AU2017335084A1

AU2017335084A1 - Compositions containing protein loaded exosome and methods for preparing and delivering the same

Info

Publication number: AU2017335084A1
Application number: AU2017335084A
Authority: AU
Inventors: Chulhee Choi; Hojun CHOI; Kyungsun CHOI; Seung-Wook RYU; Nambin YIM
Original assignee: Ilias Biologics Inc
Current assignee: Ilias Biologics Inc
Priority date: 2016-09-30
Filing date: 2017-09-29
Publication date: 2018-05-10
Anticipated expiration: 2037-09-29
Also published as: IL259023B; EP3356522A4; IL259023A; EP3356522A1; WO2018062973A1; JP2019528674A; AU2017335084B2; CN108473973A; CA3002520A1

Abstract

The present invention relates to a method for the mass-production of exosome comprising a cargo protein, a vector for preparing the exosome, exosome including a cargo protein prepared by the method, and a method for loading the cargo protein to cytosol by using the exosome prepared thereby. According to the method for preparing an exosome comprising a cargo protein provided by the present invention, the exosome loaded with a cargo protein can be produced with a high yield, so that it can be used broadly in the treatment of disease using the exosome.

Description

The present invention relates to a method tor the mass-production of exosome comprising a cargo protein, a vector tor preparing the exosome, exosome including a cargo protein prepared by the method, and a method for loading the cargo protein to cytosol by using the exosome prepared thereby. According to the method for preparing an exosome comprising a cargo protein provided by the present invention, the exosome loaded with a cargo protein can be produced with a high yield, so that it can be used broadly in the treatment of disease using the exosome.

(Continued on next page]

WO 2018/062973 Al lllllilllilllllllll^

SD, SE, SG, SK, SL, SM, ST, SV, SY, TI I, TJ, TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ΖΛ, ZM, ZW.

(84) Designated States (unless otherwise indicated, for even kind of regional protection available): ARIPO (BW, GH, GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, ST, SZ, TZ, UG, ZM, ZW), Eurasian (AM, AZ, BY, KCi, KZ, RU, TJ, TM), European (AL, AT, BE, BG, CM, CY, CZ, DE, DK, EE, ES, FI, FR, GB, GR, I-IR, HU, IE, IS, IT, LT, LU, LV, MC, MK, MT, NL, NO, PL, PT, RO, RS, SE, SI, SK, SM, TR), OAPI (BF, BJ, CF, CG, CI, CM, GA, GN, GQ, GW, KM, ML, MR, NE, SN,TD, TG).

Published:

— with international search report (Art. 21(3)) — with sequence listing part of description (Rule 5.2(a))

Description

Title of Invention: COMPOSITIONS CONTAINING PROTEIN LOADED EXOSOME AND METHODS FOR PREPARING AND

DELIVERING THE SAME

Technical Field [ 1 ] CROSS-REFERENCE TO RELATED APPLICATIONS

12j This application claims benefit from Korean Patent Application No.

10-2016-0126335 filed September 30, 2016, Korean Patent Application No. 10-2016-0126921 filed September 30, 2016, Korean Patent Application No. 10-2016-0126961 filed September 30, 2016, Korean Patent Application No. 10-2016-0127486 filed October 4, 2016, Korean Patent Application No. 10-2016-0132616 filed October 13, 2016, Korean Patent Application No. 10-2017-0018637 filed February 10, 2017, the contents of each of which arc incorporated herein by reference.

13J [4] The present invention relates to compositions containing protein loaded exosome, methods for preparing exosome loaded with a cargo protein using a photo-specific binding protein, and a method for delivering the cargo protein to cytosol using the exosome prepared thereby.

IS]

Background Art ] 6] The human body is composed of about 200 kinds of 100 trillion cells, in which the physiological activity is regulated by the action of various proteins to maintain life.

(7J Cells are surrounded by membranes in bitayer structure composed of phospholipids, which block the entry of foreign substances into cells. Most of the protein drugs which have developed so far cannot pass through the cell membrane to enter the cell and can act on the outside of the cell or act on a receptor on the cell membrane to deliver the signal into the cell in order to show physiological effect.

18J Cytosol has tots of proteins which interact with each other to regulate physiological activity. So, if only a protein drug can be delivered inside the cell, that is, inside the cytosol, the cell activity would be controlled more effectively.

19]

110] Recently, studies have been actively going on to establish a method for delivering a cargo protein directly into cells via cell membrane. When a recombinant protein of a cargo protein and protein transduction domains (PTDs), the peptide that passes through (he cell membrane, is prepared and administered, it can enter the cytosol through the ceil membrane (FIG. I). PTD is exemplified by HIV-1 TAT, HSV VP22, Antp, dfTAT, and Hph-1. A fusion protein prepared by combining the PTDs and a cargo protein is produced as a recombinant protein and at this lime a separation process is required. However, this process is problematic in that the protein refolding is not performed properly, the activity is decreased, the protein is nonspecific ally transferred, the risk of causing an immune reaction in vivo is large, the cost is high, and the yield is low.

[ i i ] The cargo protein conjugated with various nanoparticies can enter the cytosol through the cell membrane by endocytosis (FIG. 2), At this time, the nanoparticies are exemplified by Gold NP, Liposome NP, Magnetic NP, and Polymeric NP, etc. The separation of (he nanoparticies from the cargo protein occurs mostly in lysosome in the cell, so the cargo protein is decomposed inside lysosome to lose its activity. Or the nanoparticies arc difficult to be separated from the cargo protein in cytosol and toxicity of the nanoparticies can be another problem.

Π2] ] 13] Exosomc is a small vesicle with a membrane structure in the size of 50 - 200 nm. which is secreted out of (he cell with containing protein, DNA, and RNA for intercellular signaling.

114] Exosome was first found in the process ofleaving only hemoglobin in the red blood cells by eliminating intracellular proteins at the last stage of red cell maturation. From the observation under electron microscope, it was confirmed that exosome is not separated directly from plasma membrane but discharged extracellular from the intracellular specific zone, called mullivesicular bodies (MVBs). That is, when MVBs are fused with plasma membrane, such vesicles are discharged outside oflhe cell, which are called exosome (FIG. 3).

[15] It has not been clearly disclosed the molecular mechanism of the exosome generation. However, it is known that various immune cells including B-lymphocytes, T-lymphocytes, dendritic cells, megakaryocytes, and macrophages, stem cells, and tumor cells produce and secrete exosomes when they arc alive.

[16] Exosomc contains various intracellular proteins, DNA, and RNA. The substances secreted out of the cells contained in these exosomes can be reintroduced into other cells by fusion or endocytosis and serve as intercellular messengers. By analyzing such substances that arc secreted out of the cell as included in exosomc, specific disease can be diagnosed.

[ 17] Exosome also includes various types of microRNAs, A method for diagnosing a disease by detecting the presence or absence and the abundance thereof has been reported (KR 10-2010-0127768A). International Patent Publication No W02009-015357A describes a method lor predicting and diagnosing a specific disease by delecting exosome in the cancer patient originated samples (blood, saliva, tears, etc.). In particular, the exosome obtained from a patient having a specific disease (lung disease) is analyzed and the relationship between a specific microRNA and lung disease is specifically described. Studies have been still going on to establish a method to diagnose kidney disease, in addition to lung disease, by using a specific protein included in exosome.

118] Exosome might also include antigens. In antigen presenting cells (ARC), antigen peptide is loaded in MHC (major histocompatibility complex) class II molecule in the intracellular compartment having a membrane structure including polycystic bodies. Therefore, the exosome originated therefrom also has the antigen peptide-MHC class II complex. So, exosome acts as an immunogen carrier to present antigen peptide to CD4+ T lymphocytes and thereby can Induce immune response such as T lymphocyte proliferation. The molecules that arc able to stimulate immune response such as MHC class I and heat-shock proteins (HSPs) are concentrated in exosome, so that exosome can be used io increase or decrease immune response for the treatment of cancer or auto-immune disease.

U9]

Disclosure of Invention Solution to Problem

120] The present invention provides compositions containing exosome loaded with a cargo protein.

[21 ] In another embodiment, the present invention provides a method for preparing the exosome loaded with a cargo protein using a photo-specific binding protein.

122] In a further embodiment, the present invention provides a method of delivering the cargo protein to cytosol using the exosome,

123]

Brief Description of Drawings [24] FIG. 1 illustrates the method for delivering a cargo protein through a recombinant protein of a cargo protein and protein transduction domains (PTDs) (Steven R. cl al. Protein transduction: unrestricted delivery into all cells Trends in Cell Biology, 2000).

[25] FIG. 2 illustrates illustrating the method for delivering a cargo protein to cytosol using a complex of nanopartielcs and a cargo protein via cndocytosis (Munish Chanana el al. Physicochemical properties of protein-coaled gold nanoparticles in biological fluids and cells before and after proteolytic digestion, Angew. Chem. Int. Ed. 2013).

[26] FIG. 3 illustrates illustrating the process in which exosome is separated and released from multi-vesicular bodies (MVBs) (Graca Raposo and Willem Sloorvogcl. Extracellular vesicles: Exosomes, microvesicles, and friends. Cell Biology 200(4), 373-383,

2013).

[27] FIG. 4 illustrates the process of treating cancer by delivering siRNA in vivo through the targeted exosome (Alvarez-Ervili, L. et al. Delivery of siRNA to the mouse brain by systemic injection of targeted exosomes. Nature Biotechnology 29, 341-345, 2011).

[28] FIG.5 illustrates the preparation process of optogcnctically-designed proteincarrying exosomes (EXPLORs) according to the present invention.

[29] FIG. 6 illustrates the process of separating the fusion protein of a cargo protein and a photo-specific binding protein in the inside of exosome when the light irradiation on EXPLORs is stopped.

[30] FIG. 7 illustrates the changes in the intracellular location of mChcrry protein according to the blue light irradiation in the transformed HEK293T cells introduced with CIBN-EGFP-CD9 gene and mChcrry-CRY2 gene.

[31 ] FIG. 8 illustrates (he experimental procedure of obtaining EXPLORs according to (he present invention.

[32] FIG, 9 illustrates (he results of measuring the changes of the content of a cargo protein (mChcrry protein) captured in exosome according to the intensity of blue light.

[33J FIG. 10 illustrates the results of investigation of the introduction of a cargo protein in target cells after treating the target celts (HT1080) with exosome containing the cargo protein (mCherry), wherein the left indicates the target cells not-treated with exosome and the right indicates the target cells treated with exosome, [34] FIG. 11 is a set of a fluorescence image (a) illustrating the results of investigation of the introduction of a cargo protein in target cells after treating the target cells (HT1080) with exosome containing the cargo protein (mCherry); and a graph (b) illustrating the results of comparison of (he ratio of apoptolic cells induced by the treatment of exosome.

[35] FIG, 12 illustrates the changes in the intracellular location of mChcrry protein according to the blue light irradiation in the transformed HEK293T cells introduced with GIGANTEA-EGFP-CD9 gene and mCherry-FKFILOV.

[361 FIG. 13 illustrates the expression of the Lucifcrase-mChcrry fusion protein measured by fluorescence imaging (a) and the lucifcrasc activity and the number of molecules in (he production cells (b):

[37] Control: HEK293T cells treated with nothing;

[38] OVER: HEK293T cells introduced with Luc iferase-mCherry-CRY2 alone;

[39J XP: HEK293T cells introduced with XPACK-Luciferase-mCherry by using XPACK (Systems Biosciences), (he commercial vector designed for exosome loading technique;

[40] EXPLOR: HEK293T cells introduced with Luciferasc-mChcrry-CRY2 and CIBNEGFP-CD9 according to the present invention.

[41] FIG. 14 illustrates the lucifcrasc activity (a) and the number of molecules (b) in the produced exosomc:

[42] NEG: exosome produced in the HEK293T cells treated with nothing;

[43] OVER: exosome produced in the HEK293T cells introduced with LuciferasemChcrry-CRY2;

[44] XP: exosomc produced in the HEK293T cells introduced with XPACK-Luciferase-mCherry by using XPACK (Systems Biosciences), the commercial vector designed for exosomc loading technique;

[45] EXPLOR: exosome produced in the HEK293T cells introduced with LucifcrascmCherry-CRY2 and CIBN-EGFP-CD9 according to the present invention;

[46] ON: exosome produced by culturing under the irradiation of 200 pW blue light for 72 hours, [47] OFF: exosomc produced by culturing under the light-free condition for 72 hours.

[48] FIG. 15 illustrates the loading efficiency of a cargo protein in the exosome produced above.

[49] FIG. 16 illustrates the transfer efficiency of a cargo protein into the target cells (HcLa) using exosomc:

[50] Control: exosome produced in the HEK293T cells treated with nothing;

[51 ] OVER: exosome produced in the HEK293T cells introduced with LuciferasemChcrry-CRY2;

]52] XP: exosome produced in the HEK293T cells introduced with XPACK-Lucifcrasc-inChcrry by using XPACK (Systems Bioscicnces), the commercial vector designed for exosome loading technique;

[53] EXPLOR: exosome produced in the HEK293T cells introduced with LuciferasemChcrry-CRY2 and CIBN-EGFP-CD9 according to the present invention;

[54] ON: exosomc produced by culturing under the irradiation of 200 pW blue light for 72 hours, [55] OFF: exosome produced by culturing under the light-free condition for 72 hours.

[56] FIG. 17 illustrates the location of the expression of Luciferase-mChcrry-CRY2 and CIBN-EGFP-CD9 in HEK293T cells, indicating they share the same position for the expression.

[57] FIG, 18 illustrates the location of the expression of Cre-mCherry-CRY2 and CIBNEGFP-CD9 in HEK293T cells, indicating they share the same position for the expression.

[58] FIG. 19a illustrates that treatment with Cre:EXPLOR induced the expression of ZsGrcen in HT1080 cells transiently transfected with pCAGloxP-STOP-toxP-ZsGrcen (Scale bars, 40 pm):

[59] Negative:EXPLOR: no cre-loadcd exosome as negative control;

[60] Crc:EXPLOR: Crc-loadcd exosome; and [6J ] pcMV-Crc: pCMV-Cre vector transfection as positive control.

[62] FIG, 19b illustrates that treatment with Cre:EXPLOR induced the expression of ZsGreen in HeLa cells transiently transfected with pCAG-loxP-STOP-loxP-ZsGrecn (Scale bars, 40 pm):

[63] Negative: EXPLOR: no cre-loaded exosome as negative control;

[64] Cre:EXPLOR: Cre-loaded exosome; and ]65] pcMV-Cre: pCMV-Cre vector transfection as positive control.

[66] FIG. 20 illustrates that treatment with Cre:EXPLOR induced the expression of ZsGreen in primary rat embryonic neuron transiently transfected with pCAGloxP-STOP-loxP-ZsGreen (Scale bars, 100 pm):

167] ControhEXPLOR: no cre-loaded exosome as negative control; and [68] Crc:EXPLOR: : Cre-loaded exosome.

169] FIG. 21 illustrates that treatment with Cre:EXPLOR induced the expression of

ZsGreen in transgenic mice having pCAG-IoxP-STOP-loxP-eNpHR3.0-EYFP gene (Scale bars, 500 pm):

[70] ControhEXPLOR: no cre-loaded exosome as negative control;

[71 ] Cre:EXPLOR: : Cre-loaded exosome;

[72] Hip: hippocampus; and [73] Th: thalamus.

[74] FIG. 22 Illustrates the results of immunohistochemistry for NEuN/GFAP in transgenic mice having pCAG-loxP-STOP-loxP-cNpHR3.0-EYFP gene

175 j Pink: neuronal-specific nuclear protein; NEuN , positive neurons; and [76] Red: glial fibrillary acidic protein; GFAP, positive astrocyte cells.

177] Objective lens, 40x. Scale bar, 20 pm.

[ 78] FIG. 23 illustrates the location of the expression of Cas9-mChcrry-CRY2 and CIBN

EGFP-CD9 in HEK293T cells, indicating they share the same position for the expression, [79] FIG. 24 illustrates the generation of DNA constructs used for the production of Cas9-loadcd exosome.

[80] FIG. 25 illustrates the results of measuring the content of a cargo protein (CRISPR-Cas9 protein) captured in exosome.

[81] FIG. 26 illustrates the location of the expression of GBA-mCherry-CRY2 and CIBN EGFP-CD9 in HEK293T cells, indicating they share the same position for the expression, [82] FIG. 27 illustrates the expression of endogenous GBA and GBA-mcheiTy-CRY2 fusion protein in HEK293T cell transiently transfected with GBA-mCh-CRY2 and CIBN-EGFP-CD9, rat primary astrocyte, human primary astrocyte and Gaucher fi7 broblasl.

[83] FIG. 28 illustrates the results of measuring the content of a cargo protein (GBA protein) captured in exosome.

[84] FIG. 29 illustrates (he results of measuring the enzymatic activity of βglucoccrcbrosidase, a cargo protein (GBA protein) captured in exosome.

[85] Exo-Naive: HEK293T-derived exosome [86] Exo-GBA: exosome including β-glucocerebrosidase

187] FIG. 30 illustrates the results of treatment of GBA-exosomes to Gaucher disease patient-derived fibroblassls, indicating treatment with GBA-exosomes significantly induced the enzymatic activity in β-glucocerebrosidase-deficicnl cells.

[88] FIG, 31 illustrates the generation of DNA constructs used for the production of PTEN-loadcd exosome and cells stably expressing PTEN-loadcd exosome.

