AU2021285906A1 - Modified template-independent enzymes for polydeoxynucleotide synthesis - Google Patents
Modified template-independent enzymes for polydeoxynucleotide synthesis Download PDFInfo
- Publication number
- AU2021285906A1 AU2021285906A1 AU2021285906A AU2021285906A AU2021285906A1 AU 2021285906 A1 AU2021285906 A1 AU 2021285906A1 AU 2021285906 A AU2021285906 A AU 2021285906A AU 2021285906 A AU2021285906 A AU 2021285906A AU 2021285906 A1 AU2021285906 A1 AU 2021285906A1
- Authority
- AU
- Australia
- Prior art keywords
- tdt
- modified
- modified tdt
- mutations
- lys
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 230000015572 biosynthetic process Effects 0.000 title description 31
- 238000003786 synthesis reaction Methods 0.000 title description 30
- 102000004190 Enzymes Human genes 0.000 title description 27
- 108090000790 Enzymes Proteins 0.000 title description 27
- 125000003729 nucleotide group Chemical group 0.000 claims abstract description 44
- 239000002773 nucleotide Substances 0.000 claims abstract description 27
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 20
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 17
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 17
- 239000003999 initiator Substances 0.000 claims abstract description 10
- 102100033215 DNA nucleotidylexotransferase Human genes 0.000 claims description 161
- 108010008286 DNA nucleotidylexotransferase Proteins 0.000 claims description 155
- 241001529936 Murinae Species 0.000 claims description 25
- 150000001413 amino acids Chemical class 0.000 claims description 16
- 230000035772 mutation Effects 0.000 claims description 15
- 108090000623 proteins and genes Proteins 0.000 claims description 15
- 102000004169 proteins and genes Human genes 0.000 claims description 14
- 230000000903 blocking effect Effects 0.000 claims description 12
- 238000006243 chemical reaction Methods 0.000 claims description 11
- -1 CH2SSCH3 Chemical group 0.000 claims description 10
- 229910019142 PO4 Inorganic materials 0.000 claims description 7
- 235000021317 phosphate Nutrition 0.000 claims description 6
- 239000001226 triphosphate Substances 0.000 claims description 6
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 claims description 5
- 239000010452 phosphate Substances 0.000 claims description 5
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 claims description 4
- 235000000346 sugar Nutrition 0.000 claims description 3
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 claims description 2
- 229910002651 NO3 Inorganic materials 0.000 claims description 2
- 108091028664 Ribonucleotide Proteins 0.000 claims description 2
- 150000001642 boronic acid derivatives Chemical class 0.000 claims description 2
- 150000004657 carbamic acid derivatives Chemical class 0.000 claims description 2
- 150000004649 carbonic acid derivatives Chemical class 0.000 claims description 2
- DMSZORWOGDLWGN-UHFFFAOYSA-N ctk1a3526 Chemical compound NP(N)(N)=O DMSZORWOGDLWGN-UHFFFAOYSA-N 0.000 claims description 2
- 125000004093 cyano group Chemical group *C#N 0.000 claims description 2
- 150000002148 esters Chemical class 0.000 claims description 2
- 150000002170 ethers Chemical class 0.000 claims description 2
- 150000002823 nitrates Chemical class 0.000 claims description 2
- 150000008298 phosphoramidates Chemical class 0.000 claims description 2
- 150000003013 phosphoric acid derivatives Chemical class 0.000 claims description 2
- 239000002336 ribonucleotide Substances 0.000 claims description 2
- 150000008163 sugars Chemical class 0.000 claims description 2
- KOSAUBCZMVBPHK-UHFFFAOYSA-N sulfanyloxybenzene Chemical class SOC1=CC=CC=C1 KOSAUBCZMVBPHK-UHFFFAOYSA-N 0.000 claims description 2
- 150000003457 sulfones Chemical class 0.000 claims description 2
- 150000003467 sulfuric acid derivatives Chemical class 0.000 claims description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 claims 4
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 claims 4
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 claims 2
- 229930024421 Adenine Natural products 0.000 claims 2
- 229960000643 adenine Drugs 0.000 claims 2
- 229940104302 cytosine Drugs 0.000 claims 2
- 239000005547 deoxyribonucleotide Substances 0.000 claims 2
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 claims 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 claims 1
- 102220468944 Protein unc-13 homolog A_E33K_mutation Human genes 0.000 claims 1
- RWQNBRDOKXIBIV-UHFFFAOYSA-N Thymine Natural products CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 claims 1
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Natural products O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 claims 1
- 125000000218 acetic acid group Chemical group C(C)(=O)* 0.000 claims 1
- 229910052760 oxygen Inorganic materials 0.000 claims 1
- 239000001301 oxygen Substances 0.000 claims 1
- 102200139519 rs104893652 Human genes 0.000 claims 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 claims 1
- 125000004632 tetrahydrothiopyranyl group Chemical group S1C(CCCC1)* 0.000 claims 1
- 229940113082 thymine Drugs 0.000 claims 1
- 229940035893 uracil Drugs 0.000 claims 1
- 238000000034 method Methods 0.000 abstract description 19
- 102000003832 Nucleotidyltransferases Human genes 0.000 abstract 1
- 108090000119 Nucleotidyltransferases Proteins 0.000 abstract 1
- 239000000203 mixture Substances 0.000 description 39
- 230000004048 modification Effects 0.000 description 35
- 238000012986 modification Methods 0.000 description 35
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 33
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 30
- 108091034117 Oligonucleotide Proteins 0.000 description 28
- 229940088598 enzyme Drugs 0.000 description 26
- 238000010348 incorporation Methods 0.000 description 24
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 23
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 23
- 239000000243 solution Substances 0.000 description 22
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 21
- 230000002829 reductive effect Effects 0.000 description 21
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 20
- 235000001014 amino acid Nutrition 0.000 description 20
- 239000011541 reaction mixture Substances 0.000 description 19
- 238000006467 substitution reaction Methods 0.000 description 16
- 125000003275 alpha amino acid group Chemical group 0.000 description 13
- 108091033319 polynucleotide Proteins 0.000 description 13
- 102000040430 polynucleotide Human genes 0.000 description 13
- 239000002157 polynucleotide Substances 0.000 description 13
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 12
- WFDIJRYMOXRFFG-UHFFFAOYSA-N Acetic anhydride Chemical compound CC(=O)OC(C)=O WFDIJRYMOXRFFG-UHFFFAOYSA-N 0.000 description 12
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 12
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 12
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 12
- 235000018102 proteins Nutrition 0.000 description 12
- 241000283690 Bos taurus Species 0.000 description 11
- 239000012043 crude product Substances 0.000 description 11
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 10
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 10
- 238000001818 capillary gel electrophoresis Methods 0.000 description 10
- 239000000284 extract Substances 0.000 description 10
- 238000003818 flash chromatography Methods 0.000 description 10
- 239000000758 substrate Substances 0.000 description 10
- 239000000843 powder Substances 0.000 description 9
- 239000002904 solvent Substances 0.000 description 9
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 8
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 8
- 241000143060 Americamysis bahia Species 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 8
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 8
- 239000011734 sodium Substances 0.000 description 8
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 7
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 7
- 239000007787 solid Substances 0.000 description 7
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 6
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 6
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 6
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 6
- 235000011114 ammonium hydroxide Nutrition 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- HGCIXCUEYOPUTN-UHFFFAOYSA-N cyclohexene Chemical compound C1CCC=CC1 HGCIXCUEYOPUTN-UHFFFAOYSA-N 0.000 description 6
- 101150007302 dntt gene Proteins 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 6
- 229920006395 saturated elastomer Polymers 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- WVLBCYQITXONBZ-UHFFFAOYSA-N trimethyl phosphate Chemical compound COP(=O)(OC)OC WVLBCYQITXONBZ-UHFFFAOYSA-N 0.000 description 6
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 230000002255 enzymatic effect Effects 0.000 description 5
- 229920001519 homopolymer Polymers 0.000 description 5
- 230000001404 mediated effect Effects 0.000 description 5
- 239000012044 organic layer Substances 0.000 description 5
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 5
- 238000004007 reversed phase HPLC Methods 0.000 description 5
- 229940104230 thymidine Drugs 0.000 description 5
- 235000011178 triphosphate Nutrition 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 4
- 229920005654 Sephadex Polymers 0.000 description 4
- 239000012507 Sephadex™ Substances 0.000 description 4
- LDDQLRUQCUTJBB-UHFFFAOYSA-N ammonium fluoride Chemical compound [NH4+].[F-] LDDQLRUQCUTJBB-UHFFFAOYSA-N 0.000 description 4
- 238000005571 anion exchange chromatography Methods 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 239000012153 distilled water Substances 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- AFQIYTIJXGTIEY-UHFFFAOYSA-N hydrogen carbonate;triethylazanium Chemical compound OC(O)=O.CCN(CC)CC AFQIYTIJXGTIEY-UHFFFAOYSA-N 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 239000010410 layer Substances 0.000 description 4
- 238000002515 oligonucleotide synthesis Methods 0.000 description 4
- 239000012071 phase Substances 0.000 description 4
- WRMXOVHLRUVREB-UHFFFAOYSA-N phosphono phosphate;tributylazanium Chemical compound OP(O)(=O)OP([O-])([O-])=O.CCCC[NH+](CCCC)CCCC.CCCC[NH+](CCCC)CCCC WRMXOVHLRUVREB-UHFFFAOYSA-N 0.000 description 4
- 150000008300 phosphoramidites Chemical class 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 230000035484 reaction time Effects 0.000 description 4
- 241000894007 species Species 0.000 description 4
- IMFACGCPASFAPR-UHFFFAOYSA-N tributylamine Chemical compound CCCCN(CCCC)CCCC IMFACGCPASFAPR-UHFFFAOYSA-N 0.000 description 4
- UNXRWKVEANCORM-UHFFFAOYSA-N triphosphoric acid Chemical compound OP(O)(=O)OP(O)(=O)OP(O)(O)=O UNXRWKVEANCORM-UHFFFAOYSA-N 0.000 description 4
- XVZCXCTYGHPNEM-IHRRRGAJSA-N (2s)-1-[(2s)-2-[[(2s)-2-amino-4-methylpentanoyl]amino]-4-methylpentanoyl]pyrrolidine-2-carboxylic acid Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(O)=O XVZCXCTYGHPNEM-IHRRRGAJSA-N 0.000 description 3
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 3
- FUSPCLTUKXQREV-ACZMJKKPSA-N Ala-Glu-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O FUSPCLTUKXQREV-ACZMJKKPSA-N 0.000 description 3
- PUBLUECXJRHTBK-ACZMJKKPSA-N Ala-Glu-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O PUBLUECXJRHTBK-ACZMJKKPSA-N 0.000 description 3
- RGQCNKIDEQJEBT-CQDKDKBSSA-N Ala-Leu-Tyr Chemical compound C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 RGQCNKIDEQJEBT-CQDKDKBSSA-N 0.000 description 3
- 108010011667 Ala-Phe-Ala Proteins 0.000 description 3
- ZBLQIYPCUWZSRZ-QEJZJMRPSA-N Ala-Phe-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@H](C)N)CC1=CC=CC=C1 ZBLQIYPCUWZSRZ-QEJZJMRPSA-N 0.000 description 3
- AAWLEICNDUHIJM-MBLNEYKQSA-N Ala-Thr-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](C)N)O AAWLEICNDUHIJM-MBLNEYKQSA-N 0.000 description 3
- SSQHYGLFYWZWDV-UVBJJODRSA-N Ala-Val-Trp Chemical compound CC(C)[C@H](NC(=O)[C@H](C)N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O SSQHYGLFYWZWDV-UVBJJODRSA-N 0.000 description 3
- YUIGJDNAGKJLDO-JYJNAYRXSA-N Arg-Arg-Tyr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O YUIGJDNAGKJLDO-JYJNAYRXSA-N 0.000 description 3
- RIQBRKVTFBWEDY-RHYQMDGZSA-N Arg-Lys-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O RIQBRKVTFBWEDY-RHYQMDGZSA-N 0.000 description 3
- VVJTWSRNMJNDPN-IUCAKERBSA-N Arg-Met-Gly Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)NCC(O)=O VVJTWSRNMJNDPN-IUCAKERBSA-N 0.000 description 3
- KMFPQTITXUKJOV-DCAQKATOSA-N Arg-Ser-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O KMFPQTITXUKJOV-DCAQKATOSA-N 0.000 description 3
- UVTGNSWSRSCPLP-UHFFFAOYSA-N Arg-Tyr Natural products NC(CCNC(=N)N)C(=O)NC(Cc1ccc(O)cc1)C(=O)O UVTGNSWSRSCPLP-UHFFFAOYSA-N 0.000 description 3
- QTAIIXQCOPUNBQ-QXEWZRGKSA-N Arg-Val-Asp Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O QTAIIXQCOPUNBQ-QXEWZRGKSA-N 0.000 description 3
- VDCIPFYVCICPEC-FXQIFTODSA-N Asn-Arg-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O VDCIPFYVCICPEC-FXQIFTODSA-N 0.000 description 3
- DMLSCRJBWUEALP-LAEOZQHASA-N Asn-Glu-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O DMLSCRJBWUEALP-LAEOZQHASA-N 0.000 description 3
- NUCUBYIUPVYGPP-XIRDDKMYSA-N Asn-Leu-Trp Chemical compound CC(C)C[C@H](NC(=O)[C@@H](N)CC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O NUCUBYIUPVYGPP-XIRDDKMYSA-N 0.000 description 3
- GZXOUBTUAUAVHD-ACZMJKKPSA-N Asn-Ser-Glu Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O GZXOUBTUAUAVHD-ACZMJKKPSA-N 0.000 description 3
- RTFXPCYMDYBZNQ-SRVKXCTJSA-N Asn-Tyr-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O RTFXPCYMDYBZNQ-SRVKXCTJSA-N 0.000 description 3
- NECWUSYTYSIFNC-DLOVCJGASA-N Asp-Ala-Phe Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 NECWUSYTYSIFNC-DLOVCJGASA-N 0.000 description 3
- VBVKSAFJPVXMFJ-CIUDSAMLSA-N Asp-Asn-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)N VBVKSAFJPVXMFJ-CIUDSAMLSA-N 0.000 description 3
- IJHUZMGJRGNXIW-CIUDSAMLSA-N Asp-Glu-Arg Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O IJHUZMGJRGNXIW-CIUDSAMLSA-N 0.000 description 3
- QNMKWNONJGKJJC-NHCYSSNCSA-N Asp-Leu-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O QNMKWNONJGKJJC-NHCYSSNCSA-N 0.000 description 3
- DONWIPDSZZJHHK-HJGDQZAQSA-N Asp-Lys-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)N)O DONWIPDSZZJHHK-HJGDQZAQSA-N 0.000 description 3
- GXHDGYOXPNQCKM-XVSYOHENSA-N Asp-Thr-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](CC(=O)O)N)O GXHDGYOXPNQCKM-XVSYOHENSA-N 0.000 description 3
- NCWOMXABNYEPLY-NRPADANISA-N Glu-Ala-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O NCWOMXABNYEPLY-NRPADANISA-N 0.000 description 3
- CVPXINNKRTZBMO-CIUDSAMLSA-N Glu-Arg-Asn Chemical compound C(C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)O)N)CN=C(N)N CVPXINNKRTZBMO-CIUDSAMLSA-N 0.000 description 3
- OJGLIOXAKGFFDW-SRVKXCTJSA-N Glu-Arg-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCC(=O)O)N OJGLIOXAKGFFDW-SRVKXCTJSA-N 0.000 description 3
- XXCDTYBVGMPIOA-FXQIFTODSA-N Glu-Asp-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O XXCDTYBVGMPIOA-FXQIFTODSA-N 0.000 description 3
- DSPQRJXOIXHOHK-WDSKDSINSA-N Glu-Asp-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O DSPQRJXOIXHOHK-WDSKDSINSA-N 0.000 description 3
- KOSRFJWDECSPRO-WDSKDSINSA-N Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(O)=O KOSRFJWDECSPRO-WDSKDSINSA-N 0.000 description 3
- BUZMZDDKFCSKOT-CIUDSAMLSA-N Glu-Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O BUZMZDDKFCSKOT-CIUDSAMLSA-N 0.000 description 3
