaction Glucose Transporter 1 (Glutl) and cardiac muscle myosin heavy chain (MYSA) 5 A fragment of Glutl and MYSA Glutl and a fragment of MYSA A fragment of Glutl1 and a fragment of MYSA TABLE 48 .0 Protein Complexes of IRAP/SLAP-2 Interaction Insulin-Regulated Membrane-Spanning Aminopeptidase (IRAP) and SLAP-2 A fragment of IRAP and SLAP-2 IRAP and a fragment of SLAP-2 A fragment of IRAP and a fragment of SLAP-2 35 WO 00/65340 PCT/US00/10651 15 TABLE 49 Protein Complexes of IRAP/SG2NA Interaction Insulin-Regulated Membrane-Spanning Aminopeptidase (IRAP) and SG2NA A fragment of IRAP and SG2NA 5 IRAP and a fragment of SG2NA A fragment of IRAP and a fragment of SG2NA TABLE 50 Protein Complexes of OGTase/14-3-3-epsilon 0 O-linked N-acetylglucosaminyltransferase (OGTase) and 14-3-3-epsilon A fragment of OGTase and 14-3-3-epsilon OGTase and a fragment of 14-3-3-epsilon A fragment of OGTase and a fragment of 14-3-3-epsilon 5 TABLE51 Protein Complexes of PI-3K85/Chromogranin Interaction PI-3 Kinase p85 subunit (PI-3K85) and Chromogranin A fragment of PI-3K85 and Chromogranin PI-3K85 and a fragment of Chromogranin 0 A fragment of PI-3K85 and a fragment of Chromogranin TABLE 52 Protein Complexes of PI-3K85/SLP-76 Interaction PI-3 Kinase p85 subunit (PI-3K85) and SLP-76 5 A fragment of PI-3K85 and SLP-76 PI-3K85 and a fragment of SLP-76 A fragment of PI-3K85 and a fragment of SLP-76 TABLE 53 0 Protein Complexes of PI-3K85/14-3-3-zeta Interaction PI-3 Kinase p85 subunit (PI-3K85) and 14-3-3-zeta A fragment of PI-3K85 and 14-3-3-zeta PI-3K85 and a fragment of 14-3-3-zeta A fragment of PI-3K85 and a fragment of 14-3-3-zeta 5 WO 00/65340 PCT/US00/10651 16 TABLE 54 Protein Complexes of PI-3K85/14-3-3-eta Interaction PI-3 Kinase p85 subunit (PI-3K85) and 14-3-3-eta A fragment of PI-3K85 and 14-3-3-eta 5 PI-3K85 and a fragment of 14-3-3-eta A fragment of PI-3K85 and a fragment of 14-3-3-eta TABLE 55 Protein Complexes of PI-3K85/TACC2 Interaction 0 PI-3 Kinase p85 subunit (PI-3K85) and TACC2 A fragment of PI-3K85 and TACC2 PI-3K85 and a fragment of TACC2 A fragment of PI-3K85 and a fragment of TACC2 5 TABLE56 Protein Complexes of Glut4/MM-1 Interaction Glucose Transporter 4 (Glut4) and C-Myc Binding Protein (MM-1) A fragment of Glut4 and MM-1 Glut4 and a fragment of MM-1 0 A fragment of Glut4 and a fragment of MM-1 TABLE 57 Protein Complexes of Glutl/KIAA0 144 Interaction Glucose Transporter 1 (Glut 1) and KIAA0144 (KIAA) 5 A fragment of Glutl1 and KIAA Glutl and a fragment of KIAA A fragment of Glut 1 and a fragment of KIAA TABLE 58 0 Protein Complexes of Glutl/Dynamin Interaction Glucose Transporter 1 (Glutl) and Dynamin A fragment of Glutl1 and Dynamin Glutl1 and a fragment of Dynamin A fragment of Glutl and a fragment of Dynamin 5 WO 00/65340 PCT/US00/10651 17 TABLE 59 Protein Complexes of Glutl/Clone 25204 Interaction Glucose Transporter 1 (Glutl) and Clone 25204 A fragment of Glutl1 and Clone 25204 5 Glutl and a fragment of Clone 25204 A fragment of Glutl1 and a fragment of Clone 25204 TABLE 60 Protein Complexes of IRAP/VAP-A Interaction 0 Insulin-Regulated Membrane-Spanning Aminopeptidase (IRAP; oxytocinase) and VAMP Associated Protein A (VAP-A) A fragment of IRAP and VAP-A IRAP and a fragment of VAP-A A fragment of IRAP and a fragment of VAP-A 5 TABLE 61 Protein Complexes of OGTase/Nafl a Interaction O-Linked-N-AcetylglucosaminylTransferase (OGTase) and NEF-Associated Factor 1 Alpha (Nafl a) 0 A fragment of OGTase and Nafl a OGTase and a fragment of Nafla A fragment of OGTase and a fragment of Naf la TABLE 62 5 Protein Complexes of OGTase/Alpha-2-Catenin Interaction O-Linked-N-AcetylglucosaminylTransferase (OGTase) and Alpha-2-Catenin A fragment of OGTase and Alpha-2-Catenin OGTase and a fragment of Alpha-2-Catenin A fragment of OGTase and a fragment of Alpha-2-Catenin 0 TABLE 63 Protein Complexes of PI-3K110 /TRIP 15 Interaction PI-3 Kinase p110 subunit (PI-3K110) and TRIP15 A fragment of PI-3K110 and TRIP 15 5 PI-3K110 and a fragment of TRIP15 A fragment of PI-3K110 and a fragment of TRIP 15 WO 00/65340 PCT/US00/10651 18 TABLE 64 Protein Complexes of Glut4/14-3-3 Zeta Interaction Glucose Transporter 4 (Glut4) and 14-3-3 Zeta A fragment of Glut4 and 14-3-3 Zeta 5 Glut4 and a fragment of 14-3-3 Zeta A fragment of Glut4 and a fragment of 14-3-3 Zeta TABLE 65 Protein Complexes of Glut4/KIAA0282 Interaction 0 Glucose Transporter 4 (Glut4) and KIAA0282 (an efp-like protein) A fragment of Glut4 and KIAA0282 Glut4 and a fragment of KIAA0282 A fragment of Glut4 and a fragment of KIAA0282 5 TABLE66 Protein Complexes of Glut4/Tankvrase Interaction Glucose Transporter 4 (Glut4) and Tankyrase A fragment of Glut4 and Tankyrase Glut4 and a fragment of Tankyrase 0 A fragment of Glut4 and a fragment of Tankyrase TABLE 67 Protein Complexes of IRAP/PTPZ Interaction Insulin-Regulated Membrane-Spanning Aminopeptidase (IRAP) and protein tyrosine 5 phosphatase zeta (PTPZ) A fragment of IRAP and PTPZ IRAP and a fragment of PTPZ A fragment of IRAP and a fragment of PTPZ 0 TABLE 68 Protein Complexes of IRAP/3Spectrin Interaction Insulin-Regulated Membrane-Spanning Aminopeptidase (IRAP) and P3-spectrin A fragment of IRAP and P-spectrin IRAP and a fragment of p-spectrin 5 A fragment of IRAP and a fragment of 1-spectrin WO 00/65340 PCT/US00/10651 19 TABLE 69 Protein Complexes of IRAP/PI-3K85 Interaction Insulin-Regulated Membrane-Spanning Aminopeptidase (IRAP) and PI-3 Kinase p85 subunit (PI-3K85) 5 A fragment of IRAP and PI-3K85 IRAP and a fragment of PI-3K85 A fragment of IRAP and a fragment of PI-3K85 TABLE 70 0 Protein Complexes of PP5/HSP89 Interaction Protein Phosphatase 5 (PP5) and Heat Shock Protein 89 (HSP89) A fragment of PP5 and HSP89 PP5 and a fragment of HSP89 A fragment of PP5 and a fragment of HSP89 5 TABLE 71 Protein Complexes of PP5/Tankyrase Interaction Protein Phosphatase 5 (PP5) and Tankyrase A fragment of PP5 and Tankyrase !0 PP5 and a fragment of Tankyrase A fragment of PP5 and a fragment of Tankyrase TABLE 72 Protein Complexes of PI-3K85/Tankvrase Interaction 25 PI-3 Kinase p85 subunit (PI-3K85) and Tankyrase A fragment of PI-3K85 and Tankyrase PI-3K85 and a fragment of Tankyrase A fragment of PI-3K85 and a fragment of Tankyrase 30 TABLE 73 Protein Complexes of PI-3K110/APP Interaction PI-3 Kinase p 1 1 0 subunit (PI-3K110) and Amyloid Precursor Protein (APP) A fragment of PI-3K110 and APP PI-3K110 and a fragment of APP 35 A fragment of PI-3K110 and a fragment of APP WO 00/65340 PCT/US00/10651 20 The proteins newly associated with a particular physiological pathway described herein are used to screen for drug candidates useful for treating a physiological disorder. These proteins are set forth in Table 74. 5 TABLE74 Proteins for Drug Screening and Physiological Disorder PI-3K110 Alzheimer's Disease PI-3K110 Diabetes TRIP 15 Alzheimer's Disease 0 TRIP 15 Diabetes All Others Diabetes The involvement of above interactions in particular pathways is as follows. One of the key questions which must be answered in order to understand and treat non 5 insulin dependent diabetes mellitus (NIDDM) is how glucose uptake is regulated in the cell. It is known that in adipose and muscle tissues there exists an insulin-regulated membrane-spanning glucose transporter called Glut4 that shuttles between the interior of the cell to the plasma membrane by means of vesicle-mediated endocytosis and exocytosis (Garvey et al., 1998; Haruta et al.,1995; Pessin et al., 1999). Fat and muscle cells from diabetic patients appear to be defective 0 in this type of regulated glucose transport (Zierath et al., 1998). The mechanisms by which this transport to the plasma membrane and return back to the interior of the cell are regulated are not well understood. Toward this end, there has been much interest in analyzing the Glut4 protein and the additional factors that participate in glucose uptake in fat and muscle cells. As described below, the yeast two-hybrid assay has been employed as a means of identifying proteins that interact with !5 Glut4 as well as other molecules that have been implicated in the insulin-dependent transport of glucose. Thus, by understanding the regulation of glucose transport in normal cells, medical interventions can be discovered that would serve to increase sugar uptake in the cells of diabetic patients. One approach to understanding how glucose transport is achieved has been to use the Glut4 30 molecule as a molecular bait in the search for other molecules which can interact with it. In this way, it might be possible to find ways to influence the function of Glut4 and perhaps find ways to cause it to go to the plasma membrane and subsequently remove glucose from the outside of the cell and bring it into the interior. Using the yeast two-hybrid assay, we have been able to demonstrate WO 00/65340 PCT/US00/10651 21 that clone C-193 (known as CARP in other systems) can bind to Glut4. CARP is a cytokine inducible gene that reportedly acts as a negative regulator of cardiac-specific genes (Jeyaseelan et al., 1997). This interaction may serve as a tie between heart disease and diabetes. Using the yeast two-hybrid assay, we have also been able to detect the interaction of Glut4 5 with two novel proteins that have been named PN7065 and PN7386. PN7065 bears a striking similarity to a rat salt-induced protein kinase (GenBank accession AB020480). Experiments in rats have shown that this salt-induced kinase may play an important role in the regulation of adrenocortical functions in response to high plasma salt and ACTH stimulation (Wang et al., 1999). It is possible that Glut4 may act as a substrate for the kinase. PN7386 is identical to a human 0 chromosome 20 clone called 850H21 (GenBank accession ALO31680) that is uncharacterized in the literature. It is possible that the protein product of this clone may participate in protein trafficking or in the signal transduction mechanism that regulates this process. Using the yeast two-hybrid assay, we have been able to detect four more proteins, beta catenin, alpha-SNAP, tropomyosin 3 and MAPKKK6, which can bind to Glut4. Beta-catenin is a 5 protein containing so-called Armadillo repeats that is involved in two important cellular processes: signal transduction via the Wingless pathway and cell adhesion (Ben-Ze'ev et al., 1998). This interaction between Glut4 and beta-catenin may shed light on the regulation of insulin-responsive glucose transport since it links the transporter to an important signaling pathway. The alpha-SNAP is an important mediator in the cellular process of intracellular transport (St-Denis, et al., 1998). .0 The finding that alpha-SNAP and Glut4 interact provides a link between glucose transportation and the machinery required to perform movement of the glucose transporter between the outside and the interior of the cell. Glut4 has been demonstrated to interact with tropomyosin 3, a protein involved in muscle contraction (Squire et al., 1998). This interaction may represent a link between glucose uptake and muscle function. Finally, the Glut4 glucose transporter has been shown to interact with .5 a putative protein kinase, MAPKKK6. This enzyme has not been well-characterized, but it was identified by virtue of its ability to bind to another protein kinase (Wang et al., 1998). Once again, this may provide a clue to the mechanism of regulation of glucose transport since Glut4 can interact with another potential signal tranduction mediator. Using the yeast two-hybrid assay, we have been able to detect three proteins which can bind 30 to Glut4, 14-3-3 zeta, the efp-like protein (KIAA0282) and tankyrase. The 14-3-3 zeta is a signal transduction protein which has been shown to interact specifically with phospherine residues (Thorson et al., 1998). 14-3-3 zeta is part of a pathway that links the insulin receptor molecule at WO 00/65340 PCT/US00/10651 22 the cell surface to the Glut4 protein located either in the interior of the cell or also at the cell surface. Interestingly, the same small region of Glut4 that interacts with 14-3-3 zeta has been shown to be phosphorylated on a critical serine residue by the kinase Akt-2 that has also been implicated in glucose uptake (Kupriyanova et al., 1999). The efp-like protein is a putative transcription factor 5 (Orimo et al., 1995). Its function is not well described but the Glut4 protein could influence the transcriptional activation of various genes, some of which might be involved in cellular metabolism. Tankyrase is a known telomere-asscoiated protein (Smith et al., 1998). Using the yeast two-hybrid assay, we have been able to detect an additional protein, which can bind to Glut4. This protein is called MM-1 and was identified by virtue of its ability to interact 0 with the proto-oncogene c-myc (Mori et al., 1998). Other than this original characterization, there is not much else known about MM-1 but on the basis of the interaction found here, MM-1 may play critical roles in both cancer and diabetes. Other than this original characterization, there was not much else known about MM-1, however because of its association with Glut4 and its tie to Diabetes, we have used MM-1 in two 5 hybrid assays. Using the yeast two-hybrid assay, we have identified the large centrosomal protein C-Napl as an interactor ofMM-1. C-Nap1 was originally identified as a protein that could interact with the Nek2 cell cycle-regulated protein kinase (Fry et al., 1998). The finding that MM-1 can interact with C-Napl serves to tie Glut4 and glucose transport in general to the control of the cell cycle. The second protein shown to interact with MM-1 is beta spectrin. Spectrins give flexibility 0 to the cell and also act as a scaffold for other cellular proteins (Grum et al., 1999). Interestingly, we have linked beta spectrin to glucose transport and Diabetes in a previous finding where it was shown that beta spectrin could interact with the vesicle-associated protein IRAP. The finding that MM-1 can bind to beta spectrin further strengthens the argument that beta spectrin plays a role in glucose transport. MM-1 was shown to bind to a third protein, KIAA0477, which has no known function. 