[89] FIG. 32 illustrates the location of the expression of luciferase-mChcrry-CRY2 and CIBN-EGFP-CD9 in HEK293T cells, indicating they share the same position for the expression.

[90] FIG. 33 illustrates the results of measurement of quantitative lucifcrase activity based on the number of lucifcrase molecules.

[91 ] FIG. 34 illustrates the location ofthe expression of PrxI/Il-mCherry-CRY2 and

CIBN-EGFP-CD9 in HEK293T cells, indicating they share the same position for the expression.

]92] Prx I: peroxiredoxin I [93] Prx II: peroxiredoxin II

194] FIG. 35 illustrates the protective effect of Prxl/IJ-toaded exosomes in FTCF-induccd oxidative stress and cytotoxicity.

[95] None: hhOi-trcatcd group;

[96] Crc:EXPLOR: Crc-loadcd exosome [97] Prx FEXPLOR: Prxl-loaded exosomes; and [98] Prx IFEXPLOR: PrxII-Ioaded exosomes.

[99] FIG. 36 illustrates the location ofthe expression of MyoD-mCherry-CRY2 and CIBN-EGFP-CD9 in HEK293T cells, indicating they share the same position for the expression.

1100] FIG, 37 illustrates the results of treatment of MyoD-loadcd exosomes to adiposederived stem cells and, indicating treatment with MyoD-cxosomcs (clone #A6) induced the proliferation of cells after 6 days, [ 101 ] FIG. 38 illustrates the generation of cells stably expressing p53-loaded exosome.

[ 102] FIG. 39 illustrates the results of measuring the content of a cargo protein (p53 protein) captured in exosome.

[ 103] Stable cell: cells stably expressing p53-loadcd exosome.

J104] mchcrry: mchcrry-loadcd exosomc [105] p53: p53-loadcd cxosomc

1106] FIG. 40 illustrates the results of measurement of transcriptional activity of p53 using luciferase reporter gene, indicating treatment with p53-loaded exosomes induced transcriptional activity of p53 in doxorubicin-treated HcLa cells.

[107] FIG. 41 illustrates the generation of DNA constructs used for (he production of HMGB1-loaded exosome and cells stably expressing HMGB 1-loaded exosome.

[ 108] FIG. 42 illustrates the location of the expression of srlKB-mCherry-CRY2 and CIBN EGFP-CD9 in HEK293T cells, indicating they share the same position for the expression.

1109] FIG, 43 illustrates that treatment with srlkB-mCherrytEXPLORs significantly reduced tumour necrosis factor-a-induccd translocation and DNA binding of the p65 subunit of NF-κΒ in HcLa cells.

[110] FIG. 44 illustrates the analysis of disease progression after administration of srlkBloaded exosomes to rheumatoid arthritis animal model.

[Ill ] FIG. 45 illustrates the survival curve of groups treated with srlkB-loaded exosomes in LPS-induccd sepsis model.

[112] No exosome: only LPS treated group [113] Naive exosome: group treated with HEK293T-derived exosome [ 114] srlkB exosomc: group treated with srlkB-loaded exosomes

1115] FIG. 46 illustrates the location of the expression of _PYSTAT3inlrabody-mChcrry-CRY2 and CIBN-EGFP-CD9 in HEK293T cells, indicating they share the same position for the expression.

[116] FIG, 47 illustrates the intracellular delivery of pYSTAT3intrabody to target cells using pYSTAT3intrabody-loaded exosomes.

[ 117] FIG, 48 illustrates location of (he expression of Bax-mCherry-CRY2 and CIBNEGFP-CD9 in HEK293T cells, indicating they share the same position for the expression, f 118] FIG. 49 illustrates that treatment with Bax-loadcd exosomc induced a rapid release of cytochrome c from the mitochondria in HcLa cells [119] FIG. 50 illustrates location of the expression of AIMP-mCherry-CRY2 and CIBNEGFP-CD9 in HEK293T cells, indicating they share the same position for the expression.

[ 120] FIG. 51 illustrates the results of measuring the content of a cargo protein (A1MP protein) captured in exosome.

[121] FIG. 52 illustrates location of the expression of mCherry-CRY2 and CIBNEGFP-CD9 in HEK293T cells, indicating they share the same position for the expression.

1122]

Best Mode for Carrying out the Invention

1123] The present invention provides compositions containing exosome loaded with a cargo protein.

1124] In another embodiment, the present invention provides a method for preparing the exosome loaded with a cargo protein using a photo-specific binding protein.

[125] In a further embodiment, (he present invention provides a method of delivering the cargo protein to cytosol using the exosome.

[126] ] 127] In another embodiment, the present invention provides a method for the massproduction of exosome containing a fusion protein composed of an exosome specific marker and a cargo protein.

1128] The present invention provides a method for the mass-production of exosome containing a cargo protein separated from (he membrane of exosome by using a photo specific binding protein pair.

[129] The present invention also provides a vector for preparing exosome which is usable for the preparation of the exosome.

1130] The present invention further provides a method to introduce a cargo protein in cytosol by using the exosome above.

1131] [132] In one embodiment, the present invention provides pharmaceutical compositions containing exosomes loaded with a cargo proteins and a method for preparing the same.

1133] In a preferred embodiment, (he cargo protein is s uper-repressor-1 kB protein inhibiting NF-tcB, Bax(Bcl-2-associatcd X protein), Pcroxiredoxin I, Pcroxircdoxin II, ere recombinase, Cas9 (CRISPR associated protein 9), Cpfl(CRISPR from Prevotella and Francisella 1) or GBA(P-glucocerebrosidase).

[134] [135] The present invention provides exosome comprising a cargo protein which can be used for the treatment of various diseases in vivo by delivering the cargo protein. For example, exosome can be prepared to include a protein or siRNA having an anlicancer activity and then treated to cancer cells for cancer treatment (FIG. 4),

1136] For the exosomes containing a cargo protein used for the treatment of disease, the exosomes needs to be prepared efficiently to have proper load of the cargo protein. Korean Patent Publication No. 2004-0015508 describes a method for preparing exosome comprising a specific antigen. Precisely, it describes a method of discharging a cargo protein by using exosome, wherein a gene encoding a specific antigen is inserted in a host cell line and a protein of the introduced gene is stably expressed in the cell line which is discharged extracellular]y through exosome, and a method using (he exosome as a vaccine, [137] However exosome is formed naturally within the cells. So, even though a gene encoding a cargo protein is inserted in the cell producing exosome endogenously, it is very difficult to prepare exosome comprising the expressed protein in it thereby.

[138] [ 139] The present invention provides methods for preparing exosome comprising a cargo protein more efficiently. As a result, the inventors succeeded in preparing exosome comprising a cargo protein efficiently by expressing a fusion protein composed of an exosome specific marker and a cargo protein massively in the cell producing exosome endogenously at a high concentration (FIG. 5).

1140] The cargo protein is attached on the membrane of exosome, according to the method above. So, the fusion protein composed of a pair of an exosome specific marker and a cargo protein is expressed in the cell producing exosome at a high concentration, followed by irradiation to induce the linkage of the fusion protein. Then, the fusion protein is introduced inside the exosome by the action of the exosome specific marker. When the irradiation is terminated after the introduction, the fusion protein is separated into a cargo protein and a photo-specific binding protein inside the exosome. Asa result, the exosome containing a free cargo protein separated from the fusion protein can be prepared efficiently (FIG. 6).

[Hl]

1142] The cargo proteins loaded in the exosome in the present invention includes, but not limited to, natural or non-natural proteins, truncated form or mutated fonn. Examples of the cargo proteins arc listed, but not limited to, in the following table.

[143] [Tabic 1]

Classification	Sub-Class	Example
Enzymes	Proteases (extracellular & intracellular) and their in- hibitors	MMPs and TJMP (tissue inhibitor mclalloproleases)
Caspases and their inhibitors
Cathepsins and (heir inhibitors
Nucleases	Cre rccombinase
Crispr/cas9
Caspase-activated DNase
hydrolytic enzymes	Lysosomal enzymes including Belagl ucoccrcbrosidase
Kinases and phosphatase	Mitogen activated kinases: p38 MAP kinase
Inhibitor kappa B kinase (IKK)
PTEN phosphatase
Janus kinase
others	Ubiquitin ligase
luciferase
peroxiredoxins
Transcription factors	Transcription factors and their inhibitors	NF-kB / super repressor IkB
MyoD
Tbxl8 (T-box transcription factor 18)
p53
HMGB1 (High mobility group box 1 protein)
Antibodies	Antibodies and associated peptides	pYSTAT3 intrabody

others	unclassified	Pro-apoptolic proteins: Bax
Anti-apoptotic proteins: BcL-xL
Multifunctional signal molecules: A1MP (Aminoacyl-lRNA synthetaseinteracting multifunctional proteins)
Fluorescent proteins (mCherry, GFP)
Nucleic acid-binding proteins (ex, RNPs)

[144] ]145] <Enzymes>

J146] Enzymes are biological catalytic molecules accelerating chemical reactions in living organisms. Enzymes bind to their substrates and facilitate the reaction rate by lowering its activation energy. Enzymes can be classified as follows; proteases, nucleases, hydrolytic enzymes, kinases, phosphatase and other types of enzymes.

] 147] The target proteins loaded in the exosomes in the present invention include enzymes and their regulators. Examples of the target proteins are listed, but not limited to, in the following description,

1148] [ 149] - Proteases and their inhibitors ]150] MMPsandTIMP

1151 ] Matrix metalloproteinases (MMPs), also known as malrixins, are calcium-dependent zinc-containing endopeptidases. MMPs arc capable of degrading all kinds of extracellular matrix proteins and known to be involved in the cleavage of cell surface receptors, the release of apoplolic ligands (such as the FAS ligand), and chemokine/ cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.

1152] The matrix metalloproteinases are inhibited by specific endogenous tissue inhibitors of metalloproteinases (TIMPs), which comprise a family of four protease inhibitors: TIMP1, TIMP2, T1MP3 and T1MP4.

]153] The balance of MMPs and TIMPs plays an important role in tissue remodeling associated with various physiological or pathological processes such as morphogenesis, angiogenesis, tissue repair, cirrhosis, arthritis, and metastasis. MMP-2 and MMP-9 are thought to be important in metastasis. MMP-I is thought to be important in rheumatoid arthritis and osteoarthritis. Dysregulation of the balance between MMPs and TIMPs is also a characteristic of acute and chronic cardiovascular diseases.

J154] The exosomes comprising MMPs and TIMPs arc prepared by expressing a fusion protein composed of an exosomc specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with MMPs or TIMPs can be used to treat MMP-associated diseases including rheumatoid arthritis.

1155]

1156] Caspases and their inhibitors

1157] Caspases (cysteine-aspartic proteases, cysteine aspartases or cysteine-dependent aspartate-directed proteases) are a family of protease enzymes playing essential roles in programmed cell death including apoptosis, pyroplosis and necroptosis. These forms of cell death are important for protecting an organism from stress signals and pathogenic attack. Caspases also have a role in inflammation, whereby it directly processes proinflammatory cytokines such as pro-ILip. These arc signaling molecules that allow recruitment of immune cells to an infected cell or tissue. There arc other identified roles of caspases such as cell proliferation, tumour suppression, cell differentiation, neural development and axon guidance and ageing.

[158] Caspase deficiency has been identified as a cause of tumor development. Tumor growth can occur by a combination of factors, including a mutation in a cell cycle gene which removes the restraints on cell growth, combined with mutations in apoptotic proteins such as Caspases that would respond by inducing cell death in abnormally growing cells.

]159] Conversely, over-activation of some caspases such as caspase-3 can lead to excessive programmed cell death. This is seen in several ncurodegcncrative diseases where neural cells are lost, such as Alzheimer’s disease. Caspases involved with processing inflammatory signals are also implicated in disease. Insufficient activation of these caspases can increase an organism’s susceptibility to infection, as an appropriate immune response may not be activated. The integral role caspases play in cell death and disease has led to research on using caspases as a drug target. For example, inflammatory caspase-1 has been implicated in causing autoimmune diseases.

[160] The exosomes comprising caspases and their inhibitors are prepared by expressing a fusion protein composed of an exosomc specific marker and a target protein massively in the cell producing (he exosomes at a high concentration. The exosomes loaded with caspases or their inhibitors can be used to treat caspase-associated diseases including ncurodegcncrative diseases or autoimmune diseases.

[161] [162] Cathepsins and their inhibitors [ 163] Cathepsins are proteases found in all animals as well as other organisms. There arc approximately a dozen members of this family, which arc distinguished by their structure, catalytic mechanism, and which proteins they cleave. Most of the members

1164]

1165] become activated at the low pH found in lysosomcs. Thus, the activity of this family lies almost entirely within those organelles.

Calhepsins have been implicated in cancer, stroke, Alzheimer’s disease, arthritis, Ebola, COPD, chronic periodontitis, pancreatitis and several ocular disorders including kcratoconus. Especially for cancer, cathcpsin D is a mitogen and it attenuates the antitumor immune response of decaying chemokines to inhibit the function of dendritic cells. Calhepsin B and L are involved in matrix degradation and cell invasion.

The exosomes comprising cathepsins and their inhibitors are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes al a high concentration. The exosomes loaded with cathepsins or their inhibitors can be used to treat varying calhepsin-associated diseases including cancer and Alzheimer’s disease.

1166]

1167]

U68]

1169]

- Nucleases

Cre recombinase

Crc recombinase is the protein isolated from Pl bacteriophage, and induces recombination by detecting two different loxP region. The loxP is DNA fragment with 34 bp and is composed of two 13 bp palindromic sequence on both extremes and 8 bp asymmetrical core spacer on middle. The Cre recombinase binds to palindromic sequence, change the spacer region of DNA after cutting, and then recombine DNA. Excision or inversion of DNA sequence between two different lowP regions based on the directionality of spacer. The excision or inversion is occurred if direction of lowP region is same or reverse, respectively.

1170]

t>

1171] [DNA deletion by Cre recombinase]

1172] f 173] One of the representative examples of Cre rccombinasc utilization is the conditional knockout mouse which can inhibit mutated period and expressed tissues of specific gene. This technology is that eliminating specific target gene in some isolated ceils by producing loxP inserted mouse between front and end of specific target gene, mating with Crc-cxprcssing transgenic mouse, or directly treating Cre rccombinasc to specific cell. The conditional knockout mouse is efficient to confirm the function of specific gene by expressing such gene, which is lethal in early phase of embryo development, in late phase of embryo development or adult.

1174] The present invention provides exosomes loaded with cre rccombinasc protein and confirmed that cre rccombinasc protein was delivered to the cytosol of the target cells. The results indicates (hat the exosome of the present invention loaded with cre recombinasc protein can be used for conditional gene manipulation.

1175]

J176] Crispr/Cas9 (177] CRISPR-Cas9 is an RNA-based artificial restriction enzyme that makes DNA correction be possible by restricting specific region of genes. Recently, Il is remarkably spotlighted as (he key clement of genetic engineering.

1178] CRISPR, which is kind of palindromic sequence, is the abbreviated form of

Clustered regularly-interspaced short palindromic repeats and first observed acquired immunity system of bacterium. Firstly, Cas9 protein recognizes and restricts invaded virus. Then the restricted virus sequence is inserted into CRISPR sequence, and combined virus and CRISPR sequence is transcribed as RNA. This RNA is used in formation of Cas9 complex. After this process, transcribed ‘CRISPR + virus sequence’ is combined with Cas9 and eliminates same invaded virus faster than Cas9 alone. This mechanism can be applied in genetic engineering by combining target sequence with Cas9 complex to restrict target sequence.

[179] Cpfl is protein with similar function with Cas9 protein from aforementioned engineered endonuclease CRISPR-Cas9 system. As following figure, Cpfl recognizes protospace adjacent motif (PAM) sequence unlike Cas9. It can be used on the region unrecognized by Cas9, and especially it is more practical because short crispr RNA (crRNA) alone can be worked. In case of Cas9, IracrRNA is additionally needed.

11801

1181 ] [Comparison between Cas9 and Cpfl proteinl

1182] [183] The present invention provides exosomes loaded with Cas9 or Cpl’l protein and confirmed that Cas9 or Cpf 1 protein was delivered to the cytosol of the target cells. The results indicates that the exosome of the present invention loaded with Cas9 or Cpfl protein can be used for removing, adding or altering sections of the DNA sequence .

[184] [185] Caspase-activated DNase [186] Caspase-Activated DNase (CAD) or DNA fragmentation factor subunit beta (DFFB) is a protein that in humans is encoded by the DFFB gene. Il breaks up the DNA during apoptosis and promotes cell differentiation. It is usually an inactive monomer inhibited by 1CAD. This is cleaved before dimerization.

1187] Apoptosis is a cell death process (hat removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspasc-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF, DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis.

1188] The exosomes comprising Caspase-activated DNase arc prepared by expressing a fusion protein composed of an exosomc specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with Caspase-activated DNase can be used to regulate apoptosis in diverse systems.

1189]

1190] - Hydrolytic enzymes

1191 ] Lysosomal enzyme including Beta-glueocerebrosidase

1192] Lysosomal storage disorder is the disease because of storage of materials degraded by lysosome according to the innate deficiency of lysosomc. One of the common lysosomal storage disorder is Gaucher disease which is induced by genetic deficiency of β-glucocerebrosidase (GBA), lysosomal enzyme.