- KRGZZKWSBGPLKL-IUCAKERBSA-N Glu-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CCC(=O)O)N KRGZZKWSBGPLKL-IUCAKERBSA-N 0.000 description 3
- HRBYTAIBKPNZKQ-AVGNSLFASA-N Glu-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCC(O)=O HRBYTAIBKPNZKQ-AVGNSLFASA-N 0.000 description 3
- JPUNZXVHHRZMNL-XIRDDKMYSA-N Glu-Pro-Trp Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O JPUNZXVHHRZMNL-XIRDDKMYSA-N 0.000 description 3
- VNCNWQPIQYAMAK-ACZMJKKPSA-N Glu-Ser-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O VNCNWQPIQYAMAK-ACZMJKKPSA-N 0.000 description 3
- JWNZHMSRZXXGTM-XKBZYTNZSA-N Glu-Ser-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O JWNZHMSRZXXGTM-XKBZYTNZSA-N 0.000 description 3
- ZYRXTRTUCAVNBQ-GVXVVHGQSA-N Glu-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N ZYRXTRTUCAVNBQ-GVXVVHGQSA-N 0.000 description 3
- MHHUEAIBJZWDBH-YUMQZZPRSA-N Gly-Asp-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)CN MHHUEAIBJZWDBH-YUMQZZPRSA-N 0.000 description 3
- VAXIVIPMCTYSHI-YUMQZZPRSA-N Gly-His-Asp Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)CN VAXIVIPMCTYSHI-YUMQZZPRSA-N 0.000 description 3
- UHPAZODVFFYEEL-QWRGUYRKSA-N Gly-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)CN UHPAZODVFFYEEL-QWRGUYRKSA-N 0.000 description 3
- LLZXNUUIBOALNY-QWRGUYRKSA-N Gly-Leu-Lys Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCCCN LLZXNUUIBOALNY-QWRGUYRKSA-N 0.000 description 3
- IRJWAYCXIYUHQE-WHFBIAKZSA-N Gly-Ser-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)CN IRJWAYCXIYUHQE-WHFBIAKZSA-N 0.000 description 3
- BAYQNCWLXIDLHX-ONGXEEELSA-N Gly-Val-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)CN BAYQNCWLXIDLHX-ONGXEEELSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 240000000594 Heliconia bihai Species 0.000 description 3
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 3
- 241000880493 Leptailurus serval Species 0.000 description 3
- CQQGCWPXDHTTNF-GUBZILKMSA-N Leu-Ala-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(O)=O CQQGCWPXDHTTNF-GUBZILKMSA-N 0.000 description 3
- ZDSNOSQHMJBRQN-SRVKXCTJSA-N Leu-Asp-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N ZDSNOSQHMJBRQN-SRVKXCTJSA-N 0.000 description 3
- HYIFFZAQXPUEAU-QWRGUYRKSA-N Leu-Gly-Leu Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC(C)C HYIFFZAQXPUEAU-QWRGUYRKSA-N 0.000 description 3
- JRJLGNFWYFSJHB-HOCLYGCPSA-N Leu-Gly-Trp Chemical compound [H]N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O JRJLGNFWYFSJHB-HOCLYGCPSA-N 0.000 description 3
- XVZCXCTYGHPNEM-UHFFFAOYSA-N Leu-Leu-Pro Natural products CC(C)CC(N)C(=O)NC(CC(C)C)C(=O)N1CCCC1C(O)=O XVZCXCTYGHPNEM-UHFFFAOYSA-N 0.000 description 3
- BGZCJDGBBUUBHA-KKUMJFAQSA-N Leu-Lys-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O BGZCJDGBBUUBHA-KKUMJFAQSA-N 0.000 description 3
- SVBJIZVVYJYGLA-DCAQKATOSA-N Leu-Ser-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O SVBJIZVVYJYGLA-DCAQKATOSA-N 0.000 description 3
- YIRIDPUGZKHMHT-ACRUOGEOSA-N Leu-Tyr-Tyr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O YIRIDPUGZKHMHT-ACRUOGEOSA-N 0.000 description 3
- XFIHDSBIPWEYJJ-YUMQZZPRSA-N Lys-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN XFIHDSBIPWEYJJ-YUMQZZPRSA-N 0.000 description 3
- NTSPQIONFJUMJV-AVGNSLFASA-N Lys-Arg-Val Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(O)=O NTSPQIONFJUMJV-AVGNSLFASA-N 0.000 description 3
- AIPHUKOBUXJNKM-KKUMJFAQSA-N Lys-Cys-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O AIPHUKOBUXJNKM-KKUMJFAQSA-N 0.000 description 3
- NVGBPTNZLWRQSY-UWVGGRQHSA-N Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN NVGBPTNZLWRQSY-UWVGGRQHSA-N 0.000 description 3
- KJIXWRWPOCKYLD-IHRRRGAJSA-N Lys-Lys-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)N KJIXWRWPOCKYLD-IHRRRGAJSA-N 0.000 description 3
- RPWTZTBIFGENIA-VOAKCMCISA-N Lys-Thr-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O RPWTZTBIFGENIA-VOAKCMCISA-N 0.000 description 3
- KDBDVESGGJYVEH-PMVMPFDFSA-N Lys-Trp-Phe Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](N)CCCCN)C(O)=O)C1=CC=CC=C1 KDBDVESGGJYVEH-PMVMPFDFSA-N 0.000 description 3
- DSWOTZCVCBEPOU-IUCAKERBSA-N Met-Arg-Gly Chemical compound CSCC[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CCCNC(N)=N DSWOTZCVCBEPOU-IUCAKERBSA-N 0.000 description 3
- WUYLWZRHRLLEGB-AVGNSLFASA-N Met-Met-Leu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(O)=O WUYLWZRHRLLEGB-AVGNSLFASA-N 0.000 description 3
- RDLSEGZJMYGFNS-FXQIFTODSA-N Met-Ser-Asp Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O RDLSEGZJMYGFNS-FXQIFTODSA-N 0.000 description 3
- XMBSYZWANAQXEV-UHFFFAOYSA-N N-alpha-L-glutamyl-L-phenylalanine Natural products OC(=O)CCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XMBSYZWANAQXEV-UHFFFAOYSA-N 0.000 description 3
- YRKFKTQRVBJYLT-CQDKDKBSSA-N Phe-Ala-His Chemical compound C([C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CC=CC=C1 YRKFKTQRVBJYLT-CQDKDKBSSA-N 0.000 description 3
- BBDSZDHUCPSYAC-QEJZJMRPSA-N Phe-Ala-Leu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O BBDSZDHUCPSYAC-QEJZJMRPSA-N 0.000 description 3
- HOYQLNNGMHXZDW-KKUMJFAQSA-N Phe-Glu-Arg Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O HOYQLNNGMHXZDW-KKUMJFAQSA-N 0.000 description 3
- PSKRILMFHNIUAO-JYJNAYRXSA-N Phe-Glu-Lys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N PSKRILMFHNIUAO-JYJNAYRXSA-N 0.000 description 3
- HNFUGJUZJRYUHN-JSGCOSHPSA-N Phe-Gly-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC1=CC=CC=C1 HNFUGJUZJRYUHN-JSGCOSHPSA-N 0.000 description 3
- LRBSWBVUCLLRLU-BZSNNMDCSA-N Phe-Leu-Lys Chemical compound CC(C)C[C@H](NC(=O)[C@@H](N)Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(O)=O LRBSWBVUCLLRLU-BZSNNMDCSA-N 0.000 description 3
- KNYPNEYICHHLQL-ACRUOGEOSA-N Phe-Leu-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 KNYPNEYICHHLQL-ACRUOGEOSA-N 0.000 description 3
- WLYPRKLMRIYGPP-JYJNAYRXSA-N Phe-Lys-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC1=CC=CC=C1 WLYPRKLMRIYGPP-JYJNAYRXSA-N 0.000 description 3
- KLXQWABNAWDRAY-ACRUOGEOSA-N Phe-Lys-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 KLXQWABNAWDRAY-ACRUOGEOSA-N 0.000 description 3
- BPIMVBKDLSBKIJ-FCLVOEFKSA-N Phe-Thr-Phe Chemical compound C([C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 BPIMVBKDLSBKIJ-FCLVOEFKSA-N 0.000 description 3
- MWQXFDIQXIXPMS-UNQGMJICSA-N Phe-Val-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC1=CC=CC=C1)N)O MWQXFDIQXIXPMS-UNQGMJICSA-N 0.000 description 3
- UTAUEDINXUMHLG-FXQIFTODSA-N Pro-Asp-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1 UTAUEDINXUMHLG-FXQIFTODSA-N 0.000 description 3
- NOXSEHJOXCWRHK-DCAQKATOSA-N Pro-Cys-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1 NOXSEHJOXCWRHK-DCAQKATOSA-N 0.000 description 3
- FZXSYIPVAFVYBH-KKUMJFAQSA-N Pro-Tyr-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O FZXSYIPVAFVYBH-KKUMJFAQSA-N 0.000 description 3
- 108010025216 RVF peptide Proteins 0.000 description 3
- RZEQTVHJZCIUBT-WDSKDSINSA-N Ser-Arg Chemical compound OC[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=N RZEQTVHJZCIUBT-WDSKDSINSA-N 0.000 description 3
- IOVBCLGAJJXOHK-SRVKXCTJSA-N Ser-His-His Chemical compound C([C@H](NC(=O)[C@H](CO)N)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CN=CN1 IOVBCLGAJJXOHK-SRVKXCTJSA-N 0.000 description 3
- KCGIREHVWRXNDH-GARJFASQSA-N Ser-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N KCGIREHVWRXNDH-GARJFASQSA-N 0.000 description 3
- FPCGZYMRFFIYIH-CIUDSAMLSA-N Ser-Lys-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O FPCGZYMRFFIYIH-CIUDSAMLSA-N 0.000 description 3
- IFLVBVIYADZIQO-DCAQKATOSA-N Ser-Met-Lys Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N IFLVBVIYADZIQO-DCAQKATOSA-N 0.000 description 3
- XVWDJUROVRQKAE-KKUMJFAQSA-N Ser-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)CC1=CC=CC=C1 XVWDJUROVRQKAE-KKUMJFAQSA-N 0.000 description 3
- HAYADTTXNZFUDM-IHRRRGAJSA-N Ser-Tyr-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(O)=O HAYADTTXNZFUDM-IHRRRGAJSA-N 0.000 description 3
- SHOMROOOQBDGRL-JHEQGTHGSA-N Thr-Glu-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O SHOMROOOQBDGRL-JHEQGTHGSA-N 0.000 description 3
- IMDMLDSVUSMAEJ-HJGDQZAQSA-N Thr-Leu-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O IMDMLDSVUSMAEJ-HJGDQZAQSA-N 0.000 description 3
- NCXVJIQMWSGRHY-KXNHARMFSA-N Thr-Leu-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N)O NCXVJIQMWSGRHY-KXNHARMFSA-N 0.000 description 3
- BDYBHQWMHYDRKJ-UNQGMJICSA-N Thr-Phe-Met Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCSC)C(=O)O)N)O BDYBHQWMHYDRKJ-UNQGMJICSA-N 0.000 description 3
- XHWCDRUPDNSDAZ-XKBZYTNZSA-N Thr-Ser-Glu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N)O XHWCDRUPDNSDAZ-XKBZYTNZSA-N 0.000 description 3
- VUXIQSUQQYNLJP-XAVMHZPKSA-N Thr-Ser-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@@H]1C(=O)O)N)O VUXIQSUQQYNLJP-XAVMHZPKSA-N 0.000 description 3
- MYNYCUXMIIWUNW-IEGACIPQSA-N Thr-Trp-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CCCCN)C(=O)O)N)O MYNYCUXMIIWUNW-IEGACIPQSA-N 0.000 description 3
- QJBWZNTWJSZUOY-UWJYBYFXSA-N Tyr-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N QJBWZNTWJSZUOY-UWJYBYFXSA-N 0.000 description 3
- HKYTWJOWZTWBQB-AVGNSLFASA-N Tyr-Glu-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 HKYTWJOWZTWBQB-AVGNSLFASA-N 0.000 description 3
- HHSILIQTHXABKM-YDHLFZDLSA-N Val-Asp-Phe Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(O)=O HHSILIQTHXABKM-YDHLFZDLSA-N 0.000 description 3
- YODDULVCGFQRFZ-ZKWXMUAHSA-N Val-Asp-Ser Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O YODDULVCGFQRFZ-ZKWXMUAHSA-N 0.000 description 3
- OVLIFGQSBSNGHY-KKHAAJSZSA-N Val-Asp-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C(C)C)N)O OVLIFGQSBSNGHY-KKHAAJSZSA-N 0.000 description 3
- FEXILLGKGGTLRI-NHCYSSNCSA-N Val-Leu-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](C(C)C)N FEXILLGKGGTLRI-NHCYSSNCSA-N 0.000 description 3
- AEMPCGRFEZTWIF-IHRRRGAJSA-N Val-Leu-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(O)=O AEMPCGRFEZTWIF-IHRRRGAJSA-N 0.000 description 3
- SJLVYVZBFDTRCG-DCAQKATOSA-N Val-Lys-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)O)N SJLVYVZBFDTRCG-DCAQKATOSA-N 0.000 description 3
- IJGPOONOTBNTFS-GVXVVHGQSA-N Val-Lys-Glu Chemical compound [H]N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O IJGPOONOTBNTFS-GVXVVHGQSA-N 0.000 description 3
- IOETTZIEIBVWBZ-GUBZILKMSA-N Val-Met-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CS)C(=O)O)N IOETTZIEIBVWBZ-GUBZILKMSA-N 0.000 description 3
- JQTYTBPCSOAZHI-FXQIFTODSA-N Val-Ser-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N JQTYTBPCSOAZHI-FXQIFTODSA-N 0.000 description 3
- MNSSBIHFEUUXNW-RCWTZXSCSA-N Val-Thr-Arg Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N MNSSBIHFEUUXNW-RCWTZXSCSA-N 0.000 description 3
- 108010005233 alanylglutamic acid Proteins 0.000 description 3
- 108010011559 alanylphenylalanine Proteins 0.000 description 3
- 108010069926 arginyl-glycyl-serine Proteins 0.000 description 3
- 108010092854 aspartyllysine Proteins 0.000 description 3
- 108010068265 aspartyltyrosine Proteins 0.000 description 3
- 230000003197 catalytic effect Effects 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 108010060199 cysteinylproline Proteins 0.000 description 3
- RGWHQCVHVJXOKC-SHYZEUOFSA-N dCTP Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO[P@](O)(=O)O[P@](O)(=O)OP(O)(O)=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-N 0.000 description 3
- NHVNXKFIZYSCEB-XLPZGREQSA-N dTTP Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)C1 NHVNXKFIZYSCEB-XLPZGREQSA-N 0.000 description 3
- UAOMVDZJSHZZME-UHFFFAOYSA-N diisopropylamine Chemical compound CC(C)NC(C)C UAOMVDZJSHZZME-UHFFFAOYSA-N 0.000 description 3
- 238000009826 distribution Methods 0.000 description 3
- 108010042598 glutamyl-aspartyl-glycine Proteins 0.000 description 3
- 108010057083 glutamyl-aspartyl-leucine Proteins 0.000 description 3
- 108010049041 glutamylalanine Proteins 0.000 description 3
- 108010082286 glycyl-seryl-alanine Proteins 0.000 description 3
- 108010050848 glycylleucine Proteins 0.000 description 3
- 108010040030 histidinoalanine Proteins 0.000 description 3
- 108010028295 histidylhistidine Proteins 0.000 description 3
- 108010092114 histidylphenylalanine Proteins 0.000 description 3
- 238000000126 in silico method Methods 0.000 description 3
- 108010034529 leucyl-lysine Proteins 0.000 description 3
- 108010057821 leucylproline Proteins 0.000 description 3
- 108010003700 lysyl aspartic acid Proteins 0.000 description 3
- 108010057952 lysyl-phenylalanyl-lysine Proteins 0.000 description 3
- 108010054155 lysyllysine Proteins 0.000 description 3
- 108010017391 lysylvaline Proteins 0.000 description 3
- 239000002777 nucleoside Substances 0.000 description 3
- 150000003833 nucleoside derivatives Chemical class 0.000 description 3
- 108010018625 phenylalanylarginine Proteins 0.000 description 3
- 108010012581 phenylalanylglutamate Proteins 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 238000006116 polymerization reaction Methods 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 239000007858 starting material Substances 0.000 description 3
- 108010079202 tyrosyl-alanyl-cysteine Proteins 0.000 description 3
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- XCIGOVDXZULBBV-DCAQKATOSA-N Ala-Val-Lys Chemical compound CC(C)[C@H](NC(=O)[C@H](C)N)C(=O)N[C@@H](CCCCN)C(O)=O XCIGOVDXZULBBV-DCAQKATOSA-N 0.000 description 2
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- 239000006142 Luria-Bertani Agar Substances 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- KDLHZDBZIXYQEI-UHFFFAOYSA-N Palladium Chemical compound [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 2
- 108091028733 RNTP Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 2
- 108700005078 Synthetic Genes Proteins 0.000 description 2
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 2
- 102000004357 Transferases Human genes 0.000 description 2
- 108090000992 Transferases Proteins 0.000 description 2
- 239000011543 agarose gel Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 239000000908 ammonium hydroxide Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 239000012267 brine Substances 0.000 description 2
- 244000309466 calf Species 0.000 description 2
- FPPNZSSZRUTDAP-UWFZAAFLSA-N carbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(O)=O)C1=CC=CC=C1 FPPNZSSZRUTDAP-UWFZAAFLSA-N 0.000 description 2
- 229960003669 carbenicillin Drugs 0.000 description 2
- 238000005094 computer simulation Methods 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- HAAZLUGHYHWQIW-KVQBGUIXSA-N dGTP Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 HAAZLUGHYHWQIW-KVQBGUIXSA-N 0.000 description 2
- 238000006872 enzymatic polymerization reaction Methods 0.000 description 2
- 238000001917 fluorescence detection Methods 0.000 description 2
- 238000009396 hybridization Methods 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 229910021645 metal ion Inorganic materials 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 239000012299 nitrogen atmosphere Substances 0.000 description 2
- 238000001668 nucleic acid synthesis Methods 0.000 description 2
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 2
- XHXFXVLFKHQFAL-UHFFFAOYSA-N phosphoryl trichloride Chemical compound ClP(Cl)(Cl)=O XHXFXVLFKHQFAL-UHFFFAOYSA-N 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 239000012047 saturated solution Substances 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 239000002002 slurry Substances 0.000 description 2