5 KIAA0477 was originally isolated from brain but its tissue distribution is not known. The finding that KIAA0477 interacts with MM-1 suggests that KIAA0477 plays a role in glucose transport or in some cellular function associated with vesicular transport. Another approach to understanding the mechanism of glucose transport has been to use the Glutl molecule (Hresko et al., 1994), a gene highly related to Glut4 and possessing similar 0 biological function, as a molecular bait in the search for other molecules that can interact with it. Using the yeast two-hybrid assay, we have identified three more proteins which can bind to Glut l: DRAL, HSS and myosin heavy chain. DRAL is a LIM domain-containing protein that is also WO 00/65340 PCT/US00/10651 23 known as FHL-2 or SLIM3. DRAL was identified as a protein that was expressed in normal muscle tissue culture cells but was down-regulated in cancerous rhabdomyosarcoma cells (Genini et al., 1997). It is possible that DRAL plays a critical role in the terminal differentiation of muscle cells such as cardiac muscle, and that its misregulation could result in an undifferetiated cancerous phenotype. Glutl was also shown to interact with HSS or human sperm surface protein. HSS is a testis-specific protein that has no known function (Shankar et al., 1998). It does contain a putative transmembrane domain and a leucine-zipper dimerization domain. Since it interacts with Glutl1 and it is presumably membrane-bound, HSS could potentially act with Glutl or Glut4 to affect glucose transport in the testis. Glutl1 has also been demonstrated to interact with a form of the myosin heavy S chain. Myosin heavy chain plays a key role in muscle structure and contraction (Eddinger et al., 1998). The interaction between Glutl1 and myosin suggests that glucose uptake and muscle function may be interrelated via the association of these two proteins. Using the yeast two-hybrid assay, we identified dynamin as an interactor of Glutl. Dynamin has been implicated in the movement of glucose transporters via vesicular trafficking and likely 5 plays a critical role in endocytosis (or movement from the cell surface to the interior of the cell) (Kao et al., 1998). Because of dynamin's link to Diabetes and glucose transport, we used it in two hybrid assays and found two proteins that could interact with it. The first protein is called CALM, and it is a clathrin assembly protein similar to the AP-3 family of adaptor proteins. CALM was originally found in a lymphoid myeloid leukemia cell line containing a chromosome translocation 0 resulting in the fusion of the AF10 gene with CALM (Dreyling et al., 1996). Clathrin and its associated proteins have a long history of involvement in the transport of vesicles from the cell surface to the interior of the cell. The association of dynamin and CALM further supports this role and ties CALM to glucose transport. Dynamin also binds to a proteosome activator subunit termed Psme3. The human Psme3 gene maps to the region of the BRCA1 gene, and its function was 5 deduced by its similarity to the mouse gene that is also referred to as the Ki antigen (Kohda et al., 1998). Since the proteosome is required for the post-translational processing and the specific degradation of certain proteins, the finding that Psme3 can bind to dynamin implies that this type of protease activity may play a key role in glucose transport. Using the yeast two-hybrid assay, we have identified two more proteins which can bind to 0 Glutl, DRAL/FHL2 and cardiac muscle myosin heavy chain. The first protein, DRAL/FHL2, is a protein shown to be down-regulated in rhabdomyosarcoma (Genini et al., 1997). It is entirely composed of LIM domains, polypeptide motifs that form double zinc fingers and may function by WO 00/65340 PCT/US00/10651 24 facilitating binding to nucleic acid or other proteins. The same region of Glutl has been shown to bind to a cardiac muscle myosin heavy chain (MYSA)(Metzger et al., 1999). The significance of this interaction is unknown with regard to glucose transport, however myosin is known to function in muscle contraction and cell structure. Using the yeast two-hybrid assay, we have identified three proteins which can bind to Glutl, dynamin, and two proteins of unknown function, KIAA0144 and clone 25204. Dynamin has been implicated in the movement of glucose transporters via vesicular trafficking and likely plays a critical role in endocytosis (or movement from the cell surface to the interior of the cell) (Kao et al., 1998). Although the KIAA0144 gene is uncharacterized to date, the region of it that contacts Glut 1 S is highly enriched for serine, threonine and proline residues, possibly providing a clue to its function. Other proteins with similar "STP" domains include the extracellular portions of cell surface receptors. Finally, a potential translation product of clone 25204 bears a striking resemblance to a previously identified mouse gene called SEZ-6. This gene was found by virtue of its increased transcript levels in brain tissue following exposure to a seizure producing drug 5 (Shimizu-Nishikawa et al., 1995). The insulin-regulated membranse-spanning aminopeptidase or IRAP (also known as vp 165, gp160 and oxytocinase) co-localizes with the Glut4 transporter in specified endocytic vesicles (Keller et al., 1995; Malide et al., 1997). Since expression of the N-terminal fragment of IRAP has been shown to result in the translocation of Glut4 to the plasma membrane, IRAP is thought to play 0 a key role in glucose transport (Waters et al., 1997). Using the two-hybrid system, we have detected the interaction of IRAP with two proteins, 14-3-3 beta and HSS. The 14-3-3 family of proteins are critical signal transduction proteins that bind to phosphoserine residues (Jin et al., 1996). The interaction of IRAP with 14-3-3 beta strongly suggests that the function of IRAP could be regulated by phosphorylation and by the subsequent binding by 14-3-3 family members. Since IRAP and the 5 Glut4 glucose transporter co-localize in the same intracellular vesicles, it is possible that Glut4 may participate in signal transduction mechanisms mediated by the 14-3-3 proteins such as 14-3-3 beta. IRAP has also been shown to bind to the HSS protein described above. Like Glutl and Glut4, IRAP is membrane-bound and could potentially bind to HSS in the membrane. This finding points to HSS as playing a role in glucose transport or in other important functions performed in intracellular 0 vesicles. Using the two-hybrid system, we have detected the interaction of IRAP with two more proteins. The N-terminal portion of IRAP has been shown to interact with SLAP-2. The rabbit WO 00/65340 PCT/US00/10651 25 homolog of SLAP-2 has been demonstrated to localize to the sarcolemma or the membrane of muscle cells although its function has not been elucidated (Wigle et al., 1997). SLAP-2 may play a role in vesicular transport or may at least participate in it since it has been shown to be membrane associated and localizes to both the cell membrane as well as to intracellular stores in the 5 endoplasmic reticulum. The C-terminal extracellular portion of IRAP has been demonstrated to interact with SG2NA. SG2NA is a cell cycle nuclear autoantigen that contains so-called WD-40 repeats that are present in a variety of signal transduction proteins (Muro et al., 1995). Once again, the significance of this interaction is unclear however it is possible that SG2NA binding to IRAP is part of a more complex regulatory mechanism. D Using the two-hybrid system, we have detected the interaction of IRAP with one more protein. The N-terminal portion of IRAP has been shown to interact VAMP-associated protein A (VAP-A or VAP-33). This protein has been implicated in intracellular transport (specifically exocytosis or movement to the cell surface) in A. californica and likely plays a similar role in humans (Skehel et al., 1995; Weir et al., 1998). 5 Using the two-hybrid system, we have detected the interaction of IRAP with three proteins. The N-terminal portion of IRAP has been shown to interact with another signal transduction protein, the zeta polypeptide of protein tyrosine phosphatase. This protein is not well characterized but could play a role in regulating glucose transport by dephosphorylating critical proteins that cause or prevent glucose transport (Nishiwaki et al., 1998). The C-terminal portion of IRAP has been 0 shown to interact with non-erythrocytic beta-spectrin. This protein is thought to be involve in secretion and could play a role in the movement of Glut 4 vesicles through IRAP (Hu et al., 1992). The C-terminus of IRAP has also been shown in the two-hybrid assay to interact with the p85 regulatory subunit of phosphatidylinositol-3 (PI-3) kinase. This protein is a central player in cellular signal transduction and participates in transmitting signals from the outside of the cell into the 5 interior. Interestingly, one of the functions of PI-3 kinase p85 involves the insulin receptor (Martin et al., 1996). Further, it is well known that the movement of Glut 4 between the plasma membrane and the interior of the cell depends on the action of the PI-3 kinase signal transduction pathway since inhibitors of this kinase prevent the cycling of Glut4. We also discovered that PI-3 kinase p85 interacts with tankyrase. Two-hybrid interactions have been detected using the p 10 catalytic 0 subunit of PI-3 kinase, and these include interactions with the p85 and p55 subunits of the same enzyme complex as well as non-subunit interactions.
WO 00/65340 PCT/US00/10651 26 Protein phosphatase 5 (PP5) is a TPR domain containing protein that seems to be part of larger multiprotein complexes that possess several cellular functions (Silverstein et al., 1997). Our two-hybrid studies have confirmed the biochemical interaction between protein phosphatase 5 and Hsp90, and the association between these proteins has been previously demonstrated using 5 biochemical methods. PP5 has also been demonstrated using the two-hybrid assay herein to interact with another related heat shock protein, Hsp89, and also with tankyrase. Phosphatidyl inositol-3 kinase is a very important signal transduction protein and likely plays a critical role in Glut4-mediated glucose uptake (Shankar et al.. 1998). This protein participates in transmitting signals from the outside of the cell into the interior. It is composed of 0 two subunits, the p85 regulatory subunit and the p110 catalytic subunit, and functions by facilitating the transmission of signals from the outside of the cell into the interior. PI-3 kinase has been implicated in insulin-regulation and glucose uptake since one of its functions involves the insulin receptor (Martin et al., 1996). Further, the movement of Glut4 between the plasma membrane and the interior of the cell depends on the action of the PI-3 kinase signal transduction pathway since 5 inhibitors of this kinase prevent the cycling of Glut4. The p85 regulatory subunit of PI-3 kinase has been shown to interact with several proteins in the two-hybrid assay. Here we report the identification of five more proteins that can interact with p85. SLP-76 is a tyrosine phosphoprotein that participates in T cell signaling (Clements et al., 1998; Jackman et al., 1995). It is thought that SLP-76 acts as a so-called adaptor protein since 0 it plays a role in intermediate steps of signal transduction. This is achieved by bridging factors that act at the plasma membrane with other molecules that perform functions within the interior of the cell. Our results indicate that SLP-76 may play a critical role in the PI-3 kinase signal transduction pathway by virtue of its ability to bind the p85 regulatory subunit. The p85 subunit of PI-3 kinase has also been demonstrated to bind to two more important signal transduction proteins: 14-3-3 zeta 5 and 14-3-3 eta. These proteins bind specifically to phosphoserine residues in a number of proteins (Oghira et al., 1997; Thorson et al., 1998; Yaffe et al., 1997). Interestingly, our studies have shown that the Glut4 glucose transporter can also interact with 14-3-3 zeta. Thus, PI-3 kinase can also be connected to glucose uptake mechanisms by its interaction with the 14-3-3 signal transduction proteins. PI-3 kinase p85 was shown to interact with chromogranin C, a neuroendocrine secretory 0 granule protein in the granin family (Ozawa et al., 1995). Members of the granin family localize to specialized secretory vesicles and are thought to serve an important function in protein sorting and secretion (Leitner et al., 1999). Finally, TACC2 has been shown to interact with PI-3 kinase WO 00/65340 PCT/US00/10651 27 p85 in the yeast two-hybrid assay. TACC2 is a member of a family of "transforming coiled coil" proteins that have been implicated in cellular growth control and cancer (Still et al., 1999). Although the function of TACC2 remains unknown, its interaction with p85 demonstrates that it may also be a part of an important signal transduction pathway. 5 The p 1 10 subunit of this protein has been shown to interact with complement protein C4, tenascin XB and alpha acid glucosidase (GAA). The complement C4 protein plays a key role in acitvating the classical complement pathway, and it is involved in evoking histamine release from basophils and mast cells. Naturally occurring deficiencies of C4 have been correlated with a number of immune-related human diseases such as Systemic Lupus Erythmatosus, kidney disease, hepatitis, 0 dementia and the propensity for recurrent infectiions (Mascart-Lemone et al., 1983; Vergani et al., 1985; Waters et al., 1997; Nerl et al., 1984; Lhotta et al., 1990). The finding that C4 interacts with the p1 10 subunit of PI-3 kinase suggests that the function of C4 is somehow regulated by this signal transduction, perhaps in response to some immunologic stimulus. The p1 10 catalytic subunit of PI 3 kinase has been demonstrated to interact with tenascin XB. Tenascin XB is an extracellular 5 structural protein. Deficiency oftenascin XB is linked to the connective tissue disorder Ehler-Danlos syndrome (Burch et al., 1997). This finding that p110 can bind to tenascin XB suggest that the function of tenascin XB could be modified or regulated by the PI-3 kinase signal trasduction pathway. PI-3 kinase p 110 has also been shown to bind to GAA or alph acid glucosidase. GAA is a lysosomal enzyme that catalyzes the release of glucose from glycosylated substrates, and defects 0 in GAA result in a glycogen storage disease (Raben et al., 1995). The finding that PI-3 kinase can bind to GAA suggests that GAA activity may be influenced by the PI-3 kinase signaling mechanism. Our previous two-hybrid results have linked the PI-3 kinase to human diseases such as Diabetes and Alzheimer's disease. These new findings therefore link complement protein C4, tenascin XB and alpha acid glucosidase to these diseases as well as to the other diseases already 5 described. The p110 subunit of this protein has been shown to interact with the thyroid hormone interacting protein TRIP 15 in the two-hybrid assay. TRIP 15 is part of a larger multiprotein complex termed the signalsome that is likely to be involved in cell signaling (Seeger et al., 1998). Our two hybrid results have linked the PI-3 kinase to human diseases such as Diabetes and Alzheimer's 0 disease. We have detected the