] 193] Lack of GBA induces malfunction on liver, spleen, and bone marrow, and so on by storing glucoccrcbrosidase/glucosylsphingosinc on lysosomc of macrophage. Also it induces hematologic abnormality such as anemia, thrombocytopenia, and leukopenia, gepatolientalny, osteoclasia, and central nerve injury, etc.

1194] Present treatment of Gaucher disease is the enzyme replacement therapy injecting GBA analogue, cerezyme, by intravenous injection. However, these kinds of protein drugs have various disadvantage such as short half-life in blood, low efficiency because of antibody production, difficulty of delivery to lysosome, and the impossibility on applying neurogenic Gaucher disease, etc.

1195] The present invention provides exosomes loaded with GBA{ β-glucoccrcbrosidase) protein and confirmed that GBA(fi-glucoccrebrosidasc) protein was delivered to the cytosol of the target cells. The results indicates that the exosome of the present invention loaded with GBA^-glucocerebiOsidase) protein can be used for treatment of Gaucher disease.

U96]

1197] - Kinases and phosphatase

1198] Mitogen activated kinases: p38 MAP kinase

1199] P38 mitogen-activated protein kinases arc a class of mitogen-activated protein kinases (MAPKs) that are responsive to stress stimuli, such as cytokines, ultraviolet irradiation, heal shock, and osmotic shock. P36 MAP kinase are involved in cell differentiation, apoptosis and autophagy.

[200] P38 MAP Kinase (MAPK) participates in a signaling cascade controlling cellular responses to cytokines and stress. P38 inhibitors are being sought for possible therapeutic effect on autoimmune diseases and inflammatory processes.

[201 ] The exosomes comprising p38 MAPK and its inhibitor arc prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with p38 MAPK or its inhibitors can be used to treat p38 MAPK-associatcd diseases including autoimmune diseases.

[202] [203] Inhibitor kappa B kinase (IKK) [204] The IkB kinase (IKK) is an enzyme complex that is involved in propagating the cellular response to inflammation. The IkB kinase enzyme complex is pail of the upstream NF-κΒ signal transduction cascade. The IkBce (inhibitor of kappa B) protein inactivates the NF-κΒ transcription factor by masking the nuclear localization signals (NLS) of NF-κΒ proteins and keeping them sequestered in an inactive state in the cytoplasm. IKK phosphorylates the inhibitory ΙκΒα protein. This phosphorylation results in the dissociation of ΙκΒα from NF-κΒ. NF-kB, which is now free, migrates into the nucleus and activates the expression of at least 150 genes; some of which arc anti-apoptotic.

[205] IkB kinase activity is essential for activation of members of the nuclear factor-kB (NF-κΒ) family of transcription factors, which play a fundamental role in lymphocyte immune-regulation. Activation of the canonical NF-κΒ pathway begins in response to stimulation by various pro-inflammatory stimuli, including lipopolysaccharidc (LPS) expressed on (he surface of pathogens, or the release of pro-inflammatory cytokines such as tumor necrosis factor (TNF) or interleukin-1 (IL-1). Following immune cell stimulation, a signal transduction cascade leads to the activation of the IKK complex, an event characterized by the binding of NEMO to the homologous kinase subunits IKK-ct and ΙΚΚ-β.

[206] Though functionally adaptive in response to inflammatory stimuli, deregulation of NF-κΒ signaling has been exploited in various disease states. Increased NF-κΒ activity as a result of constitutive IKK-mcdiated phosphorylation of ΙκΒα has been observed in (he development of atherosclerosis, asthma, rheumatoid arthritis, inflammatory bowel diseases, and multiple sclerosis. Specifically, constitutive NF-κΒ activity promotes continuous inflammatory signaling at the molecular level that translates to chronic inflammation phcnotypically. Furthermore, the ability of NF-kB to simultaneously suppress apoptosis and promote continuous lymphocyte growth and proliferation explains its intimate connection with many types of cancer.

[207] The exosomes comprising IKK are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with IKK can be used lo treat NF-KB-associated diseases including cancers.

[208] [209] PTEN phosphatase [210] Phosphatase and tensin homolog (PTEN) is identified as a tumor suppressor protein. Mutations of this gene arc a step in the development of many cancers. The protein contains a lensin-like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dcphosphorylates phosphoinositide substrates. Il negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphatc in cells and functions as a tumor suppressor by negatively regulating Akt/PKB signaling pathway.

[211] PTEN loss or mutation is closely related with cancer, non-cancerous neoplasia and autism. Especially during tumor development, mutations and deletions of PTEN occur that inactivate its enzymatic activity leading to increased cell proliferation and reduced cell death. Frequent genetic inactivation of PTEN occurs in glioblastoma, endometrial cancer, and prostate cancer; and reduced expression is found in many other tumor types such as lung and breast cancer. Furthermore, PTEN mutation also causes a variety of inherited predispositions lo cancer.

[212] Mutations in the PTEN gene cause several other disorders that, like Cowden syndrome, are characterized by the development of non-cancerous tumors called hamartomas. These disorders include Bannayan-Riley-Ruvalcaba syndrome and Protcus-likc syndrome. Together, the disorders caused by PTEN mutations arc called PTEN hamartoma tumor syndromes, or PHTS. Mutations responsible for these syndromes cause the resulting protein lo be non-functional or absent. The defective protein allows the cell to divide in an uncontrolled way and prevents damaged cells from dying, which can lead to the growth of tumors, [213] The exosomes comprising PTEN are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes al a high concentration. The exosomes loaded with PTEN can be used lo treat varying types of cancers.

[214] ]215] Janus kinase [216] Janus kinase (JAK) is a family of intracellular, nonreccptor tyrosine kinases that transduce cytokine-mediated signals via the JAK-STAT pathway. Since members of the type I and type II cytokine receptor families possess no catalytic kinase activity, they rely on the JAK family of tyrosine kinases to phosphorylate and activate downstream proteins involved in their signal transduction pathways. After the receptor associates with its respective eytokine/ligand, it goes through a conformational change.

bringing the two JAKs close enough to phosphorylatc each other. The JAK autophosphorylation induces a conformational change within itself, enabling it to transduce the intracellular signal by further phosphorylating and activating transcription factors called STATs (Signal Transducer and Activator of Transcription). The activated STATs dissociate from the receptor and form dimers before translocating to the cell nucleus, where they regulate transcription of selected genes.

(217] Some examples of the molecules that use the JAK/STAT signaling pathway are colony-stimulating factor, prolactin, growth hormone, and many cytokines. JAK inhibitors are under development for (he treatment of psoriasis, rheumatoid arthritis, polycythemia vera, alopecia, essential thrombocylhemia, ulcerative colitis, myeloid metaplasia with myelofibrosis and vitiligo.

[218] The exosomes comprising JAK and its inhibitors are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes al a high concentration. The exosomes loaded with JAK or its inhibitors can be used to treat JAK-associated diseases including cancers.

1219] ]220] - Others

1221 ] Ubiquitin ligase

1222] A ubiquitin ligase (also called an E3 ubiquitin ligase) is a protein that recruits an E2 ubiquitin-conjugating enzyme that has been loaded with ubiquitin, recognizes a protein substrate, and assists or directly catalyzes the transfer of ubiquitin from the E2 to the protein substrate. The ubiquitin is attached to a lysine on the target protein by an isopeplide bond. E3 ligases interact with both the target protein and the E2 enzyme, and so impart substrate specificity to the E2, [223] Ubiquitination by E3 ligases regulates diverse areas such as cell trafficking, DNA repair, and signaling and is of profound importance in cell biology, E3 ligases arc also key players in cell cycle control, mediating the degradation of eyclins, as well as cyclin dependent kinase inhibitor proteins.

[224] E3 ubiquitin ligases regulate homeostasis, cell cycle, and DNA repair pathways, and as a result, a number of these proteins are involved in a variety of cancers, including famously MDM2, BRCA1, and Von Hippel-Lindau tumor suppressor. For example, a mutation of MDM2 has been found in stomach cancer, renal cell carcinoma, and liver cancer (amongst others) to deregulate MDM2 concentrations by increasing its promoter’s affinity for the Spl transcription factor, causing increased transcription of MDM2 mRNA.

1225] The exosomes comprising Ubiquitin ligase arc prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the ceil producing the exosomes at a high concentration. The exosomes loaded with

Ubiquitin ligase can be used to treat ubiquitination-associatcd diseases including cancers.

1226] [227] Luciferase [228] Luciferase is a generic term for the class of oxidative enzymes that produce bioluminescence, and is usually distinguished from a photoprotcin. Luciferases are widely used in biotechnology, for microscopy and as reporter genes, for many of the same applications as fluorescent proteins. However, unlike fluorescent proteins, luciferases do not require an external light source, but do require addition of lucifcrin, the consumable substrate.

[229] All luciferases are classified as oxidoreduclases (EC 1.13,12,-), meaning they act on single donors with incorporation of molecular oxygen. Because luciferases arc from many diverse protein families (hat arc unrelated, there is no unifying mechanism, as any mechanism depends on the luciferase and luciferin combination. However, all characterized luciferase-luciferin reactions to date have been shown (o requite molecular oxygen at sonic stage.

[230] In biological research, luciferase is commonly used as a reporter to assess the transcriptional activity in cells that are transfected with a genetic construct containing the luciferase gene under the control of a promoter of interest. Additionally proluminescent molecules that are converted to lucifcrin upon activity of a particular enzyme can be used to delect enzyme activity in coupled or two-step luciferase assays. Such substrates have been used to detect caspase activity and cytochrome P450 activity, among others. Luciferase can also be used to detect the level of cellular ATP in cell viability assays or for kinase activity assays. Luciferase can act as an ATP sensor protein through biotinylation. Biotinylation will immobilize luciferase on the ccll-surlace by binding to a streptavidin-biotin complex. This allows luciferase to detect the efflux of ATP from the cell and will effectively display the real-time release of ATP through bioluminescence. Luciferase can additionally be made more sensitive for ATP detection by increasing the luminescence intensity by changing certain amino acid residues in the sequence of the protein.

[231 ] Whole animal imaging (referred to as in vivo or, occasionally, ex vivo imaging) can be performed using luci(erase-expressing cell line injection. Different types of cells (e.g. bone marrow stem cells, T-cells) can be engineered to express a luciferase allowing their non-invasive visualization inside a live animal using a sensitive chargecouple device camera (CCD camera).This technique has been used to follow tumorigenesis and response of tumors to treatment in animal models.

[232] The present invention prepared exosomes loaded with luciferase protein and confirmed that luciferase protein was delivered to the cytosol of the target cells. The results indicates that the exosome of the present invention loaded with lucifcrase protein can be used for cell viability assay, kinase activity assay and whole animal imaging, [233] [234] Peroxiredoxins [235] Peroxiredoxin (Prx) is representative antioxidant enzyme in cytoplasm and obtain 0.1 ~ 0.8 % of water-soluble protein in mammalian cells. Prx has the role to reduce hydroperoxide to HiO and ROH- by receiving 2c- in cells. Prx also involves in cell proliferation, differentiation, death, and cell signal transduction by participating the formation and elimination of H₃O₂ (nmol concentration). Prx is classified more specifically into 1-Cys Prx, or 2-Cys Prx based on the number of cysteine amino acid. Furthermore, 2-Cys prx is subdivided into ‘typical’ or ‘atypical’ based on structural, and mechanistic difference. All three Prx have difference in oxidation-reduction from second process of formation of Cys-SOH. Prx 1-Prx IV are typical 2-Cys Prx, and Prx V is atypical 2-Cys Pre, and Prx VI is I-Cys Prx. Some cases of 2-Cys Prx form oligomer.

[236] Prx 1, and 11 involve in activation of receptor-signaling pathway by regulating the concentration of H₂O₂ in cell generated by growth factor and TNF-α. Specifically, Prx II has the role in protecting cells from stimulus of cell-death inducing factor such as scrum starvation, ceramide, and cpotosidc.

]237] In normal cells, Prx I has the role to maintain activity of PTEN phosphatase by inhibiting its oxidation. However, in case of increased oxidative stress, the activity of PTEN is inhibited by H₂O₂ through separation of Prx from PTEN by irreversible oxidation. Consequently, it induces tumor through continuous activation of cell proliferating signal such as Akt.

[238] It has a significant relation with disease that quantitative change of Prx in cell.

During the process of cancer development, arteriosclerosis, respiratory inflammation, osteoporosis, obesity, and degenerative dementia, quantitative change of reactive oxygen species has a close connection.

[239] The present invention provides exosomes loaded with Peroxiredoxin I or Peroxiredoxin II protein and confirmed that Peroxiredoxin 1 or Peroxiredoxin II protein was delivered to the cytosol of the target cells. The results indicates that the exosome of the present invention loaded with Peroxiredoxin I or Peroxiredoxin II protein can be used for treatment of reactive oxygen-related diseases.

[240] [241] <Transcription factors>

[242] Transcription factors arc proteins regulating mRNA transcription from DNA in eukaryotes. Transcription factors are associated with the basal transcription regulation.

organism development, response to intercellular signals or environment, cell cycle control and pathogenesis.

(243] The target proteins loaded in the exosomes in the present invention include transcription factors and their regulators (enhancers or inhibitors). Examples of (he target proteins arc listed, but not limited to, in the following description.

1244]

1245] - Transcription factors and their regulators

1246] NF-kB regulator, super-repressor IkB ]247] NF-κΒ is the major transcription factor inducing the inflammatory response, and regulates the expression of inflammatory-related genes in various types of cells especially immune cells. Therefore, it can be effective therapeutic strategy for incurable chronic inflammatory disease such as rheumatoid arthritis, sepsis, and psoriasis that selectively inhibits the ovcractivc NF-κΒ signaling pathway in immune cells. In addition, activation of NF-κΒ has the role that inhibits apoptosis by increasing the expression of anti-apoptotic factors. From (his role, continuous activation of NF-κΒ signaling pathway in cancer is the cause for anticanccr drug resistance and then decreases the therapeutic effects of anticanccr drugs.

1248] Most NF-κΒ is on inactive phase by binding with IkB, which is the inhibitory protein of NF-κΒ, in normal cells. IkB Kinase (IKK) complex activated by various stimuli such as TNF-α and LPS phosphorylatcs IkB. The phosphorylalcd IkB is then ubiquitinated and finally degraded by proteasome. Through degradation of IkB, NF-kB (p50/p65) bound on IkB passes through nuclear membrane. After passing, it activates mRNA transcription by binding on the promolor region of target genes in nucleus. This is the important element of immune response that induces transcription of cytokine and inflammatory mediator such as iNOS, COX-2, NO, PGE2, TNF-α, and IL-1 (Lappas et al.. Biol. Rcprod. 67:668673, 2002).

]249] Super-repressor IkB which is S32A and S36A mutant form of IkB can continuously inhibit NF-κΒ because it is not phosphorylalcd by IkB Kinase and degraded by proteasome. Therefore, It has the great potential as treatment for various inflammatory diseases.

1250] The present invention provides exosomes loaded with Super-repressor IkB protein and confirmed that Super-repressor IkB protein was delivered to the cytosol of the target cells. The results indicates that the exosome of the present invention loaded with Super-repressor IkB protein can be used for treatment of inflammatory diseases.

1251]

1252] MyoD

1253] MyoD is a protein that plays critical role in regulating muscle differentiation. MyoD belongs to a family of proteins known as myogenic regulatory factors (MRFs). MyoD is known Io have binding interactions with hundreds of muscular gene promoters and to permit myoblast proliferation. Also one of the main functions of MyoD is to remove cells from the cell cycle by enhancing the transcription of p21 and myogenin,

1254] The exosomes comprising MyoD protein are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes al a high concentration. The exosomes loaded with MyoD can be used to treat myoblast-associated diseases.

1255] [256] Tbx 18 (T-box transcription factor 18) [257] Tbxl 8 codes lor a member of an evolutionarily conserved family of transcription factors that plays a crucial role in embryonic development, Tbx 18 is characterized by the presence of the DNA-binding T-box domain and it belongs to the vertebrate specific Tbxl sub-family. Tbx 18 acts as a transcriptional repressor by antagonizing transcriptional activators in the T-box family. Tbx 18 is required in various developmental process in tissues and organs, including the heart and coronary vessels, the ureter and the vertebral column. It is also required lor sinoatrial node (SAN) head area.

[258] Tbxl 8 transduction is a method of turning on genes in heart muscle cells as a treatment for certain cardiac arrhythmias. In a healthy heart, sinoatrial nodal cells act as the heart’s pacemaker and cause the heart to beat in a regular rhythm. The problem in sick sinus syndrome is that SA node is not functioning properly and is causing an irregular heartbeat. Expression of Tbx 18 using adenovirus into atrial myocytes converts atrial muscle cells into SA node cells that initiate the heartbeat. Tbx 18 can be a one of many forms of gene therapy that can cure cardiac arrhythmias.

]259] The exosomes comprising Tbx 18 protein are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with Tbxl8 protein can be used for the treatment of sick sinus syndrome.