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 2
- 229910052938 sodium sulfate Inorganic materials 0.000 description 2
- 235000011152 sodium sulphate Nutrition 0.000 description 2
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- 239000002699 waste material Substances 0.000 description 2
- GHYOCDFICYLMRF-UTIIJYGPSA-N (2S,3R)-N-[(2S)-3-(cyclopenten-1-yl)-1-[(2R)-2-methyloxiran-2-yl]-1-oxopropan-2-yl]-3-hydroxy-3-(4-methoxyphenyl)-2-[[(2S)-2-[(2-morpholin-4-ylacetyl)amino]propanoyl]amino]propanamide Chemical compound C1(=CCCC1)C[C@@H](C(=O)[C@@]1(OC1)C)NC([C@H]([C@@H](C1=CC=C(C=C1)OC)O)NC([C@H](C)NC(CN1CCOCC1)=O)=O)=O GHYOCDFICYLMRF-UTIIJYGPSA-N 0.000 description 1
- QFLWZFQWSBQYPS-AWRAUJHKSA-N (3S)-3-[[(2S)-2-[[(2S)-2-[5-[(3aS,6aR)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-4-[1-bis(4-chlorophenoxy)phosphorylbutylamino]-4-oxobutanoic acid Chemical compound CCCC(NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)CCCCC1SC[C@@H]2NC(=O)N[C@H]12)C(C)C)P(=O)(Oc1ccc(Cl)cc1)Oc1ccc(Cl)cc1 QFLWZFQWSBQYPS-AWRAUJHKSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- UNILWMWFPHPYOR-KXEYIPSPSA-M 1-[6-[2-[3-[3-[3-[2-[2-[3-[[2-[2-[[(2r)-1-[[2-[[(2r)-1-[3-[2-[2-[3-[[2-(2-amino-2-oxoethoxy)acetyl]amino]propoxy]ethoxy]ethoxy]propylamino]-3-hydroxy-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-[(2r)-2,3-di(hexadecanoyloxy)propyl]sulfanyl-1-oxopropan-2-yl Chemical compound O=C1C(SCCC(=O)NCCCOCCOCCOCCCNC(=O)COCC(=O)N[C@@H](CSC[C@@H](COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NCC(=O)N[C@H](CO)C(=O)NCCCOCCOCCOCCCNC(=O)COCC(N)=O)CC(=O)N1CCNC(=O)CCCCCN\1C2=CC=C(S([O-])(=O)=O)C=C2CC/1=C/C=C/C=C/C1=[N+](CC)C2=CC=C(S([O-])(=O)=O)C=C2C1 UNILWMWFPHPYOR-KXEYIPSPSA-M 0.000 description 1
- CKTSBUTUHBMZGZ-SHYZEUOFSA-N 2'‐deoxycytidine Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 CKTSBUTUHBMZGZ-SHYZEUOFSA-N 0.000 description 1
- ASJSAQIRZKANQN-CRCLSJGQSA-N 2-deoxy-D-ribose Chemical compound OC[C@@H](O)[C@@H](O)CC=O ASJSAQIRZKANQN-CRCLSJGQSA-N 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 1
- 239000001879 Curdlan Substances 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- CKTSBUTUHBMZGZ-UHFFFAOYSA-N Deoxycytidine Natural products O=C1N=C(N)C=CN1C1OC(CO)C(O)C1 CKTSBUTUHBMZGZ-UHFFFAOYSA-N 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- ZRALSGWEFCBTJO-UHFFFAOYSA-N Guanidine Chemical group NC(N)=N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 1
- CSTNMMIHMYJGFR-IHRRRGAJSA-N His-His-Arg Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)C1=CN=CN1 CSTNMMIHMYJGFR-IHRRRGAJSA-N 0.000 description 1
- AKAPKBNIVNPIPO-KKUMJFAQSA-N His-His-Lys Chemical compound C([C@@H](C(=O)N[C@@H](CCCCN)C(O)=O)NC(=O)[C@@H](N)CC=1NC=NC=1)C1=CN=CN1 AKAPKBNIVNPIPO-KKUMJFAQSA-N 0.000 description 1
- 108010009595 Inorganic Pyrophosphatase Proteins 0.000 description 1
- 102100027050 Inorganic pyrophosphatase Human genes 0.000 description 1
- ZVXSESPJMKNIQA-YXMSTPNBSA-N Lys-Thr-Pro-Pro Chemical compound NCCCC[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 ZVXSESPJMKNIQA-YXMSTPNBSA-N 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- ZSXGLVDWWRXATF-UHFFFAOYSA-N N,N-dimethylformamide dimethyl acetal Chemical compound COC(OC)N(C)C ZSXGLVDWWRXATF-UHFFFAOYSA-N 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- TXPUNZXZDVJUJQ-LPEHRKFASA-N Pro-Asn-Pro Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CC(=O)N)C(=O)N2CCC[C@@H]2C(=O)O TXPUNZXZDVJUJQ-LPEHRKFASA-N 0.000 description 1
- CGSOWZUPLOKYOR-AVGNSLFASA-N Pro-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 CGSOWZUPLOKYOR-AVGNSLFASA-N 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 229910006024 SO2Cl2 Inorganic materials 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- JPIDMRXXNMIVKY-VZFHVOOUSA-N Ser-Ala-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O JPIDMRXXNMIVKY-VZFHVOOUSA-N 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 1
- DCLBXIWHLVEPMQ-JRQIVUDYSA-N Thr-Asp-Tyr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 DCLBXIWHLVEPMQ-JRQIVUDYSA-N 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- WPGBCELIUCBRKN-UHFFFAOYSA-L [hydroxy(oxido)phosphoryl] hydrogen phosphate;tetrabutylazanium Chemical compound OP(O)(=O)OP([O-])([O-])=O.CCCC[N+](CCCC)(CCCC)CCCC.CCCC[N+](CCCC)(CCCC)CCCC WPGBCELIUCBRKN-UHFFFAOYSA-L 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- UYJXRRSPUVSSMN-UHFFFAOYSA-P ammonium sulfide Chemical compound [NH4+].[NH4+].[S-2] UYJXRRSPUVSSMN-UHFFFAOYSA-P 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 229910052786 argon Inorganic materials 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- JAMFGQBENKSWOF-UHFFFAOYSA-N bromo(methoxy)methane Chemical compound COCBr JAMFGQBENKSWOF-UHFFFAOYSA-N 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 239000002894 chemical waste Substances 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 229940125904 compound 1 Drugs 0.000 description 1
- 229940125773 compound 10 Drugs 0.000 description 1
- 229940125797 compound 12 Drugs 0.000 description 1
- 229940125782 compound 2 Drugs 0.000 description 1
- 229940126214 compound 3 Drugs 0.000 description 1
- 229940125898 compound 5 Drugs 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 238000004163 cytometry Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000011033 desalting Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 229940043279 diisopropylamine Drugs 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 230000009881 electrostatic interaction Effects 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- DNJIEGIFACGWOD-UHFFFAOYSA-N ethyl mercaptane Natural products CCS DNJIEGIFACGWOD-UHFFFAOYSA-N 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 108010081551 glycylphenylalanine Proteins 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000000383 hazardous chemical Substances 0.000 description 1
- 230000003301 hydrolyzing effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- ZLVXBBHTMQJRSX-VMGNSXQWSA-N jdtic Chemical compound C1([C@]2(C)CCN(C[C@@H]2C)C[C@H](C(C)C)NC(=O)[C@@H]2NCC3=CC(O)=CC=C3C2)=CC=CC(O)=C1 ZLVXBBHTMQJRSX-VMGNSXQWSA-N 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- NCGWKCHAJOUDHQ-UHFFFAOYSA-N n,n-diethylethanamine;formic acid Chemical compound OC=O.OC=O.CCN(CC)CC NCGWKCHAJOUDHQ-UHFFFAOYSA-N 0.000 description 1
- XNBKKRFABABBPM-UHFFFAOYSA-N n,n-diphenylcarbamoyl chloride Chemical compound C=1C=CC=CC=1N(C(=O)Cl)C1=CC=CC=C1 XNBKKRFABABBPM-UHFFFAOYSA-N 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 230000005257 nucleotidylation Effects 0.000 description 1
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 1
- 239000010815 organic waste Substances 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- 229910052763 palladium Inorganic materials 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 239000013545 self-assembled monolayer Substances 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 238000007086 side reaction Methods 0.000 description 1
- 238000004513 sizing Methods 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 238000010530 solution phase reaction Methods 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 239000012536 storage buffer Substances 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- YBBRCQOCSYXUOC-UHFFFAOYSA-N sulfuryl dichloride Chemical compound ClS(Cl)(=O)=O YBBRCQOCSYXUOC-UHFFFAOYSA-N 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- YLQBMQCUIZJEEH-UHFFFAOYSA-N tetrahydrofuran Natural products C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 1
- 108010033670 threonyl-aspartyl-tyrosine Proteins 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 230000036962 time dependent Effects 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 1
- 239000003039 volatile agent Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1241—Nucleotidyltransferases (2.7.7)
- C12N9/1264—DNA nucleotidylexotransferase (2.7.7.31), i.e. terminal nucleotidyl transferase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P19/00—Preparation of compounds containing saccharide radicals
- C12P19/26—Preparation of nitrogen-containing carbohydrates
- C12P19/28—N-glycosides
- C12P19/30—Nucleotides
- C12P19/34—Polynucleotides, e.g. nucleic acids, oligoribonucleotides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6806—Preparing nucleic acids for analysis, e.g. for polymerase chain reaction [PCR] assay
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/07—Nucleotidyltransferases (2.7.7)
- C12Y207/07031—DNA nucleotidylexotransferase (2.7.7.31), i.e. terminal deoxynucleotidyl transferase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
Abstract
The invention includes methods for identifying polymerases, such as modified terminal nucleotidyl transferases (TdT), that are capable of binding nucleotides comprising removable 3'- O-blocking moieties to a nucleic acid initiator, without the use of a template. The invention further includes the identified polymerases, and methods of using the polymerases for
Description
MODIFIED TEMPLATE-INDEPENDENT ENZYMES FOR
POLYDEOXYNUCLEOTIDE SYNTHESIS
RELATED APPLICATIONS
This Application claims priority to and the benefit of U.S. Application Ser. No. 16/891,449, filed June 3, 2020, the content of which is incorporated by reference herein.
FIELD OF THE INVENTION
The invention relates to modified enzymes for de novo synthesis of polynucleotides with a desired sequence, and without the use of a template. As such, the invention provides the capability to make libraries of polynucleotides of varying sequence and varying length for research, genetic engineering, and gene therapy.
BACKGROUND
Most de novo nucleic acid sequences are synthesized using solid phase phosphoramidite- techniques developed more than 30 years ago. The technique involves the sequential de protection and synthesis of sequences built from phosphoramidite reagents corresponding to natural (or non-natural) nucleic acid bases. Phosphoramidite nucleic acid synthesis is length- limited, however, in that nucleic acids greater than 200 base pairs (bp) in length experience high rates of breakage and side reactions. Additionally, phosphoramidite synthesis produces toxic by products, and the disposal of this waste limits the availability of nucleic acid synthesizers, and increases the costs of contract oligo production. (It is estimated that the annual demand for oligonucleotide synthesis is responsible for greater than 300,000 gallons of hazardous chemical waste, including acetonitrile, trichloroacetic acid, toluene, tetrahydrofuran, and pyridine. See LeProust et al., Nucleic Acids Res., vol. 38(8), p.2522-2540, (2010), incorporated by reference herein in its entirety). Thus, there is a need for more efficient and cost-effective methods for oligonucleotide synthesis.
SUMMARY
The invention discloses modified terminal deoxynucleotidyl transferase (TdT) enzymes that can be used for de novo synthesis of oligonucleotides in the absence of a template.
Methods for creating a template-independent polymerase through a combination of computational guidance and saturation mutagenesis, with a subsequent screen to identify functional mutants, are also disclosed. Native TdT enzymes are either inefficient or completely unable to incorporate the different blocked nucleotide analogs used in template-independent synthesis schemes. The present invention provides various TdT modifications that expand the enzyme’s functionality with respect to blocked nucleotide analogs, especially those with 3'-0 blocking groups. In particular, modified TdTs of the invention can be used to incorporate 3'-0- Phosphate-blocked nucleotide analogs where wild type TdTs may be unable to do so.
Methods of the invention include nucleic acid synthesis using 3'-0-blocked nucleotide analogs and Shrimp Alkaline Phosphatase (SAP) for controlled addition of selected nucleotides.
Using enzymes and methods of the invention, it will be possible to synthesize de novo polynucleotides faster and more cheaply. As such, the invention dramatically reduces the overall cost of synthesizing custom nucleic acids. In particular, the methods can be used to create template-independent transferases that can synthesize custom oligos in a stepwise fashion using modified 3' hydroxyl-blocked nucleotides. Because of the terminating group, synthesis pauses with the addition of each new base, whereupon the terminating group is cleaved, leaving a polynucleotide that is essentially identical to a naturally occurring nucleotide (i.e., is recognized by the enzyme as a substrate for further nucleotide incorporation).
The methods and enzymes of the invention represent an important step forward in synthetic biology because the enzymes will allow for aqueous phase, template-independent oligonucleotide synthesis. Such methods represent an improvement over the prior art in that they will greatly reduce the chemical waste produced during oligonucleotide synthesis while allowing for the production of longer polynucleotides. Furthermore, because the methods replace a chemical process with a biological one, costs will be reduced, and the complexity of automated synthetic systems will also be reduced. In an embodiment, a simple five-reagent delivery system can be used to build oligonucleotides in a stepwise fashion and will enable recycling of unused reagents.
BRIEF DESCRIPTION OF THE DRAWINGS FIG. 1 shows an agarose gel of a solution phase polymerization reaction composed of terminal deoxynucleotidyl transferase (TdT), deoxyadenosine triphosphate (dATP) and fluorescent strand initiator 5’-Cy5-dA10 at different time points from Tjong et al. “Amplified on-
chip fluorescence detection of DNA hybridization by surface-initiated enzymatic polymerization,” Anal. Chem., 2011; 83:5153-5159 (2011).
FIG. 2 illustrates an exemplary modified terminal deoxynucleotidyl transferase (TdT) mediated polynucleotide synthesis cycle using a support bound initiator and 3’-0-blocked nucleotide triphosphate including (A) incorporation of a nucleotide analog comprising a cleavable 3'-0-blocking group (indicated by R), and (B) removal of the 3’-0-blocking group thus enabling the next 3’-0-blocked nucleotide analog to be incorporated, wherein N=A, G, C, or T.
FIG. 3 shows the polyacrylamide gel analysis of a solution phase reaction time course of commercially-available TDT and a nucleic acid initiator with 3'-0-azidomethyl-dCTP or 3'-0- azidomethyl-dATP. Lane 1 - 100 bp ladder size standard, Lane 2 - oligonucleotide standard, Lane 3 - 3’-0-azidomethyl-dCTP + TdT 15’ reaction time, Lane 4 - 1 hour, Lane 5 - 2 hours, Lane 6 - 4 hours, Lane 7 - 24 hours, Lane 8 - 3’-0-azidomethyl-dATP + TdT 15’ reaction time, Lane 9 - 1 hour, Lane 10 - 2 hours, Lane 10 - 4 hours, Lane 11 - 24 hours, Lane 12 - dATP +
TdT 15’ reaction time, Lane 13 - 1 hour, Lane 14 - 4 hours, Lane 15 - 24 hours.
FIG. 4 shows a computer-generated image of the active site of TdT using the PDB crystal structure 4129, showing the computationally docked catalytically productive position a 3'-0— dATP analog (blue, red, orange frame), each complexed to the two active-site metal ions (large greenspheres). Shown are the residues, that are in close proximity to the incoming dNTP and the targets of mutagenesis and screening.
FIG. 5 shows a table of TdT variants that were selected for increased incorporation of selected 3'-0-blocked dNTP analogs as described herein.
FIG. 6 shows exemplary 3'-0-azidomethyl deoxynucleotides that can be used to synthesize custom DNA oligomers using modified TdTs, as described herein.
FIG. 7 shows a synthetic scheme for producing 3'-0-azidomethyl deoxyadenosine triphosphate (3'-0-azidomethyl-dATP).