interaction of PI-3 kinase p 110 subunit with the P3-amyloid precursor protein (APP). In brief, there is now growing evidence that APP metabolism and AP3 generation are WO 00/65340 PCT/US00/10651 28 central events to AD pathogenesis. For a more extensive review of APP and AD pathogenesis, see U.S. patent application Serial No. 09/466,139, filed 21 December 1999 and international patent application No. PCT/US99/30396, filed 21 December 1999, each incorporated herein by reference. Although several candidates (cathepsin G, cathepsin D, chymotrypsin, and others) have been 5 suggested, the P3-secretase enzyme has not yet been identified. Even less is known about c- and 7y secretases. The biochemical link between the presenilins and APP processing has not been established. The proteins that mediate the neurotrophic and neuroprotective effects of sAPP are unknown. This last point is of utmost importance because an alteration of APP metabolism could result in both the generation of a toxic product (AP3) and the impairment of sAPP trophic activity 0 (Saitoh et al.1994; Roch et al.1993; Saitoh and Roch, 1995). In this respect, it is interesting that one APP mutation associated with Alzheimer's results in a defective neurite extension activity of sAPP (Li et al., 1997). Moreover, the balance of phosphorylation cascades is deeply altered in Alzheimer brains (Saitoh and Roch, 1995; Jin and Saitoh, 1995; Mook-Jung and Saitoh, 1997; Saitoh et al., 1991; Shapiro et al., 1991). Since APP is thought to play a major role in the pathology of 5 Alzheimer's disease, the elucidation of a tie between PI-3 kinase and APP provides a new target for discovering the treatment for this neurological disorder (Russo et al., 1998). O-linked N-acetylglucosaminyltransferase or OGTase is an enzyme implicated in intracellular signal transduction (Kreppel et al., 1997). It has been speculated that OGTase may play a key role in glucose uptake and may therefore participate in the Diabetes related pathways 10 (Cooksey et al., 1999). OGTase has been shown to also interact with myosin heavy chain. The binding of myosin heavy chain to OGTase suggests that the function of myosin in muscle structure or function could be influenced by OGTase in its signal transductive capacity. This could potentially affect many cellular processes in the muscle cell, including glucose transport. OGTase has been shown to bind to a novel protein termed PN6931. PN6931 is very similar to the mouse !5 kinesin light chain gene (GenBank accession AF055666). Kinesin is a molecular motor involved in cellular transport and chromosome movement (Kirchner et al., 1999). Perhaps by post translationally modifying this novel kinesin-like protein, OGTase can influence its function. Amino acids 250 to 450 of OGTase has been shown to interact with a member of the 14-3-3 protein family, 14-3-3 epsilon. The 14-3-3 proteins function in intracellular signal transduction 30 pathways by specifically binding to phosphoserine residues on other critical signaling molecules (Ogihara et al., 1997; Yaffe et al., 1997). The interaction between OGTase and 14-3-3 epsilon may WO 00/65340 PCT/US00/10651 29 serve to link two different signal transduction pathways, one which involves phosphorylation and a second which involves another type of protein modification. Amino acids 250 to 450 of OGTase has been shown to interact with two proteins, alpha-2 catenin and Nafl a. Alpha-catenin is a protein related to vinculins that functions in cell-cell contact 5 by binding to cadherins (Rudiger et al., 1998). The same region of OGTase can interact with Nafl b, a protein identified by virtue of its ability to bind the Nef gene product of HIV in the two-hybrid assay (Fukushi et al., 1999). Over-expression of Nafla was observed to cause an increase in cell surface expression of the CD4 antigen, therefore this protein may also function in intracellular trafficking and could potentially participate in a number of diseases related to this general process 0 such as Diabetes and Alzheimer's. Using the yeast two-hybrid assay, we identified Nafl b as an interactor of OGTase. Nafl b is a protein which was identified by virtue of its ability to bind the Nef gene product of HIV in the two-hybrid assay (Fukushi et al., 1999). Over-expression of Naflb was observed to cause an increase in cell surface expression of the CD4 antigen, therefore this protein may also function in 5 intracellular trafficking and could potentially participate in a number of diseases related to this general process such as Diabetes and Alzheimer's. In a two-hybrid search using Naflb as a bait, the TRAF-interacting protein I-TRAF was found to be an interactor. I-TRAF appears to act as a regulator of the TRAF signal transduction pathway that transmits signals from TNF (tumor necrosis factor) receptor family members (Rothe et al., 1996). The observation that Naflb interacts with I 0 TRAF serves to link an extracellular stimulated signal transduction mechanism with the OGTase pathway involved in glucose transport. A two-hybrid search using Naflb as a bait has also identified a novel protein fragment called PN7582. This small protein fragment does not appear to have any strong similarity to known proteins therefore its function is not readily apparent. It is very possible that it may participate in protein trafficking or signal transduction by its association with 5 Naflb. In a two-hybrid search using OGTase as a bait, four new interactors were found. The first interactor, desmin, is a cytoplasmic intermediate filament protein found in muscle (Capetanaki et al., 1998). It functions in striated muscle by connecting myofibrils with themselves and with the plasma membrane. Desmin is broken down into three functional domains, the head, rod and tail, 0 and OGTase can bind to the rod structure. The second protein shown to interact with OGTase is called alpha-karyopherin. Alpha-karyopherin (also known as importin and SRP1) is a ubiquitously expressed protein that plays a role in trafficking nuclear localization signal-containing proteins into WO 00/65340 PCT/US00/10651 30 the nucleus through the nuclear pore (Moroianu, 1997). The third protein that OGTase has been shown to bind is glutanimyl-tRNA synthetase. The aminoacyl-tRNA synthetases not only play a key role in protein synthesis, but recent studies have shown that they also impact a number of other cellular processes such as tRNA processing, RNA splicing, RNA trafficking, apoptosis, and transcriptional and translational regulation (Martinis et al., 1999). The fourth protein shown to bind to OGTase in the yeast two-hybrid assay is called clone 25100 and it has no known function. The gene for clone 25100 was isolated from human infant brain and appears to encode a small protein with no structural characteristics that shed light on its function. All four of these OGTase interacting proteins may act as substrates for OGTase or may affect its function in some way. The S finding that they interact with OGTase suggests that they may play a role in glucose transport or in the pathogenesis of Diabetes. Our yeast two-hybrid studies have demonstrated that OGTase can interact with a variety of proteins that can fall into a number of functional categories. Two proteins that have been implicated in vesicular transport bind to OGTase. The first is called BAP31, and it likely plays a critical role 5 in sorting and transporting membrane proteins between intracellular compartments (Annaert et al., 1997). The second protein is called dynamin II, and it is implicated in the movement of transport vesicles from the plasma membrane to sites within the interior of the cell (Sontag et al., 1994). OGTase has been demonstrated to interact with two proteins that function in transcription, as well. The first is called EGR1 for early growth response protein 1, and it has been shown to be highly D induced in cells following mitogenic stimulation (Sukhatme et al., 1988). It is a zinc-finger containing protein, and following its own stimulation, goes on to activate the transcription of genes involved in mitogenesis and differentiation. Additionally, OGTase can interact with MOP2, a basic helix-loop-helix containing transcription factor that is involved in the induction of oxygen regulated genes (Hogenesch et al., 1997). OGTase binds to a structural protein called talin. Talin is a 5 cytoplasmic protein that serves to link integrins with the actin cytoskeleton (Calderwood etal., 1999). Finally, OGTase has been shown in the yeast two-hybrid assay to bind to five proteins of unknown or poorly characterized function. OGTase binds to Int-6, a protein that has also been demonstrated to bind to the HTLV-I Tax transactivator and it is a component of promyelocytic leukemia nuclear bodies (Desbois et al., 1996). OGTase binds to interferon-induced protein 54, an 0 uncharacterized protein that shows a large increase in its transcript following treatment with alpha and beta-interferons (Levy et al., 1986). Lastly, HSPCO28, KIAA0443, and clone 25100 interact with OGTase.
WO 00/65340 PCT/US00/10651 31 Akt kinase is a serine/threonine protein kinase that has been implicated in insulin-regulated glucose transport and the development of non-insulin dependent diabetes mellitus (Krook et al., 1998). Because of this link, Akt kinase has been used in two-hybrid assays to determine what proteins interact with it either because they are substrates of Akt kinase or because they are 5 regulators of the kinase. Two closely related Akt proteins were used: Aktl and its closely related family-member Akt2. Aktl and Akt2 were both shown to interact with the nuclear mitotic apparatus protein NuMA1. NuMA1 displays a distinct pattern of immunofluorescent staining that varies throughout the cell cycle. It is nuclear throughout interphase but re-localizes to the spindle apparatus during mitosis (Lydersen et al., 1980). Phosphorylation is thought to play a critical role 0) in NuMA function. It appears to become phosphorylated just prior to mitosis and becomes dephosphorylated after mitosis has occurred in the G1 phase of the cell cycle mitosis (Sparks et al., 1995). Aktl and Akt2 may be capable of phosphorylating NuMA, especially since the region of NuMA that interacts with Akt2 (amino acids 98 to 365) contains 23 serines and 9 threonines. Akt2 was also shown to interact with two proteins involved in vesicular transport. The first protein, 5 BAP31, likely plays a role in the movement of membrane-bound proteins from the Golgi appartus to the plasma membrane (Annaert et al., 1997). Since BAP31 was also shown to interact with OGTase in our previous experiments, two signal transduction proteins implicated in glucose transport have been tied to BAP31. Akt2 was also shown to bind to another vesicular transport protein termed beta-adaptin or AP2-beta. Beta-adaptin is a part of the AP2 coat assembly complex 0 that links clathrin and to transmembrane receptors resident in coated vesicles (Pearse, 1989). This finding suggests a role for Akt2 in the regulation of endocytosis, while the finding that Akt2 binds to BAP31 provides for a tie between Akt2 and exocytosis. All of the proteins that can interact with the Akt kinase may play a role in glucose transport by virtue of their association with Akt. PTPlb is a protein tyrosine phosphatase that plays a critical role in signal transduction. It 5 has been implicated as a negative regulator of insulin-responsive glucose transport (Chen et al., 1997), and therefore it has been used in yeast two-hybrid assays in an attempt to find more proteins involved in this function, perhaps by acting as substrates. PTPlb was shown to interact with VAMP-associated protein A (VAP-A or VAP-33). This protein has been implicated in intracellular transport (specifically exocytosis or movement to the cell surface) in,4 A. californica and likely plays 0 a similar role in humans (Skehel et al., 1995; weir et al., 1998). The interaction between PTPlb and VAP-A serves as a potential tie between PTPlb and IRAP since IRAP was also shown to bind to VAP-A in two-hybrid experiments. IRAP, insulin-regulated membrane-spanning aminopeptidase WO 00/65340 PCT/US00/10651 32 (also known as vp165, gpl60 and oxytocinase) co-localizes with the Glut4 transporter in specified endocytic vesicles (Keller et al., 1995; Malide et al., 1997). Since expression of the N-terminal fragment of IRAP has been shown to result in the translocation of Glut4 to the plasma membrane, IRAP is thought to play a key role in glucose transport (Waters et al., 1997). Thus, the result that PTPlb interacts with VAP-A serves to strengthen the tie between PTPlb and VAP-A to glucose transport and Diabetes. The small GTP-binding protein Rab4 is another signal transduction factor that has been implicated in the regulation of insulin-stimulated glucose uptake (Vollenweider et al., 1997; Cormont et al., 1996). Rab4, therefore, has also been used in the yeast two-hybrid assay to find ) additional proteins involved in glucose transport and in Diabetes. Two proteins have been shown to bind to Rab4, an alpha-catenin-like protein (sometimes called alpha-catulin) and another small GTP-binding protein called Rab2. The alpha-catenin-like protein resembles alpha-catenin and vinculin however its function has not yet been well-characterized (Janssens et al., 1999). Alpha catenin itself is a protein related to vinculins that functions in cell-cell contact by binding to 5 cadherins (Rudinger et al., 1998). Interestingly, alpha-catenin was found in our previous studies to bind to OGTase and, as a consequence, has been implicated in glucose transport. The second protein shown to bind to Rab4 is Rab2. These two small GTP-binding proteins are highly related with a 50% amino acid identity. Unlike Rab4, Rab2 has not been thought to play a role in insulin stimulated glucose transport (Uphues et al., 1994) although it does play an important role in ) vesicular transport in the cell (Tisdale et al., 1998). The finding that Rab4 and Rab2 interact suggests that they may be capable of influencing each others cellular functions, thus Rab2 could potentially affect Rab4's role in glucose transport. The proteins disclosed in the present invention were found to interact with their corresponding proteins in the yeast two-hybrid system. Because of the involvement of the 5 corresponding proteins in the physiological pathways disclosed herein, the proteins disclosed herein also participate in the same physiological pathways. Therefore, the present invention provides a list of uses of these proteins and DNA encoding these proteins for the development of diagnostic and therapeutic tools useful in the physiological pathways. This list includes, but is not limited to, the following examples.