1260] [261] p53 [262] Tumor protein p53 is known as the guardian of the genome because it conserves the stability of genome by preventing genome mutation. p53 can activate DNA repair proteins when DNA has sustained damage. In addition, p53 can arrest growth by holding the cell cycle at the Gl/S regulation point on DNA damage recognition. Upon DNA damage and it is irreparable, p53 can induce apoptosis. Lastly, p53 is essential for the senescence response to short telomeres. p53 becomes activated in response to myriad stressors, including DNA damage, oxidative stress, osmotic shock, ribonucleotide depletion and deregulated oncogene expression, ]263] If the p53 is damaged, tumor suppression is severely compromised. People who inherit only one functional copy of p53 gene will most likely develop tumors in early adulthood. Increasing the amount of p53 may seem a solution for treatment of tumors or prevention of their spreading,

1264] The exosomes comprising p53 protein are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes al a high concentration. The exosomes loaded with p53 protein can be used for the treatment of varying types of cancers,

1265] [266] HMGB1 (High mobility group box 1 protein) [267] HMGB 1 is among the most important chromatin proteins like histones. In the nucleus, HMGB 1 interacts with nucleosomes, transcription factors and histones. This nuclear protein organizes the DNA and regulates transcriptions. After binding,

HMGB1 bends DNA, which facilitates the binding of other proteins. It also interacts with nucleosomes to loosen packed DNA and remodel the chromatin.

]268] HMGB! is secreted by immune cells through leaderless secretory pathway. Activated macrophages and monocytes secrete HMGB 1 as a cytokine mediator of inflammation. Antibodies that neutralize HMGB 1 confer protection against damage and tissue injury during arthritis, colitis, ischemia, sepsis, etc.

]269] The exosomes comprising HMGB 1 protein are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with HMGB1 protein can be used for the treatment of inflammatory diseases.

1270] ]27I] NeuroDl [272] Neurogenic differentiation!, also called p2, is a transcription factor of the NcuroD(ype, it mediates transcriptional activation by binding Ιο E box-containing promoter consensus core sequences 5’-CANNTG-3’. Il is contributed to the regulation of several cell differentiation pathways. It promotes the formation of early retinal ganglion cells, inner car sensory neurons and granule cells forming cither the cerebellum or the dentate gyrus cell layer of the hippocampus, endocrine islet cells of the pancreas and enteroendocrine cells of the small intestine.

]273] The exosomes comprising NeuroDl protein are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with NeuroDl protein can be used for the regulation of neuron development.

1274] [275 ] Tumor-associated macrophages (TAMs) are a type of cell belonging to the macrophage lineage. They are found in close proximity or within tumor masses. TAMs arc derived from circulating monocytes or resident tissue macrophages, which form the major leukocytic infiltrate found within the stroma of many tumor types. TAMs have been linked to poor prognosis in breast cancer, ovarian cancer, types of glioma and lymphoma; better prognosis in colon and stomach cancers and both poor and better prognoses in lung and prostate cancers.

[276J TAMs are classified into two major phenotypes, Μ1 and M2. M1 TAMs suppress cancer progression, while M2 TAMs promote it. Several transcription factors are associated with the transition of M2 macrophage to Μ1 macrophage. The target proteins loaded in the exosomes in the present invention include transcription factors associated with (he M2 (ο Μ1 conversion of macrophage. Examples of the target proteins are listed, but not limited to, in the following description.

[277] [278] IRF5 [279] 1RF5 is a member of the interferon regulatory factor, a group of transcription factor,

Il has role in virus-mediated activation of interferon and modulation of cell growth, differentiation, apoptosis and immune system activity. IRF5 work by directly interacting with DNA or with other proteins.

[280] IRF5 acts as a molecular switch that controls whether macrophages will promote or inhibit inflammation. Blocking the production ol'IRF in macrophage can help treat a wide range of autoimmune disease and upregulating 1RF5 levels can help treat people whose immune system are weak or damaged.

[281] The exosomes comprising IRF5 protein are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with IRF5 protein can be used for macrophage transition from M2 to Ml for the treatment of varying types of cancers.

[282] [283] 1RF3 [284] IRF3 is a member of the interferon regulatory factors, a group of transcription factor. IRF3 includes functional domains, nuclear export signal, a DNA-binding domain, a Cterminal IRF association domain and several regulatory sites. It is found in an inactive form in the cytoplasm of uninfected cells. Upon viral infection, double stranded RNA or loll-likc receptor signaling, it is phosphorylalcd by IKBKE and TBK1 kinases. This leads to dimerization and nuclear localization. IRF3 can activate distinct gene expression programs in macrophages.

[285] The exosomes comprising IRF3 protein are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with 1RF3 protein can be used for macrophage transition from M2 to Μ1 for the treatment of varying types of cancers.

[286] [287] STAT1 [288] Signal transducer and activator of transcription 1 is a transcription factor, member of the STAT protein family. STAT! can be activated by several ligands such as interferon alpha, interferon gamma, epidermal growth factor, platelet derived growth factor or interleukin 6.

[289] Following type 1IFN binding to cell surface receptors, Jak kinase gets activated and phosphorylates STAT1 and STAT2. STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor. 1SGF3 binds to the IFN stimulated response element to activate the transcription of IFN-stimulated genes.

[290] In response to type 11 IFN, STAT1 is tyrosine and serine phosphorylates. Il forms a homodimer and binds to IFN gamma activated sequence to drive the expression of target genes, inducing a cellular antiviral state.

[291 ] The exosomes comprising STAT1 protein arc prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with STATI protein can be used for the treatment of varying types of cancers.

1292] [293] SOCS3 [294] Suppression of cytokine signaling is a member of STAT-induced STAT inhibitor. STAT-induce d STAT inhibitors are cytokine-inducible negative regulators of cytokine signaling. SOCS3 is induced by various cytokines like IL6, IL 10, and IFN-gamma.

[295] Overcxprcssion of SOCS3 inhibits insulin signaling in adipose tissue and liver but not in muscle. But deletion of SOCS3 in the skeletal muscle of mice protects against the obesity. SOCS3 also contributes to both leptin resistance and insulin resistance as a result of increased ceramide synthesis. Study shows that removal of the SOCS gene prevents against insulin resistance in obesity. SOCS3 protein can bind to JAK2 kinase and inhibits the activity of JAK2 kinase.

[296] The exosomes comprising SOCS3 protein are prepared by expressing a fusion protein composed of an exosomc specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with SOCS3 protein can be used for the treatment of varying types of cancers.

[297] [298] <Anlibodics>

[299] Antibodies are the proteins that recognize and bind to their specific antigen via the

Fab’s variable region on the tip of the “Y”-shaped antibody. Antibodies can suppress the activity of the target antigen proteins by binding to them.

[300] The target proteins loaded in the exosomes in the present invention include antibodies and antibody-associated peptides. Examples of the target proteins are listed, but not limited to, in the following description.

[301] [302] - antibodies and associated peptides [303] pySTAT3 intrabody [304] STATs (Signal Transducer and Transcriptions) arc transcription factors that have been identified: ST ATI, STAT2, STAT3, STAT4, STATS (STAT5A and STAT5B), and STAT6, STAT3 proteins have C-terminal transaclivation domain (Tyrosine 705 and Serine 727 residues for the major phosphorylation sites of STAT3). Tyrosine phos phorylalion and subsequent dimerization of STAT3 promote the transportation to the nucleus and transcriptional activation.

[305] The JAK/STAT3 signaling pathway is identified in growth factor-induced activation of interferon signaling and involved in proliferation, differentiation, apoptosis, angiogenesis, oncogenesis and immunity. Therefore, STAT3 proteins can be a good target as a single agent or combination therapeutics for development of anticancer drugs.

[306] The present invention prepared exosomes loaded with pYSTAT3 inlrabody and confirmed that pYSTAT3 intrabody was delivered to the cytosol of the target cells.

The results indicates (hat the exosomc of the present invention loaded with pYSTAT3 intrabody can be used for treatment of cancer.

[307] [308] <Othcrs>

[309] - apoptosis-associated proteins [310] Apoptosis (programmed cell death) is the process for eliminating damaged cells by various factors and abnormal apoptosis induces tumorigenecily. Based on (his reason, researches about inducing apoptosis of tumor have actively progressed as tumoreliminating strategy. Condensation of chromatin by cell atrophy, apoptotic body formation, and DNA fragmentation are the features of apoptosis. The apoptosis is induced by two different routes; one is (he intrinsic pathway through mitochondria, and the other is the extrinsic pathway through death receptors. The apoptosis is regulated variously, for example activation of pro-apoptolic Bcl-2 family, segmentation of procaspase, and fragmentation of poly ADP-ribose polymerase (PARP), and so on. Especially caspases belonged to cysteine proteases arc being pro-enzyme in normally proliferated cells and activated by apoptotic inducing signals, then has the significant role in apoptosis through involving cargo proteins such as PARP.

[311] Most apoptolic stimuli induce the apoptosis of mammalian cells through the pathway controlled by members of Bel-2 gene family which arc coding homologous protein group including agonist and antagonist of apoptosis such as Bel-2, and Bcl-XL. These members share the sequence homologous domain even though (hey are regulated discriminatcly. During apoptosis, the anti-apoplotic or pro-apoplotic effect of bcl-2 and Bax(2l% identity with Bcl-2 at the protein level) is regulated by homo- and heterodimers, which are differently formed by the ratio of Bel-2 to Bax.

[312] [313] Pro-apoplotic proteins: Bax [314] Bax (Bcl-2-associaled X protein) is the one of Bcl-2 protein family, so-called Bcl-2 like protein 4. Aforementioned Bax, which binds to the externa] membrane of mitochondria and its 4 residues of C-terminal protrude on intermembrane space of mitochondria, has the role to activate apoptosis. Specific information about aforementioned protein and base sequence of its gene is noticed on NCBI (GenBank: NM_001291428, NP_001278357, etc.).

[315 ] Bax is the one of Bcl-2 gene family synthesizing pro-apoptotic protein. Bax is inhibited its transcription by mutant p53. It has well known that insertion or deletion of Bax base sequence is the cause of markedly decreased expression of Bax in cell lines of blood, colon, and lcctal cancer.

[316] It is known that Bax involves in apoptosis of neuron in development, homeostatic equilibrium of lymphatic and genital system, cell death by DNA damage, damage of ischaemia reperfusion and so on.

[317] The present invention provides exosomes loaded with Bax(Bcl-2-associated X protein) protein and confirmed that Bax(Bcl-2-associated X protein) protein was delivered to the cytosol of the target cells. The results indicates that the exosome of the present invention loaded with Bax(Bcl-2-associaled X protein) protein can be used for treatment of cancer.

[318] [319] Anti-apoplotic proteins: BcL-xL [320] B-ecll lymphoma-cxtra-largc (Bcl-xL), encoded by the BCL2-likc 1 gene, is a transmembrane molecule in the mitochondria. It is a member of the Bcl-2 family of proteins, and acts as an anti-apoplotic protein by preventing the release of mitochondrial contents such as cytochrome c, which leads to caspase activation and ultimately, programmed cell death.

[321] It is a well-established concept in the field of apoptosis that relative amounts of proand anti-survival Bcl-2 family of proteins determine whether the cell will undergo cell death; if more Bel-xL is present, then pores arc non-pcrmcablc to pro-apoptolic molecules and the cell survives. Similar to Bcl-2, Bcl-xL has been implicated in the survival of cancer cells by inhibiting the function of p53, a tumor suppressor.

[322] The exosomes comprising Bcl-xL protein arc prepared y by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing (he exosomes at a high concentration. The exosomes loaded with BclxL protein can be used for the regulation of apoptosis.

[323] [324] - etc, [325] Multifunctional signal molecules: AIMP (Aminoacyl-lRNA synthetase-interacting multifunctional proteins) ]326] Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (AIMP1) is a non-catalylic component of (he multi-synthase complex. Stimulates the catalytic activity of cytoplasmic arginyl-tRNA synthase. Possesses inflammatory cytokine activity. Negatively regulates TGF-beta signaling through stabilization of SMURF2 by binding to SMURF2 and inhibiting its SMAD7-mediated degradation. Involved in glucose homeostasis through induction of glucagon secretion al low glucose levels. Promotes dermal fibroblast proliferation and wound repair.

]327] Plays a role in angiogenesis by inducing endothelial cell migration at low concentrations and endothelial cell apoptosis at high concentrations. Induces maturation of dendritic cells and monocyte cell adhesion. Modulates endothelial cell responses by degrading HIF-1A through interaction with PSMA7.

1328] Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2) is required for assembly and stability of the aminoacyl-tRNA synthase complex.

Mediates ubiquitination and degradation of FUBPI, a transcriptional activator of MYC, leading to MYC down-regulation which is required for alveolar type II cell differentiation. Accumulates in brains affected by autosomal-recessive juvenile Parkinsonism, idiopathic Parkinson disease and diffuse Lcwy body disease.

[329] The exosomes comprising AIM Pl and A1MP2 proteins are prepared by expressing a fusion protein composed of an exosome specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with AIMP1 or AIMP2 protein can be used for multifunctional regulation.

[330] ]331] Fluorescent proteins (mCherry, GFP) [332] Fluorescent proteins arc members of a structurally homologous class of proteins that share the unique property of being self-sufficient to form a visible wavelength chromophore from a sequence of 3 amino acids within their own polypeptide sequence. It is common research practice for biologists to introduce a gene (or a gene chimera) encoding an engineered fluorescent protein into living cells and subsequently visualize the location and dynamics of the gene product using fluorescence mi31 croscopy.

[333] The most popular applications of fluorescent proteins involve exploiting them for imaging of the localization and dynamics of specific organelles or recombinant proteins in live cells. For imaging of a specific organelle, standard molecular biology techniques arc used to fuse the gene encoding the fluorescent protein to a cDNA encoding a protein or peptide known to localize to that specific organelle. This fusion is done such that the chimeric gene will be expressed as a single polypeptide, creating a covalent link between the targeting motif and the fluorescent protein. A plasmid containing the chimeric gene under control of a suitable promoter is used to transfect mammalian cells that then express the gene to produce the corresponding chimeric protein. The chimera localizes to (he target organelle and thus renders it fluorescent. Through the use of fluorescence microscopy, the morphology, dynamics, and distribution of the organelle can be imaged as a function of lime.

[334] mChcrry is a monomeric fluorescent construct with peak excilalion/emission al 587 nm/610 nm, respectively. It is resistant to photobleaching and is stable. Il matures quickly, with a t0.5 of 15 minutes, allowing it to be visualised soon after translation.

[335] [336] The green fluorescent protein (GFP) is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to tight in the blue to ultraviolet range. Although many other marine organisms have similar green fluorescent proteins, GFP traditionally refers to the protein first isolated from the jellyfish Aequorca victoria. The GFP from A. victoria has a major excitation peak al a wavelength of 395 nm and a minor one at 475 nm. Its emission peak is at 509 nm, which is in (he lower green portion of the visible spectrum.

[337] The present invention prepared exosomes loaded with mCherry or GFP protein and confirmed that mChcrry or GFP protein was delivered to the cytosol of the target cells. The results indicates that the exosome of the present invention loaded with mCherry or GFP protein can be used for imaging of the localization and dynamics of exosomes and linked proteins in live cells or animal.

[338] [339] Nucleic acid-binding proteins (ex. RNPs)

1340] Nucleoproteins are any proteins that are structurally associated with nucleic acids, either DNA or RNA. A dcoxyribonuclcoprotcin (DNP) is a complex of DNA and protein. The prototypical examples arc nueleosomes, complexes in which genomic DNA is wrapped around clusters of eight histone proteins in eukaryotic cell nuclei to form chromatin. Protamines replace histones during spermatogenesis. Deoxyribonucleoprotcins in this kind of complex inlcracl to generate a mulliprotcin regulatory complex in which the intervening DNA is looped or wound. The deoxyribonucleo32 proteins participate in regulating DNA replication and transcription.

[341] A ribonuclcoprotein (RNP) is a complex of RNA and protein. The enzyme telomerase, vault ribonueleoproteins, RNase P, hnRNP and small nuclear RNPs (snRNPs), and ribosomes are ribonueleoproteins. The ribonueleoproteins play a role of protection. mRNAs never occur as free RNA molecules in the cell. They always associate with ribonueleoproteins and function as ribonuclcoprotein complexes.

[342] The exosomes comprising DNPs or RNPs are prepared by expressing a fusion protein composed of an exosomc specific marker and a target protein massively in the cell producing the exosomes at a high concentration. The exosomes loaded with DNPs or RNPs can be used for genetic regulations or nucleic acid transportable exosomes.

[343] [344] The present invention confirmed that the cargo protein was successfully delivered to cytosol of a target cell by using the exosome containing the cargo protein therein, and thereby the present invention provides a method to treat disease using exosome by regulating intracellular signaling efficiently in cytosol.

[345] [346] Another object of the present invention is to provide a pharmaceutical composition for preventing or treating inflammatory diseases containing the exosome as an active ingredient.

[347] Another object of the present invention is to provide a pharmaceutical composition for preventing or treating cancer containing the exosome as an active ingredient.

[348] Another object of the present invention is to provide a pharmaceutical composition for preventing or treating oxygen-related diseases containing the exosome as an active ingredient.

[349] Another object of the present invention is to provide a composition for producing a conditional knockout allele of a target gene containing the exosomc as an active ingredient.

]350] Another object of the present invention is to provide a DNA sequence manipulating composition containing the exosomc as an active ingredient.

[351 ] Another object of the present invention is to provide a pharmaceutical composition for preventing or treating Gaucher’s disease containing the exosome as an active ingredient.