FIG. 8 shows a synthetic scheme for producing 3'-0-azidomethyl deoxythymidine triphosphate (3'-0-azidomethyl-dTTP).
FIG. 9 shows a synthetic scheme for producing 3'-0-azidomethyl deoxycytidine triphosphate (3'-0-azidomethyl-dCTP).
FIG. 10 shows a synthetic scheme for producing 3'-0-azidomethyl deoxyguanosine triphosphate (3'-0-azidomethyl-dGTP).
FIG. 11 shows a synthetic scheme for producing 3’-0-methoxymethyl deoxythymidine
triphosphate (3'-0-M0M-dTTP).
FIG. 12 shows a synthetic scheme for producing 3’-0-thiomethyl deoxycytidine triphosphate (3'-0-MTM-dCTP).
FIG. 13 shows CGE (Capillary Gel Electrophoresis) traces showing migration of chemically synthesized authentic standard of A) 5’-FAM-TAATAATAATAATAATTTTT compared to chemically synthesized authentic standard of B) 5’-FAM- T A AT A AT A AT A AT A ATTTTTT-P04-3 ’ .
FIG. 14 shows CGE traces showing the removal of 3’-P04 by treatment with Shrimp Alkaline Phosphatase. A) Chemically synthesized 5’-TAATAATAATAATAATTTTT-P04-3’ prior to treatment with Shrimp Alkaline Phosphatase and chemically synthesized 5’- T A AT A AT A AT A AT A ATTTTT -P04- 3 ’ after treatment with B) 4.1 x 10-4 U/ul, C) 1.23 x 10- 3 U/ul, D) 3.7 x 10-3 U/ul, E) 1.1 x 10-2, F) 3.33 x 10-2 U/ul, G) 1.0 x 10-1 U/ul of Shrimp Alkaline Phosphatase for 1 minute at 37°C.
FIG. 15 shows CGE traces comparing: A) 5 ’ -FAM-T A AT A AT A AT A AT A ATTTTT after treatment with murine WT TdT and no dNTP; B) 5’-FAM-
T A AT A AT A AT A AT A ATTTTT after treatment with murine WT TdT and 500 uM 3’-P04- dTTP for 60 minutes at 37oC; C) 5’-FAM-TAATAATAATAATAATTTTT after treatment with murine WT TdT and 500 uM 3’-P04-dTTP for 60 minutes at 37oC, followed by treatment with 0.2 units of Shrimp Alkaline Phosphatase for 15 minutes at 37oC.
FIG. 16 shows CGE traces comparing A) 5 ’ -FAM-TAAT AAT AATAAT AATTTTT -3 ’ after treatment with murine WT TdT and no dNTP for 60 minutes at 37oC; B) 5’-FAM- T AAT AAT AAT AAT AATTTTT after treatment with murine TdT E180K + M192K + L381K + R454K + N474R and 500 uM 3’-P04-dTTP for 60 minutes at 37oC; C) 5’-FAM- TAATAATAATAATAATTTTT-3’ after treatment with murine WT TdT and 500 uM 3’-P04- dTTP for 60 minutes at 37oC, followed by treatment with 0.2 units of Shrimp Alkaline Phosphatase for 15 minutes at 37oC; D) Homopolymer dT extension ladder created by treatment of 5 ’-FAM-T AAT AATAAT AAT AATTTTT-3’ with murine WT TdT and dTTP.
DESCRIPTION OF THE INVENTION
The invention facilitates the synthesis of polynucleotides, such as DNA, by providing modified enzymes that can be used with nucleic acid analogs. Using the disclosed methods, a modified template-independent terminal deoxynucleotidyl transferase (TdT) is obtained that
allows the enzymatically mediated synthesis of de novo oligodeoxynucleotides, thereby enabling their use in routine assembly for gene synthesis. The enzymes of the invention lend themselves to aqueous-based, enzyme-mediated methods of synthesizing polynucleotides of a predetermined sequence on a solid support.
The modified enzymes of the invention will allow 3’-0-blocked dNTP analogs to be used in a step-by-step method to extend an initiating nucleic acid into a user defined sequence (see Figure 2). Furthermore, after each nucleotide extension step, the reactants can be recovered and recycled from the solid support back to the original reagent reservoir. Once that step is complete, the 3 ’-O-blocking group will be removed, allowing the cycle to start anew. At the conclusion of n cycles of extension-recover-deblock-wash, the full length, single strand polydeoxynucleotide will be cleaved from the solid support and isolated for subsequent use. A variety of 3'-0-blocked deoxynucleotides, may be used, but the choice of specific 3'-0-blocking groups is dictated by: 1) the smallest possible bulk to maximize substrate utilization by TdT and 2) removal of the blocking group with the mildest and preferably aqueous conditions in the shortest period of time.
Cost savings by this approach will be achieved by exploiting the higher yield of final oligonucleotide product at a lower starting scale than currently being used as the existing industry standard (i.e., less than 1 nanomole). Future adaptation of this enzymatic approach to array based formats will allow even further and more dramatic reductions in the cost of synthesis of long oligonucleotides achievable by highly parallel synthesis. Furthermore, the enzymatic synthesis process that we propose uses only aqueous based chemistries like buffers and salts, thus greatly reducing the environmental burden of the organic waste generated by the existing phosphoramidite method.
The methods of the invention may be used to modify terminal deoxynucleotidyl transferases (TdT), however other enzymes could be modified with similar methods. TdT is likely to be a successful starting enzyme because it is capable of 3'- extension activity using single strand initiating primers in a template-independent polymerization. However, prior to the invention described herein, there have been no reports of 3'-0-blocked nucleotides being incorporated into single- stranded oligonucleotide by an enzyme in the absence of a template. In fact, as Chang and Bollum reported, substitution of the 3'-hydroxyl group results in complete inactivity of available transferase enzymes. See Chang and Bollum, “Molecular Biology of Terminal Transferase, CRC Critical Reviews in Biochemistry, vol. 21 (1), p. 27-52 (1986),
incorporated herein by reference in its entirety. Nonetheless, when TdT is used with natural dNTPs (i.e., not 3'-0-blocked), and without a template, oligonucleotide extension continues without stopping. Such uncontrolled incorporation is evidenced by the time-dependent gel electrophoresis images shown in FIG. 1. FIG. 1 shows an agarose gel of a solution phase polymerization reaction composed of terminal deoxynucleotidyl transferase (TdT), deoxyadenosine triphosphate (dATP) and fluorescent strand initiator 5’-Cy5-dA10 at different time points. (Adapted with permission from Tjong et al. “Amplified on-chip fluorescence detection of DNA hybridization by surface-initiated enzymatic polymerization,” Anal. Chem., 2011; 83:5153-5159 (2011), incorporated by reference herein in its entirety.) Additionally, TdT can extend primers in a near quantitative manner resulting in the addition of thousands of nucleotides, while TdT is likely to accept a wide variety of modified and substituted dNTPs as efficient substrates. Furthermore, a substantial library of mechanistic and structural information regarding TdT already exists. See Delame et ah, EMBQ J. 2002;21(3):427-39; Gouge et al., J Mol Biol. 2013 Nov 15;425(22):4334-52 and Romain et al., Nucleic Acids Res. 2009;37(14):4642-56, both of which are incorporated by reference in their entireties.
It is known that TdT can use substrates having modifications and/or substitutions at the deoxyribose sugar ring as well as the purine/pyrimidine nucleobases. For example, TdT accepts bulky modifications at the C5 of pyrimidines and the C7 of purines. See Sorensen et al., “Enzymatic Ligation of Large Biomolecules to DNA,” ACS Nano 2013, 7(9):8098-104; Figeys et al., Anal. Chem. 1994, 66(23):4382-3; Li et al., Cytometry, 1995, 20(2): 172-80, all of which are incorporated by reference in their entireties. In some instances, TdT can even accept non nucleotide triphosphates. See Barone et al., Nucleotides and Nucleic Acids 2001, 20(4-7): 1141- 5, and Alexandrova et al., Bioconjug Chem., 2007, 18(3):886-93, both of which are incorporated by reference in their entireties. However, there is little evidence in the prior art that TdT can accept 3'-0-blocked nucleotides. See, for example, Knapp et al., Chem. Eur. J., 2011, 17:2903, incorporated herein by reference in its entirety. While the lack of activity of TdT was not a focus
of Knapp et al., the authors reported that they tested their 3 ’-OH modified analog with TdT, and saw no incorporation of this relatively small 3 ’-OH modification into an oligonucleotide.
Native TdT is a very efficient enzyme. It has been demonstrated that TdT can polymerize extremely long homopoly deoxynucleotides of 1000 to 10,000 nucleotides in length (see Hoard et al., J of Biol Chem, 1969244(19):5363-73; Bollum, The Enzymes, Volume 10, New York: Academic Press; 1974. p. 141-71; Tjong et al., Anal Chem, 2011, 83:5153-59, all of which are incorporated by reference in their entireties). Random sequence oligomers consisting of all four nucleotides have also been polymerized by TdT, however there are no reports of ordered polynucleotides being synthesized in the absence of a template. See Damiani, et al., Nucleic Acids Res, 1982, 10(20):6401-10, incorporated by reference herein in its entirety. Support-bound synthesis of polynucleotides by TdT is additionally supported by reports of homopolymer synthesis of 150 bps initiators covalently attached to self-assembled monolayers on gold surfaces. See Chow et al., J Am Chem Soc 2005; 127:14122-3, and Chow and Chilikoti, Langmuir 2007, 23:11712-7, both of which are incorporated by reference in their entireties. These authors also observed preference by TdT of dATP>dTTP»dGTP~dCTP for incorporation of homopolymers. In a more recent report, Tjong et al. demonstrated the TdT mediated synthesis of long (>1 Kb) homopolymer ssDNA from initiator primers immobilized on glass surfaces.
The distributive behavior of TdT is reinforced by Figure 3, which shows a time course of a solution phase synthesis of 1-1.5 kb homopolymers. After each addition of an unmodified (natural) dNTP, the enzyme dissociates, thus allowing the random extension of any strand in the population. The distribution of product lengths in such a system should follow a Poisson distribution, as reported by Bollum and co-workers in 1974. If TdT were used with a terminating nucleotide species, i.e., one with the 3’-0-position blocked, the reaction should proceed to completion, resulting not in a distribution of product lengths, but essentially a pure product of a single nucleotide addition.
Nonetheless, as described above, nucleotide synthesis with 3'-0-blocked dNTPs does not proceed with commercially-available TdT proteins. This fact is reinforced by FIG. 3, which shows a gel shift assay used to monitor the solution phase incorporation kinetics of 3'-0- azidomethyl dATP and 3'-0-azidomethyl dCTP using a commercially-available, recombinant TdT. The data in FIG. 3 clearly show that neither 3'-0-modified dNTP analog is a substrate for
TdT, i.e., there is no polynucleotide extension when compared to reactions containing dATP as a positive control (lanes 12 thru 15). FIG. 3, thus, adds further evidence that commercially- available TdTs are not able to synthesize oligomers by incorporating dNTPs with modified 3'-
OHs.
With suitable modifications, a variety of different 3'-0-blocked dNTP analogs will be suitable for the controlled addition of nucleotides by TdT. Modified 3'-0-blocked dNTP analogs include, but are not limited to, the 3'-0-allyl, 3'-0-azidomethyl, 3'-0-NH2, 3'-0-CH2N3, 3'-0- 0NHC(0)H, 3'-0-CH2SSCH3, and 3'-0-CH2CN blocking groups. Overall, the choice of the 3'- O-blocking group will be dictated by: 1) the smallest possible bulk to maximize substrate utilization by TdT, which is likely to affect kinetic uptake, and 2) the blocking group with the mildest removal conditions, preferably aqueous, and in the shortest period of time. 3'-0- blocking groups that are the suitable for use with this invention are described in WO 2003/048387; WO 2004/018497; WO 1996/023807; WO 2008/037568; Hutter D, et al. Nucleosides Nucleotides Nucleic Acids, 2010, 29(11): 879-95; and Knapp et al., Chem. Eur. J., 2011, 17:2903, all of which are incorporated by reference in their entireties.
A computational model of the active site of murine TdT was created to understand the structural basis for the lack of utilization of 3'-0-blocked dNTPs by TdT. Additionally, the computer model made it possible to “fit” various modified dNTPs into the active site. Figure 4 shows the docking of a -dATP (shown in blue, red, magenta, orange) with murine TdT (see SEQ ID NO. 9, below) using the PDB crystal structure 4129 and AutoDock 4.2 (Molecular Graphics Laboratory, Scripps Research Institute, La Jolla, CA).
The phosphate portions of the dATPs (orange) are in complex with the catalytic metal ions (green) while the alpha phosphate is positioned to be attacked by the 3'-OH of the bound oligonucleotide . The model shown in FIG. 4 indicates the choice of amino acid residues likely to interfere with the formation of a catalytically productive complex when a 3’-0-blocked dNTP is present. Other residues that may interact with the closest residues, like Glu 180 or Met 192, are also targets of modification. Amino acid numbering and positions are provided with reference to the murine TdT of SEQ ID NO. 9 but the referenced amino acid modifications are applicable to any TdT having similar sequence including the GGFRR or TGSR motifs.
AutoDock’ s predicted binding mode suggests that modification to the 3'-OH will change the electrostatic interactions between two residues, Arg336 and Arg454. Although Arg336 is near the reaction center in the active site, Arg 336 is highly conserved, and early studies found
that replacement of Arg336 with Gly or Ala reduced dNTP activity by 10-fold (Yang B et al. J. Mol. Biol. 1994; 269(16): 11859-68). Accordingly, one motif for modification is the GGFRR motif including Arg 336 in the above structural model.
Additionally, it is thought that Gly452 and Ser453 exist in a cis-peptide bond conformation (see Delarue et al., EMBQ J., 2002; 21(3):427- 39, incorporated herein by reference in its entirety) and that the guanidinium group of Arg336 assists in the stabilization of this conformation. The stability provided by Arg336 may help explain why substitutions at this position have a negative impact on the reactivity of modified TdT proteins. In some instances, the instability created by modifying position 336 may be overcome by using proline residues to stabilize cis-peptide bond conformation. However, if Arg336 is substituted, e.g., with alanine or glycine, the entire TGSR motif (positions 451, 452, 435, 454) may also have to be modified to compensate for this change. For example, the TGSR motif may be modified to TPSR or TGPR. Accordingly, the TGSR motif, including Gly452 in the above structural model was targeted for modification.
On the other hand, sequence analysis of the TdT family demonstrates a wide range of amino acids that can be accommodated at position 454. This analysis suggests structural flexibility at position 454, and surrounding residues. In another embodiment, substitutions at Arg454 to accommodate the steric bulk of a 3'- O-blocking group may require additional modifications to the al4 region to compensate for substitutions of glycine or alanine at Arg454. In other embodiments, substitutions to other residues in the all region may be required to compensate for substitution to Arg336 either instead of, or in addition to, modification of the TGSR motif.
While modification to Arg336 and Arg454 may change the binding interactions of 3'-0- modified dNTPs, it may also be necessary to explore substitutions that would result in improved steric interactions of 3'-0-modified dNTPs with TdT. In order to test computationally predicted enzyme variants that show increased substrate utilization of 3’-0-blocked dNTPs, synthetic genes specifying specific amino acid substitutions were generated in appropriate plasmid vectors and introduced into cells. After expression and isolation, protein variants were screened for activity by a polymerase incorporation assay with selected 3’-0-blocked dNTP analogs. FIG. 5 shows the results of the screening of various synthetically generated murine TdT variants. In some embodiments, single amino acid changes are important while in other, combinations of one & two amino acids also produce increased incorporation of 3’-0-blocked dNTPs.
Interactions with residues such as Gly332, Gly333, Gly452, Thr451, Trp450, Ser453, and Q455
of murine TdT are important. Each of these residues is within 0.6nm of the 3'-OH of a typical dNTP. These residues are also potential targets for substitution to allow the extra steric bulk of a 3’-blocking group like 3'-0-azidomethyl or 3'-0-aminoxy. Residues that are within 1.2 nm of the 3'-OH such as Glu457, Ala510, Asp509, Arg508, Lysl99, Serl96, Metl92, Glul80 or Leul61 may also potentially interfere with the substrate utilization of a 3'-0-blocked dNTP and are thus targets for substitution in addition to or in combination with Arg336 and Arg454. Additional residues of interest include Arg461 and Asn474.
While the TGSR and GGFRR motifs are highlighted here, modifications to the flanking amino acids such as Thr331, Gly337, Lys338, Gly341, or His342 are also contemplated for providing (alone or in combination) increased incorporation of 3’-0-blocked dNTPs as discussed herein. Various in silico modeled TdT modifications capable of increased incorporation are discussed in Example 2 below.