)
WO 00/65340 PCT/US00/10651 3.3 Two-Hybrid System The principles and methods of the yeast two-hybrid system have been described in detail elsewhere (e.g., Bartel and Fields, 1997; Bartel et al., 1993; Fields and Song, 1989; Chevray and Nathans, 1992). The following is a description of the use of this system to identify proteins that 5 interact with a protein of interest. The target protein is expressed in yeast as a fusion to the DNA-binding domain of the yeast Gal4p. DNA encoding the target protein or a fragment of this protein is amplified from cDNA by PCR or prepared from an available clone. The resulting DNA fragment is cloned by ligation or recombination into a DNA-binding domain vector (e.g., pGBT9, pGBT.C, pAS2-1) such that an in 10 frame fusion between the Gal4p and target protein sequences is created. The target gene construct is introduced, by transformation, into a haploid yeast strain. A library of activation domain fusions (i.e., adult brain cDNA cloned into an activation domain vector) is introduced by transformation into a haploid yeast strain of the opposite mating type. The yeast strain that carries the activation domain constructs contains one or more Gal4p-responsive reporter 15 gene(s), whose expression can be monitored. Examples of some yeast reporter strains include Y190, PJ69, and CBY14a. An aliquot of yeast carrying the target gene construct is combined with an aliquot of yeast carrying the activation domain library. The two yeast strains mate to form diploid yeast and are plated on media that selects for expression of one or more Gal4p-responsive reporter genes. Colonies that arise after incubation are selected for further characterization. 20 The activation domain plasmid is isolated from each colony obtained in the two-hybrid search. The sequence of the insert in this construct is obtained by the dideoxy nucleotide chain termination method. Sequence information is used to identify the gene/protein encoded by the activation domain insert via analysis of the public nucleotide and protein databases. Interaction of the activation domain fusion with the target protein is confirmed by testing for the specificity of the 25 interaction. The activation domain construct is co-transformed into a yeast reporter strain with either the original target protein construct or a variety of other DNA-binding domain constructs. Expression of the reporter genes in the presence of the target protein but not with other test proteins indicates that the interaction is genuine. In addition to the yeast two-hybrid system, other genetic methodologies are available for the 30 discovery or detection of protein-protein interactions. For example, a mammalian two-hybrid system is available commercially (Clontech, Inc.) that operates on the same principle as the yeast two hybrid system. Instead of transforming a yeast reporter strain, plasmids encoding DNA-binding and WO 00/65340 PCT/US00/10651 34 activation domain fusions are transfected along with an appropriate reporter gene (e.g., lacZ) into a mammalian tissue culture cell line. Because transcription factors such as the Saccharomyces cerevisiae Gal4p are functional in a variety of different eukaryotic cell types, it would be expected that a two-hybrid assay could be performed in virtually any cell line of eukaryotic origin (e.g., insect 5 cells (SF9), fungal cells, worm cells, etc.). Other genetic systems for the detection of protein-protein interactions include the so-called SOS recruitment system (Aronheim et al., 1997). Protein-protein interactions Protein interactions are detected in various systems including the yeast two-hybrid system, 0 affinity chromatography, co-immunoprecipitation, subcellular fractionation and isolation of large molecular complexes. Each of these method is well characterized and can be readily performed by one skilled in the art. See, e.g., U.S. Patents No. 5,622,852 and 5,773,218, PCT published application No. WO 97/27296 and PCT published application No. WO 99/65939, each of which are incorporated herein by reference. 5 The protein of interest (or an interacting domain thereof) can be produced in eukaryotic or prokaryotic systems. A cDNA encoding the desired protein is introduced in an appropriate expression vector and transfected in a host cell (which could be bacteria, yeast cells, insect cells, or mammalian cells). Purification of the expressed protein is achieved by conventional biochemical and immunochemical methods well known to those skilled in the art. The purified protein is then 0 used for affinity chromatography studies: it is immobilized on a matrix and loaded on a column. Extracts from cultured cells or homogenized tissue samples are then loaded on the column in appropriate buffer, and non-binding proteins are eluted. After extensive washing, binding proteins or protein complexes are eluted using various methods such as a gradient of pH or a gradient of salt concentration. Eluted proteins can then be separated by two-dimensional gel electrophoresis, eluted 5 from the gel, and identified by micro-sequencing. The purified proteins can also be used for affinity chromatography to purify interacting proteins disclosed herein. All of these methods are well known to those skilled in the art. Similarly, both proteins of the complex of interest (or interacting domains thereof) can be produced in eukaryotic or prokaryotic systems. The proteins (or interacting domains) can be under 0 control of separate promoters or can be produced as a fusion protein. The fusion protein may include a peptide linker between the proteins (or interacting domains) which, in one embodiment, WO 00/65340 PCT/US00/10651 35 serves to promote the interaction of the proteins (or interacting domains). All of these methods are also well known to those skilled in the art. Purified proteins of interest, individually or a complex, can also be used to generate antibodies in rabbit, mouse, rat, chicken, goat, sheep, pig, guinea pig, bovine, and horse. The 5 methods used for antibody generation and characterization are well known to those skilled in the art. Monoclonal antibodies are also generated by conventional techniques. Single chain antibodies are further produced by conventional techniques. DNA molecules encoding proteins of interest can be inserted in the appropriate expression vector and used for transfection of eukaryotic cells such as bacteria, yeast, insect cells, or 0 mammalian cells, following methods well known to those skilled in the art. Transfected cells expressing both proteins of interest are then lysed in appropriate conditions, one of the two proteins is immunoprecipitated using a specific antibody, and analyzed by polyacrylamide gel electrophoresis. The presence of the binding protein (co-immunoprecipitated) is detected by immunoblotting using an antibody directed against the other protein. Co-immunoprecipitation is 5 a method well known to those skilled in the art. Transfected eukaryotic cells or biological tissue samples can be homogenized and fractionated in appropriate conditions that will separate the different cellular components. Typically, cell lysates are run on sucrose gradients, or other materials that will separate cellular components based on size and density. Subcellular fractions are analyzed for the presence of proteins of interest 0 with appropriate antibodies, using immunoblotting or immunoprecipitation methods. These methods are all well known to those skilled in the art. Disruption of protein-protein interactions It is conceivable that agents that disrupt protein-protein interactions can be beneficial in 5 many physiological disorders, including, but not-limited to NIDDM, AD and others disclosed herein. Each of the methods described above for the detection of a positive protein-protein interaction can also be used to identify drugs that will disrupt said interaction. As an example, cells transfected with DNAs coding for proteins of interest can be treated with various drugs, and co immunoprecipitations can be performed. Alternatively, a derivative of the yeast two-hybrid system, 30 called the reverse yeast two-hybrid system (Leanna and Hannink, 1996), can be used, provided that the two proteins interact in the straight yeast two-hybrid system.
WO 00/65340 PCT/US00/10651 36 Modulation of protein-protein interactions Since the interaction described herein is involved in a physiological pathway, the identification of agents which are capable of modulating the interaction will provide agents which can be used to track the physiological disorder or to use as lead compounds for development of 5 therapeutic agents. An agent may modulate expression of the genes of interacting proteins, thus affecting interaction of the proteins. Alternatively, the agent may modulate the interaction of the proteins. The agent may modulate the interaction of wild-type with wild-type proteins, wild-type with mutant proteins, or mutant with mutant proteins. Agents can be tested using transfected host cells, cell lines, cell models or animals, such as described herein, by techniques well known to those 0 of ordinary skill in the art, such as disclosed in U.S. Patents No. 5,622,852 and 5,773,218, PCT published application No. WO 97/27296 and PCT published application No. WO 99/65939, each of which are incorporated herein by reference. The modulating effect of the agent can be screened in vivo or in vitro. Exemplary of a method to screen agents is to measure the effect that the agent has on the formation of the protein complex. 5 Mutation screening The proteins disclosed in the present invention interact with one or more proteins known to be involved in a physiological pathway, such as in NIDDM or AD. Mutations in interacting proteins could also be involved in the development of the physiological disorder, such as NIDDM 0 or AD, for example, through a modification of protein-protein interaction, or a modification of enzymatic activity, modification of receptor activity, or through an unknown mechanism. Therefore, mutations can be found by sequencing the genes for the proteins of interest in patients having the physiological disorder, such as insulin, and non-affected controls. A mutation in these genes, especially in that portion of the gene involved in protein interactions in the physiological 5 pathway, can be used as a diagnostic tool, and the mechanistic understanding the mutation provides can help develop a therapeutic tool. Screening for at-risk individuals Individuals can be screened to identify those at risk by screening for mutations in the protein 0 disclosed herein and identified as described above. Alternatively, individuals can be screened by analyzing the ability of the proteins of said individual disclosed herein to form natural complexes. Further, individuals can be screened by analyzing the levels of the complexes or individual proteins WO 00/65340 PCT/US00/10651 37 of the complexes or the mRNA encoding the protein members of the complexes. Techniques to detect the formation of complexes, including those described above, are known to those skilled in the art. Techniques and methods to detect mutations are well known to those skilled in the art. Techniques to detect the level of the complexes, proteins or mRNA are well known to those skilled in the art. Cellular models of Physiological Disorders A number of cellular models of many physiological disorders or diseases have been generated. The presence and the use of these models are familiar to those skilled in the art. As an ) example, primary cell cultures or established cell lines can be transfected with expression vectors encoding the proteins of interest, either wild-type proteins or mutant proteins. The effect of the proteins disclosed herein on parameters relevant to their particular physiological disorder or disease can be readily measured. Furthermore, these cellular systems can be used to screen drugs that will influence those parameters, and thus be potential therapeutic tools for the particular physiological 5 disorder or disease. Alternatively, instead of transfecting the DNA encoding the protein of interest, the purified protein of interest can be added to the culture medium of the cells under examination, and the relevant parameters measured. Animal models ) The DNA encoding the protein of interest can be used to create animals that overexpress said protein, with wild-type or mutant sequences (such animals are referred to as "transgenic"), or animals which do not express the native gene but express the gene of a second animal (referred to as "transplacement"), or animals that do not express said protein (referred to as "knock-out"). The knock-out animal may be an animal in which the gene is knocked out at a determined time. The 5 generation of transgenic, transplacement and knock-out animals (normal and conditioned) uses methods well known to those skilled in the art. In these animals, parameters relevant to the particular physiological disorder can be measured. These parametes may include receptor function, protein secretion in vivo or in vitro, survival rate of cultured cells, concentration of particular protein in tissue homogenates, signal 0 transduction, behavioral analysis, protein synthesis, cell cycle regulation, transport of compounds across cell or nuclear membranes, enzyme activity, oxidative stress, production of pathological products, and the like. The measurements of biochemical and pathological parameters, and of WO 00/65340 PCT/US00/10651 38 behavioral parameters, where appropriate, are performed using methods well known to those skilled in the art. These transgenic, transplacement and knock-out animals can also be used to screen drugs that may influence the biochemical, pathological, and behavioral parameters relevant to the particular physiological disorder being studied. Cell lines can also be derived from these animals 5 for use as cellular models of the physiological disorder, or in drug screening. Rational drug design The goal of rational drug design is to produce structural analogs of biologically active polypeptides of interest or of small molecules with which they interact (e.g., agonists, antagonists, O inhibitors) in order to fashion drugs which are, for example, more active or stable forms of the polypeptide, or which, e.g., enhance or interfere with the function of a polypeptide in vivo. Several approaches for use in rational drug design include analysis of three-dimensional structure, alanine scans, molecular modeling and use of anti-id antibodies. These techniques are well known to those skilled in the art. 5 Following identification of a substance which modulates or affects polypeptide activity, the substance may be further investigated. Furthermore, it may be manufactured and/or used in preparation, i.e., manufacture or formulation, or a composition such as a medicament, pharmaceutical composition or drug. These may be administered to individuals. A substance identified as a modulator of polypeptide function may be peptide or non-peptide 0 in nature. Non-peptide "small molecules" are often preferred for many in vivo pharmaceutical uses. Accordingly, a mimetic or mimic of the substance (particularly if a peptide) may be designed for pharmaceutical use. The designing of mimetics to a known pharmaceutically active compound is a known approach to the development of pharmaceuticals based on a "lead" compound. This approach might .5 be desirable where the active compound is difficult or expensive to synthesize or where it is unsuitable for a particular method of administration, e.g., pure peptides are unsuitable active agents for oral compositions as they tend to be quickly degraded by proteases in the alimentary canal. Mimetic design, synthesis and testing is generally used to avoid randomly screening large numbers of molecules for a target property. 0 Once the pharmacophore has been found, its structure is modeled according to its physical properties, e.g., stereochemistry, bonding, size and/or charge, using data from a range of sources, e.g., spectroscopic techniques, x-ray diffraction data and NMR. Computational analysis, similarity WO 00/65340 PCT/US00/10651 39 mapping (which models the charge and/or volume of a pharmacophore, rather than the bonding between atoms) and other techniques can be used in this modeling process. A template molecule is then selected, onto which chemical groups that mimic the pharmacophore can be grafted. The template molecule and the chemical groups grafted thereon can 5 be conveniently selected so that the mimetic is easy to synthesize, is likely to be pharmacologically acceptable, and does not degrade in vivo, while retaining the biological activity of the lead compound. Alternatively, where the mimetic is peptide-based, further stability can be achieved by cyclizing the peptide, increasing its rigidity. The mimetic or mimetics found by this approach can then be screened to see whether they have the target property, or to what extent it is exhibited. 0 Further optimization or modification can then be carried out to arrive at one or more final mimetics for in vivo or clinical testing. Diagnostic Assays The identification of the interactions disclosed herein enables the development of diagnostic 5 assays and kits, which can be used to determine a predisposition to or the existence of a physiological disorder. In one aspect, one of the proteins of the interaction is used to detect the presence of a "normal" second protein (i.e., normal with respect to its ability to interact with the first protein) in a cell extract or a biological fluid, and further, if desired, to detect the quantitative level of the second protein in the extract or biological fluid. The absence of the "normal" second protein 0 would be indicative of a predisposition or existence of the physiological disorder. In a second aspect, an antibody against the protein complex is used to detect the presence and/or quantitative level of the protein complex. The absence of the protein complex would be indicative of a predisposition or existence of the physiological disorder. Z5 EXAMPLES The present invention is further detailed in the following Examples, which are offered by way of illustration and are not intended to limit the invention in any manner. Standard techniques well known in the art or the techniques specifically described below are utilized.
WO 00/65340 PCT/US00/10651 40 EXAMPLE 1 Yeast Two-Hybrid System The principles and methods of the yeast two-hybrid systems have been described in detail (Bartel and Fields, 1997). The following is thus a description of the particular procedure that we used, which was applied to all proteins. The cDNA encoding the bait protein was generated by PCR from brain cDNA. Gene specific primers were synthesized with appropriate tails added at their 5' ends to allow recombination into the vector pGBTQ. The tail for the forward primer was 5' GCAGGAAACAGCTATGACCATACAGTCAGCGGCCGCCACC-3' (SEQ ID NO: 1) and the tail for the reverse ) primer was 5'-ACGGCCAGTCGCGTGGAGTGTTATGTCATGCGGCCGCTA-3' (SEQ ID NO:2). The tailed PCR product was then introduced by recombination into the yeast expression vector pGBTQ, which is a close derivative of pGBTC (Bartel et al., 1996) in which the polylinker site has been modified to include M13 sequencing sites. The new construct was selected directly in the yeast J693 for its ability to drive tryptophane synthesis (genotype of this strain: Mat c, ade2, his3, leu2, trpl, 5 URA3::GAL1-lacZ LYS2::GAL1-HIS3 gal4del gal80del cyhR2). In these yeast cells, the bait is produced as a C-terminal fusion protein with the DNA binding domain of the transcription factor Gal4 (amino acids 1 to 147). A total human brain (37 year-old male Caucasian) cDNA library cloned into the yeast expression vector pACT2 was purchased from Clontech (human brain MATCHMAKER cDNA, cat. # HL4004AH), transformed into the yeast strain J692 (genotype of ) this strain: Mat a, ade2, his3, leu2, trpl, URA3::GAL1-lacZ LYS2::GAL1-HIS3 gal4del gal80del cyhR2), and selected for the ability to drive leucine synthesis. In these yeast cells, each cDNA is expressed as a fusion protein with the transcription activation domain of the transcription factor Gal4 (amino acids 768 to 881) and a 9 amino acid hemagglutinin epitope tag. J693 cells (Mat ca type) expressing the bait were then mated with J692 cells (Mat a type) expressing proteins from the 5 brain library. The resulting diploid yeast cells expressing proteins interacting with the bait protein were selected for the ability to synthesize tryptophane, leucine, histidine, and P-galactosidase. DNA was prepared from each clone, transformed by electroporation into E. coli strain KC8 (Clontech KC8 electrocompetent cells, cat # C2023-1), and the cells were selected on ampicillin-containing plates in the absence of either tryptophane (selection for the bait plasmid) or leucine (selection for 0 the brain library plasmid). DNA for both plasmids was prepared and sequenced by di deoxynucleotide chain termination method. The identity of the bait eDNA insert was confirmed and the cDNA insert from the brain library plasmid was identified using BLAST program against public WO 00/65340 PCT/US00/10651 41 nucleotides and protein databases. Plasmids from the brain library (preys) were then individually transformed into yeast cells together with a plasmid driving the synthesis of lamin fused to the Gal4 DNA binding domain. Clones that gave a positive signal after P-galactosidase assay were considered false-positives and discarded. Plasmids for the remaining clones were transformed into yeast cells 5 together with plasmid for the original bait. Clones that gave a positive signal after P-galactosidase assay were considered true positives. EXAMPLE 2 Identification of Glut4/CARP Interaction 0 A yeast two-hybrid system as described in Example 1 using amino acids 463-509 of Glut4 (Swiss Protein (SP) accession no. P 14672) as bait was performed. One clone that was identified by this procedure included the amino acids encoded by nucleotides 312-1155 of CARP (GenBank (GB) accession no. X83703). 5 EXAMPLE 3 Identification of GLUT1/DRAL(FHL2) Interaction A yeast two-hybrid system as described in Example 1 using amino acids 448-492 of Glutl1 (SP accession no. P11166) as bait was performed. One clone that was identified by this procedure included amino acids 1-279 of DRAL(FHL2) (SP accession no. Q13229). 0 EXAMPLE 4 Identification of GLUT1/Myosin Heavy Chain Interaction A yeast two-hybrid system as described in Example 1 using amino acids 448-492 of Glutl (SP accession no. P11166) as bait was performed. One clone that was identified by this procedure !5 included amino acids 1589-1909 of myosin heavy chain (SP accession no. P13533). EXAMPLE 5 Identification of GLUT1/HSS Interaction A yeast two-hybrid system as described in Example 1 using amino acids 448-492 of Glutl 30 (SP accession no. P11166) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 1-? of HSS (GB accession no. X91879).