[352] [353] To develop an efficient method for preparing exosome containing a cargo protein, the present inventors studied with various attempts. In the course of our study, the inventors paid attention on exosome specific markers (CD9, CD63, CD81, and CD82). These markers belong to the tclraspanin family and arc commonly 4-timcs penetration type membrane proteins. The present inventors predicted that when a cargo protein was conjugated on the membrane protein of exosome, the cargo protein would be relatively easily included in the inside of exosome.

[354] By expressing the fusion protein composed of an exosome specific marker which is rich especially on exosome membrane and can penetrate cell membrane and a cargo protein in the cell producing exosome endogenously at a high concentration, exosome containing a cargo protein can be massively produced.

[355] Particularly, the method for preparing exosome comprising a cargo protein of the present invention is characterized by introduction of polynucleotide encoding the fusion protein composed of an exosome specific marker and a cargo protein in the cell producing exosome.

[356] Al this lime, in (he prepared exosome, a cargo protein is fused with an exosome specific marker embedded in exosome membrane.

[357] [358] The said cargo protein is bound to the membrane protein of exosome and is not separated even after it arrives al the target cell. To solve (his problem, various attempts have been made. As a result, a technique has been developed for the preparation of exosome comprising a cargo protein by conjugating a cargo protein temporarily to a marker protein. For example, a photo-specific binding protein such as Cl BN and CRY2 can be used herein. Particularly, C1BN is expressed in a form fused with CD9, which is one of the marker proteins. In the meantime, a gene encoding the fusion protein of CRY2 and a cargo protein is introduced in the cell producing exosome. The CIBN-CD9 fusion protein expressed in (he exosome production cell can be included due to CD9. At this time, when the cell is irradiated with blue LED light, CRY2 domain of the cargo protein-CRY2 fusion protein expressed in the exosome production cell is bound to the CD9 fused CIBN domain. As a result, the reversible 'cargo proteinCRY2-C1BN-CD9 fusion protein' is produced. This fusion protein can be included in the inside of exosome due to CD9. Once exosome containing a cargo protein therein is produced and the irradiation with the blue LED light is terminated, CIBN-CRY2 link is broken and thereby the cargo protein remains in exosome as being apart from the cell membrane of exosome, resulting in the preparation of exosome comprising the cargo protein (FIGs 5 ~ 10).

1359] [360] This kind of exosome prepared by the method of the present invention is completely different in its effect from the conventional exosome containing a target material. The conventional exosome is expressed as being fused onto an exosome specific marker in order to present a cargo protein inside of the exosome, so that the cargo protein, even though it is included in the inside of the exosome, it is not free and instead presented as being attached on the membrane of exosome, suggesting that the cargo protein cannot be separated from the membrane of exosome and therefore it can be delivered into a target cell only when the exosome is fused on the cell wall of the target cell. Moreover, even after the fusion onto the target cell, the cargo protein remains as being conjugated to the membrane of exosome. Therefore, (he probability that the cargo protein exhibits its effect in the target cell is very low. However, the exosome of the present invention presents a cargo protein which resides as free and not being conjugated on the membrane of exosome. So, when such exosome enters cytosol by endocytosis of the target cell, it does not adhere to the membrane of exosome, and when the exosome is decomposed therein, the included cargo protein can be delivered in cytosol and is free to move in cytosol of the target cell, suggesting that the cargo protein is fully active with its physiological activity in the target cell cytosol (FIG. 11), [361] The binding level of the cargo protein to the marker protein can be changed according to the intensity of the light to be irradiated. Therefore, by regulating the intensity of the light, the concentration of the cargo protein collected in exosome can be controlled.

1362] The method for preparing exosome containing a cargo protein by using a photospecific binding protein has not been reported yet and was proposed first by the present inventors.

1363] [364] Particularly, the method for preparing exosome containing a cargo protein of the present invention is composed of the following steps: (a) introducing the polynucleopeptide encoding the fusion protein (fusion protein I) composed of an exosome specific marker and the first photo-specific binding protein and the polynucleotide encoding the fusion protein (fusion protein 11) composed of a cargo protein and the second photo-specific binding protein that can be linked to the first photo-spccific binding protein in the exosome production cell; (b) irradiating the exosome production cell with light that can cause the conjugation between the first photo-specific binding protein and the second photo-specific binding protein; and (c) terminating (he irradiation after the production of exosome finished in the exosome production cell.

[365] [366] The term exosome in the present invention indicates a small vesicle with the plasma membrane structure, which is originated from an intracellular specific compartment called multivcsicular bodies (MVBs) and is released or secreted from the cell.

[367] In this invention, exosome plays a role as a carrier to deliver a cargo protein into a target cell or tissue by carrying the cargo protein in itself. At this time, the cargo protein carried by the exosome works for the target cell or tissue to help the treatment or diagnosis of a specific disease.

[368] [369] The term exosome production cell in this invention indicates the cell that is able lo produce exosome.

[370] In this invention, the exosome production cell is not limited but is preferably exemplified by B-lymphoeyte, T-lymphocyte, dendritic cell, megakaryocyte, macrophage, stem cell, and tumor cell, etc. For example, in this invention, HEK293T cell that is a kind of immortalized cell line was used as the exosome production cell.

1371] ]372] The term exosome specific marker in this invention indicates a protein which is rich on the membrane of exosome.

[373] In this invention, the exosome specific marker is not limited but is preferably exemplified by CD9, CD63, CD81, and CD82, etc. For example, in a preferred embodiment of the present invention, CD9 was used as the exosome specific marker. CD9, CD63, CD81, and CD82 arc 4-limcs penetration type membrane proteins that allow the cargo protein to be easily present in exosome when the cargo protein is bound to the membrane protein of the exosome, [374] [375J The term photo-specific binding protein in this invention is also called photoinduced heterodimer formation protein or photo-induced homodimer formation protein, which indicates a protein that is able to form a heterodimer by combining with different proteins or lo form a homodimer by combining with another protein in the same kind when (he light of a specific wavelength is irradiated.

[376] In this invention, the photo-specific binding protein is not limited but is preferably exemplified by the photo-induced heterodimer formation protein or CIB (cryplochrome-interacting basic-helix-loop-helix protein), CIBN (N-terminal domain of CIB), PhyB (phytoehrome B), PIF (phytochrome interacting factor), FKFI (Flavinbinding, Kclch repeal, F-box 1), GIGANTEA, CRY (cryplochrome), and PHR (phylolyase homologous region), etc.

]377] In particular, when the photo-specific binding protein is the photo-induced hetcrodimcr formation protein, two types of photo-specific binding protein (the first and (he second photo-specific binding proteins) can be used. When the first photo-specific binding protein is CIB or CJBN, the second photo-specific binding protein can be CRY or PHR. When the first photo-specific binding protein is PhyB, the second photospecific binding protein can be PIF. When the first photo-specific binding protein is GIGANTEA, the second photo-spceil’ic binding protein can be FKFI.

]378] For example, in a preferred embodiment of the present invention, CIBN was used as the first photo-specific binding protein, and CRY2 was used as the second photospecific binding protein. The wavelength of the light used herein was the blue light with 460 ~ 490 nm. The intensity of the light was 20 ~ 50 pW.

[379] In the meantime, in order to confirm the expression and to find out the location of the first fusion protein composed of the cxosomc specific marker and the first photospecific binding protein expressed therein, a marker protein can be fused thereto. For example, in a preferred embodiment of the invent ion, the fluorescent protein EGFP was inserted in the first fusion protein wherein CIBN and CD9 or GIGANTEA and CD arc linked together. So, the expression pattern {expression and expression level) and the intracellular location of the first fusion protein can be investigated by the expression of the first fusion protein as harboring the fluorescent protein EGFP.

[380] [381] The term cargo protein in this invention indicates a protein which is expressed as a fusion protein conjugated with the second photo-specific binding protein to locale the cargo protein inside the exosome.

[382] In this invention, the cargo protein can be carried by cxosomc after being expressed in cells. The cargo protein is not limited but is preferably a disease treating protein or disease diagnosing protein. For example, in a preferred embodiment of the present invention, mChcrry with fluorescence was used as the cargo protein.

[383] [384] An example of the cargo proteins in the present invention is selected from, but not limited to, Matrix metalloproteinases (MMPs) proteins, Tissue inhibitor of metalloprotcinases (TIMPs) proteins, caspases proteins, caspases inhibitory proteins, cathepsins proteins or cathepsin inhibitory proteins, [385] wherein, [386] MMPs proteins are such as, but not limited to, MMP1 Protein (SEQ ID NO: 13);

[387] TIMPs proteins are such as, but not limited to, TIMP1 protein (SEQ ID NO: 14), T1MP2 protein (SEQ ID NO: 15), T1MP3 protein (SEQ ID NO: 16), or T1MP4 protein (SEQ ID NO: 17);

[388] caspases proteins are such as, but not limited to, casepase 1 protein (SEQ ID NO: 18), casepase 2 protein (SEQ ID NO: 19), casepase 3 protein (SEQ ID NO:20), casepase 4 protein (SEQ ID NO:21), casepase 5 protein (SEQ ID NO:22), casepase 6 protein (SEQ ID NO:23), casepase 7 protein (SEQ ID NO:24), casepase 8 protein (SEQ ID NO:25), casepase 9 protein (SEQ ID NO:26), casepase 10 protein (SEQ ID NO:27), casepase 11 protein (SEQ ID NO:28), casepase 12 protein (SEQ ID NO:29), casepase 13 protein (SEQ ID NO:30), or casepase 14 protein (SEQ ID NO:31);

[389] caspases inhibitory proteins are such as, but not limited to, proteins inhibiting caspase proteins represented by SEQ ID NO: 18-31 or any proteins inhibiting caspase;

[390] ealhepsins proteins are such as, but not limited to, ealhepsins A protein (SEQ ID NO:32), cathepsins B protein (SEQ ID NO:33), ealhepsins C protein (SEQ ID NO:34), ealhepsins D protein (SEQ ID NO:35), cathepsins E protein (SEQ ID NO:36), cathcpsins F protein (SEQ ID NO:37), cathcpsins G protein (SEQ ID NO:38), ealhepsins H protein (SEQ ID NO:39), cathcpsins K protein (SEQ ID N0:40), cathepsins LI protein (SEQ ID NO:41), ealhepsins L2 protein (SEQ ID NO:42), ealhepsins Q protein (SEQ ID NO:43), cathepsins S protein (SEQ ID NO:44), cathcpsins W protein (SEQ ID NO:45), or cathcpsins Z protein (SEQ ID NO:46); and [391] cathepsin inhibitory proteins are such as, but not limited to, proteins inhibiting calhepsin proteins represented by SEQ ID NO:32-46 or any protein inhibiting cathepsins.

[392] ]393] Another example of the cargo proteins in the present invention is selected from, but not limited to, Cre recombinase, Cas protein, pasease-activated DNase (CAD) proteins, β-glucoccrcbrosidase (GBA), p38 mitogen-activated protein kinases, Phosphatase and tensin homolog (PTEN), Janus kinase (JAK), ubiquitin ligase, luciferasc, peroxiredoxin (Prx) I or II, protein inhibiting NF-κΒ, MyoD proteins, TbxlS proteins, p53 proteins, High mobility group box 1 (HMGB1) proteins, neurogenic differentiation! (Ncuro-Dl) proteins, Interferon regulatory factor 5 (IRF5) proteins, Interferon regulatory factor 3 (IRF3) proteins, Signal transducer and activator of transcription 1 (STAT1) proteins, Suppressor of cytokine signaling 3 (SOCS3) proteins, Signal transducer and activator of transcription 2 (STAT2) proteins, proteins inhibiting phosphorylatcd STAT3 (pySTAT3), Bax (Bcl2-associatcd X protein), B-cell lymphomaextra-large (Bcl-xL) proteins, Aminoacyl-tRNA synthetase-interacting multifunctional proteins (AIMPs), mChcrry proteins, green fluorescent proteins (GFP), or nuclcoproteins binding to nucleic acid, [394] wherein, [395] Cre recombinase recombines the DNA bctw'ccn loxP sites by recognizing them in DNA and includes, but not limited, Cre recombinase represented by SEQ ID NO: 9;

[396] Cas protein has endonuclease or nickase activity when it combines the complex with guide RNA. In some embodiment, Cas protein is Cas9 protein such as Cas protein represented by SEQ ID NO: 10, its mutant, or Cpfl protein such as amino acids represented by SEQ ID NO: 11;

[397] CAD protein is such as the amino acids represented by SEQ ID NO:47;

1398] β-glucocerebrosidase (GBA) is such as the amino acids represented by SEQ ID NO:12;

[399] p38 mitogen-activated protein kinases (p38 MAPKs) proteins are such as p38-a or its mulans and include amino acide represented by SEQ ID NOs:48-51;

[400] Inhibitor kappa B kinase (IKK) proteins are such as the amino acids represented by SEQ1DNO:83;

[401 ] Nuclear factor-kappaB (NF-κΒ) proteins are such as the amino acids represented by

SEQIDNO:84;

[402] Phosphatase and lensin homolog (PTEN) proteins are such as the amino acids represented by SEQ ID NO: 5 2;

[403] Janus kinase (JAK) proteins include JAK1, JAK2, JAK3 and TYK.2, wherein JAK1 proteins arc such as the amino acids represented by SEQ ID NO:53, JAK2 proteins arc such as the amino acids represented by SEQ ID NO:54, JAK3 proteins arc such as the amino acids represented by SEQ ID NO:55, and ΤΎΚ2 proteins are such as the amino acids represented by SEQ ID NO:56; ubiquitin ligase proteins include c-CBL, PRKN, RBX1, TRAF2 and Mdm2, wherein ubiquitin ligase proteins arc such as the amino acids represented by SEQ ID NO:57 to 61;

[404] lucilerase proteins are such as the amino acids represented by SEQ ID NO:62;

[405] peroxiredoxin (Prx) I or II has the effect of inhibiting cytotoxicity from oxidative stress, wherein peroxiredoxin I is such as the amino acids represented by SEQ ID NO: 7, and peroxiredoxin II is the amino acids represented by SEQ ID NO: 8;

[406] protein inhibiting NF-κΒ is super-repressor-IkB which inactivates NF-κΒ by binding with it in cytoplasm, whercin.lhc super-reprcs sor-ΙκΒ protein, which is S32A and S36A mutant form of IkB, is not phosphorylaled by IkB Kinase (IKK) and consequently it can continuously inhibit NF-κΒ, and NF-κΒ inhibiting proteins are such as the amino acids represented by one of SEQ ID NO: 1 to 5, exemplified by ΙκΒ-o, IkBβ, 1κΒ-ε, BCL-3 or their mutant;

]407] MyoD proteins are such as he amino acids represented by SEQ ID NO:63;

[408] TbxlS proteins are such as the amino acids represented by SEQ ID NO: 64;

[409] p53 proteins are such as the amino acids represented by SEQ ID NO: 65;

[410] High mobility group box 1 protein (HMGB1) proteins are such as the amino acids represented by SEQ ID NO: 66;

[411] Neurogenic differentiation 1 (Ncuro-Dt) proteins arc such as the amino acids represented by SEQ ID NO: 67;

[412] Interferon regulatory factor 5 (IRF5) proteins are such as the amino acids represented by SEQ ID NO: 68;

[413] Interferon regulatory factor 3 (IRF3) proteins are such as the amino acids represented by SEQ ID NO: 69;

[414] Signal transducer and activator of transcription 1 (STAT1) proteins are such as the amino acids represented by SEQ ID NO: 70;

[415 ] Suppressor of cytokine signaling 3 (SOCS3) proteins arc such as the amino acids represented by SEQ ID NO: 71;

[416] Signal transducer and activator of transcription 2 (STAT2) proteins arc such as the aniion acids represented by SEQ ID NO: 72;

[417] proteins inhibiting phosphorylaled STAT3 (pySTAT3) including pySTAT3 intrabody antibody proteins, which binds to pySTAT3 to deactivate pySTAT3, and are such as the amino acids represented by SEQ ID NO:73 or any proteins inhibiting pySTAT3;

[418] Bax (Bcl2-associated X protein) is such as the amino acids represented by SEQ ID NO: 6;

[419] B-cell lymphoma-extra-iarge (Bcl-xL) proteins are such as the amino acids represented by SEQ ID NO: 74;

[420] Aminoacyl-tRNA synthetase-interacting multifunctional proteins (AIMPs) include AIMP1 and AIMP2, wherein A1MP1 proteins arc such as the amino acids represented by SEQ ID NO:75 and AIMP2 proteins are such as the amino acid represented by SEQ ID NO:76;

[421 ] mChcrry proteins are such as the amino acids represented by SEQ ID NO:77;

[422] green fluorescent protein (GFP) arc such as the amino acids represented by SEQ ID NO:78;

[423] nucleoproteins binding to nucleic acids include deoxyribonucleoprolein (DNP) binding to DNA or ribonuclcoprotein (RNP) binding to RNA, wherein DNP includes RBBP4 or NAP1L4 and RNP include Telomerase, Heterogenous nuclear ribonuclcoprotein K (HNRNPK) and wherein nucleoprolines are such as the amino acids represented by SEQ ID NOs: 79-82, nucieosome, prolamine, small nuclear RNPs (snRNPs) or mutants thereof, or any proteins binding to nucleic acid.

[424] [425 ] The term culture in this invention indicates a method to grow cells or microorganisms in a properly controlled environment.