In addition to amino acid substitutions at positions 500- 510 it may be necessary to delete residues to remove interference with a 3 ’-O-blocking group. Since these amino acids are located near the C-terminus of the protein, and exist in a relatively unstructured region, they may be deleted singly or altogether, either instead of or in combination with the modifications described above. In certain embodiments, insertion of residues into the modified TdT. For example, insertions of residues in the GGFRR or TGSR motifs or flanking regions can allow an increased rate of incorporation of 3'-0-blocked dNTP by the modified TdT. TdT modifications can include insertion of a Tyrosine residue between the Phe334 and Arg335 residues (or substitutions thereof) of the GGFRR motif.
Modified TdT’s of the invention include those described in FIG. 5. Modified TdT’s may include one or more of a modification to Glul80 including E180F, E180R, E180D, or E180K. Contemplated modifications to Met 192 include, for example, M192E, M192W, M192K, or M192R. Contemplated modifications to Gln455 include, for example, Q455I. Contemplated modifications to Trp450 include, for example, W450H. Contemplated modifications to ARG454 include, for example, R454I, R454K, R454A, or R454T. Contemplated modifications to Arg461 include, for example, R461V and modifications to Asn474 may include N474R. In various embodiments combinations of two or more modified residues may be used such as, for example, E180D+W450H, E180K+R454A, M192K+E180K, E180K+R454I, E180D+M192E,
E 180D+M 192E+R454T, or E180K+W450H.
As shown below, most TdTs include the GGFRR and TGSR motifs. In the following sequences, the GGFRR and TGSR motifs have been bolded and underlined for easy reference.
Native calf thymus TdT is a candidate for alteration of the primary structure to achieve a suitable template-independent polymerase. However, a variety of other proteins may be explored to identify a candidate suitable for the use with 3'-0-blocked dNTP analogs, including human and murine TdT. The amino acid sequence corresponding to native calf TdT is listed in Table 1 as SEQ ID NO. 1, while the nucleic acid sequence is listed in Table 2 as SEQ ID NO. 2. In some embodiments, the resulting protein, adapted for sequence- specific de novo polynucleotide synthesis with 3'-0-modified dNTPs and NTPs, will be at least 85% identical, i.e., at least 90% identical, i.e., at least 93% identical, i.e., at least 95% identical, i.e., at least 97% identical, i.e., at least 98% identical, i.e., at least 99% identical, with SEQ ID NO. 1. Furthermore, it may be possible to truncate portions of the amino acid sequence of bovine TdT and still maintain catalytic activity.
Table 1. Amino Acid Sequence of Bovine TdT
SEQ ID NO. 1: (520 aa)
MAQQRQHQRL PMDPLCTASS GPRKKRPRQV GASMASPPHD IKFQNLVLFI LEKKMGTTRR NFLMELARRK GFRVENELSD SVTHIVAENN SGSEVLEWLQ VQNIRASSQL ELLDVSWLIE SMGAGKPVEI TGKHQLVVRT DYSATPNPGF QKTPPLAVKK ISQYACQRKT TLNNYNHIFT DAFEILAENS EFKENEVSYV TFMRA AS VLK SLPFTIISMK DTEGIPCLGD KVKCIIEEII EDGESSEVKA VLNDERYQSF KLFTSVFGVG LKTSEKWFRM GFRSLSKIMS DKTLKFTKMQ KAGFLYYEDL VSCVTRAEAE AVGVLVKEAV WAFLPDAFVT MTGGFRRGKK IGHDVDFLIT SPGSAEDEEQ LLPKVINLWE KKGLLLYYDL VESTFEKFKL PSRQVDTLDH FQKCFLILKL HHQRVDSSKS NQQEGKTWKA IRVDLVMCPY ENRAFALLGW TGSRQFERDI RRY ATHERKM MLDNHALYDK TKRVFLKAES EEEIFAHLGL DYIEPWERNA
Table 2. Nucleic Acid Sequence of Bovine TdT
SEQ ID NO. 2: (1923 nt) ctcttctgga gataccactt gatggcacag cagaggcagc atcagcgtct tcccatggat ccgctgtgca cagcctcctc aggccctcgg aagaagagac ccaggcaggt gggtgcctca atggcctccc ctcctcatga catcaagttt caaaatttgg tcctcttcat tttggagaag aaaatgggaa ccacccgcag aaacttcctc atggagctgg ctcgaaggaa aggtttcagg gttgaaaatg agctcagtga ttctgtcacc cacattgtag cagaaaacaa ctctggttca gaggttctcg agtggcttca
ggtacagaac ataagagcca gctcgcagct agaactcctt gatgtctcct ggctgatcga aagtatggga gcaggaaaac cagtggagat tacaggaaaa caccagcttg ttgtgagaac agactattca gctaccccaa acccaggctt ccagaagact ccaccacttg ctgtaaaaaa gatctcccag tacgcgtgtc aaagaaaaac cactttgaac aactataacc acatattcac ggatgccttt gagatactgg ctgaaaattc tgagtttaaa gaaaatgaag tctcttatgt gacatttatg agagcagctt ctgtacttaa atctctgcca ttcacaatca tcagtatgaa ggatacagaa ggaattccct gcctggggga caaggtgaag tgtatcatag aggaaattat tgaagatgga gaaagttctg aagttaaagc tgtgttaaat gatgaacgat atcagtcctt caaactcttt acttctgttt ttggagtggg actgaagaca tctgagaaat ggttcaggat ggggttcaga tctctgagta aaataatgtc agacaaaacc ctgaaattca caaaaatgca gaaagcagga tttctctatt atgaagacct tgtcagctgc gtgaccaggg ccgaagcaga ggcggttggc gtgctggtta aagaggctgt gtgggcattt ctgccggatg cctttgtcac catgacagga ggattccgca ggggtaagaa gattgggcat gatgtagatt ttttaattac cagcccagga tcagcagagg atgaagagca acttttgcct aaagtgataa acttatggga aaaaaaggga ttacttttat attatgacct tgtggagtca acatttgaaa agttcaagtt gccaagcagg caggtggata ctttagatca ttttcaaaaa tgctttctga ttttaaaatt gcaccatcag agagtagaca gtagcaagtc caaccagcag gaaggaaaga cctggaaggc catccgtgtg gacctggtta tgtgccccta cgagaaccgt gcctttgccc tgctaggctg gactggctcc cggcagtttg agagagacat ccggcgctat gccacacacg agcggaagat gatgctggat aaccacgctt tatatgacaa gaccaagagg gtatttctca aagcggaaag tgaagaagaa atctttgcac atctgggatt ggactacatt gaaccatggg aaagaaatgc ttaggagaaa gctgtcaact tttttctttt ctgttctttt tttcaggtta gacaaattat gcttcatatt ataatgaaag atgccttagt caagtttggg attctttaca ttttaccaag atgtagattg cttctagaaa taagtagttt tggaaacgtg atcaggcacc ccctgggtta tgctctggca agccatttgc aggactgatg tgtagaactc gcaatgcatt ttccatagaa acagtgttgg aattggtggc tcatttccag ggaagttcat caaagcccac tttgcccaca gtgtagctga aatactgtat acttgccaat aaaaatagga aac
Additionally, to make isolation of recombinant proteins easier, it is common to append an N-terminal His tag sequence to the recombinant protein (see Boule J-B et al., Molecular Biotechnology, 1998;10:199-208, incorporated by reference herein in its entirety), which is used in combination with an affinity column (Hitrap, Amersham Pharmacia Biotech, Uppsala, Sweden). Alternatively, N-terminal truncated forms of the enzyme with appended His-tag sequence will work with the current invention (see, e.g., US 7,494,797, incorporated by reference herein in its entirety). His-tagged Bovine TdT amino acid sequences are shown below in Tables 3, 5, and 7, while His-tagged Bovine TdT nucleic acid sequences are shown below in Tables 4, 6, and 8. His tags may be engineered at other positions as required. In some embodiments, the resulting protein, adapted for sequence-specific de novo polynucleotide synthesis with 3'-0- modified dNTPs and NTPs, will be at least 85% identical, i.e., at least 90% identical, i.e., at least 93% identical, i.e., at least 95% identical, i.e., at least 97% identical, i.e., at least 98% identical, i.e., at least 99% identical, with SEQ ID NOS. 3, 5, or 7.
Table 3. Amino Acid Sequence of a A138 and His-tagged Bovine TdT.
SEQ ID No. 3: (392 aa)
Met Arg Gly Ser His His His His His His Arg Thr Asp Tyr Ser Ala Thr Pro Asn Pro Gly Phe Gin Lys Thr Pro Pro Leu Ala Val Lys Lys lie Ser Gin Tyr Ala Cys Gin Arg Lys Thr Thr Leu Asn Asn Tyr Asn His he Asp Ala Phe Glu he Leu Ala Glu Asn Ser Glu Phe Lys Glu Asn Glu Val Ser Tyr Val Thr Phe Met Arg Ala Ala Ser Val Leu Lys Ser Leu Pro Phe Thr lie He Ser Met Lys Asp Thr Phe Thr Glu Gly lie Pro Cys Leu Gly Asp Lys Val Lys Cys He He Glu Glu He He Glu Asp Gly Glu Ser Ser Glu Val Lys Ala Val Leu Asn Asp Glu Arg Tyr Gin Ser Phe Lys Leu Ser Val Phe Gly Val Gly Leu Lys Thr Ser Glu Lys Trp Phe Arg Met Gly Phe Thr Phe Arg Ser Leu Ser Lys He Met Ser Asp Lys Thr Leu Lys Lys Met Gin Lys Ala Gly Phe Leu Tyr Tyr Glu Asp Leu Val Ser Cys Val Thr Arg Ala Glu Ala Glu Ala Val Gly Val Leu Val Lys Glu Ala Val Trp Ala Phe Leu Pro Asp Ala Phe Val Thr Met Thr Glv Glv Phe Arg Arg Glv Lys Lys He Gly His Asp Val Asp Phe Leu He Thr Ser Pro Gly Ser Ala Glu Asp Glu Glu Gin Leu Leu Pro Lys Val He Asn Leu Trp Glu Lys Lys Gly Leu Leu Leu Tyr Tyr Asp Leu Val Glu Ser Thr Phe Glu Lys Phe Lys Phe Thr Leu Pro Ser Arg Gin Val Asp Thr Leu Asp His Phe Gin Lys Cys Phe Leu He Leu Lys Leu His His Gin Arg Val Asp Ser Ser Lys Ser Asn Gin Gin Glu Gly Lys Thr Trp Lys Ala He Arg Val Asp Leu Val Met Cys Pro Tyr Glu Asn Arg Ala Phe Ala Leu Leu Gly Trp Thr Glv Ser Arg Gin Phe Glu Arg Asp He Arg Arg Tyr Ala Thr His Glu Arg Lys Met Met Leu Asp Asn His Ala Leu Tyr Asp Lys Thr Lys Arg Val Phe Leu Lys Ala Glu Ser Glu Glu Glu He Phe Ala His Leu Gly Leu Asp Tyr He Glu Pro Trp Glu Arg Asn Ala
Table 4. Nucleotide Sequence of a A138 and His-tagged Bovine TdT.
SEQ ID No. 4: (1187 nt) atgagaggat cgcatcacca tcaccatcac agaacagact attcagctac cccaaaccca ggcttccaga agactccacc acttgctgta aaaaagatct cccagtacgc gtgtcaaaga aaaaccactt tgaacaacta taaccacata ttcacggatg cctttgagat actggctgaa aattctgagt ttaaagaaaa tgaagtctct tatgtgacat ttatgagagc agcttctgta cttaaatctc tgccattcac aatcatcagt atgaaggata cagaaggaat tccctgcctg ggggacaagg tgaagtgtat catagaggaa attattgaag atggagaaag ttctgaagtt aaagctgtgt taaatgatga acgatatcag tccttcaaac tctttacttc tgtttttgga gtgggactga agacatctga gaaatggttc aggatggggt tcagatctct gagtaaaata atgtcagaca aaaccctgaa attcacaaaa atgcagaaag caggatttct ctattatgaa gaccttgtca gctgcgtgac cagggccgaa gcagaggcgg ttggcgtgct ggttaaagag gctgtgtggg catttctgcc ggatgccttt gtcaccatga caggaggatt ccgcaggggt aagaagattg ggcatgatgt agatttttta attaccagcc caggatcagc agaggatgaa gagcaacttt tgcctaaagt
gataaactta tgggaaaaaa agggattact tttatattat gaccttgtgg agtcaacatt tgaaaagttc aagttgccaa gcaggcaggt ggatacttta gatcattttc aaaaatgctt tctgatttta aaattgcacc atcagagagt agacagtagc aagtccaacc agcaggaagg aaagacctgg aaggccatcc gtgtggacct ggttatgtgc ccctacgaga accgtgcctt tgccctgcta ggctggactg gctcccggca gtttgagaga gacatccggc gctatgccac acacgagcgg aagatgatgc tggataacca cgctttatat gacaagacca agagggtatt tctcaaagcg gaaagtgaag aagaaatctt tgcacatctg ggattggact acattgaacc atgggaaaga aatgcttaag cttgcgc
Table 5: Amino Acid Sequence of a A151 and His-tagged Bovine TdT.
SEQ ID No. 5: (379 aa)
Met Arg Gly Ser His His His His His His Lys Thr Pro Pro Leu Ala Val Lys Lys lie Ser Gin Tyr Ala Cys Gin Arg Lys Thr Thr Leu Asn Asn Tyr Asn His he Asp Ala Phe Glu he Leu Ala Glu Asn Ser Glu Phe Lys Glu Asn Glu Val Ser Tyr Val Thr Phe Met Arg Ala Ala Ser Val Leu Lys Ser Leu Pro Phe Thr he lie Ser Met Lys Asp Thr Phe Thr Glu Gly He Pro Cys Leu Gly Asp Lys Val Lys Cys He He Glu Glu He lie Glu Asp Gly Glu Ser Ser Glu Val Lys Ala Val Leu Asn Asp Glu Arg Tyr Gin Ser Phe Lys Leu Ser Val Phe Gly Val Gly Leu Lys Thr Ser Glu Lys Trp Phe Arg Met Gly Phe Thr Phe Arg Ser Leu Ser Lys He Met Ser Asp Lys Thr Leu Lys Lys Met Gin Lys Ala Gly Phe Leu Tyr Tyr Glu Asp Leu Val Ser Cys Val Thr Arg Ala Glu Ala Glu Ala Val Gly Val Leu Val Lys Glu Ala Val Trp Ala Phe Leu Pro Asp Ala Phe Val Thr Met Thr Glv Glv Phe Arg Arg Glv Lys Lys He Gly His Asp Val Asp Phe Leu He Thr Ser Pro Gly Ser Ala Glu Asp Glu Glu Gin Leu Leu Pro Lys Val He Asn Leu Trp Glu Lys Lys Gly Leu Leu Leu Tyr Tyr Asp Leu Val Glu Ser Thr Phe Glu Lys Phe Lys Phe Thr Leu Pro Ser Arg Gin Val Asp Thr Leu Asp His Phe Gin Lys Cys Phe Leu He Leu Lys Leu His His Gin Arg Val Asp Ser Ser Lys Ser Asn Gin Gin Glu Gly Lys Thr Trp Lys Ala He Arg Val Asp Leu Val Met Cys Pro Tyr Glu Asn Arg Ala Phe Ala Leu Leu Gly Trp Thr Glv Ser Arg Gin Phe Glu Arg Asp He Arg Arg Tyr Ala Thr His Glu Arg Lys Met Met Leu Asp Asn His Ala Leu Tyr Asp Lys Thr Lys Arg Val Phe Leu Lys Ala Glu Ser Glu Glu Glu He Phe Ala His Leu Gly Leu Asp Tyr He Glu Pro Trp Glu Arg Asn Ala
Table 6. Nucleotide Sequence of a A151 and His-tagged Bovine TdT.
SEQ ID No. 6: (1148 nt) atgagaggat cgcatcacca tcaccatcac aagactccac cacttgctgt aaaaaagatc tcccagtacg cgtgtcaaag aaaaaccact ttgaacaact ataaccacat attcacggat gcctttgaga tactggctga aaattctgag tttaaagaaa atgaagtctc ttatgtgaca tttatgagag cagcttctgt acttaaatct ctgccattca caatcatcag tatgaaggat acagaaggaa ttccctgcct
gggggacaag gtgaagtgta tcatagagga aattattgaa gatggagaaa gttctgaagt taaagctgtg ttaaatgatg aacgatatca gtccttcaaa ctctttactt ctgtttttgg agtgggactg aagacatctg agaaatggtt caggatgggg ttcagatctc tgagtaaaat aatgtcagac aaaaccctga aattcacaaa aatgcagaaa gcaggatttc tctattatga agaccttgtc agctgcgtga ccagggccga agcagaggcg gttggcgtgc tggttaaaga ggctgtgtgg gcatttctgc cggatgcctt tgtcaccatg acaggaggat tccgcagggg taagaagatt gggcatgatg tagatttttt aattaccagc ccaggatcag cagaggatga agagcaactt ttgcctaaag tgataaactt atgggaaaaa aagggattac ttttatatta tgaccttgtg gagtcaacat ttgaaaagtt caagttgcca agcaggcagg tggatacttt agatcatttt caaaaatgct ttctgatttt aaaattgcac catcagagag tagacagtag caagtccaac cagcaggaag gaaagacctg gaaggccatc cgtgtggacc tggttatgtg cccctacgag aaccgtgcct ttgccctgct aggctggact ggctcccggc agtttgagag agacatccgg cgctatgcca cacacgagcg gaagatgatg ctggataacc acgctttata tgacaagacc aagagggtat ttctcaaagc ggaaagtgaa gaagaaatct ttgcacatct gggattggac tacattgaac catgggaaag aaatgcttaa gcttgcgc
Table 7. Amino Acid Sequence of a A160 and His-tagged Bovine TdT.