WO 00/65340 PCT/US00/10651 42 EXAMPLE 6 Identification of OGTase/Mvosin Heavy Chain Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (GB accession no. U77413) as bait was performed. One clone 5 that was identified by this procedure included amino acids encoded by nucleotides 1773-2283 of myosin heavy chain (GB accession no. AF 111785). EXAMPLE 7 Identification of IRAP/14-3-3 beta Interaction 0 A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 449-880 of IRAP (GB accession no. U62768) as bait was performed. One clone that was identified by this procedure included amino acids 97-236 of 14-3-3 beta (SP accession no. P31946). 5 EXAMPLE 8 Identification ofl IRAP/HSS Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 62-880 of IRAP (GB accession no. U62768) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 726-1446 of HSS (GB 0 accession no. X91879). EXAMPLE 9 Identification of PI-3K110/Complement Protein C4 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 1-300 of PI-3 .5 kinase p110 subunit (SP accession no. P42338) as bait was performed. One clone that was identified by this procedure included amino acids 1056-1277 of complementj protein C4 (SP accession no. P01028). EXAMPLE 10 0 Identification of PI-3K110/Tenascin XB Interaction A yeast two-hybrid system as described in Example 1 using amino acids 1-300 of PI-3 kinase p 1 10 subunit (SP accession no. P42338) as bait was performed. One clone that was WO 00/65340 PCT/US00/10651 43 identified by this procedure included amino acids 3573-3787 of tenascin XB (SP accession no. P78530). EXAMPLE 11 5 Identification of PI-3K110/GAA Interaction A yeast two-hybrid system as described in Example 1 using amino acids 1-300 of PI-3 kinase p110 subunit (SP accession no. P42338) as bait was performed. One clone that was identified by this procedure included amino acids 513-? of GAA (SP accession no. P10253). 0 EXAMPLE 12 Identification of MM- 1/C-Nap 1 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 27-175 of MM-1 (SP accession no. Q99471) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 1508-1949 of C-Napl (GB accession no. AF049105). 5 EXAMPLE 13 Identification of MM-i1/Beta Spectrin Interaction A yeast two-hybrid system as described in Example 1 using amino acids 1-175 of MM-1 (SP accession no. Q99471) as bait was performed. One clone that was identified by this procedure 0 included amino acids 1545-1789 of beta spectrin (SP accession no. Q01082). EXAMPLE 14 Identification of MM- 1/KIAA0477 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 27-175 of MM-1 5 (SP accession no. Q99471) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 2448-3207 of KIAA0477 (GB accession no. AB007946). EXAMPLE 15 .0 Identification of Dynamin/CALM Interaction A yeast two-hybrid system as described in Example 1 using amino acids 250-700 of dynamin (SP accession no. Q05193) as bait was performed. One clone that was identified by this WO 00/65340 PCT/US00/10651 44 procedure included amino acids encoded by nucleotides 948-1599 of CALM (GB accession no. U45976). EXAMPLE 16 5 Identification of Dvnamin/Psme3 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 250-700 of dynamin (SP accession no. Q05193) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 378-966 of Psme3 (GB accession no. U11292). 0 EXAMPLE 17 Identification of Naflb/I-TRAF Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 590-1610 ofNaflb (GB accession no. Q05193) as bait was performed. One clone that 5 was identified by this procedure included amino acids encoded by nucleotides 209-1420 of I-TRAF (GB accession no. U59863). EXAMPLE 18 Identification of Akt 1l/NuMA1 Interaction 0 A yeast two-hybrid system as described in Example 1 using amino acids 1-118 of Aktl (SP accession no. P31749) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 813-1341 of NuMAl (GB accession no. Z11584). EXAMPLE 19 5 Identification of Akt2/NuMA 1 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 1-152 of Akt2 (SP accession no. P31751) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 552-1353 ofNuMAl (GB accession no. ZI 1584).
WO 00/65340 PCT/US00/10651 45 EXAMPLE 20 Identification of Akt2/BAP31 I Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 915-1311 of Akt2 (GB accession no. M95936) as bait was performed. One clone that 5 was identified by this procedure included amino acids encoded by nucleotides 469-877 of BAP31 (GB accession no. NM00574). EXAMPLE 21 Identification of Akt2/Beta Adaptin Interaction 0 A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 915-1311 of Akt2 (GB accession no. M95936) as bait was performed. One clone that was identified by this procedure included amino acids 214-594 of beta adaptin (SP accession no. P21851). 5 EXAMPLE 22 Identification of OGTase/Desmin Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (GB accession no. U77413) as bait was performed. One clone that was identified by this procedure included amino acids 219-449 of desmin (SP accession no. 0 P17661). EXAMPLE 23 Identification of OGTase/Alpha-karyopherin Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by 5 nucleotides 1016-1349 of OGTase (GB accession no. U77413) as bait was performed. One clone that was identified by this procedure included amino acids 152-444 of alpha-karyopherin (SP accession no. P52294). EXAMPLE 24 0 Identification of OGTase/Glutaminvl tRNA Synthetase Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (GB accession no. U77413) as bait was performed. One clone WO 00/65340 PCT/US00/10651 46 that was identified by this procedure included amino acids 36-161 of glutaminyl tRNA synthetase (SP accession no. P47897). EXAMPLE 25 5 Identification of OGTase/Clone 25100 Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (GB accession no. U77413) as bait was performed. One clone that was identified by this procedure included amino acids 11-338 of clone 25100 (GB accession no. AF131780). ) EXAMPLE 26 Identification of PTP 1 b/VAP-A Interaction A yeast two-hybrid system as described in Example 1 using amino acids 280-436ofPTPlb (SP accession no. P18031) as bait was performed. One clone that was identified by this procedure 5 included amino acids encoded by nucleotides 9-? of VAP-A (GB accession no. AF086627). EXAMPLE 27 Identification of Rab4/Alpha-catenin-like Protein Interaction A yeast two-hybrid system as described in Example 1 using amino acids 1-214 of Rab4 (SP S accession no. P20338) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 1573-1987 of alpha-catenin-like protein (GB accession no. U97067). EXAMPLE 28 5 Identification of Rab4/Rab2 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 1-214 of Rab4 (SP accession no. P20338) as bait was performed. One clone that was identified by this procedure included amino acids 27-177 of Rab2 (SP accession no. P08886).
WO 00/65340 PCT/US00/10651 47 EXAMPLE 29 Identification of Glut4/PN7065 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-509 of Glut4 (Swiss Protein (SP) accession no. P14672) as bait was performed. One clone that was identified by 5 this procedure included novel protein fragment PN7065. The DNA sequence and the predicted protein sequence for PN7065 are set forth in 75 and 76, respetively. TABLE 75 Nucleotide Sequence of PN7065 (SEQ ID NO:3) 0 CGCCGGTGGATGCGGGCTGAGCCCTGCTTGCCGGGACCCGCCTGCCCCGCCTTCTCCGCA CACAGCTACACCTCCAACCTGGGCGACTACGATGAGCAGGCGCTGGGTATCATGCAGACC CTGGGCGTGGACCGGCAGAGGACGGTGGAGTCACTGCAAAACAGCAGCTATAACCACTTT GCTGCCATTTATTACCTCCTCCTTGAGCGGCTCAAGGAGTATCGGAATGCCCAGTGCGCC CGCCCCGGGCCTGCCAGGCAGCCGCGGCCTCGGAGCTCGGACCTCAGTGGTTTGGAGGTG 5 CCTCAGGAAGGTCTTTCCACCGACCCTTTCCGACCTGCCTTGCTGTGCCCGCAGCCGCAG ACCTTGGTGCAGTCCGTCCTCCAGGCCGAGATGGACTGTGGGCTCCAGAGCTCGCTGCAG TGGCCCTTGTTCTTCCCGGTGGATGCCAGCTGCAGCGGAGTGTTCCGGCCCCGGCCCGTG TCCCCAAGCAGCCTGCTGGACACAGCCATCAGTGAGGAGGCCAGGCAGGGGCCGGGCCTA GAGGAGGAGCAGGACACGCAGGAGTCCCTGCCCAGCAGCACGGGCCGGGGGCACACCCTG 0 GCCGAGGTCTCCACCCGCCTCTCCCCACTCACCGCGCCAG TABLE 76 Predicted Protein Sequence of PN7065 (SEQ ID NO:4) RRWMRAEPCLPGPACPAFSAHSYTSNLGDYDEQALGIMQTLGVDRQRTVESLQNSSYNHF 5 AAIYYLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQ TLVQSVLQAEMDCGLQSSLQWPLFFPVDASCSGVFRPRPVSPSSLLDTAISEEARQGPGL EEEQDTQESLPSSTGRGHTLAEVSTRLSPLTAP EXAMPLE 30 0 Identification of Glut4/PN7386 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 478-509 of Glut4 (SP accession no. P 14672) as bait was performed. One clone that was identified by this procedure included novel protein fragment PN7386. The DNA sequence and the predicted protein sequence for PN7386 are set forth in Tables 77 and 78, respectively. 5 WO 00/65340 PCT/US00/10651 48 TABLE 77 Nucleotide Sequence of PN7386 (SEQ ID NO:5) GGCCAATGTTGACGTTTTGGTAGGCTATGCAGACATCCATGGAGACTTACTACCTATAAA TAATGATGATAATTATCACAAAGCTGTTTCAACGGCCAATCCACTGCTTAGGATATTTAT 5 ACAAAAGAAGGAAGAAGCAGACTACAGTGCCTTTGGTACAGACACGCTAATAAAGAAGAA GAATGTTTTAACCAACGTATTGCGTCCTGACAACCATAGAAAAAAGCCACATATAGTCAT TAGTATGCCCCAAGACTTTAGACCTGTGTCTTCTATTATAGACGTGGATATTCTCCCAGA AACGCATCGTAGGGTACGTCTTTACAAATACGGCACGGAGAAACCCCTAGGATTCTACAT CCGGGATGGCTCCAGTGTCAGGGTAACACCACATGGCTTAGAAAAGGTTCCAGGGATCTT 0 TATATCCAGGCTTGTCCCAGGAGGTCTGGCTCAAAGTACAGGACTATTAGCTGTTAATGA TGAAGTTTTAGAAGTTAATGGCATAGAAGTTTCAGGGAAGAGCCTTGATCAAGTAACAGA CATGATGATTGCAAATAGCCGTAACCTCATCATAACAGTGAGACCGGCAAACCAGAGGAA TAATGTTGTGAGGAACAGTCGGACTTCTGGCAGTTCCGGTCAGTCTACTGATAACAGCCT TCTTGGCTACCCACAGCAGATTGAACCAAGCTTTGAGCCAGAGGATGAAGACAGCGAAGA 5 AGATGACATTATCATTGAAGACAATGGAGTGCCACAGCAGATTCCAAAAGCTGTTCCTAA TACTGAGAGCCTGGAGTCATTAACACAGATAGAGCTAAGCTTTGAGTCTGGACAGAATGG CTTTATTCCCTCTAATGAAGTGAGCTTAGCAGCCATAGCAAGCAGCTCAAACACGGAATT TGAAACACATGCTCCAGATCAAAAACTCTTAGAAGAAGATGGAACAATCATAACATTATG AAACCGTGGTTTGAATGTTTTCAGAGTGAGGATGCCATGAGGACTTGTACATTTGGCTAG 0 TTTAGGCCAATGTTGACGTTTTGGTAGGCTATGCAGACATCCATG TABLE 78 Predicted Amino Acid Sequence of PN7386 (SEQ ID NO:6) ANVDVLVGYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKK 5 NVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYI RDGSSVRVTPHGLEKVPGIFI SRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTD MMIANSRNLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQIEPSFEPEDEDSEE DDIIIEDNGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAAIASSSNTEF ETHAPDQKLLEEDGT IITL 0 EXAMPLE 31 Identification of OGTase/PN6931 Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1618 of OGTase (GenBank (GB) accession no. U77413) as bait was performed. 5 One clone that was identified by this procedure included novel protein fragment PN6931. The DNA sequence and the predicted protein sequence for PN6931 are set forth in Tables 79 and 80, respectively. TABLE79 0 Nucleotide Sequence of PN6931 (SEQ ID NO:7)
AGGGAGGAGAAGCTGAGCCAGGATGAGATCGTGCTGGGCACCAAGGCTGTCATCCAGGGA
WO00/65340 PCTUS00/10651 49 CTGGAGACTCTGCGTGGGGAGCATCGTGCCCTGCTGGCTCCTCTGGTTGCACCTGAGGCC GGCGAAGCCGAGCCTGGCTCGCAGGAGCGCTGCATCCTCCTGCGTCGCTCCCTGGAAGCC ATTGAGCTTGGGCTGGGGGAGGCCCAGGTGATCTTGGCATTGTCGAGCCACCTGGGGGCT GTAGAATCAGAGAAGCAGAAGCTGCGGGCGCAGGTGCGGCGTCTGGTGCAGGAGAACCAG 5 TGGCTGCGTGAGGAGCTGCCGGGGACACAGCAKAAGCTGCAGCGCAGTGAGCAGGCCGTG GCCCAGCTCGAGGAGGAGAAGCAGCACTTGCTGTTCATGARCCAGATCCGCAGTTGGATG AAGACGCCTYCCCTAACGAGGAGAAGGGGGACGTCCCCAAAGACACACTGGATGACCTGT TCCCCAATGAGGATGAGCAGAGCCCAGCCCCTAGCCCAGGAGGAGGGGATGTGTCTGGTC AGCATGGGGGATACGAGATCCCGGCCCGGCTCCGCACCCTGCACAACTGGTGATCCAATA 0 CGCCTCACAGGGCCGCTACGAGGTAGCTGTGCCACTCTGCAAGCAGGCACTCGAAGACTG GAGAAGACGTCAGGCCACGACCACCCTGACGTTGCCACCATGCTGAACATCCTGGCACTG GTCTATCGGGATCAGAACAAGTACAAGGAGGCTGCCCACCTGCTCAATGATGCTCTGGCC ATCCGGGAGAAAACACTGGGCAAGGACCACCCAGCCGTGGCTGCGACACTAAACAACCTG GCAGTCCTGTATAGCGCAGAG 5 TABLE80 Predicted Protein Sequence of PN6931 (SEQ ID NO:8) REEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEA IELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELPGTQXKLQRSEQAV 0 AQLEEEKQHLLFMXQIRSWMKTPXLTRRRGTSPKTHWMTCSPMRMSRAQPLAQEEGMCLV SMGDTRSRPGSAPCTTGDPIRLTGPLRGSCATLQAGTRRLEKTSGHDHPDVATMLNILAL VYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYSAE EXAMPLE 32 5 Identification of Naflb/PN7582 Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 233-1568 ofNaflb (GB accession no. AJ011896) as bait was performed. One clone that was identified by this procedure included novel protein fragment PN7582. The DNA sequence and the predicted protein sequence for PN7582 are set forth in Tables 81 and 82, respectively. 0 TABLE 81 Nucleotide Sequence for PN7582 (SEQ ID NO:9) ATTTCAAGGGGGCTGCTGTACCCCCAGGCATGTGTCTGTATATCGCACAGGAAGAAGGAA AGTAAGGACATTGCCAGCAAATATCTTACATCTCATCAGCCTATACTGTGTCTCCTGACC 5 ACTCCTAACTGCAAAGGATGCTGGGAAAAAAAGAGCATTGTAGCTTTTCCAGCCTCTGTG GTAGGCGCAGATAAGGGATTAGAGTTGGGTGTTACTGAATCAATGTATCAGACACTTCTC AGTCAGGCTAGAGCCAGATTTAACTAGATTTAGCAGGAAAAGTATGTTTCTTTCACCTGC ATGTAATGAAGGAAATCTATGTCCTTCATACACTTAATAAACCTGTAAGTCTCTACTATG GGCAGGTACTGTGCTAGCTAGACATTACAATGTGTGGGGGCAGACACAAAGATGGGAACA 0 GTAGACACTGGGGAACCCTAGAGGGGGGAGGTTGGGAGTAGGGGAAGGGTTGAAAAATGA TTGGGTACTATGCTCACTACCTGGGTGATGGGATCATTTGTACACCAAATGCCAGCAACA CACAATTTACCCGTGTAACACACCGGCACGTGTACCCCCTGAACCTAAGATGAAAGCCGA
A
WO 00/65340 PCT/US00/10651 50 TABLE 82 Predicted Amino Acid Sequence for PN7582 (SEQ ID NO:10) ISRGLLYPQACVCISHRKKESKDIASKYLTSHQPILCLLTTPNCKGCWEKKSIVAFPASV 5 VGADKGLELGVTESMYQTLLSQARARFN EXAMPLE 33 Identification of OGTase/Talin Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by 0 nucleotides 1016-1349 of OGTase (Genbank (GB) accession no. U77413) as bait was performed. One clone that was identified by this procedure included amino acids 812 et seq. of talin (GB accession no. AF078828). EXAMPLE 34 5 Identification of OGTase/MOP2 Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (Genbank (GB) accession no. U77413) as bait was performed. One clone that was identified by this procedure included amino acids 397-546 of MOP2 (Swiss Protein (SP) accession no. Q99814). 0 EXAMPLE 35 Identification of OGTase/Clone 25100 Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (Genbank (GB) accession no. U77413) as bait was performed. !5 One clone that was identified by this procedure included amino acids encoded by nucleotides 31 1014 of clone 25100 (GB accession no. AF121780). EXAMPLE 36 Identification of OGTase/KIAA0443 Interaction 30 A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (Genbank (GB) accession no. U77413) as bait was performed.