[426] In this invention, a transformant was cultured for 1 - 3 days and then the medium was replaced with a serum-free medium, followed by further culture for 2 ~ 5 days.

[427] In this invention, the method for culturing the transformant is any of those well known to those in the art.

[428] The said medium herein indicates a notified medium widely used for animal cell culture, which can be selected from the group consisting of commercially available scrum-free media, protein-free media, and chemically defined media.

[429] The serum-free media above are used for animat cell culture, which are free from bovine serum and are exemplified by SFM4CHO {HyClone) and EX-Cell (JHR Bioscicncc). Insulin like growth factor I (IGF-I), clhanolaminc, ferric chloride, and phosphatidyl choline can be added to the media, but not always limited thereto.

[430] The protein-free media above are animal cell culture media, from which animal originated proteins especially high molecular proteins in particular having the molecular weight of at least 10 kDa arc eliminated. The prolcin-frcc media can be ProCHO (Lonza) and PF-CHQ (HyClone), but not always limited thereto.

[431 ] The chemically defined media above arc animal cell culture media which do not include any animal originated components and instead have components all having defined chemical structures. The chemical defined media can be CDM4CH0 (HyClone), PowerCHO2CD (Lonza), and CD-op(iCHO (Life Technologies), but not always limited thereto.

1432]

1433] The term the first fusion protein in this invention indicates the fusion protein made by binding between the exosome specific marker and the first photo-spccific binding protein.

[434] In this invention, the order of arrangement of the exosome specific marker and the first photo-specific binding protein contained in the first fusion protein is not limited as long as the first photo-specific binding protein is located in the direction toward the inside of exosome when the first fusion protein is expressed in (he exosome production cell. For example, N-terminal of the first photo-specific binding protein can be conjugated to C-terminal of the exosome specific marker, )435 ] The exosome specific marker and the first photo-spccific binding protein which compose the first fusion protein arc linked directly each other or can be connected by a linker. The linker above is not limited as long as the first fusion protein is expressed in the exosome production cell with presenting the first photo-specific binding protein located in the direction toward the inside of exosome, but is preferably a peptide linker composed of amino acids and more preferably a flexible peptide linker. The peptide linker can be expressed by using an expression vector wherein the nucleic acids encoding the linker are connected with other nucleic acids encoding each domain in frame.

1436] [437] The term the second fusion protein” indicates a fusion protein in which the second photo-specific binding protein and the cargo protein are combined.

[438] In this invention, the order of arrangement of the second photo-specific binding protein and the cargo protein contained in the second fusion protein is not limited as long as the second fusion protein is located inside of exosome as being conjugated with the first photo-specific binding protein region of the first fusion protein in the exosome production cell. For example, N-terminal of the cargo protein can be conjugated to Ctcrminal of the second photo-specific binding protein.

[439] The second photo-specific binding protein and the cargo protein which compose the second fusion protein are linked directly each other or can be connected by a linker. The linker above is not limited as long as the second fusion protein is located inside of exosome as being conjugated with the first photo-spccific binding protein of the first fusion protein in the exosome production cell, but is preferably a peptide linker composed of amino acids and more preferably a flexible peptide linker. The peptide linker can be expressed by using an expression vector wherein the nucleic acids encoding the linker are connected with other nucleic acids encoding each domain in frame.

[440] In addition, each fusion protein above can include a polypeptide having the sequence wherein at least one amino acid residues are different from those in the wild type amino acid sequence of each domain included therein, Amino acid exchange in proteins and polypeptides without changing the overall activity of a molecule is well known to those in the art. The most common exchange occurs between Ala/Scr, Val/ lie, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/lle, Leu/Val, Ala/Glu, and Asp/Gly. In addition, a protein having increased structural stability against heat or pH or increased protein activity due to mutation or modification of amino acid sequence can be included.

]44I ] Lastly, the fusion protein above or the polypeptide of each domain comprising the fusion protein can be prepared by the chemical peptide synthesis method well informed to those in the art, or prepared by the following method. A gene encoding each domain is amplified by PCR (polymerase chain reaction) or synthesized by the conventional method well known to those in the art. The gene is cloned in an expression vector and expressed.

[442] In the meantime, each fusion protein can be expressed in the exosome production cell by introducing a polynucleotide encoding each fusion protein in (he exosome production cell. At this time, the polynucleotide is introduced in the exosome production cell by the conventional method well informed to those in the art. For example, an expression vector can be used for the introduction.

]443] The term expression vector” in this invention is a recombinant vector capable of expressing a target peptide in host cells. This vector indicates a gene construct containing essentia] regulators operably linked so as to express the gene insert. The expression vector includes expression control elements such as a start codon, a termination codon, a promoter, and an operator. The start codon and termination codon arc generally understood as a pail of the nucleotide sequence encoding a polypeptide. They arc supposed to he working when a gene construct is introduced and to reside in a coding sequence in frame. The promoter of the vector can be constitutive or inductive.

[444] [445] The term operably linked in this invention indicates the status when the nucleic acid expression regulation sequence functioning as usual and the nucleic acid sequence encoding a cargo protein or RNA are linked by functional linkage. For example, a promoter is operably linked to a nucleic acid sequence encoding a protein or RNA in order to affect the expression of the coding sequence. The functional linkage with an expression vector can be achieved by the recombinant DNA technology well known to those in the art, and particularly the site-specific DNA cleavage and linkage can be achieved by using the conventional enzyme welt known to those in the art.

1446] The said expression vector can include a signal sequence for the discharge of a fusion polypeptide in order to promote the separation of a protein from the cell culture medium. A specific initiation signal might be necessary for the efficient translation of the inserted nucleic acid sequence. These signals contain ATG start codon and its neighboring sequences. In some cases, an exogenous translational control signal, which may include the ATG start codon, should be provided. These exogenous translational control signals and start codon can be various natural and synthetic sources. The expression efficiency can be increased by (he introduction of appropriate transcription or translation enhancers.

1447] ]448] In a preferred embodiment of the present invention, the expression vector is able to express a cargo protein conjugated with a lag in order to confirm the insertion of a cargo protein inside the exosome. The lag herein is to confirm the presence of a cargo protein, which can be conjugated to the region opposite to the region of the second photo-specific binding protein conjugation. For example, a fluorescent protein such as a red fluorescent protein and a green fluorescent protein is used as a tag to be conjugated to C-tcrminal of a cargo protein.

]449] The cargo protein prepared as described above is expressed in the exosome production cell. Once exosome is produced, it is investigated whether or not the fluorescent protein lag is detected, by which the presence of the cargo protein in exosome can be confirmed,

1450] [451 ] The term light in this invention indicates the light to be irradiated in order to combine temporarily the first photo-specific binding protein and the second photospecific binding protein expressed in the exosome production cell.

[452] As described hereinbefore, the first photo-specific binding protein is expressed as the first fusion protein conjugated with the exosome specific marker, while the second photo-specific binding protein is expressed as the second fusion protein conjugated with the cargo protein. When the light is irradiated to the exosome production cell, the first photo-specific binding protein is combined with the second photo-specific binding protein, and as a result the fusion protein complex comprising the exosome specific marker-the first photo-specific binding protein-lhe second photo-specific binding piOtein-the cargo protein is formed temporarily. When exosome is produced in the exosome production cell, the cargo protein can be linked to the exosome due to the exosome specific marker. Al this time, the cargo protein presents inside the exosome and when the irradiation with the light is slopped after the production of the exosome, the first photo-specific binding protein is separated from the second photo-spccific binding protein and thereby the cargo protein included in the exosome is to be discharged together with the exosome as being a part of the exosome. It is preferred lor the light to be irradiated to the cell intermittently rather than continually in order to deliver the cargo protein inside the exosome more efficiently. Thai is, when the light is irradiated intermittently, the conjugation and separation of the first photo-specific binding protein and the second photo-specific binding protein repeat so that the probability that the cargo protein is introduced into the exosome can be increased.

]453] In the meantime, the wavelength of the light enough to induce the binding of the first photo-spec!fie binding protein with the second photo-specific binding protein varies from the kinds of the first and the second photo-specific binding proteins. The wavelength of the light that induces the binding of the first photo-spccific binding protein and the second photo-specific binding protein depends on the type of the proteins. So, the proper wavelength of the light can be selected as known to those in the art. For example, in order to link CRY2 to CIBN, the light with the wavelength of 460 ~ 490 nm is preferred. If the light is irradiated less than 10 minutes, CRY2 and CIBN are separated from each other. When PhyB is combined with P1F, the light with the wavelength of 650 nm is irradiated for 10 minutes. When the light with the wavelength of 750 nm is irradiated lor 5 minutes, PhyB and P1F are separated from each other. When FKF1 is combined with GIGANTEA, the light with the wavelength of 460 nm is irradiated for 30 minutes. In a preferred embodiment of the present invention, in order to induce the binding of CIBN and CRY2, the light with the wavelength of 460 - 490 nm was irradiated.

1454] [455] In a preferred embodiment of the present invention, (he CRY2/mChcrry fusion protein and the C1B/CD9 fusion protein were expressed in HEK293T, the immortalized cell line producing a large amount of exosome. As a result, the distribution of mChcrry protein uniformly distributed in cytosol was found to be in cell membrane and cndosomc-like structure membrane when the blue light was irradiated (FIG. 7). Similar results were observed when the FKF1 /mCherry fusion protein and the GIGANTEA/CD9 fusion protein were expressed in HEK293T cells (FIG. 12). The CRY2/mChcrry fusion protein and the CIBN/CD9 fusion protein were expressed in HEK293T cells, followed by irradiation with the blue light with regulating the intensity of the light. As a result, when the light was irradiated with the intensity of 20 ~ 50 pW, the level of mChcrry protein collected in exosome was the highest (FIG. 9). The exosomes isolated from the cells were treated to HT10S0 cells al the concentration of approximately 250 /ig/mf.. As a result, the exosomes did not show any specific cyto44 toxicity against the HT1080 cells and it was confirmed that the mChcrry protein was delivered in the cytosol thereof (FIG. 10).

[456] To compare the efficiency of introducing the cargo protein in exosome and the efficiency of exosome transfer to the target cell with those of the conventional methods, XPACK vector was used for the conventional method and the expression vectors of the CRY2/mChcrry fusion protein and the CIBN/CD9 fusion protein were introduced in HEK293T cells. Then, the production of the cargo protein in exosome was compared. As a result, it was confirmed that the introduction efficiency was remarkably high when the method of the present invention was used (FIG. 15). The exosome separated from the exosome production cell was treated to the target cell (HeLa) to compare the expression of the cargo protein. When the exosome separated by the method of the present invention was used, the expression of the cargo protein was the highest in the target cell (FIG. 16).

1457] [458] In another preferred embodiment of the present invention, the present invention provides a vector for the production of exosomc comprising (a) the first expression vector containing the polynucleotide encoding the fusion protein of the exosomc specific marker and the first photo-specific binding protein (the first fusion protein); and (b) the second expression vector containing the mullicloning site to which the polynucleotide encoding the cargo protein can be introduced and the polynucleotide encoding the second photo-specific binding protein to be linked to the first photospecific binding protein above.

]459] In the vector for the production of exosome provided by the present invention, the exosome specific marker, the first photo-specific binding protein, (he exosome production cell, and the second photo-specific binding protein are same as described above.

[460] [461 ] The term transformed cells for exosome production in (his invention indicates the ceils capable of producing exosomc by expressing the first fusion protein wherein the polynucleotide encoding the fusion protein (the first fusion protein) of the exosome specific marker and the first photo-specific binding protein is introduced.

[462] f463] In this invention, the second expression vector includes a polynucleotide encoding the second photo-specific binding protein and a neighboring multicloning site. When a polynucleotide encoding a cargo protein is inserted in the multicloning site, it is expressed as the fusion protein comprising the second photo-specific binding protein and the cargo protein (the second fusion protein).

[464] [465] The vector for preparing exosome provided by the present invention can contain one or more kinds of constituents, solutions, or devices usable not only for the transformed cells for exosome production and the expression vector; but also for the introduction of the expression vector; for the culture of the transformed cells for exosome production; and for the separation and purification of the exosome produced from the transformed cells for exosome production. For example, a buffer proper for the introduction of the expression vector and a medium and a vessel necessary for (he culture of the transformed cells for exosome production can be additionally included.

1466] ]467] The term “Cas protein” in this invention indicates the essential protein in CRISPR/ Cas system which form active endonuclease or nickase when Cas protein form the complex with two RNA called CRSPR RNA (crRNA) and trans-activating crRNA (IracrRNA).

]468] The term “guide RNA” in this invention indicates target DNA-specific RNA which is able to form complex with Cas protein and guides Cas protein to target DNA.

]469] In this invention, aforementioned guide RNA is able to be made by two RNA.

CRISPR RNA (crRNA) and transactivating crRNA (IracrRNA) or single-chain RNA (sgRNA) by fusing the essential parts of crRNA and IracrRNA.

]470] Aforementioned guide RNA is able to be dual RNA including crRNA and tracrRNA. If aforementioned RNA includes the essential parts and target complementary parts of crRNA and IracrRNA, any guide RNA is being able to be applied in this invention. Aforementioned crRNA is able to hybridize target DNA.

]471 ] Aforementioned guide RNA is able to include one or more additional nucleotide on 5’ terminal of single-chain guide RNA or crRNA in dual RNA, ]472] Desirably, aforementioned guide RNA is able to include two additional guanine nucleotides on 5’ terminal of single-chain guide RNA or crRNA in dual RNA. Guide RNA is able to be delivered to cell or organism as RNA or guide RNA coding DNA, Guide RNA is able to be separated RNA, RNA included in virus vector, or coded in vector. Desirably, aforementioned vector is not limited but is able to be virus vector, plasmid vector, or agrobacterium vector, ]473] Guide RNA coding DNA is able to be vector including guide RNA coding DNA sequence. For example, guide RNA is able to be delivered to cell or organism by transfecting plasmid DNA that includes isolated guide RNA or guide RNA coding sequence and promoter. By other method, guide RNA can be delivered to cell or organism by using virus-mediated gene delivery.

]474] When guide RNA is transfected into cell or organism as isolated RNA, it can be manufactured by in vitro transcription by using any in vitro transcription systems known in industry. Desirably, guide RNA is delivered to cell as isolated RNA rather than plasmid including guidc-RNA coding sequence. The term “isolated RNA” can be replaced by “naked RNA” in this invention. It is able to save cost and lime in that isolated RNA does not need cloning process. However, the usage of plasmid DNA or virus-mediated gene delivery for guide RNA transfection is not excluded.

1475] [476] The present invention provides the exosome prepared by the method of the invention in which a cargo protein is included.

[477] In another aspect, (he present invention provides an exosomc produced by the above method, wherein the ere recombinase is contained in the exosomc.

[478] In another aspect, the present invention provides an exosome prepared by the above method, wherein the Cas9 protein is contained (herein, [479] In another aspect, the present invention provides an exosomc produced by the above method, wherein GBA (β-glucoccrcbrosidasc) protein is contained therein.

[480] In another aspect, the present invention provides an exosome produced by the above method, wherein the peroxiredoxin (Prx) I or II protein is contained therein.

[481 ] In another aspect, the present invention provides an exosome produced by the above method and comprising a protein that inhibits NF-kB.

[482] In another aspect, the present invention provides an exosome prepared by the above method, wherein Bax (Bcl-2-associated X protein) protein is contained therein.

[483] ]484] The exosome prepared by the method above contains a fusion protein (the first fusion protein) composed of an exosome specific marker and the first photo-specific binding protein on the plasma membrane thereof and another fusion protein (the second fusion protein) composed of the second photo-specific binding protein that can be conjugated to the first photo-specific binding protein and a cargo protein. So, when such exosomc is treated to the target tissue cells, the second fusion protein included in the exosome can be delivered to cytosol of the target tissue cells through the fusion of the plasma membrane.

[485] [486] The said exosome containing a cargo protein can be used for the treatment of various diseases in vivo. For example, exosome containing a protein polymer (for example, antibody, etc.) showing the anticancer activity as a cargo protein is prepared, which is then treated to cancer cells. That is, the exosomc can be used as a bioeompatiblc anlicancer agent better acting than the conventional liposome.

[487] [488] This invention also provides the pharmaceutical components for inflammatory disease prevention and therapy including exosomes with NF-κΒ inhibiting protein.

[489] Aforementioned inflammatory diseases are not limited but is preferably exemplified by allergy, dermatitis, atopy, conjunctivitis, periodontitis, rhinitis, otitis media, Iaryngopharyngitis, tonsillitis, pneumonia, gastric ulcer, gastritis, Crohn’s disease, colitis, gout, ankylosing spondylitis, rheumatic fever, lupus, fibromyalgia, psoriatic arthritis, osteoarthritis, rheumatoid arthritis, periarthritis of shoulder, tendonitis, tenosynovitis, peritendinitis, myositis, hepatitis, cystitis, nephritis, sjogren’s syndrome, multiple sclerosis, acute and chronic inflammatory diseases, sepsis, and ulcerative colitis, etc.

J490] In the experimental examples in this invention, the present inventors confirmed that transfer of NF-κΒ activated by TNF-α to nucleus is inhibited by pretreating superreprcssor-lKB:EXPLOR to HcLa cell to verify inflammation inhibitory effect mediated by TNF-ct (FIG, 43. Left). In addition, inhibition of DNA binding of NF-κΒ activated by TNF-rx was confirmed (FIG. 43. Right). Also, the present inventors confirmed that symptom of arthritis is decreased in mouse model which is induced arthritis by collagen through injecting retro-orbital three limes to verify inflammation inhibitory effects, and thereby super-repressor-lKB:EXPLOR in this invention can be used as the pharmaceutical components for inflammatory disease prevention and therapy.