SEQ ID No. 7: (370 aa)
Met Arg Gly Ser His His His His His His lie Ser Gin Tyr Ala Cys Gin Arg Lys Thr Thr Leu Asn Asn Tyr Asn His lie Asp Ala Phe Glu lie Leu Ala Glu Asn Ser Glu Phe Lys Glu Asn Glu Val Ser Tyr Val Thr Phe Met Arg Ala Ala Ser Val Leu Lys Ser Leu Pro Phe Thr He He Ser Met Lys Asp Thr Phe Thr Glu Gly He Pro Cys Leu Gly Asp Lys Val Lys Cys He lie Glu Glu He He Glu Asp Gly Glu Ser Ser Glu Val Lys Ala Val Leu Asn Asp Glu Arg Tyr Gin Ser Phe Lys Leu Ser Val Phe Gly Val Gly Leu Lys Thr Ser Glu Lys Trp Phe Arg Met Gly Phe Thr Phe Arg Ser Leu Ser Lys He Met Ser Asp Lys Thr Leu Lys Lys Met Gin Lys Ala Gly Phe Leu Tyr Tyr Glu Asp Leu Val Ser Cys Val Thr Arg Ala Glu Ala Glu Ala Val Gly Val Leu Val Lys Glu Ala Val Trp Ala Phe Leu Pro Asp Ala Phe Val Thr Met Thr Glv Glv Phe Arg Arg Glv Lys Lys He Gly His Asp Val Asp Phe Leu He Thr Ser Pro Gly Ser Ala Glu Asp Glu Glu Gin Leu Leu Pro Lys Val He Asn Leu Trp Glu Lys Lys Gly Leu Leu Leu Tyr Tyr Asp Leu Val Glu Ser Thr Phe Glu Lys Phe Lys Phe Thr Leu Pro Ser Arg Gin Val Asp Thr Leu Asp His Phe Gin Lys Cys Phe Leu He Leu Lys Leu His His Gin Arg Val Asp Ser Ser Lys Ser Asn Gin Gin Glu Gly Lys Thr Trp Lys Ala He Arg Val Asp Leu Val Met Cys Pro Tyr Glu Asn Arg Ala Phe Ala Leu Leu Gly Trp Thr Glv Ser Arg Gin Phe Glu Arg Asp He Arg Arg Tyr Ala Thr His Glu Arg Lys Met Met Leu Asp Asn His Ala Leu Tyr Asp Lys Thr Lys Arg Val Phe Leu Lys Ala Glu Ser Glu Glu Glu He Phe Ala His Leu Gly Leu Asp Tyr He Glu Pro Trp Glu Arg Asn Ala
Table 8. Nucleotide Sequence of a A160 and His-tagged Bovine TdT.
SEQ ID No. 8: (1121 nt) atgagaggat cgcatcacca tcaccatcac atctcccagt acgcgtgtca aagaaaaacc actttgaaca actataacca catattcacg gatgcctttg agatactggc tgaaaattct gagtttaaag aaaatgaagt ctcttatgtg acatttatga gagcagcttc tgtacttaaa tctctgccat tcacaatcat cagtatgaag gatacagaag gaattccctg cctgggggac aaggtgaagt gtatcataga ggaaattatt gaagatggag aaagttctga agttaaagct gtgttaaatg atgaacgata tcagtccttc aaactcttta cttctgtttt tggagtggga ctgaagacat ctgagaaatg gttcaggatg gggttcagat ctctgagtaa aataatgtca gacaaaaccc tgaaattcac aaaaatgcag aaagcaggat ttctctatta tgaagacctt gtcagctgcg tgaccagggc cgaagcagag gcggttggcg tgctggttaa agaggctgtg tgggcatttc tgccggatgc ctttgtcacc atgacaggag gattccgcag gggtaagaag attgggcatg atgtagattt tttaattacc agcccaggat cagcagagga tgaagagcaa cttttgccta aagtgataaa cttatgggaa aaaaagggat tacttttata ttatgacctt gtggagtcaa catttgaaaa gttcaagttg ccaagcaggc aggtggatac tttagatcat tttcaaaaat gctttctgat tttaaaattg caccatcaga gagtagacag tagcaagtcc aaccagcagg aaggaaagac ctggaaggcc atccgtgtgg acctggttat gtgcccctac gagaaccgtg cctttgccct gctaggctgg actggctccc ggcagtttga gagagacatc cggcgctatg ccacacacga gcggaagatg atgctggata accacgcttt atatgacaag accaagaggg tatttctcaa agcggaaagt gaagaagaaa tctttgcaca tctgggattg gactacattg aaccatggga aagaaatgct taagcttgcg c
Table 9. Amino Acid Sequence of murine TdT
SEQ ID NO. 9: (510 aa)
MDPLQAVHLG PRKKRPRQLG TPVASTPYDI RFRDLVLFIL EKKMGTTRRA FFMEFARRKG FRVENEFSDS VTHIVAENNS GSDVFEWFQF QNIKASSEFE FFDISWFIEC MGAGKPVEMM GRHQFVVNRN SSPSPVPGSQ NVPAPAVKKI SQYACQRRTT FNNYNQFFTD AFDIFAENDE FRENEGSCFA FMRASSVFKS FPFPITSMKD TEGIPCFGDK VKSIIEGIIE DGESSEAKAV FNDERYKSFK FFTSVFGVGF KTAEKWFRMG FRTFSKIQSD KSFRFTQMQK AGFFYYEDFV SCVNRPEAEA V S MFVKE A V V TFFPDAFVTM TCCFRRGKMT GHDVDFFITS PEATEDEEQQ FFHKVTDFWK QQGFFFYCDI FESTFEKFKQ PSRKVDAFDH FQKCFFIFKF DHGRVHSEKS GQQEGKGWKA IRVDFVMCPY DRRAFAFFGW TGSRQFERDL RRY ATHERKM MFDNHAFYDR TKRVFFEAES EEEIFAHFGF DYIEPWERNA
In certain embodiments, modified enzymes of the invention may include an N-terminus truncation relative to their respective native TdT enzyme. For example, in preferred embodiments, the native enzyme may be murine TdT as provided in SEQ ID NO. 9 above. The modified TdT may be truncated at the equivalent of position 147 or 131 of the native murine TdT as shown in
SEQ ID Nos. 10 and 11 respectively. Modified TdTs may include a protein tag sequence such as a His tag and additional linkers at their N-terminus as illustrated in SEQ ID Nos. 10 and 11. The His- tag portion if underlined in each of the sequences and the linker is provided in bold.
SEQ ID No. 10: Murine del- 147 with His-tag and linker
MRGSHHHHHHGMASMTGGOOMGRDLYDDDDKDRWGSELEKKISOYACORRTTLNNY
NQLFTDALDILAENDELRENEGSCLAFMRASSVLKSLPFPITSMKDTEGIPCLGDKVKSIIEG
IIEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQM
QKAGFLY YEDL V S C VNRPE AE A V S ML VKE A V VTFLPD AL VTMT GGFRRGKMTGHD VDF
LITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVDALDHFQKCFLIL
KLDHGRVHSEKSGQQEGKGWKAIRVDLVMCPYDRRAFALLGWTGSRQFERDLRRYATH
ERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA
SEQ ID No. 11: Murine del- 131 with His-tag and linker
MRGS HHHHHHGM AS MT GGOOMGRENL YFOGS PS P VPGS ON VP AP A VKKIS O Y AC ORRT
TLNNYNQLFTDALDILAENDELRENEGSCLAFMRASSVLKSLPFPITSMKDTEGIPCLGDKV
KS IIEGIIEDGES S E AK A VLNDERYKS FKLFT S VF G V GLKT AEKWFRMGFRTLS KIQS DKS L
RFTQMQKAGFLYYEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTG
HDVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVDALDHFQ
KCFLILKLDHGRVHSEKSGQQEGKGWKAIRVDLVMCPYDRRAFALLGWTGSRQFERDLR
RYATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA
Additional TdT modifications that may increase incorporation efficiency of 3'-0-blocked or other nucleotide analogs are listed in Table 10 below. While the modifications are described with referenced to the murine TdT listed in SEQ ID NO. 9, such the invention contemplates such modifications applied to the equivalent amino acids in any TdT including the truncated enzymes disclosed in SEQ ID Nos. 10 and 11 above with or without the His-tags and linkers. In various embodiments, contemplated modifications include deletion of the S420 through E424 amino acids. Various combinations of amino acid substitutions of the invention are listed in each row 1-175 of Table 10.
Table 10
A variety of 3'-0-modified dNTPs and NTPs may be used with the disclosed proteins for de novo synthesis. In some embodiments, the preferred removable 3'-0-blocking group is a 3'- O-amino, a 3'-0-allyl or a 3'-0-azidomethyl. In other embodiments, the removable 3'-0- blocking moiety is selected from the group consisting of O-phenoxyacetyl; O-methoxyacetyl; O- acetyl; 0-(p-toluene )-sulfonate; O-phosphate; O-nitrate; 0-[4-methoxy ]-tetrahydrothiopyranyl; O-tetrahydrothiopyranyl; 0-[5-methyl]-tetrahydrofuranyl; O- [2-methyl, 4-methoxy]- tetrahydropyranyl; 0-[5-methyl]-tetrahydropyranyl; and O-tetrahydrothiofuranyl (see US 8,133,669). In other embodiments the removable blocking moiety is selected from the group consisting of esters, ethers, carbonitriles, phosphates, carbonates, carbamates, hydroxylamine, borates, nitrates, sugars, phosphoramide, phosphoramidates, phenylsulfenates, sulfates, sulfones and amino acids (see Metzker ML et al. Nuc Acids Res. 1994;22(20):4259-67, U.S.P.N. 5,763,594, 6,232,465, 7,414,116; and 7,279,563, all of which are incorporated by reference in their entireties).
Synthesis of exemplary 3’ -O-blocked dNTP analogs
FIG. 6 shows four exemplary 3'-0-blocked dNTP analogs, namely 3'-0-azidomethyl- dATP, 3'-0-azidomethyl-dCTP, 3'-0-azidomethyl-dGTP, and 3'-0-azidomethyl-dTTP. The synthesis of each 3'-0-azidomethyl analog is described below and detailed in FIGS. 7-12. The 3'-0-blocked dNTP analogs can also be purchased from specialty suppliers, such as Azco Biotech, Oceanside, CA. It is to be understood that corresponding 3'-0-blocked ribonucleotides can be formed with similar synthetic methods to enable the creation of custom RNA oligos.
3'-0-azidomethyl-dATP: With reference to FIG. 7, a solution of N^-benzoyl-5'-0-(tert- butyldimethylsilyl)-2'-deoxyadenosine (3.0 g; 6.38 mmol) [CNH Technologies, Woburn, MA] in DMSO (12 ml), acetic acid (5.5 ml) and acetic anhydride (17.6 ml) was prepared. The mixture was stirred at room temperature for 48 h. Approximately 100 ml of a saturated NaHC03 solution was added and the aqueous layer was extracted with CH2C12. The combined organic extract was washed with saturated NaHC03 solution and dried over Na2S04. The residue was purified by flash column chromatography (hexane/ethyl acetate, 1:1 to 1:4) to recover N6-Benzoyl-3'-0- (methylthiomethyl)-5'-0-(tert-butyldimethylsilyl)-2'-deoxyadenosine (shown as compound 1 in FIG. 7) as a white powder (2.4 g; 71% yield). 400 mg of N6-Benzoyl-3'-0-(methylthiomethyl)- 5'-0-(tert-butyldimethylsilyl)-2'-deoxyadenosine was dissolved in dry CH2CI2 (7ml) under nitrogen to create a solution (0.76 mmol). Cyclohexene (400pl), and S02Cl2(155pl; 1.91 mmol, redistilled) were then added. The reaction mixture was stirred at 0°C for 2 h. The solvent was then removed under reduced pressure and then under a high-vacuum pump for 10 min. The resulting residue was dissolved in dry DMF (5 ml) and reacted with NaN3 (400 mg; 6.6 mmol) at room temperature for 3 h. The reaction mixture was dispersed in distilled water (50 ml) and extracted with CH2CI2. The combined organic layer was dried over Na2S04 and concentrated under reduced pressure. The residue was dissolved in MeOH (5 ml) and stirred with NH4F (300 mg; 8.1 mmol) at room temperature for 24 h. The solvent was then removed under reduced pressure. The reaction mixture was concentrated under reduced pressure and partitioned between water and CH2CI2. The organic layer was separated and dried over Na2S04. After concentration, the crude product was purified by flash column chromatography (ethyl acetate/methanol) to produce N6-Benzoyl-3'-0-(azidomethyl)-2'-deoxyadenosine (compound 2; FIG. 7) as a white powder (150 mg; 48% yield). N6-Benzoyl-3'-0-(azidomethyl)-2'-deoxyadenosine (123 mg; 0.3 mmol) and a proton sponge (75.8 mg; 0.35 mmol) were then dried in a vacuum desiccator over P2O5 overnight before dissolving in trimethyl phosphate (600m1). Next freshly distilled POCI3 (40m1; 0.35 mmol) was added dropwise at 0°C and the mixture was stirred at 0°C for 2 h. Subsequently, a mixture of tributylammonium pyrophosphate (552 mg) and tributylamine (0.55 ml; 2.31 mmol) in anhydrous DMF (2.33 ml) was added at room temperature and stirred for 30 min. Triethyl ammonium bicarbonate solution (TEAB) (0.1 M; pH 8.0; 15 ml) was then added, and the mixture was stirred for 1 hour at room temperature. Subsequently, concentrated NH4OH (15 ml) was added and stirred overnight at room temperature. The resulting mixture was concentrated under vacuum and the residue was diluted with 5 ml of water. The crude mixture was then purified with anion exchange chromatography on DEAE-Sephadex A-25 at 4°C using
a gradient of TEAB (pH 8.0; 0.1-1.0 M). The crude product was purified with reverse-phase HPLC to produce 3'-0-azidomethyl-dATP (FIG. 7, compound 3), a nucleotide analog to be used for later synthesis.
3'-0-azidomethyl-dTTP: Acetic acid (4.8 ml) and acetic anhydride (15.4 ml) were added to a stirred solution of 5'-0-(tertbutyldimethylsilyl)thymidine (2.0 g; 5.6 mmol) [CNH Technologies, Woburn, MA] in DMSO. The reaction mixture was stirred at room temperature for 48 h. A saturated NaHCCF solution (100 ml) was added, and the aqueous layer was extracted with ethyl acetate (3x100 ml). The combined organic extract was washed with a saturated solution of NaHCCF and dried over NaiSCF. After concentration, the crude product was purified by flash column chromatography (hexane/ethyl acetate) to produce 3'-0-(Methylthiomethyl)-5'- 0-(tert-butyldimethylsilyl)thymidine (FIG. 8; Compound 4) as a white powder (1.75 g; 75% yield). Approximately 1 gram of 3'-0-(Methylthiomethyl)-5'-0-(tert- butyldimethylsilyl)thymidine was then dissolved in dry CH2CI2 (10 ml) under nitrogen. To this mixture cyclohexene (1.33 ml) and SO2CI2 (284pl; 3.5 mmol, redistilled) were added. The resulting mixture was then stirred at 0°C for 1.5 h. The solvent was then removed under reduced pressure and then under high vacuum for 10 min. The residue was dissolved in dry DMF (5 ml) and reacted with NaN3 (926 mg; 15.4 mmol) at room temperature for 3 h. That reaction mixture was next dispersed in distilled water (50 ml) and extracted with CH2CI2 (3x50 ml). The combined organic extract was dried over Na2S04 and concentrated under reduced pressure. The residue was dissolved in MeOH (5 ml) and reacted with NH4F (600 mg; 16.2 mmol) at room temperature for 24 h. The reaction mixture was concentrated under reduced pressure and partitioned between water and CH2CI2. The organic layer was then separated and dried over Na2S04. After concentration, the residue was purified by flash column chromatography (hexane/ethyl acetate) to produce 3'-0-(azidomethyl)thymidine (FIG. 8, Compound 5) as a white powder (550 mg; 71% yield). Next, the 3'-0-(azidomethyl)thymidine and a proton sponge (0.35 mmol) were dried in a vacuum desiccator over P2O5 overnight before dissolving in trimethyl phosphate (600pl). Next, freshly distilled POCI3 (40m1; 0.35 mmol) was added dropwise at 0°C and the mixture was stirred at 0°C for 2 h. Subsequently, a mixture of tributylammonium pyrophosphate (552 mg) and tributylamine (0.55 ml; 2.31 mmol) in anhydrous DMF (2.33 ml) was added at room temperature and stirred for 30 min. Triethyl ammonium bicarbonate solution (TEAB) (0.1 M; pH 8.0; 15 ml) was then added, and the mixture was stirred for 1 hour at room temperature. Subsequently, concentrated NH4OH (15 ml) was added and stirred overnight at
room temperature. The resulting mixture was concentrated under vacuum and the residue was diluted with 5 ml of water. The crude mixture was then purified with anion exchange chromatography on DEAE-Sephadex A-25 at 4°C using a gradient of TEAB (pH 8.0; 0.1-1.0 M). The crude product was purified with reverse-phase HPLC to produce 3'-0-azidomethyl- dTTP (FIG. 8, compound 6), a nucleotide analog to be used for later synthesis.