WO 00/65340 PCT/US00/10651 51 One clone that was identified by this procedure included amino acids encoded by nucleotides 3468 4106 of KIAA0443 (GB accession no. AB007903). EXAMPLE 37 5 Identification of OGTase/EGR1 Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (Genbank (GB) accession no. U77413) as bait was performed. One clone that was identified by this procedure included amino acids 415-544 of EGR1 (SP accession no. P18146). 0 EXAMPLE 38 Identification of OGTase/Dynamin II Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (Genbank (GB) accession no. U77413) as bait was performed. 5 One clone that was identified by this procedure included amino acids 515-823 of dynamin II (SP accession no. P50570). EXAMPLE 39 Identification of OGTase/INT-6 Interaction 10 A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (Genbank (GB) accession no. U77413) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 824 1191 of Int-6 (GB accession no. U62962). :5 EXAMPLE 40 Identification of OGTase/HSPCO28 Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (Genbank (GB) accession no. U77413) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 58-443 )0 of HSPCO28 (GB accession no. AF083246).
WO 00/65340 PCT/US00/10651 52 EXAMPLE 41 Identification of OGTase/BAP31 Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (Genbank (GB) accession no. U77413) as bait was performed. 5 One clone that was identified by this procedure included amino acids 116-215 of BAP31 (SP accession no. P51572). EXAMPLE 42 Identification of OGTase/Interferon-Ind Protein Interaction 0 A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1349 of OGTase (Genbank (GB) accession no. U77413) as bait was performed. One clone that was identified by this procedure included amino acids 1 et seq. of interferon-ind protein (SP accession no. P09913). 5 EXAMPLE 43 Identification of Glut4/Beta-catenin Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-509 of Glut4 (Swiss Protein (SP) accession no. P14672) as bait was performed. One clone that was identified by this procedure included amino acids 579-782 of Beta-catenin (SP accession no. P35222). :0 EXAMPLE 44 Identification of Glut4/Alpha-SNAP Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-509 of Glut4 (SP accession no. P14672) as bait was performed. One clone that was identified by this procedure .5 included amino acids 36-241 of Alpha-SNAP (SP accession no. P54920). EXAMPLE 45 Identification of Glut4/MAPKKK6 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-509 of Glut4 30 (SP accession no. P14672) as bait was performed. One clone that was identified by this procedure included amino acids 824-1012 of MAPKKK6 (GenBank (GB) accession no. AF 100318).
WO 00/65340 PCT/US00/10651 53 EXAMPLE 46 Identification of GLUT4/Tropomyosin 3 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 434-509 of Glut4 (SP accession no. P 14672) as bait was performed. One clone that was identified by this procedure 5 included amino acids 171-286 of tropomyosin 3 (SP accession no. P06753). EXAMPLE 47 Identification of GLUT 1/DRAL/FHL2 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 448-492 of Glutl1 0 (SP accession no. P11166) as bait was performed. One clone that was identified by this procedure included amino acids 1-280 of DRAL/FHL2 (SP accession no. Q13229). EXAMPLE 48 Identification of GLUT1/MYSA Interaction 5 A yeast two-hybrid system as described in Example 1 using amino acids 448-492 of Glutl (SP accession no. P11166) as bait was performed. One clone that was identified by this procedure included amino acids 1589-1909 of MYSA (SP accession no. P13533). EXAMPLE 49 0 Identification of IRAP/SG2NA Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 2311-3136 of IRAP (GB accession no. U62768) as bait was performed. One clone that was identified by this procedure included amino acids 623-713 of SG2NA (SP accession no. P70483). '5 EXAMPLE 50 Identification of IRAP/SLAP-2 Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 62-880 of IRAP (GB accession no. U62768) as bait was performed. One clone that was .0 identified by this procedure included amino acids 236-453 of SLAP-2 (GB accession no. AF100750).
WO 00/65340 PCT/US00/10651 54 EXAMPLE 51 Identification of OGTase/14-3-3 Epsilon Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1618 of OGTase (GB accession no. U77413) as bait was performed. One clone 5 that was identified by this procedure included amino acids 21-232 of 14-3-3 epsilon (SP accession no. P29360). EXAMPLE 52 Identification of PI-3K85/Chromogranin Interaction 0 A yeast two-hybrid system as described in Example 1 using amino acids 1-250 of PI-3 kinase p85 subunit (SP accession no. P27986) as bait was performed. One clone that was identified by this procedure included amino acids 2-322 of chromogranin (SP accession no. P13521). EXAMPLE 53 5 Identification of PI-3K85/SLP-76 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 320-440 of PI-3 kinase p85 subunit (SP accession no. P27986) as bait was performed. One clone that was identified by this procedure included amino acids 291-486 of SLP-76 (GB accession no. U20158). 20 EXAMPLE 54 Identification of PI-3K85/SLP-76 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 600-724 of PI-3 kinase p85 subunit (SP accession no. P27986) as bait was performed. One clone that was identified by this procedure included amino acids 291-486 of SLP-76 (GB accession no. U20158). 25 EXAMPLE 55 Identification of PI-3K85/14-3-3-zeta Interaction A yeast two-hybrid system as described in Example 1 using amino acids 425-630 of PI-3 kinase p85 subunit (SP accession no. P27986) as bait was performed. One clone that was identified 30 by this procedure included amino acids 79-246 of 14-3-3-zeta (AP accession no. P29213).
WO 00/65340 PCT/US00/10651 55 EXAMPLE 56 Identification of PI-3K85/14-3-3-eta Interaction A yeast two-hybrid system as described in Example 1 using amino acids 425-630 of PI-3 kinase p85 subunit (SP accession no. P27986) as bait was performed. One clone that was identified 5 by this procedure included amino acids beginning with residue 91 of 14-3-3-eta (SP accession no. Q04917). EXAMPLE 57 Identification of PI-3K85/TACC2 Interaction 0 A yeast two-hybrid system as described in Example 1 using amino acids 600-724 of PI-3 kinase p85 subunit (SP accession no. P27986) as bait was performed. One clone that was identified by this procedure included amino acids 350-600 of TACC2 (GB accession no. AF095791). EXAMPLE 58 5 Identification of Glut4/MM-1 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-509 of Glut4 (Swiss Protein (SP) accession no. P14672) as bait was performed. One clone that was identified by this procedure included amino acids 27-168 of MM-1 (GenBank (GB) accession no. D89667). 10 EXAMPLE 59 Identification of Glut 1 /KIAA0144 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-492 of Glutl (SP accession no. P11166) as bait was performed. One clone that was identified by this procedure included amino acids beginning with residue 691 of KIAA0144 (GB accession no. D63478). 25 EXAMPLE 60 Identification of Glutl/Dynamin Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-492 of Glutl (Swiss. Protein (SP) accession no. P11166) as bait was performed. One clone that was identified by 30 this procedure included amino acids 104-365 of dynamin (GB accession no. L07807).
WO 00/65340 PCT/US00/10651 56 EXAMPLE 61 Identification of Glut 1/Clone 25204 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-492 of Glutl (Swiss Protein (SP) accession no. P11166) as bait was performed. One clone that was identified by 5 this procedure included undetermined amino acids residues of Clone 25204 (GB accession no. AF 131749). EXAMPLE 62 Identification of IRAP/VAP-A Interaction 0 A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 62-880 of IRAP (GB accession no. U62768) as bait was performed. One clone that was identified by this procedure included amino acids 3-243 ofVAP-A (GB accession no. AF086627). EXAMPLE 63 5 Identification of OGTase/Nafl a Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 1016-1618 of OGTase (GB accession no. U77413) as bait was performed. One clone that was identified by this procedure included amino acids 41-486 of Nafla (GB accession no. AJ0 11895). :0 EXAMPLE 64 Identification of OGTasePP5/Alpha-2-Catenin A yeast two-hybrid system as described in Example 1 using acids encoded by nucleotides 1016-1618 of OGTase (GB accession no. U77413) as bait was performed. One clone that was .5 identified by this procedure included amino acids 366-469 of Alpha-2-Catenin (GB accession no. M94151). EXAMPLE 65 Identification of PI-3K110/TRIP 15 Interaction 30 A yeast two-hybrid system as described in Example 1 using amino acids 1-300 of PI-3K110 (SP accession no. P42338) as bait was performed. One clone that was identified by this procedure included amino acids 24-233 of TRIP15 (GB accession no. L40388).