1491] [492J This invention also provides the pharmaceutical components for cancer prevention and therapy including exosomes with Bax (Bcl-2 associated X protein).

]493] Aforementioned cancer is not limited hut is preferably exemplified by breast cancer, colon cancer, lung cancer, small-cell lung cancer, gastric cancer, liver cancer, blood cancer, bone cancer, pancreatic cancer, skin cancer, head or neck cancer, skin or choroidal melanoma, eye cancer, peritoneal cancer, uterine cancer, ovarian cancer, rectal cancer, anal cancer, and cervical cancer, etc.

]494] In the experimental examples in this invention, the present inventors confirmed (hat cytochrome c release is increased by pretreating Bax::EXPLOR to HeLa cell, and thereby Bax:EXPLOR can be used as (he pharmaceutical components for cancer prevention and therapy.

1495] [496] This invention also provides the pharmaceutical components for anti-oxidation including exosomes with peroxiredoxin (Prx) 1 or 11.

]497] Also, this invention provides the pharmaceutical components for prevention and therapy of reactive oxygen species disease exemplified by cancer, arteriosclerosis, respiratory disease, osteoporosis, obesity, and degenerative dementia including exosomes with peroxiredoxin (Prx) J or II.

]498] Also, this invention provides the cosmetic ingredients for anti-oxidation including exosomes with peroxiredoxin (Prx) I or II.

]499] Also, this invention provides the cosmetic ingredients for anli-aging of skin including exosomes with peroxiredoxin (Prx) 1 or 11.

[500] In the experimental examples in this invention, the present inventors confirmed that cytotoxicity by oxidative stress is inhibited statistically significant by prctrcaling Prx V II::EXPLOR to HeLa cell to verify the inhibitory effect on cytotoxicity by oxidative stress induced by H₂O₂, and thereby Prx I/II::EXPLOR can be used as the pharmaceutical components for anti-oxidation or prevention and therapy of reactive oxygen species, or the cosmetic ingredients for anti-oxidation or anti-aging of skin.

1501] [502] This invention also provides the components lor creating conditional knockout allele of target gene including exosomes with Crc rccombinasc.

]503] In the experimental examples of this invention, the present inventors confirmed the expression of ZsGreen reporter protein in Cre::EXPLOR treated HT1080 cell and HeLa cell, with identical results of pCMV-Crc vector transfection as positive control, through detecting ZsGreen reporter expression after transfecting pCAGloxP-STOP-loxP-ZsGreen encoded DNA into HT1080 and HeLa cell to verify the effect of Cre recombinase (FIG. 19a and 19b). In addition, the present inventors was able to confirm the ZsGreen expression on Crc::EXPOR treated primary mouse embryo neuron performed by experiment identical to aforementioned (FIG. 20). Also, the present inventors confirmed that EYFP is expressed on Cre::EXPLOR treated group after ventrolateral injection of Cre::EXPLOR on pCAGlowP-STOP-loxP-cNpHR3.0-EYFP transgenic mouse to verify Crc-EXPLOR function in vivo (FIG, 21). Furthermore, it was confirmed that Cre::EXPLOR mainly targets neuron in mouse brain through merged neuronal region in the results of immunohistochemistry to verify Cre::EXPLOR targeting cell (FIG. 22), and thereby Cre::EXPLOR can he used as the components for creating conditional knockout allele of target gene, [-504] [505] This invention also provides the components for engineering DNA sequence including exosomes with Cas9 protein and target DNA specific guide RNA (gRNA).

[506] Aforementioned components are not limited but preferably induces mutation on normal sequence or proofreads mutation. Mutation can be naturally occurred mutation or induced by pathogenic microbes. In other word, mutation is occurred by infection of pathogenic microbes when pathogenic microbes are detected and it becomes clear that biological sample is infected. Pathogenic microbe is not limited but it can be virus or bacteria.

[507] In the experimental examples in this invention, the present inventors confirmed exosome comprising a CRISPR/Cas9 protein can be prepared with a high yield.

[508] [509] This invention also provides the pharmaceutical components for curing Gaucher disease including exosomes with [3-glucocerebrosidase (GBA).

[510] In the experimental examples in this invention, the present inventors confirmed (hat activity of β-glucocerebrosidase (GBA) is recovered by treating GBA::EXPLOR to cells from Gaucher disease patients (FIG. 30), and thereby GBA::EXPLOR can be used as the pharmaceutical components for curing Gaucher disease.

[511] [512] According to the method for preparing exosome containing a cargo protein of the invention, exosome comprising a cargo protein can be prepared with a high yield.

Also, a cargo protein presents as being separated from the membrane of exosome, so (hat it can be widely applied to treat disease.

[513]

Mode for the Invention [514] Practical and presently preferred embodiments of the present invention are illustrative as shown in the following Examples, However, it will be appreciated that those skilled in the art, on consideration of this disclosure, may make modifications and improvements within the spirit and scope of the present invention.

1515] |516] EXAMPLES [517] Example 1: Preparation of exosome [518] <1-1> Confirmation of the binding of CIBN and CRY2 for the production of exosome [519] PcDNA3.1(+) vector containing CIBN-EGFP-CD9 gene and pcDNA3.1(+) vector containing mChcrry-CRY2 gene were introduced into HEK293T cells, the exosome production cells, under the light-free condition, followed by culture for 24 hours. The medium was replaced with a serum-free medium, followed by additional culture for 48 hours. Upon completion of the culture, the cells were irradiated with the blue light with the wavelength of 460 - 490 nm. The location of red fluorescence shown in mCherry before and after the blue light irradiation was confirmed by using a confocal microscope (FIG. 7).

[520] FIG. 7 is a fluorescence image illustrating the changes in the intracellular location of mCherry protein according to the blue light irradiation in the transformed HEK293T cells introduced with CIBN-EGFP-CD9 gene and mChcrry-CRY2 gene. As shown in FIG. 7, before the blue light irradiation that could cause the binding of the photospecific binding proteins CIBN and CRY2, mCherry protein was evenly distributed in the cytosol. However, after the blue light irradiation, mCherry protein was concentrated in the membrane. This clustering of mCherry protein was analyzed to be caused by the binding of CIBN and CRY2, the photo-specific binding proteins.

[521] [522] <l-2> Confirmation of the binding of GIGANTEA and FKF1 for the production of exosome [523] Pc DN A3.1(+) vector containing GIG ANTE A-EGFP-CD9 gene and pcDNA3.1(+) vector containing mCherry-FKFI LOV gene were used in this example. The intracellular Exosome was confirmed by the same manner as described in Example <1-1>. (LOV in the FKF1LOV above is an abbreviation of lighl-oxygen-voltagc domain, which indicates the domain that binds to other proteins by light in FKF1 protein, so FKF1 and FKF1LOV are in fact the same herein), [524] Like Example <1-1>, as shown in FIG. 12, mChcrry protein was evenly distributed in the cytosol before the blue light irradiation that could cause the binding of the photo-specific binding proteins GIGANTEA and FKF1. However, after the blue light irradiation, mChcrry protein was concentrated in the membrane. This clustering of mChcrry protein was analyzed to be caused by the binding of GIGANTEA and FKF1, the photo-specific binding proteins.

[525] [526] Example 2: Exosome production and the effect of light intensity on exosome production [527] Each expression vector respectively containing CIBN-EGFP-CD9 gene and mCherry-CRY2 gene was introduced into HEK293T cells under the LED light with the wavelength of 460 nm al the intensity of 0, 5, 20, 50, and 200 pW, followed by culture for 24 hours. Then, the medium was replaced with a scrum-free medium, followed by additional culture for 48 hours. Upon completion of the culture, the culture medium was separated, which was centrifuged (3000xg, 15 minutes) to obtain the supernatant excluding cell debris, ExoQuick-TC Exosome Precipitation Solution (System Biosciences, Mountain View, California, USA) was added to the obtained supernatant at the volume of 5 times the supernatant. After (he mixing, centrifugation was performed (1500xg, 30 minutes) to obtain the precipitated exosome. The obtained exosome was suspended in PBS, resulting in the exosome suspension. The exosome suspension was filtered with a 0.2 pm filter using a syringe equipped with a 27-G needle. As a result, exosome in the single size was obtained (FIG. 8), Then, exosome lysate was prepared by using lysis buffer, followed by immune-blotting to compare the amount of mCherry protein in the exosome (FIG. 9).

[528] FIG. 9 is an immunoblot analysis image showing the results of measuring the changes oflhc content of a cargo protein (mCherry protein) captured in exosome according to the intensity of blue light. As shown in FIG. 9, when the cells were irradiated with blue light at the intensity of 20 - 50 pW, the amount of mChcrry, the cargo protein, in exosome was the highest. From the above results, it was confirmed that the content of the cargo protein captured in exosome could be regulated by con51 trolling the intensity of the light irradiated to the cells in the course of the binding of the photo-specific binding proteins.

1529]

1530] Example 3: Effect of exosome treatment (531 ] Each expression vector respectively containing CJBN-EGFP-CD9 gene and mChcrry-CRY2 gene was introduced into HEK293T cells under the LED light with the wavelength of 460 nm al the intensity of 50 pW, followed by extracting exosome by the same manner as described in Example 2. The extracted exosome was treated to HT1080 cells al the concentration of 250 /zg/inf for 24 hours. The HT1080 cells were fixed on 10% gelatin gel by adding with 0.1 M phosphate buffer (pH 7.4) containing 4% PFA and 0.01 % GA. The cells attached on the gelatin gel were cooled for a day by using liquid nitrogen. Thin sections cut in 45 nm by using cryoultramicrotomc were obtained at -120°C. The thin sections were immuno-slaincd by using anti-mChcrry antibody and Protein A-gold. MCherry protein was observed with Tecnai G2 Spirit TwinTEM (FIG. 10).

1532] FIG. 10 is an electron micrograph illustrating the results of investigation of the introduction of a cargo protein in target cells after treating the target cells (HTI080) with exosome containing the cargo protein (mCherry), wherein the left indicates the target cells not-treated with exosome and the right indicates the target cells treated with exosomc. As shown in FIG. 10, it was confirmed that the cargo protein was transferred into the target cells when the target cells were treated with the exosome of the present invention.

1533]

1534] Example 4: Analysis of exosome with cargo protein

1535] Each expression vector respectively containing CIBN-EGFP-CD9 gene and mChcrry-CRY2 gene was introduced into HEK293T cells under (he LED light with the wavelength of 460 nm at the intensity of 50 pW, followed by extracting exosome by the same manner as described in Example 2. The extracted exosome was treated to HT10S0 cells at the concentration of 250 /zg/mC for 24 hours. Then, red fluorescence was confirmed in mChcrry protein under a fluorescent microscope and the ratio of dead cells was compared between the cells treated with exosome and the cells notIreated with exosome by LDH cell death assay (FIG. 11).

[536] FIG. 11 is a set of a fluorescence image (a) illustrating the results of investigation of the introduction of a cargo protein in target cells after treating the target cells (HTI080) with exosome containing the cargo protein (mCherry); and a graph (b) illustrating the results of comparison of the ratio of apoptolic cells induced by the treatment of exosomc. As shown in FIG. 11, it was confirmed that apoptosis did not induced by the treatment of exosome.

[537] [538] Example 5: Exosome production and the comparison of introduction efficiency of a cargo protein into the produced exosome [539] <5-l> Confirmation of exosome production efficiency [540] To compare the exosome production and the introduction efficiency of a cargo protein into the exosome produced thereby according to the present invention with those of the conventional method, the expression of the cargo protein in the exosome production cells was investigated by measuring the luciferase activity therein.

[541 ] According to the conventional method, XPACK-Lucifcrasc-mCherry was introduced in HEK293T cells by using XPACK (Systems Biosciences), the commercial vector designed for exosome loading technique (XP). On the other hand, according to the method of the invention, Luciferasc-mChcrry-CRY2 and CIBN-EGFP-CD9 were introduced in HEK293T cells (EXPLOR). Then, the luciferase activity in both cells was measured to compare the efficiency of the two methods. The luciferase activity was measured according to the manufacturer's instructions (Luciferase Assay Reagent, Promcga). The standard curve of the results was plotted, and then the number of exosomes in the cells was quantitatively calculated.

[542] As shown in FIG. 14, it was confirmed that (he method using the photo-specific binding proteins C1BN andCRY2 of the present invention was significantly higher in the introduction efficiency into exosome than the conventional method (XP) (FIG. 14).

1543] [544] <5-2> Expression of a cargo protein in the produced exosome [545] The cells of Example <5-l> were cultured for 72 hours, followed by extracting exosome (Exoquick-TC, Systems biosciences). The concentration of the cargo protein included in the exosomes separated by the conventional method (XP) or the method of the present invention was compared indirectly by measuring the luciferase activity (herein. As shown in FIG. 15, it was confirmed that the method of the present invention could produce exosome containing a remarkably large amount of the cargo protein than the conventional method (FIG. 15).

[546] [547] <S-3> Comparison of the introduction efficiency of the cargo protein [548] The introduction efficiency (E) of the cargo protein was calculated by the mathematical formula below based on the luciferase activity measured in Examples <5-l> and <5-2>.

[549] [Mathematical Formula 1] [550] E = measured value of luciferase activity in produced exosome / measured value of luciferase activity in exosome production cell [551 ] As shown in FIG. 15, it was confirmed that the exosome produced using the binding ol’CRY2 and CIBN of the present invention exhibited 4 to 120 limes higher efficiency than those of the other comparative groups (FIG. 15).

[552] [553] Example 6: Comparison of exosome transfer efficiency to target cells [554] To compare the cxosomc transfer efficiency, the target cells were treated with exosome containing the cargo protein. Particularly, HcLa cells were treated with 5 x 10¹' exosomes for 24 hours, and then the fluorescence intensity expressed in the cells was measured. As shown in FIG. 16, it was confirmed that the fluorescence intensity in (he exosomc of the present invention (EXPLOR) was remarkably high (FIG. 16).

[555] Therefore, it was confirmed that the method using the exosome of (he present invention could deliver (he cargo protein to the target cells more efficiently.

[556] [557] EXPERIMENTAL EXAMPLES [558] Experimental Example 1: MMPs (Matrix metalloproteinases) [559] The binding of CIBN and CR Y2 in cells expressing CIBN-EGFP-CD9 and MMPmChcrry-Cry2 at 488 nm wavelength blue light, and the loading of MMPs within the cxosomc is evaluated.

[560] For the massive production of MMPs-loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and MMP-mCheiTy-CRY2 gene are established, and exosomes arc isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant, [561 ] Functional analysis of MMPs-loaded exosomes is performed in target cells:

[562] Target cells are treated with the MMPs-loaded exosomes to evaluate the functional enzymatic activity.

[563] Animal models arc administered with the MMPs-loaded exosomes by i.p. or i.v. to show therapeutic effect.

[564] [565] Experimental Example 2: TIMPs (Tissue inhibitor of metalloproteinase) [566] The binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and TIMPmChcrry-Cry2 al 488 nm wavelength blue light, and the loading of TIMPs within the exosome is evaluated.

[567] For the massive production of TIMPs-loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and TIMP-mChcrry-CRY2 gene arc established, and exosomes arc isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[568] Functional analysis of TIMPs-loaded exosomes is performed in target cells:

[569] Target cells arc treated with the TIMPs-loaded exosomes to evaluate the functional enzymatic activity.

[570] Animal models arc administered with the TIMPs-Ioadcd exosomes by i.p. or i.v. to show therapeutic effect.

1571] ]572] Experimental Example 3: Caspases (573] The the binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and caspase-mCherry-Cry2 at 488 nm wavelength blue light, and the loading of caspases within the exosome is evaluated,

1574] For the massive production of caspases-loaded exosomes, cells stably expressing

CIBN-EGFP-CD9 gene and caspasc-mChcrry-CRY2 gene arc established, and exosomes are isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

(575] Functional analysis of caspases-loaded exosomes is performed in target cells:

]576] Target cells arc treated with the caspases-loaded exosomes lo evaluate (he functional enzymatic activity.

1577] Animal models are administered with the caspases-loaded exosomes by i.p. or i.v. to show therapeutic effect.

1578] ]579] Experimental Example 4: Cathepsins ]580] The binding of CIBN and CRY2 in cells expressing C1BN-EGFP-CD9 and calhcpsin-mChcrry-Cry2 al 488 nm wavelength blue light, and the loading of cathepsins within the exosome is evaluated.

[581 ] For the massive production of cathepsins-loadcd exosomes, cells stably expressing CIBN-EGFP-CD9 gene and calhepsin-mCherry-CRY2 gene are established, and exosomes are isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[582] Functional analysis of cathepsins-loadcd exosomes is performed in target cells:

]583] Target cells are treated with the calhepsins-loaded exosomes lo show the functional enzymatic activity.

[584] Animal models arc administered with the calhepsins-loaded exosomes by i.p. or i.v. lo show therapeutic effect.