3'-0-azidomethyl-dCTP: Three and a half grams of N4-benzoyl-5'-0-(tert- butyldimethylsilyl)-2'-deoxycytidine [CNH Technologies, Woburn, MA] was added to 14.7 ml of DMSO to produce a 7.65 mmol solution. To this solution, acetic acid (6.7 ml) and acetic anhydride (21.6ml) were added, and the reaction mixture was stirred at room temperature for 48 h. A saturated NaHCCE solution (100 ml) was then added and the aqueous layer was extracted with CH2Cl2(3xl00 ml). The combined organic extract was washed with a saturated solution of NaHCCE and then dried over Na2S04. After concentration, the crude product was purified by flash column chromatography (ethyl acetate/hexane) to produce N4-Benzoyl-3'-0- (methylthiomethyl)-5'-0-(tert-butyldimethylsilyl)-2'-deoxycytidine (FIG. 9; compound 7) as a white powder (2.9 g; 73% yield). In 8 ml of CH2CI2 N4-Benzoyl-3'-0-(methylthiomethyl)-5'-0- (tert-butyldimethylsilyl)-2'-deoxycytidine (558 mg; 1.04 mmol) was dissolved and then cyclohexene (560pl) and SO2Cl2(220 mΐ; 2.7 mmol) were added. The reaction mixture was stirred at 0°C for 1 h. The volatiles were then removed with reduced pressure. The remaining residue was dissolved in dry DMF (5 ml) and reacted with NaN3(400 mg; 6.6mmol) at room temperature for 2 h. The reaction mixture was dispersed in distilled water (50 ml) and extracted with CH2Cl2(3x50 ml). The combined organic extract was dried over Na2S04 and concentrated under reduced pressure. The residue was dissolved in MeOH (5 ml) and reacted with NH4F (600 mg; 16.2 mmol) at room temperature for 24 h. The solvent was removed under reduced pressure. The resulting residue was suspended in water (50 ml) and extracted with CH2Cl2(3x50 ml). The combined organic extract was dried over Na2S04 and concentrated under reduced pressure. The crude product was purified by flash column chromatography (hexane/ethyl acetate) to produce
N4-Benzoyl-3'-0-(azidomethyl)-2'-deoxycytidine (FIG. 9, compound 8) as a white powder (200 mg; 50% yield). Next, the N4-Benzoyl-3'-0-(azidomethyl)-2'-deoxycytidine and a proton sponge (0.35 mmol) were dried in a vacuum desiccator over P2O5 overnight before dissolving in trimethyl phosphate (600m1). Then freshly distilled POCI3 (40m1; 0.35 mmol) was added dropwise at 0°C and the mixture was stirred at 0°C for 2 h. Subsequently, a mixture of tributylammonium pyrophosphate (552 mg) and tributylamine (0.55 ml; 2.31 mmol) in
anhydrous DMF (2.33 ml) was added at room temperature and stirred for 30 min. Triethyl ammonium bicarbonate solution (TEAB) (0.1 M; pH 8.0; 15 ml) was then added, and the mixture was stirred for 1 hour at room temperature. Subsequently, concentrated NH4OH (15 ml) was added and stirred overnight at room temperature. The resulting mixture was concentrated under vacuum and the residue was diluted with 5 ml of water. The crude mixture was then purified with anion exchange chromatography on DEAE-Sephadex A-25 at 4°C using a gradient of TEAB (pH 8.0; 0.1-1.0 M). The crude product was purified with reverse-phase HPLC to produce 3'-0-azidomethyl-dCTP (FIG. 9, compound 9), a nucleotide analog to be used for later synthesis.
3'-0-azidomethyl-dGTP: To a stirred solution of N2-isobutyryl-5'-0-(tert- butyldimethylsilyl)-2'-deoxyguanosine (5 g; 11.0 mmol) [CNH Technologies, Woburn, MA] in dry DMSO (21 ml), acetic acid (10 ml) and acetic anhydride (32 ml) were added. The reaction mixture was stirred at room temperature for 48 h. A saturated NaHCCb solution (100 ml) was added and the aqueous layer was extracted with ethyl acetate (3x100 ml). The combined organic extract was washed with a saturated NaHCCb solution and dried over NaiSC . After concentration, the crude product was purified by flash column chromatography (CHiCh/MeOH) to produce N2-Isobutyryl-3'-0-(methylthiomethyl)-5'-0-(tert-butyldimethylsilyl)-2'- deoxyguanosine (FIG. 10, compound 10) as a white powder (3.9 g; 69% yield). One gram of N - Isobutyryl-3'-0-(methylthiomethyl)-5'-0-(tert-butyldimethylsilyl)-2'-deoxyguanosine was subsequently added to dry pyridine (22 ml; 2.0 mmol) along with diphenylcarbamoyl chloride (677 mg; 2.92 mmol) and DIEA (N,N-diisopropylethylamine; SIGMA) (1.02 ml; 5.9 mmol). The reaction mixture was stirred under nitrogen atmosphere at room temperature for 3 h. The solvent was removed under high vacuum. The crude product was purified by flash column chromatography (ethyl acetate/hexane) to produce N2-Isobutyryl-06-(diphenylcarbamoyl)-3'-0- (methylthiomethyl)-5'-0-(tert-butyldimethylsilyl)-2'-deoxyguanosine (FIG. 10, compound 11), which appeared as a yellowish powder (1.09 g; 80% yield). N2-Isobutyryl-06- (diphenylcarbamoyl)-3'-0-(methylthiomethyl)-5'-0-(tert-butyldimethylsilyl)-2'-deoxyguanosine was then dissolved in dry CH2CI2 (1.1 mmol) and stirred under nitrogen atmosphere at 0°C for 1.5 h. The solvent was removed under reduced pressure and then under high vacuum for 10 min. The resulting residue was dissolved in dry DMF (5 ml) and reacted with NaN3 (600 mg; 10 mmol) at room temperature for 3 h. The reaction mixture was then dispersed in distilled water (50 ml) and extracted with CH2Cl2(3x50 ml). The combined organic extract was dried over
Na2S04 and concentrated under reduced pressure. The resultant residue was dissolved in MeOH
(5 ml) and reacted with NH4F (500 mg; 13.5 mmol) at room temperature for 24 h. The solvent was removed under reduced pressure. The residue was suspended in water (50 ml) and extracted with CH2Cl2(3x50 ml). The combined organic extract was dried over Na2S04 and concentrated under reduced pressure. The crude product was purified by flash column chromatography (hexane/ethyl acetate) to produce N2-Isobutyryl-06-(diphenylcarbamoyl)-3'-0-azidomethyl-2'- deoxyguanosine (FIG. 10, compound 12) as a white powder (230 mg; 36% yield). Finally, the N2-Isobutyryl-06-(diphenylcarbamoyl)-3'-0-azidomethyl-2'-deoxyguanosine and a proton sponge (0.35 mmol) were dried in a vacuum desiccator over P2O5 overnight before dissolving in trimethyl phosphate (600pl). Then freshly distilled POCI3 (40m1; 0.35 mmol) was added dropwise at 0°C and the mixture was stirred at 0°C for 2 h. Subsequently, a mixture of tributylammonium pyrophosphate (552 mg) and tributylamine (0.55 ml; 2.31 mmol) in anhydrous DMF (2.33 ml) was added at room temperature and stirred for 30 min. Triethyl ammonium bicarbonate solution (TEAB) (0.1 M; pH 8.0; 15 ml) was then added, and the mixture was stirred for 1 hour at room temperature. Subsequently, concentrated NH4OH (15 ml) was added and stirred overnight at room temperature. The resulting mixture was concentrated under vacuum and the residue was diluted with 5 ml of water. The crude mixture was then purified with anion exchange chromatography on DEAE-Sephadex A-25 at 4°C using a gradient of TEAB (pH 8.0; 0.1-1.0 M). The crude product was purified with reverse-phase HPLC to produce 3'-0-azidomethyl-dGTP (FIG. 10, compound 13), a nucleotide analog to be used for later synthesis.
As described with respect to FIG. 2, once a 3'-0-blocked dNTP or 3'-0-blocked rNTP is added, it will be necessary to remove the blocking group so that additional dNTPs or rNTPs can be added. In some embodiments, the 3'-0-blocking group can be removed with a palladium catalyst in neutral aqueous solution at elevated temperature hydrochloric acid to pH 2, a reducing agent such as mercaptoethanol, or by the addition of tris-(2-carboxyethyl) phosphine. See, e.g., U.S.P.N. 6,664,079; Meng, et al. J. Qrg. Chem.. 2006, 71(81):3248-52; Bi et ak, J. Amer. Chem. Soc. 2006; 2542-2543, U.S.P.N. 7,279,563, and U.S.P.N. 7,414,116, all of which are incorporated herein by reference in their entireties. In other embodiments, the 3'-substitution group may be removed by UV irradiation (see, e.g., WO 92/10587, incorporated by reference herein in its entirety). Most 3'-0-blocking groups are removed by oxidative, reductive or hydrolytic chemical reactions. In some embodiments, a 3'-0-N02 group is removed from a oligonucleotide by a 40% w/v solution of ammonium sulfide for <5 minutes at R.T. In some embodiments, a 3'-0-CH2CN group is removed from an oligonucleotide by treatment with 0.5M
KOH at 70°C. In some embodiments, the removal of the 3'-0-blocking group does not include chemical cleavage but uses a cleaving enzyme such as alkaline phosphatase.
In preferred embodiments an enzymatic reaction is used for removal of the 3'-blocking group. Shrimp Alkaline Phosphatase (SAP) may be used in certain embodiments. SAP has one of the fastest enzymatic rates reported in the literature and has a wide range of substrate utilization.
3’-0-Methoxymethyl-dTTP: 5’-0-Benzoylthymidine (173 mg, 0.5 mmol, 1 equiv) was dissolved in 10 mL of dichloromethane under argon at ambient T. Di-isopropylethylamine (128 mg, 1 mmol, 2 equiv) was added followed by methoxymethyl bromide (124 mg, 1 mmol, 2 equiv). The mixture was stirred at ambient T for 18h. The mixture was diluted with 10 mL dichloromethane and this was washed successively with 20 mL of 5% aq HC1, and brine. The organic layer was dried with sodium sulfate and evaporated. 5’-0-Benzoyl-3’-0- methoxymethylthymidine (50 mg, 0.13 mmol) was dissolved in 5 mL of concentrated ammonium hydroxide at ambient temperature. The mixture was stirred at ambient T overnight. The mixture was diluted extracted 3 times with 10 mL portions of dichloromethane. The combined extracts were washed with brine. The organic layer was dried with sodium sulfate and evaporated. 3’-0-Methoxymethylthymidine (23 mg, 0.08 mmol) was co-evaporated with pyridine (1.5 mL x 3) and dried overnight under high vacuum. The nucleoside was dissolved in a mixture of 1.5 mL of trimethylphosphate and 0.6 mL dry pyridine under Ar. The mixture was cooled in an ice bath a first aliquot of 10 uL of POC13 was added dropwise. Five minutes later, a second aliquot of 10 uL was added. The mixture was stirred an additional 30 min. A solution of the TBA phosphate salt in dry DMF (1.25 mL) was cooled in an ice bath in a vial under Ar. This was added to the rxn mixture dropwise over 10 sec. Immediately the pre weighed solid proton sponge (21 mg, 1.25 equiv) was added as a solid in one portion. The mixture was stirred for 25 min after this addition and was quenched with 5 mL of cold TEAB buffer. The mixture was stirred in the ice bath for 10 min and then transferred to a small RB flask for FPLC separation. Final separation was accomplished by reverse phase HPLC using a water/acetonitrile gradient containing 0.1 mM formic acid.
3’-0-Methylthiomethyl-dCTP: To a suspension of deoxycytidine (1 g, 4.4 mmol) in
25 mL of methanol was added N,N-dimethylformamide dimethyl acetal (1.75 mL, 13.2 mmol).
The mixture was stirred overnight at ambient temperature. The reaction mixture was
evaporated, and the residue was purified by flash chromatography using a DCM/methanol gradient as eluant. N6-Formamidino-5’-0-benzoyldeoxy-3’-0-methylthiomethyldeoxycytidine (250 mg, 0.41 mmol) was dissolved in 10 mL of methanol and 10 mL cone aqueous ammonium hydroxide. The mixture was stirred at ambient temperature for 18 h and then evaporated under reduced pressure. The residue was purified by column chromatography (DCM/Methanol 98:2 to 90:10) to afford 170 mg (93%) of the desired nucleoside as a slightly yellow solid. 3’-0- Methylthiomethyl dexoxycytidine (25.0 mg, 0.09 mmol) in a 25 mL vial was co-evaporated with anhydrous pyridine (3 x lmL) and dried over the weekend. Trimethyl phosphate (0.7 mL) was added to dissolve the nucleoside and cooled in an ice bath to 0 °C. Phosphoryl chloride (28 pL, 0.3 mmol) was added slowly (12 pL, 5 min later 8 pL, 30 min later 8 pL) and the reaction was stirred for 2 h at 0 °C. The di(tetrabutylammonium) hydrogen pyrophosphate was dissolved in anhydrous DMF (1 mL), this mixture was cooled to 0 °C and added to the reaction mixture. Proton sponge (9.2 mg, 0.04 mmol) was added and the reaction was stirred at 0 °C for 2 h. To the reaction mixture was added 1 M triethylammonium bicarbonate buffer (TEAB) (2 mL) and the mixture was stirred for 1 h. The mixture was then transferred to round-bottom flask, 50 mL x 3 of miliQ water was added and mixture was concentrated to dryness. The residue was dissolved in miliQ water (11 mL) and loaded onto an AKTA FPLC at room temperature. The fractions containing the triphosphate (F48-F52) were evaporated under reduced pressure at 40 °C, and the residue was then lyophilized. The triphosphate was dried to afford the desired triphosphate (12 mg, 16.5%).
EXAMPLES
Example 1: Protein Modifications.
Murine (mur) TdT variants originated from 380 aa synthetic gene. This backbone is a truncated version of WT murine TdT and represents a catalytic core of the ET sequence. Chemically synthesized TdT constructs were cloned into a pRSET A bacterial expression vector, featuring an N-terminal 6x-histidine tag and enterokinase cleavage site (ThermoFisher Scientific GeneArt Gene Synthesis). Synthetic TdT plasmids were maintained in DH5alpha cells (Biopioneer) plated on LB agar plates containing 100 ug/ml carbenicillin. For expression, the pRSETA-murine TdT plasmids were transformed into BL21 (DE3) pLysS cells (Thermo-Fisher) by incubating plasmids and cells on ice for 20 min., followed by a 30 sec. heat shock at 42°C, followed by addition of SOC media and incubation with shaking at 37°C for 30-60 min. After
addition of SOC media to cells, the entire volume (typically 60 ul) were plated on LB agar plates containing 100 ug/mL carbenicillin plus 34 ug/mL chloramphenicol.
Cells from 10 mL cultures (24-well plates, Coming) were harvested by centrifugation (3000xg, 15 min), then lysed in B-PER lysis buffer (Thermo-Fisher) containing lysozyme, protease inhibitors, and 100 mM NaCl. Pellets were soaked 1 x 60 min. in TBS buffer and supernatants collected for purification. The supernatant was bound onto 50 uL Ni-NTA bead (GE Life Sciences) slurry in 24-well plates for 30 min. The bead slurry was then washed 3 x 50mM Tris-HCl, pH 8, 500mM NaCl (500 uL), followed by washing 4 x 50mM Tris-HCl, pH 8, 500mM NaCl, 50 mM Imidazole (200 uL). The protein was then recovered by treating with 50mM Tris-HCl, pH 8, 500mM NaCl, 300 mM Imidazole (50 uL), then 50mM Tris-HCl, pH 8, 500mM NaCl, 300 mM Imidazole (130 uL), and finally 50mM Tris-HCl, pH 8, 500mM NaCl, 1M Imidazole (50 uL).