WO 00/65340 PCT/US00/10651 57 EXAMPLE 66 Identification of Glut4/14-3-3 Zeta Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-509 of Glut4 5 (Swiss Protein (SP) accession no. P14672) as bait was performed. Three clones that were identified by this procedure included amino acids 1-121, 1-200 and 1-209 of 14-3-3 zeta (SP accession no. P29213). EXAMPLE 67 3 Identification of Glut4/KIAA0282 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-509 of Glut4 (Swiss Protein (SP) accession no. P14672) as bait was performed. One clone that was identified by this procedure included amino acids 229-379 of KIAA0282 (GenBank (GB) accession no. D87458), an efp-like protein. 5 EXAMPLE 68 Identification of Glut4/Tankyrase Interaction A yeast two-hybrid system as described in Example 1 using amino acids 463-509 of Glut4 (Swiss Protein (SP) accession no. P14672) as bait was performed. One clone that was identified by 0 this procedure included amino acids encoded by nucleotides 1110-1750 of tankyrase (GB accession no. AF082557). EXAMPLE 69 Identification of IRAP/PTPZ Interaction 5 A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 62-880 of IRAP (GB accession no. U62768) as bait was performed. One clone that was identified by this procedure included amino acids 1420-1780 of PTPZ (SP accession no. P23471). EXAMPLE 70 0 Identification of IRAP/3Spectrin Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 2311-3136 of IRAP (GB accession no. U62768) as bait was performed. One clone that WO 00/65340 PCT/US00/10651 58 was identified by this procedure included amino acids 1487-1993 of P-spectrin (SP accession no. Q01082). EXAMPLE 71 5 Identification of IRAP/PI-3K85 Interaction A yeast two-hybrid system as described in Example 1 using amino acids encoded by nucleotides 2311-3136 of IRAP (GB accession no. U62768) as bait was performed. One clone that was identified by this procedure included amino acids 498-544 of PI-3 kinase p85 subunit (SP accession no. P27986). 0 EXAMPLE 72 Identification of PP5/HSP89 Interaction A yeast two-hybrid system as described in Example 1 using amino acids 1-150 of PP5 (SP accession no. P53041) as bait was performed. One clone that was identified by this procedure 5 included amino acids 517-681 of Hsp89 (SP accession no. P07900). EXAMPLE 73 Identification of PP5/Tankyrase Interaction A yeast two-hybrid system as described in Example 1 using amino acids 1-150 of PP5 (SP 0 accession no. P53041) as bait was performed. One clone that was identified by this procedure included amino acids encoded by nucleotides 1110-1750 and nucleotides 1809-2257 of tankyrase (GB accession no. AF082557). EXAMPLE 74 5 Identification of PI-3K85/Tankvrase Interaction A yeast two-hybrid system as described in Example 1 using amino acids 320-440 of PI-3 kinase p85 subunit (SP accession no. P27986) as bait was performed. Two clones that were identified by this procedure included amino acids encoded by nucleotides 1110-1750 of tankyrase (GB accession no. AF082557). 0 WO 00/65340 PCT/US00/10651 59 EXAMPLE 75 Identification of PI-3K110/APP Interaction A yeast two-hybrid system as described in Example 1 using amino acids 1-300 of PI-3 kinase p 1 10 subunit (SP accession no. P42338) as bait was performed. One clone that was 5 identified by this procedure included amino acids 374-546 ofAPP (SP accession no. P05067). EXAMPLE 76 Generation of Polyclonal Antibody Against Protein Complexes As shown above, Glut4 interacts with CARP to form a complex. A complex of the two 10 proteins is prepared, e.g., by mixing purified preparations of each of the two proteins. If desired, the protein complex can be stabilized by cross-linking the proteins in the complex, by methods known to those of skill in the art. The protein complex is used to immunize rabbits and mice using a procedure similar to that described by Harlow et al. (1988). This procedure has been shown to generate Abs against various other proteins (for example, see Kraemer et al., 1993). 5 Briefly, purified protein complex is used as immunogen in rabbits. Rabbits are immunized with 100 pg of the protein in complete Freund's adjuvant and boosted twice in three-week intervals, first with 100 pg of immunogen in incomplete Freund's adjuvant, and followed by 100 gg of immunogen in PBS. Antibody-containing serum is collected two weeks thereafter. The antisera is preadsorbed with Glut4 and CARP, such that the remaining antisera comprises antibodies which 20 bind conformational epitopes, i.e., complex-specific epitopes, present on the Glut4-CARP complex but not on the monomers. Polyclonal antibodies against each of the complexes set forth in Tables 1-73 are prepared in a similar manner by mixing the specified proteins together, immunizing an animal and isolating antibodies specific for the protein complex, but not for the individual proteins. 25 WO 00/65340 PCT/US00/10651 60 EXAMPLE 77 Generation of Monoclonal Antibodies Specific for Protein Complexes Monoclonal antibodies are generated according to the following protocol. Mice are immunized with immunogen comprising Glut4/CARP complexes conjugated to keyhole limpet 5 hemocyanin using glutaraldehyde or EDC as is well known in the art. The complexes can be prepared as described in Example 76, and may also be stabilized by cross-linking. The immunogen is mixed with an adjuvant. Each mouse receives four injections of 10 to 100 pg of immunogen, and after the fourth injection blood samples are taken from the mice to determine if the serum contains antibody to the immunogen. Serum titer is determined by ELISA or RIA. Mice with sera indicating 10 the presence of antibody to the immunogen are selected for hybridoma production. Spleens are removed from immune mice and a single-cell suspension is prepared (Harlow et al., 1988). Cell fusions are performed essentially as described by Kohler et al. (1975). Briefly, P3.65.3 myeloma cells (American Type Culture Collection, Rockville, MD) or NS-1 myeloma cells are fused with immune spleen cells using polyethylene glycol as described by Harlow et al. (1988). 15 Cells are plated at a density of 2x10 5 cells/well in 96-well tissue culture plates. Individual wells are examined for growth, and the supernatants of wells with growth are tested for the presence of Glut4/CARP complex-specific antibodies by ELISA or RIA using Glut4/CARP complex as target protein. Cells in positive wells are expanded and subcloned to establish and confirm monoclonality. Clones with the desired specificities are expanded and grown as ascites in mice or in a 20 hollow fiber system to produce sufficient quantities of antibodies for characterization and assay development. Antibodies are tested for binding to Glut4 alone or to CARP alone, to determine which are specific for the Glut4/CARP complex as opposed to those that bind to the individual proteins. Monoclonal antibodies against each of the complexes set forth in Tables 1-73 are prepared 25 in a similar manner by mixing the specified proteins together, immunizing an animal, fusing spleen cells with myeloma cells and isolating clones which produce antibodies specific for the protein complex, but not for the individual proteins. EXAMPLE 78 30 In vitro Identification of Modulators for Protein-Protein Interactions The present invention is useful in screening for agents that modulate the interaction of Glut4 and CARP. The knowledge that Glut4 and CARP form a complex is useful in designing such WO 00/65340 PCT/US00/10651 61 assays. Candidate agents are screened by mixing Glut4 and CARP (a) in the presence of a candidate agent, and (b) in the absence of the candidate agent. The amount of complex formed is measured for each sample. An agent modulates the interaction of Glut4 and CARP if the amount of complex formed in the presence of the agent is greater than (promoting the interaction), or less than 5 (inhibiting the interaction) the amount of complex formed in the absence of the agent. The amount of complex is measured by a binding assay, which shows the formation of the complex, or by using antibodies immunoreactive to the complex. Briefly, a binding assay is performed in which immobilized Glut4 is used to bind labeled CARP. The labeled CARP is contacted with the immobilized Glut4 under aqueous conditions that 0 permit specific binding of the two proteins to form an Glut4/CARP complex in the absence of an added test agent. Particular aqueous conditions may be selected according to conventional methods. Any reaction condition can be used as long as specific binding of Glut4/CARP occurs in the control reaction. A parallel binding assay is performed in which the test agent is added to the reaction mixture. The amount of labeled CARP bound to the immobilized Glut4 is determined for the 5 reactions in the absence or presence of the test agent. If the amount of bound, labeled CARP in the presence of the test agent is different than the amount of bound labeled CARP in the absence of the test agent, the test agent is a modulator of the interaction of Glut4 and CARP. Candidate agents for modulating the interaction of each of the protein complexes set forth in Tables 1-73 are screened in vitro in a similar manner. 0 EXAMPLE 79 In vivo Identification of Modulators for Protein-Protein Interactions In addition to the in vitro method described in Example 78, an in vivo assay can also be used to screen for agents which modulate the interaction of Glut4 and CARP. Briefly, a yeast two-hybrid 5 system is used in which the yeast cells express (1) a first fusion protein comprising Glut4 or a fragment thereof and a first transcriptional regulatory protein sequence, e.g., GAL4 activation domain, (2) a second fusion protein comprising CARP or a fragment thereof and a second transcriptional regulatory protein sequence, e.g., GAL4 DNA-binding domain, and (3) a reporter gene, e.g., -galactosidase, which is transcribed when an intermolecular complex comprising the 0 first fusion protein and the second fusion protein is formed. Parallel reactions are performed in the absence of a test agent as the control and in the presence of the test agent. A functional Glut4/CARP complex is detected by detecting the amount of reporter gene expressed. If the amount of reporter WO 00/65340 PCT/US00/10651 62 gene expression in the presence of the test agent is different than the amount of reporter gene expression in the absence of the test agent, the test agent is a modulator of the interaction of Glut4 and CARP. Candidate agents for modulating the interaction of each of the protein complexes set forth 5 in Tables 1-73 are screened in vivo in a similar manner. While the invention has been disclosed in this patent application by reference to the details of preferred embodiments of the invention, it is to be understood that the disclosure is intended in an illustrative rather than in a limiting sense, as it is contemplated that modifications will readily 0 occur to those skilled in the art, within the spirit of the invention and the scope of the appended claims. LIST OF REFERENCES Annaert, W.G. et al. (1997). JCell Biol. 139:1397-410. 5 Aronheim et al., 1997. Mol. Cell. Biol. 17:3094-3102. Bartel, P.L. et al. (1993). "Using the 2-hybrid system to detect protein-protein interactions." In: Cellular Interactions in Development: A Practical Approach, Oxford University Press, pp. 153-179. Bartel, P.L. et al. (1996). Nat Genet 12:72-77. 0 Bartel, P.L. and Fields, S. (1997). The Yeast Two-Hybrid System. New York: Oxford University Press. Ben-Ze'ev, A. et al. (1998). Curr Opin Cell Biol. 10:629-39. Burch, G.H. et al. (1997). Nat Genet. 17:104-8. Calderwood, D.A. et al. (1999). JBiol Chem. 274:28071-4. 5 Capetanaki, Y. et al. (1998). SubcellBiochem. 31:463-95. Chen, H. et al. (1997). JBiol Chem. 272:8026-31. Chevray, P.M. and Nathans, D.N. (1992). Proc. Natl. Acad Sci. USA 89:5789-5793. Clements, J.L. et al. (1998). Science 281:416-9. Cooksey, R.C. et al. (1999). Endocrinology 140:1151-7. 0 Cormont, M. et al. (1996). Mol Cell Biol. 16:6879-86. Desbois, C. et al. (1996). Exclusion of Int-6 from PML nuclear bodies by binding to the HTLV-I Tax oncoprotein. Science 273:951-3. Dreyling MH, et al. (1996). Proc Natl Acad Sci USA 93:4804-9. Eddinger, T.J. (1998). Comp Biochem Physiol B Biochem Mol Biol. 119:425-34.
WO 00/65340 PCT/US00/10651 63 Fields, S. and Song, O-K. (1989). ractions. Nature 340:245-246. Fukushi, M. et al. (1999). FEBSLett 442:83-8. Fry, A.M. et al. (1998). JCellBiol. 141:1563-74. Garvey, W.T. et al. (1998). J Clin Invest. 101:2377-86. 5 Genini, M. et al. (1997). DNA Cell Biol. 16:433-42. Grum, V.L. et al. (1999). Cell 98:523-35. Harlow et al. (1988). Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.). Haruta, T. et al. (1995). JBiol Chem. 270:27991-4. 0 Hogenesch, J.B. et al. (1997) JBiol Chem. 272:8581-93. Hresko, R.C. et al. (1994). JBiol Chem. 269:32110-9. Hu RJ, et al. (1992). JBiol Chem. 267:18715-22. Jackman, J.K. et al. 1995). JBiol Chem. 270:7029-32. Janssens, B. et al. (1999). Biochim Biophys Acta 1447:341-7. 5 Jeyaseelan, R. et al. (1997). JBiol Chem. 272:22800-8. Jin, D.Y. et al. (1996). Nature 382:308. Jin, L-W. and Saitoh, T. (1995). Drugs Aging 6:136-149. Kao, A.W. et al. (1998). JBiol Chem. 273:25450-7. Keller, S.R. et al. (1995). JBiol Chem. 270:23612-8. 0 Kirchner, J. et al. (1999). 1 Biol Chem. 380:915-21. Kohda, K. et al. (1998). JImmunol. 160:4923-35. Kohler, G. and Milstein, C. (1975). Nature 256:495-497. Kraemer, F.B. et al. (1993). J. Lipid Res. 34:663-672. Kreppel, L.K. et al. (1997). JBiol Chem. 272:9308-15. !5 Krook, A. et al. (1998). Diabetes 47:1281-6. Kupriyanova TA, et al. (1999). JBiol Chem. 1999 274:1458-64. Leanna, C.A. and Hannink, M. (1996). Nucl. Acids Res. 24:3341-3347. Leitner, B. et al. (1999). JNeurochem. 72:1110-6. Levy, D. et al. (1986). Proc NatlAcad Sci USA 83:8929-33. 30 Lhotta, K. et al. (1990). Nephron 56:206-211. Lydersen, B.K. et al. (1980). Cell 22:489-99. Malide, D. et al. (1997). FEBSLett. 409:461-8. Martin, S.S. et al. (1996). JBiol Chem. 271:17605-8. Martinis, S.A. et al. (1999). Biochimie 81:683-700.
WO 00/65340 PCT/US00/10651 64 Mascart-Lemone, F. et al. (1983). Am. J. Med 75:295-304. Metzger, J.M. et al. (1999). Circ Res. 84:1310-7. Mook-Jung, I. and Saitoh, T. (1997). Neurosci Lett 235:1-4 [published erratum appears in Neurosci Lett 239:131 ]. 5 Mori, K. et al. (1998). J Biol Chem 273:29794-29800. Moroianu, J. (1997). Crit Rev Eukaryot Gene Expr. 7:61-72. Muro, Y. et al. (1995). Biochem Biophys Res Commun. 207:1029-37. Nerl, C. et al. (1984). Neurology 34:310-314 Nishiwaki T, et al. (1998). JBiochem (Tokyo) 123:458-67. 0 Ogihara, T. et al. (1997). JBiol Chem. 272:25267-74. Ozawa, H. et al. (1995). Cell Struct Funct. 20:415-20. Orimo A, et al. (1995). JBiol Chem. 270:24406-13. Pessin, J.E. et al. (1999). JBiol Chem. 1999 274:2593-6. Pearse, B.M. (1989). Methods Cell Biol. 31:229-46. 5 Raben, N. et al. (1995).. Muscle Nerve 3:S70-4. Roch, J-M., et al. (1993). Ann N YAcadSci 695:149-157. Rothe, M. et al. (1996). Proc Natl AcadSci USA 93:8241-6. Rudiger, M. (1998). Bioessays 20:733-40. Russo T, et al. (1998). FEBSLett. 434:1-7. 0 Saitoh, T. and Roch, J-M. (1995). DN&P 8:206-215. Saitoh, T. et al. (1991). Lab Invest 64:596-616. Saitoh, T., et al. (1994). The Biological Function of Amyloid P3/A4 Protein Precursor. In: Amyloid Protein Precursor in Development, Aging, and Alzheimer's Disease (Masters CL, Beyreuther K, Trillet M, Christen Y eds), pp 90-99. Berlin: Springer-Verlag. 5 Seeger, M. et al. (1998). FASEB J12:469-78. Shankar, S. et al. (1998). Biochem Biophys Res Commun. 243:561-5. Shimizu-Nishikawa, K. et al. (1995). Brain Res Mol Brain Res 28:201-10. Silverstein AM, et al. (1997). JBiol Chem. 272:16224-30. Skehel, P.A. et al. (1995). Science 269:1580-3. 0 Smith S, et al. (1998). Science 282:1484-7. Sontag, J.M. et al. (1994). JBiol Chem. 269:4547-54. Sparks, C.A. et al. (1995). J Cell Sci. 108:3389-96. Squire, J.M. et al. (1998). FASEB J. 12:761-71. St-Denis, J.F. et al. (1998). J Basic Clin Physiol Pharmacol. 9:153-65.