Recovered fractions were analyzed by taking 2.5 ul sample and running on 8% NuPage gel (Thermo-Fisher) , 200 V for 50 min, denaturing conditions. Gel stained with Coomassie Blue. The eluted protein was buffer exchanged using a 7.5 MWCO desalting column (Thermo-Fisher) and sored at -80°C (Storage Buffer = 20mM Tris-HCl, pH 6.8, 50 mM NaOAc; 0.01% Triton X-100 and 10% Glycerol).
Activity Screens:
TdT activity screening was performed via a dNTP polymerase extension reaction using different 3’-0-blocked dNTP analogs and a biotinylated oligonucleotide:
5B io s G/T A AT A AT A AT A AT A AT A AT A AT A AT A AT A AT A AT A ATTTTTT (ChemGenes Corporation) SEQ ID NO. 12
Reactions were typically set up in a 96 well plate. Reactions were performed by making a master mix with final concentrations of the following components: 0.2U PPase (Thermo-Fisher),
10 pmol of oligonucleotide, 75 uM dNTP (see below), IX TdT reaction buffer (5X from Thermo- Fisher) to a final volume of 10 ul. Reactions were initiated by adding a defined volume (typically 2ul) of TdT variants in different wells and incubating the reaction mix at 37°C for 5 min and 60 min time points. Reactions were terminated by removal of a 10 ul aliquot and adding to 5 ul of 250 mM EDTA. dNTPs tested:
3 ’ - O- azidomethy 1-dTTP see description above
3 ’ - O- azidomethy 1-d ATP see description above
3 ’ - O- azidomethy 1-dGTP see description above
3 ’ -O-MOM-dTTP see description above
3 ’ -O-MTM-dCTP see description above
3’-aminoxy-dTTP Firebird BioMolecular Sciences LLC
3’-aminoxy-dATP Firebird BioMolecular Sciences LLC
3’-aminoxy-dGTP Firebird BioMolecular Sciences LLC
3’-0-methyl-dATP TriLink BioTechnologies LLC
3’-0-methyl-dGTP TriLink BioTechnologies LLC
3’-0-methyl-dCTP TriLink BioTechnologies LLC
Biotinylated oligos in the quenched reaction mix were bound to Streptavidin beads (0.77 um, Spherotech). The beads were then transferred to filter plates (Pall Corporation) and washed several times with water. The oligonucleotides were cleaved from the solid support by incubating the plate with cleavage buffer (10% Diisopropyl-amine in methanol) at 50°C for 30 min followed by elution in water. The eluted samples were dried and dissolved in 30pl of water containing oligonucleotide sizing standards (two oligonucleotides (ChemGenes Corporation) that are approximately 15-20 bases smaller or larger than the starting 42-mer oligonucleotide). Oligonucleotides were then analyzed for extension efficiency by Capillary Gel Electrophoresis (Oligo Pro II, Advanced Analytical Technologies Inc.).
Example 2: In silico modeling
Several amino acid modifications to the GGFRR and TGSR motifs and flanking amino acids discussed above were modeled in silico to determine modifications capable of increased incorporation of 3’-0-blocked dNTP analogs as described above. Single, double, and triple amino acid substitutions as well amino acid insertions were modeled. Table 11 below shows modifications found to elicit increased incorporation. Amino acid positions are provided with reference to murine TdT but are applicable to conserved sequences of any TdT. Rows in Table 11 describe a base modification to one or more amino acids in or flanking the GGFRR motif. Columns include additional combinations of modifications to other amino acids such as those in and flanking the TGSR motif.
Table 11.
Example 3: Incorporation of dNTPs with phosphate blocking groups
DNA and the nucleotides that comprise DNA are highly negatively charged due to the phosphate groups within the nucleotides. See Lipfert J, Doniach S, Das R, Herschlag D. Understanding Nucleic Acid-Ion Interactions, Annu Rev Biochem. 2014; 83: 813-841, incorporated herein by reference. 3’-P04-dNTPs have an even greater negative charge relative to natural nucleotides due to the additional phosphate group at the 3’ - position. The increased negative charge may affect the ability of the TdT to incorporate the modified nucleotides. In certain embodiments, engineered TdT enzymes of the invention may be modified for efficient incorporation of 3’- phosphate-dNTPs by neutralizing the negative charges with positive charges on the modified TdT.
The Average number of Neighboring Atoms Per Sidechain Atom (AvNAPSA) algorithm within the Rosetta protein software suite3 was used to identify mutations that will increase the positive charge in and around the enzymatic active site of TdT. By increasing a key parameter of the AvNAPSA algorithm, termed surface_atom_cutoff, sequence positions in the active site of TdT were targeted. The surface charge of proteins was manipulated by mutating solvent-exposed polar residues to charged residues, with the amount of solvent exposure determined by the number of neighboring non-self atoms. See, Miklos AE, et al., Structure-Based Design of Supercharged, Highly Thermoresistant Antibodies, Chemistry & Biology, Volume 19, Issue 4, 20 April 2012,
Pages 449-455; Kaufmann KW, et ak, Practically useful: what the Rosetta protein modeling suite can do for you, Biochemistry. 2010 Apr 13; 49(14):2987-98; the content of each of which is incorporate herein by reference. Increasing the surface_atom_cutoff term allows AvNAPSA to consider sequence positions with a higher number of neighboring atoms, such as positions within an enzyme active site. A summary of positions identified in TdT using AvNAPSA as being potentially useful for more efficient incorporation of 3’-phosphate-dNTP is shown in Table 12.
Table 12: TdT modifications for incorporation of phosphate-blocked dNTPs
FIGS. 13-16 illustrate the superior nucleotide incorporation of modified TdT over the wild type with respect to 3’-P04-dNTPs . FIG. 13, Panel A is the CGE analysis of a chemically synthesized oligonucleotide (IDT) (21-mer; 5 ’ -FAM-TAAT AAT AATAAT AATTTTTT-P04-3 ’ ), while Panel B shows that the addition of one nucleotide bearing a 3’-P04 group, causes faster electrophoretic mobility than a comparable 20-mer (IDT) (5’-FAM-
TAATAATAATAATAATTTTT). FIG. 14 is the CGE analysis demonstrating that Shrimp Akaline Phosphatase (SAP) (NEB #P0757) quantitatively removes a 3’-P04 group in 1 minute or less at a concentration of 1.23 x 103 U/ul per pmol of oligonucleotide. The figure shows a titration series of increasing amounts of SAP from 0 U/ul (Panel A) to 1.0 x 10 1 U/ul (Panel G). FIG. 15, Panel B is the CGE analysis of a murine WT TdT reaction mixture that demonstrates no polymerase mediated extension even in the presence of 500 uM 3’-P04-dTTP (MyChem LLC) as evidenced by no change to the starting material oligonucleotide shown in Panel A. Further evidence of the lack of substrate utilization of 3’-P04-dTTP is shown in panel C of FIG. 15 as demonstrated by the lack of reactivity of the oligonucleotide starting material (Panel A). FIG. 16 is a CGE analysis of the partial incorporation of a 3’-P04-dTTP by a variant TdT enzyme (E180K + M192K + L381K +
R454K + N474R) as shown in panel B that demonstrates the appearance of a new oligonucleotide species (new peak circled) with a faster electrophoretic mobility as would be expected based on the results shown in FIG. 13. Further evidence of the incorporation of a 3’-P04 by the variant TdT is demonstrated by the post-extension removal of the 3’-P04 by treatment with SAP and the appearance of a new oligonucleotide species (Panel C - new peak circled) with an electrophoretic migration rate slower than the oligonucleotide starting material as would be expected from the poly-dT size ladder shown in panel D and the disappearance of the species formed in Panel B as indicated by the arrow in Panel C In another embodiment, increased incorporation of 3’-P04-dTTP is demonstrated by a variant enzyme (E180K+M192K+R454K+R461V+N474R)
Incorporation by Reference
References and citations to other documents, such as patents, patent applications, patent publications, journals, books, papers, web contents, have been made throughout this disclosure.
All such documents are hereby incorporated herein by reference in their entirety for all purposes.
Equivalents
Various modifications of the invention and many further embodiments thereof, in addition to those shown and described herein, will become apparent to those skilled in the art from the full contents of this document, including references to the scientific and patent literature cited herein. The subject matter herein contains important information, exemplification and guidance that can be adapted to the practice of this invention in its various embodiments and equivalents thereof.
Claims (27)
1. A modified terminal deoxynucleotidyl transferase (TdT) comprising a mutation selected from the group consisting of E33K, E180L, E180K, M192E, M192K, M192W, W303H, L381K, L381Q, L381R, L381V, W450H, R454I, R454T, R454K, E457K, R461V, R461Q, R461V, N474R, and N474K, said modified TdT capable of adding a nucleotide analog comprising a removable blocking moiety at a 3'-Oxygen of the analog to a 3'-OH of a nucleic acid initiator in the absence of a nucleic acid template.
2. The modified TdT of claim 1, comprising a mutation E457K.
3. The modified TdT of claim 1, comprising the mutations E180K, M192W, L381R, and W450H.
4. The modified TdT of claim 1, comprising the mutations L381Q and W450H.
5. The modified TdT of claim 1, comprising the mutations E180L, M193E, L381K, R461Q, and N457K.
6. The modified TdT of claim 1, comprising the mutations E180K, L381Q, W450H and R461V.
7. The modified TdT of claim 1, comprising the mutations L381Q and W450H.
8. The modified TdT of claim 1, comprising the mutations E180L, M192E, L381K, R461Q, and N457K.
9. The modified TdT of claim 1, comprising the mutations E180K, M192E, L381K, R454T, and N47K.
10. The modified TdT of claim 1, comprising the mutations E180K, M192K, L381K, R454T, and N457R.
11. The modified TdT of claim 1, comprising the mutations E180K, M192K, L381K, R454K, and N457K.
12. The modified TdT of claim 1, comprising the mutations M192E, L381V, R454I, and R461V.
13. The modified TdT of claim 1, comprising the mutations E180K and L381R.
14. The modified TdT of claim 1, comprising the mutations E180K, M192K, L381K, R454K, and N474R.
15. The modified TdT of claim 1, wherein the modified TdT is capable of adding the nucleotide analog comprising the removable 3'-0-blocking moiety to the 3'-OH of the nucleic acid initiator at an increased rate compared to native TdT.
16. The modified TdT of claim 1, comprising an N-terminus truncation relative to native TdT
17. The modified TdT of claim 15, wherein the modified TdT comprises an N-terminus t-131 murine TdT and a protein tag sequence attached to the N-terminus.
18. The modified TdT of claim 15, wherein the modified TdT comprises an N-terminus t- 147 murine TdT and a protein tag sequence attached to the N-terminus.
19. The modified TdT of claim 1, wherein the modified TdT is capable of adding adenine, cytosine, guanine, and thymine deoxyribonucleotides modified with a removable 3'-0- blocking moiety.
20. The modified TdT of claim 18, wherein said nucleotides are 2 '-deoxyribonucleotides.
21. The modified TdT of claim 1, wherein the modified TdT is capable of adding adenine, cytosine, guanine, and uracil ribonucleotides modified with a removable 3 '-O-blocking moiety.
22. The modified TdT of claim 1, wherein said removable 3 '-O-blocking moiety comprises a 3'- O-blocking group selected from the group consisting of CH2N3, Nth, 0NHC(0)H, allyl, CH2SSCH3, phenoxyacetyl, methoxyacetyl, acetyl, (p-toluene) sulfonate, phosphate, nitrate, [4-methoxy]-tetrahydrothiopyranyl, tetrahydrothiopyranyl, [5-methyl]-tetrahydrofuranyl, [2- methyl,4-methoxy]-tetrahydropyranyl, [5-methyl]-tetrahydropyranyl; and O- tetrahydrothiofuranyl.
23. The modified TdT of claim 1, wherein the modified TdT is capable of incorporating a 3'-0- blocked nucleotide 5 '-triphosphate, and said removable blocking moiety comprises a group selected from esters, ethers, carbonitriles, phosphates, carbonates, carbamates, hydroxylamine, borates, nitrates, sugars, phosphoramide, phosphoramidates, phenylsulfenates, sulfates, sulfones and amino acids.
24. The modified TdT of claim 1, wherein the modified TdT is capable of incorporating modified nucleotides at a reaction temperature from about 30° C to about 80° C.
25. The modified TdT of claim 1, wherein the modified TdT is capable of incorporating modified nucleotides at a concentration of 1000 mM or less.
26. The modified TdT of claim 1, wherein the modified TdT is capable of incorporating modified nucleotides at a concentration of 100 pM or less.
27. The modified TdT of claim 14, said modified TdT capable of adding a nucleotide analog comprising a removable 3'-0-phosphate to the 3'-OH of a nucleic acid initiator.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/891,449 | 2020-06-03 | ||
US16/891,449 US11390858B2 (en) | 2014-10-20 | 2020-06-03 | Modified template-independent enzymes for polydeoxynucleotide synthesis |
PCT/US2021/035685 WO2021247851A2 (en) | 2020-06-03 | 2021-06-03 | Modified template-independent enzymes for polydeoxynucleotide synthesis |
Publications (1)
Publication Number | Publication Date |
---|---|
AU2021285906A1 true AU2021285906A1 (en) | 2023-02-02 |
Family
ID=78831733
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2021285906A Pending AU2021285906A1 (en) | 2020-06-03 | 2021-06-03 | Modified template-independent enzymes for polydeoxynucleotide synthesis |
Country Status (7)
Country | Link |
---|---|
EP (1) | EP4162035A2 (en) |
JP (1) | JP2023528477A (en) |
KR (1) | KR20240016237A (en) |
CN (1) | CN116075593A (en) |
AU (1) | AU2021285906A1 (en) |
CA (1) | CA3185851A1 (en) |
WO (1) | WO2021247851A2 (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN114410602B (en) * | 2022-01-28 | 2024-01-19 | 赛纳生物科技(北京)有限公司 | Mutant of terminal deoxynucleotidyl transferase and application thereof |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2008112258A2 (en) * | 2007-03-12 | 2008-09-18 | Danisco Us Inc. | Modified proteases |
US10059929B2 (en) * | 2014-10-20 | 2018-08-28 | Molecular Assemblies, Inc. | Modified template-independent enzymes for polydeoxynucleotide synthesis |
GB201502152D0 (en) * | 2015-02-10 | 2015-03-25 | Nuclera Nucleics Ltd | Novel use |
CN112105725A (en) * | 2018-01-08 | 2020-12-18 | Dna斯克瑞普特公司 | Variants of terminal deoxynucleotidyl transferase and uses thereof |
-
2021
- 2021-06-03 CN CN202180057936.6A patent/CN116075593A/en active Pending
- 2021-06-03 JP JP2022574577A patent/JP2023528477A/en active Pending
- 2021-06-03 EP EP21818476.0A patent/EP4162035A2/en active Pending
- 2021-06-03 WO PCT/US2021/035685 patent/WO2021247851A2/en unknown
- 2021-06-03 KR KR1020237000176A patent/KR20240016237A/en unknown
- 2021-06-03 AU AU2021285906A patent/AU2021285906A1/en active Pending
- 2021-06-03 CA CA3185851A patent/CA3185851A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
WO2021247851A3 (en) | 2022-03-17 |
KR20240016237A (en) | 2024-02-06 |
CN116075593A (en) | 2023-05-05 |
CA3185851A1 (en) | 2021-12-09 |
WO2021247851A2 (en) | 2021-12-09 |
JP2023528477A (en) | 2023-07-04 |
EP4162035A2 (en) | 2023-04-12 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10760063B2 (en) | Modified template-independent enzymes for polydeoxynucleotide synthesis | |
US11390858B2 (en) | Modified template-independent enzymes for polydeoxynucleotide synthesis | |
US10774316B2 (en) | Modified template-independent enzymes for polydeoxynucleotide synthesis | |
KR102628876B1 (en) | Methods for seamless nucleic acid assembly | |
US20180305746A1 (en) | Methods and apparatus for synthesizing nucleic acids | |
WO2018231864A1 (en) | Methods for seamless nucleic acid assembly | |
US5859231A (en) | Synthesis of oligonucleotides with boranophosphonate linkages | |
CN105264085B (en) | Method and apparatus for synthesizing nucleic acid | |
CA2958581A1 (en) | Methods and apparatus for synthesizing nucleic acids | |
JP2002525129A (en) | Methods for analyzing polynucleotides | |
EP4162035A2 (en) | Modified template-independent enzymes for polydeoxynucleotide synthesis | |
CN114729389B (en) | Increasing long sequence yield in template-free enzymatic synthesis of polynucleotides | |
US11384377B2 (en) | Reusable initiators for synthesizing nucleic acids | |
Scheitl | In vitro selected ribozymes for RNA methylation and labeling | |
WO2020160122A1 (en) | Reusable initiators for synthesizing nucleic acids | |
AU2021252542A1 (en) | Reusable initiators for synthesizing nucleic acids | |
Pawlowska et al. | Substrate Specificity of T7 RNA Polymerase toward Hypophosphoric Analogues of ATP |