WO 00/65340 PCT/US00/10651 65 Sukhatme, V.P. et al. (1988). Cell 53:37-43. Thorson JA, et al. (1998). Mol Cell Biol. 18:5229-38. Tisdale, E.J. et al. (1998). J Biol Chem. 273:17269-77. Uphues, I. et al. (1994). Biochem J. 301:177-82. 5 Vergani, D. et al. (1985). Lancet II:294-298. Vollenweider, P. et al. (1997). Endocrinology 138:4941-9. Wang, X.S. et al. (1998). Biochem Biophys Res Commun. 253:33-7. Wang, Z. et al. (1999). FEBSLett. 453:135-9. Waters, S.B. et al. (1997). JBiol Chem. 272:23323-7. 0 Weir, M.L. et al. (1998). Biochem J 333:247-51. Wigle, J.T. et al. (1997). JBiol Chem. 272:32384-94. Yaffe, M.B. et al. (1997). Cell 91:961-71. Zierath, J.R. et al. (1998). Mol Cell Biochem. 182:153-60. 5 PCT Published Application No. WO 97/27296 PCT Published Application No. WO 99/65939 U.S. Patent No. 5,622,852 U.S. Patent No. 5,773,218
Claims (43)
1. An isolated protein complex comprising two proteins, the protein complex selected from the group consisting of 5 (a) a complex set forth in Table 1; (b) a complex set forth in Table 2; (c) a complex set forth in Table 3; (d) a complex set forth in Table 4; (e) a complex set forth in Table 5; 0 (f) a complex set forth in Table 6; (g) a complex set forth in Table 7; (h) a complex set forth in Table 8; (i) a complex set forth in Table 9; (j) a complex set forth in Table 10; 5 (k) a complex set forth in Table 11; (1) a complex set forth in Table 12; (m) a complex set forth in Table 13; (n) a complex set forth in Table 14;. (o) a complex set forth in Table 15; 0 (p) a complex set forth in Table 16; (q) a complex set forth in Table 17; (r) a complex set forth in Table 18; (s) a complex set forth in Table 19; (t) a complex set forth in Table 20; !5 (u) a complex set forth in Table 21; (v) a complex set forth in Table 22; (w) a complex set forth in Table 23; (x) a complex set forth in Table 24; (y) a complex set forth in Table 25; 0 (z) a complex set forth in Table 26; (aa) a complex set forth in Table 27; (ab) a complex set forth in Table 28; WO 00/65340 PCT/US00/10651 67 (ac) a complex set forth in Table 29; (ad) a complex set forth in Table 30; (ae) a complex set forth in Table 31; (af) a complex set forth in Table 32; 5 (ag) a complex set forth in Table 33; (ah) a complex set forth in Table 34; (ai) a complex set forth in Table 35; (aj) a complex set forth in Table 36; (ak) a complex set forth in Table 37; ) (al) a complex set forth in Table 38; (am) a complex set forth in Table 39; (an) a complex set forth in Table 40; (ao) a complex set forth in Table 41;. (ap) a complex set forth in Table 42; 5 (aq) a complex set forth in Table 43; (ar) a complex set forth in Table 44; (as) a complex set forth in Table 45 (at) a complex set forth in Table 46; (au) a complex set forth in Table 47; ) (av) a complex set forth in Table 48; (aw) a complex set forth in Table 49; (ax) a complex set forth in Table 50; (ay) a complex set forth in Table 51; (az) a complex set forth in Table 52; 5 (ba) a complex set forth in Table 53; (bb) a complex set forth in Table 54; (bc) a complex set forth in Table 55; (bd) a complex set forth in Table 56; (be) a complex set forth in Table 57; S(bf) a complex set forth in Table 58; (bg) a complex set forth in Table 59; (bh) a complex set forth in Table 60; WO 00/65340 PCT/US00/10651 68 (bi) a complex set forth in Table 61; (bj) a complex set forth in Table 62; (bk) a complex set forth in Table 63; (bl) a complex set forth in Table 64; (bm) a complex set forth in Table 65; (bn) a complex set forth in Table 66; (bo) a complex set forth in Table 67; (bp) a complex set forth in Table 68;. (bq) a complex set forth in Table 69; D (br) a complex set forth in Table 70; (bs) a complex set forth in Table 71; (bt) a complex set forth in Table 72; and (bu) a complex set forth in Table 73. 5
2. The protein complex of claim 1, wherein said protein complex comprises complete proteins.
3. The protein complex of claim 1, wherein said protein complex comprises a fragment of one protein and a complete protein of anther protein. 0
4. The protein complex of claim 1, wherein said protein complex comprises fragments of proteins.
5. An isolated antibody selectively immunoreactive with the protein complex of claim 1. .5
6. The antibody of claim 5, wherein said antibody is a monoclonal antibody.
7. A method for diagnosing a physiological disorder in an animal, which comprises assaying for: (a) whether a protein complex set forth in any one of Tables 1-73 is present in a 30 tissue extract; (b) the ability of proteins to form a protein complex set forth in any one of Tables 1-73; and WO 00/65340 PCT/US00/10651 69 (c) a mutation in a gene encoding a protein of a protein complex set forth in any one of Tables 1-73.
8. The method of claim 7, wherein said animal is a human. 5
9. The method of claim 7, wherein the diagnosis is for a predisposition to said physiological disorder.
10. The method of claim 7, wherein the diagnosis is for the existence of said physiological 0 disorder.
11. The method of claim 7, wherein said assay comprises a yeast two-hybrid assay.
12. The method of claim 7, wherein said assay comprises measuring in vitro a complex formed 5 by combining the proteins of the protein complex, said proteins isolated from said animal.
13. The method of claim 12, wherein said complex is measured by binding with an antibody specific for said complex. 20
14. The method of claim 7, wherein said assay comprises mixing an antibody specific for said protein complex with a tissue extract from said animal and measuring the binding of said antibody.
15. A method for determining whether a mutation in a gene encoding one of the proteins of a 25 protein complex set forth in any one of Tables 1-73 is useful for diagnosing a physiological disorder, which comprises assaying for the ability of said protein with said mutation to form a complex with the other protein of said protein complex, wherein an inability to form said complex is indicative of said mutation being useful for diagnosing a physiological disorder. 30
16. The method of claim 15, wherein said gene is an animal gene.
17. The method of claim 16, wherein said animal is a human. WO 00/65340 PCT/US00/10651 70
18. The method of claim 15, wherein the diagnosis is for a predisposition to a physiological disorder. 5
19. The method of claim 15, wherein the diagnosis is for the existence of a physiological disorder.
20. The method of claim 15, wherein said assay comprises a yeast two-hybrid assay. 0
21. The method of claim 15, wherein said assay comprises measuring in vitro a complex formed by combining the proteins of the protein complex, said proteins isolated from an animal.
22. The method of claim 21, wherein said animal is a human. 5
23. The method of claim 21, wherein said complex is measured by binding with an antibody specific for said complex.
24. A method for screening for drug candidates capable of modulating the interaction of the proteins of a protein complex set forth in any one of Tables 1-73, which comprises: 0 (a) combining the proteins of said protein complex in the presence of a drug to form a first complex; (b) combining the proteins in the absence of said drug to form a second complex; (c) measuring the amount of said first complex and said second complex; and (d) comparing the amount of said first complex with the amount of said second 5 complex, wherein if the amount of said first complex is greater than, or less than the amount of said second complex, then the drug is a drug candidate for modulating the interaction of the proteins of said protein complex.. 0
25. The method of claim 24, wherein said screening is an in vitro screening. WO 00/65340 PCT/US00/10651 71
26. The method of claim 24, wherein said complex is measured by binding with an antibody specific for said protein complexes.
27. The method of claim 24, wherein if the amount of said first complex is greater than the 5 amount of said second complex, then said drug is a drug candidate for promoting the interaction of said proteins.
28. The method of claim 24, wherein if the amount of said first complex is less than the amount of said second complex, then said drug is a drug candidate for inhibiting the interaction of 0 said proteins.
29. A non-human animal model for a physiological disorder wherein the genome of said animal or an ancestor thereof has been modified such that the formation of a protein complex set forth in any one of Tables 1-73 has been altered. 5
30. The non-human animal model of claim 29, wherein the formation of said protein complex has been altered as a result of: (a) over-expression of at least one of the proteins of said protein complex; (b) replacement of a gene for at least one of the proteins of said protein complex with 0 a gene from a second animal and expression of said protein; (c) expression of a mutant form of at least one of the proteins of said protein complex; (d) a lack of expression of at least one of the proteins of said protein complex; or (e) reduced expression of at least one of the proteins of said protein complex. 25
31. A cell line obtained from the animal model of claim 29.
32. A non-human animal model for a physiological disorder, wherein the biological activity of a protein complex set forth in any one of Tables 1-73 has been altered. 30
33. The non-human animal model of claim 32, wherein said biological activity has been altered as a result of: WO 00/65340 PCT/US00/10651 72 (a) disrupting the formation of said complex; or (b) disrupting the action of said complex.
34. The non-human animal model of claim 32, wherein the formation of said complex is 5 disrupted by binding an antibody to at least one of the proteins which form said protein complex.
35. The non-human animal model of claim 32, wherein the action of said complex is disrupted by binding an antibody to said complex. 0
36. The non-human animal model of claim 32, wherein the formation of said complex is disrupted by binding a small molecule to at least one of the proteins which form said protein complex. 15
37. The non-human animal model of claim 32, wherein the action of said complex is disrupted by binding a small molecule to said complex.
38. A cell in which the genome of cells of said cell line has been modified to produce at least one protein complex set forth in any one of Tables 1-73. 20
39. A cell line in which the genome of the cells of said cell line has been modified to eliminate at least one protein of a protein complex set forth in any one of Tables 1-73.
40. A method of screening for drug candidates useful in treating a physiological disorder 25 which comprises the steps of: (a) measuring the activity of a protein selected from the proteins set forth in Tables 1-73 in the presence of a drug, (b) measuring the activity of said protein in the absence of said drug, and (c) comparing the activity measured in steps (1) and (2), 30 wherein if there is a difference in activity, then said drug is a drug candidate for treating said physiological disorder. WO 00/65340 PCT/US00/10651 73
41. An isolated nucleic acid encoding a polypeptide comprising an amino acid sequence selected from the group consisting of amino acid sequences set forth in SEQ ID NOs:4, 6, 8 andl0.
42. The isolated nucleic acid of claim 41 comprising a nucleotide sequence selected from the 5 group consisting of nucleotide sequences set forth in SEQ ID NOs:3, 5, 7 and 9.
43. An isolated polypeptide comprising an amino acid amino acid sequence selected from the group consisting of amino acid sequences set forth in SEQ ID NOs:4, 6, 8 and10. 0
Applications Claiming Priority (13)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US13038999P | 1999-04-22 | 1999-04-22 | |
US60130389 | 1999-04-22 | ||
US14069399P | 1999-06-24 | 1999-06-24 | |
US60140693 | 1999-06-24 | ||
US15694799P | 1999-09-30 | 1999-09-30 | |
US60156947 | 1999-09-30 | ||
US16307399P | 1999-11-02 | 1999-11-02 | |
US60163073 | 1999-11-02 | ||
US16837699P | 1999-12-02 | 1999-12-02 | |
US16837899P | 1999-12-02 | 1999-12-02 | |
US60168376 | 1999-12-02 | ||
US60168378 | 1999-12-02 | ||
PCT/US2000/010651 WO2000065340A1 (en) | 1999-04-22 | 2000-04-21 | Protein-protein interactions |
Publications (1)
Publication Number | Publication Date |
---|---|
AU4475400A true AU4475400A (en) | 2000-11-10 |
Family
ID=27558127
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU44754/00A Abandoned AU4475400A (en) | 1999-04-22 | 2000-04-21 | Protein-protein interactions |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP1181549A1 (en) |
JP (1) | JP2002542774A (en) |
AU (1) | AU4475400A (en) |
CA (1) | CA2371006A1 (en) |
WO (1) | WO2000065340A1 (en) |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1272640A2 (en) * | 2000-03-24 | 2003-01-08 | Millennium Pharmaceuticals, Inc. | 3714, 16742, 23546, and 13887 novel protein kinase molecules and uses therefor |
CA2407850A1 (en) * | 2000-05-05 | 2001-11-15 | Incyte Genomics, Inc. | Cytoskeleton-associated proteins |
US20050020519A1 (en) * | 2001-08-02 | 2005-01-27 | Albiston Anthony L. | Modulation of insulin-regulated aminopeptidase (irap)/angiotensin iv (at4) receptor activity |
WO2003087403A2 (en) * | 2002-04-16 | 2003-10-23 | Evotec Neurosciences Gmbh | Diagnostic and therapeutic use of a golgi protein for neurodegenerative diseases |
KR101723514B1 (en) * | 2016-07-26 | 2017-04-05 | 아주대학교산학협력단 | Pharmecuetical composition for preventing or treating of Alzheimer disease, neurodegenerative disease containing SNO-OGT inhibitor |
-
2000
- 2000-04-21 JP JP2000614029A patent/JP2002542774A/en active Pending
- 2000-04-21 AU AU44754/00A patent/AU4475400A/en not_active Abandoned
- 2000-04-21 WO PCT/US2000/010651 patent/WO2000065340A1/en not_active Application Discontinuation
- 2000-04-21 CA CA002371006A patent/CA2371006A1/en not_active Abandoned
- 2000-04-21 EP EP00926188A patent/EP1181549A1/en not_active Withdrawn
Also Published As
Publication number | Publication date |
---|---|
EP1181549A1 (en) | 2002-02-27 |
CA2371006A1 (en) | 2000-11-02 |
JP2002542774A (en) | 2002-12-17 |
WO2000065340A1 (en) | 2000-11-02 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20020048769A1 (en) | Protein-protein interactions in neurodegenerative disorders | |
WO2002032286A2 (en) | Protein-protein interactions in neurodegenerative diseases | |
WO2002033112A2 (en) | Protein-protein interactions in neurodegenerative diseases | |
AU4475400A (en) | Protein-protein interactions | |
US5854016A (en) | Creba Isoform | |
US20020098511A1 (en) | Protein-protein interactions | |
US20030064408A1 (en) | Protein-protein interactions | |
AU3879700A (en) | Hermansky pudlak syndrome protein-interacting proteins and methods of use thereof | |
US20020164666A1 (en) | Protein-protein interactions | |
US20020164647A1 (en) | Protein-protein interactions | |
US20030068630A1 (en) | Protein-protein interactions | |
US20020104105A1 (en) | Protein-protein interactions | |
US20030055219A1 (en) | Protein-protein interactions | |
US7220851B2 (en) | Nucleic acid encoding calcyon, a D-1 like dopamine receptor activity modifying protein | |
US20020098514A1 (en) | Protein-protein interactions | |
US20030032592A1 (en) | Protein-protein interactions | |
US20020165352A1 (en) | Protein-protein interactions | |
KR20020089352A (en) | Compositions useful for regulating parkin gene activity | |
US20020164615A1 (en) | Protein-protein interactions | |
US20020102606A1 (en) | Protein-protein interactions | |
US20050100966A1 (en) | FHOS-interacting proteins and use thereof | |
US20030032058A1 (en) | Protein-protein interactions | |
US20020197626A1 (en) | Protein-protein interactions | |
US20030054515A1 (en) | Protein-protein interactions | |
WO2004019880A2 (en) | Aw755252-interacting proteins and use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
MK1 | Application lapsed section 142(2)(a) - no request for examination in relevant period |