1585] ]586] Experimental Example 5: Cre recombinase [587] <5-l> Production of Cre rccoinbinase-loaded exosome (Crc::EXPLOR) ]588] A. Confirmation of Cre recombinase in exosome ]589] The present inventor confirmed the binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and Cre-mCherry-Cry2 to verify exosome loading of Crerecombinasc with amino acids recorded as SEQ ID NO: 9. In particular, HEK293T exosome producing cells were additionally cultured 48 hrs in Dulbecco’s modified

Eagle’s medium (DMEM) without fetal bovine serum (FBS), after 24 hrs culture with transfected pcDNA3.1(+) vector including CIBN-EGFP-CD9 gene and CremCherry-CRY2 gene in non-light condition. After finish culture, position of red fluorescence from mCherry was investigated by confocal microscopy before and after the irradiation of 488 nm wavelength blue light. This experiment was performed more than five limes.

1590] According to the results, binding between Cre-mCherry-CRY2 (red) and CIBNEGFP-CD9 was confirmed (FIG. 18) and thereby exosome loading of Cre recombinase was verified.

1591] ]592] B, Production of Cre recombinase-loaded exosome (Cre::EXPLOR) (593] The present inventors performed following experiment to yield (he Cre recombinaseloaded exosomes.

]594] In particular, C1BN-EGRP-CD9 gene and Cre-mCherry-CRY2 gene included vectors were transfected on HEK293T exosome producing cells and these cells were cultured 24 hrs. After 24 hrs culture, cells were changed their medium as it without fetal bovine scrum (FBS) and additionally cultured during 48 hrs on 50pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. The supernatant was added ExoQuick-TC Exosome Precipitation Solution (System Bioscicnccs, Mountain View, California, USA) with five times more volume and mixed during 18 hrs on 4°C. Suspended exosomes were obtained by suspending exosome pellet through centrifugation (1500xg, 30 min) of aforementioned supernatant and ExoQuick-TC mixture (FIG. 8).

1595] In addition, HEK293T exosome producing cells which stably express CIBNEGFP-CD9 gene and Crc-mChcrry-CRY2 gene were cultured in medium without fetal bovine serum during 48 ~ 72 hrs on 50pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. To remove particles bigger than 200 nm from supernatant, it filtered by 0.2 ul PES membrane (Coming). Tangential Flow Filtration (TFF) method was applied in identical supernatant to remove particles smaller than 20 nm, condense and refine exosomes from filtrate. Vivafiow 50-100 kDa PES memcbranc (Sarlorius) was used in TFF. Exosomes were condensed and refined by rotation of filtrate under 1.5-2 air pressure of TFF. Then, exosome concentrate was eliminated liquid by centrifugation (10000 - 14000 g, 5 min) on Amicon Ultra-0,5 (100 kDa) (Minipore) filter. Finally, exosomes were obtained by reverse-directional centrifugation (10000 - 14000 g, 5 min) with preferable buffer on experimental purpose.

1596] ]597] <5-2> Confirmation of Crc rccombinase function by Crc rccombinasc-loadcd exosome (Cre::EXPLOR)

1598] A. Functional confirmation of CrexEXPLOR on HT1080 and HeLa cell (599] Crc rccombinase has the function to recombine DNA on loxP regions. The present inventors performed following experiment to investigate the function of CrexEXPLOR.

1600] In particular, pCAG-loxP-STOP-loxP-ZsGreen encoded DNA was transfected to HT1080 and HeLa cell and washed after 6 hrs. Then 0,25 mg/ml Crc::EXPLOR or Negative ::EXPLOR was treated or pCMV-Cre vector was transfected. After 48 hrs culture, expression of ZsGreen with green fluorescence was investigated. Expression of ZsGrecn was confirmed on Cre:;EXPLOR treated HTIOSO and HeLa cell, unlike Ncgalivc::EXPLOR treated HTIOSO and HeLa cell, and was similar to the results of pCMV-Cre vector transfection in positive control (FIG. 19a and 19b).

1601] ]602] B. Confirmation of CreuEXPLOR’s function on primary rat embryonic neuron

1603] Following experiment was performed to investigate function of Cre::EXPLOR on primary rat embryonic neuron.

1604] In particular, pCAG-loxP-STOP-loxP-ZsGreen encoded DN A was transfected to primary rat embryonic neurons and washed after 6 hrs. Then they were cultured on

0.15 tng/ml Crc::EXPLOR. After 48 hrs culture, expression of ZsGreen with green Hu orcscencc was investigated. This experiment was performed al least three repeals, and thereby expression of ZsGreen was confirmed on Cre::EXPLQR treated primary ral embryonic neuron (FIG. 20).

1605] [606] C. Confirmation of Cre::EXPLOR function on in vivo transgenic mouse [607] The present inventors were performed following experiment to verify Cre;:EXPLOR’s function on in vivo.

[608] In particular, 50 μΐ Crc:EXPLORs (10 mg/mL) was injected by ventrolateral injection to pCAG-loxP-STOP-loxP-cNpHR3.0-EYFP transgenic mouse. After injection, fixed brain slices by 4% formaldehyde were imaged by fluorescence microscopy. Green fluorescence indicates expression of eNpHR3.0-EYFP, and blue lluo resccncc indicates cell nuclei, cNpHR3.0-EYFP expression on neuron in zona inccrta (ZI) of Cre::EXPLOR treated mouse was investigated by confocal microscopy, and thereby EYFP expression was confirmed on Cre::EXPLOR treated groups of pCAGloxP-STOP-loxP-eNpHR3.0-EYFP transgenic mouse (FIG. 21).

1609] [610] D. Confirmation of Cre::EXPLOR target cell on transgenic mouse [611] To confirm specific cell targeting of Crc::EXPLOR on aforementioned in vivo experiment, immunohistochemistry was performed. NeuN antibody specifically stained neuron, and GFAP antibody specifically stained astrocytes, and thereby it was confirmed that Cre;:EXPLOR targets specifically neuron in mouse brain through investigating that merged region mainly was neuron (FIG, 22).

[612] [613] Experimental Example 6: CR1SPR-Cas9 [614] <6-l> Production of Cas9-loaded exosome (Cas9::EXPLOR) [615] A. Confirmation of Cas9 within exosome [616] The present inventors investigated the binding of CIBN and CRY2 expressing the CIBN-EGFP-CD9 and Cas9-mCherry-CRY2 to confirm the loading of Cas9, which is recorded in amino acid SEQ ID NO: 10.

[617] As described in FIG. 23, Cas9-mChcrry-CRY2 inserted pcDNA3.1 (+) vector has 11,890 base pair in length, and the three protein parts consist of Cas9 with NLS sequence at 5-terminal, mCherry, and Cryptochrome 2 has 45 and 27 base pairs of linker sequences, respectively. Each protein part has 4194, 699, and 1497 base pairs in lengths, respectively.

[618] In particular, HEK293T exosome producing cells were additionally cultured 48 hrs in Dulbecco’s modified Eagle’s medium (DMEM) without fetal bovine serum (FBS), after 24 hrs culture with transfected pcDNA3.1(+) vector including C1BN-EGFP-CD9 gene and Cas9-mCherry-CRY2 gene in non-light condition. After finish culture, position of red fluorescence from mCherry was investigated by confocal microscopy before and after the irradiation of 488 nm wavelength blue light. This experiment was performed more than five limes, and (hereby Cas9 protein is loaded within exosome by confirming that CIBN-EGFP-CD9 binds to Cas9-mCherry-CRY2 by the blue light stimulus (FIG. 23).

1619] [620] B, Production of Cas9-loaded exosome (Cas9::EXPLOR) [621 ] The present inventors performed following experiment to yield the Cas9-Ioadcd exosomes.

[622] In particular, C1BN-EGRP-CD9 gene and Cas9-mCherry-CRY2 gene included vectors were transfected on HEK293T exosome producing cells and these cells were cultured 24 hrs. Alter 24 hrs culture, cells were changed then· medium as it without fetal bovine serum (FBS) and additionally cultured during 48 hrs on 50 liW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. The supernatant was added ExoQuick-TC Exosome Precipitation Solution (System Biosciences, Mountain View, California, USA) with five times more volume and mixed during 18 hrs on 4°C. Suspended exosomes were obtained by suspending exosome pellet through centrifugation (1500xg, 30 min) of aforementioned supernatant and ExoQuick-TC mixture (FIG. 8), [623] In addition, HEK293T exosome producing cells which stably express C1BNEGFP-CD9 gene and Cas9-mCherry-CRY2 gene were cultured in medium without fetal bovine scrum during 48 ~ 72 hrs on 50 pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. To remove particles bigger than 200 nm from supernatant, it filtered by 0.2 ui PES membrane (Coming). Tangential Flow Filtration (TFF) method was applied in identical supernatant to remove particles smaller than 20 nm, condense and refine exosomes from filtrate, Vivafiow 50-100 kDa PES mcmebrane (Sartorius) was used in TFF. Exosomes were condensed and refined by rotation of filtrate under 1.5~2 air pressure of TFF. Then, exosome concentrate was eliminated liquid by centrifugation (10000 - 14000 g, 5 min) on Amicon Ultra-0.5 (100 kDa) (Millipore) filler. Finally, exosomes were obtained by reverse-directional centrifugation (10000 - 14000 g, 5 min) with preferable buffer on experimental purpose. The loading of Cas9 within the exosomc was evaluated (FIG. 25).

[624] Functional analysis of Cas9-Ioaded exosomes is performed in target cells:

[625] Target cells are treated with the Cas9-loadcd exosomes to show the functional activity.

[626] Animal models arc administered with the Cas9-loadcd exosomes by i.p. or i.v. to show therapeutic effect.

[627] [628] Experimental Example 7: Caspase-activated DNase (CAD) [629] The the binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and CAD mCherry-Cry2 al 488 nm wavelength blue light, and the loading of CAD within the exosome is evaluated.

[630] For the massive production of CAD-loaded exosomes, cells stably expressing C1BNEGFP-CD9 gene and CAD-mChcrry-CRY2 gene are established, and exosomes arc isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[631] Functional analysis of CAD-loaded exosomes is performed in target cells:

[632] Target cells are treated with the CAD-loaded exosomes to show the functional activity.

[633] Animal models are administered with the CAD-loaded exosomes by i.p. or i.v. to show therapeutic effect.

[634] [635] Experimental Example 8: β-glucoccrcbrosidasc

1636] <8- l> Production of GBA-loadcd exosome (GBA::EXPLOR)

1637] A, Confirmation of GBA within exosome ]638] The present inventors investigated (he binding of CIBN and CRY2 expressing the

CIBN-EGFP-CD9 and GBA-mChcrry-CRY2 to confirm the loading of GBA, which is recorded in amino acid SEQ ID NO: 12.

]639] [Table 2]

SEQ. ID	GENE	Nucleotide sequence
12	β-glucoccrcbros idase	MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSW ASGARPC1PKSFGYSSVVCVCNATYCDSFDPPTFPAL GTFSRYESTRSGRRMELSMGP1QANHTGTGLLLTLQ PEQKFQKVKGFGGAMTDAAALN1LALSPPAQNLLL KSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDF QLHNFSLPEEDTKLKIPL1HRALQLAQRPVSLLASPW TSPTWLKTNGAVNGKGSLKGQPGDIYHQTWARYF VKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQC LGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQ RLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLA PAKATLGETHRLFPNTMLFASEACVGSKFWEQSVR LGSWDRGMQYSFfSIITNLLYHVVGWTDWNLALNP EGGPNWVRNFVDSPlIVDiTKDTFYKQPMFYHLGHF SKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVV VVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWR RQ

[640] [641 ] In particular, HEK293T exosome producing cells were additionally cultured 48 hrs in Dulbecco’s modified Eagle’s medium (DMEM) without fetal bovine serum (FBS), after 24 hrs culture with transfected pcDNA3.1(+) vector including C1BN-EGFP-CD9 gene and GBA-mChcrry-CRY2 gene in non-light condition. After finish culture, position of red fluorescence from mChcrry was investigated by eonfocal microscopy before and after the irradiation of 488 nm wavelength blue light. This experiment was performed more than five times, and thereby GBA protein is loaded within exosome by confirming that CIBN-EGFP-CD9 binds to GBA-mChcrry-CRY2 by the blue light stimulus (FIG. 26).

[642] [643] B. Production of GBA-loadcd exosome (GBA::EXPLOR) [644] The present inventors performed following experiment to yield the GBA-loadcd exosomes.

[645] In particular, C1BN-EGRP-CD9 gene and GBA-mCherry-CRY2 gene included vectors were transfected on HEK293T exosome producing cells and these cells were cultured 24 hrs. After 24 hrs culture, cells were changed their medium as it without fetal bovine scrum (FBS) and additionally cultured during 48 hrs on 50 pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. The supernatant was added ExoQuick-TC Exosome Precipitation Solution (System Bioseiences, Mountain View, California, USA) with five times more volume and mixed during 18 hrs on 4°C. Suspended exosomes were obtained by suspending exosome pellet through centrifugation (1500xg, 30 min) of aforementioned supernatant and ExoQuick-TC mixture (FIG. 8).

[646] In addition, HEK293T exosome producing cells which stably express C1BNEGFP-CD9 gene and GBA-mCherry-CRY2 gene were cultured in medium without fetal bovine serum during 48 - 72 hrs on 50 pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. To remove particles bigger than 200 nm from supernatant, it filtered by 0.2 ul PES membrane (Coming). Tangential Flow Filtration (TFF) method was applied in identical supernatant to remove particles smaller than 20 nm, condense and refine exosomes from filtrate. Vivafiow 50-100 kDa PES mcmebrane (Sartorius) was used in TFF. Exosomes were condensed and refined by rotation of filtrate under 1.5-2 air pressure of TFF. Then, exosome concentrate was eliminated liquid by centrifugation (10000 - 14000 g, 5 min) on Amicon EIltra-0.5 (100 kDa) (Millipore) filter. Finally, exosomes were obtained by reverse-directional centrifugation (10000 - 14000 g, 5 min) with preferable buffer on experimental purpose.

[647] [648] <8-2> Measurement of GBA expression in GBA-loadcd exosome producing cells [649] The present inventors performed western blot to measure GBA expression in GBAloaded exosome.

]650] In particular, C1BN-EGRP-CD9 gene and GBA-mCherry-CRY2 gene included vectors were transfected on HEK293T exosome producing cells and these cells were cultured 24 hrs. The HEK293T cells were lysed using MPER (Mammalian Protein Extraction Reagent) and the proteins were analyzed by western blot. Rat primary astrocyte, human primary astrocyte, and Gaucher disease patient-derived fibroblast where β-glucoccrcbrosidasc is deficient due to GBA gene abnormality were lysed to perform western blot and the proteins were analyzed by western blot.

[651] As a result, endogenous GBA was observed in HEK293T cells including CIBNEGRP-CD9 gene and GBA-mChcrry-CRY2 gene, rat primary astrocyte, human primary astrocyte, except Gaucher disease patient-derived fibroblast (FIG. 27).

[652] In addition, GBA-mCherry-CRY2 fusion protein {15 lkDa) was observed in HEK293T cells including CIBN-EGRP-CD9 gene and GBA-niChcrry-CRY2 gene, and this presents (hat GBA-mChcrry-CRY2 fusion protein is well expressed in GBAloaded exosome producing cells (FIG. 28).

[653] [654] <8-3> Confirmation of GBA activity on Gaucher disease patient-derived cells by GBA-loaded exosome (GBA::EXPLOR) [655] A. Enzyme activity of GBA within exosome [656] The present inventor performed experiment for β-glucocercbrosidasc enzyme activity to investigate glucoccrcbroside degrading activity of GBA within exosome.

[657] In particular, C1BN-EGRP-CD9 gene and GBA-mCherry-CRY2 gene included vectors were transfected on HEK293T exosome producing cells and these cells were cultured 24 hrs. After 24 hrs culture, cells were changed (heir medium as it without fetal bovine serum (FBS) and additionally cultured during 48 hrs on 50 pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. The supernatant was added ExoQuick-TC Exosome Precipitation Solution (System Biosciences, Mountain View, California, USA) with five times more volume and mixed during 18 hrs on 4°C. Suspended exosomes were obtained by suspending exosome pellet through centrifugation (1500xg, 30 min) of aforementioned supernatant and ExoQuick-TC mixture, [658] In addition, HEK293T exosome producing cells which stably express CIBNEGFP-CD9 gene and GBA-mChcrry-CRY2 gene were cultured in medium without fetal bovine serum during 48 ~ 72 hrs on 50 pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. To remove particles bigger than 200 nm from supernatant, it filtered by 0.2 ul PES membrane (Coming), Tangential Flow Filtration (TFF) method was applied in identical supernatant to remove particles smaller than 20 nm, condense and refine exosomes from filtrate. Vivaflow 50-100 kDa PES mcmebranc (Sartorius) was used in TFF. Exosomes were condensed and refined by rotation of filtrate under 1.5--2 air pressure of TFF. Then, exosome concentrate was eliminated liquid by centrifugation {10000 - 14000 g, 5 min) on Amicon Ultra-0.5 (100 kDa) (Millipore) filter. Finally, exosomes were obtained by reverse-directional centrifugation (10000 - 14000 g, 5 min). The exosomes were lysed using MPER (Mammalian Protein Extraction Reagent) and the proteins were analyzed.

[659] Increased β-glucoccrcbrosidasc enzyme activity of GBA-loadcd GBA::EXPLOR was observed comparing to mCherry-loaded exosomes, and thereby active GBA loading on exosome was confirmed (FIG. 29).

1660] [661 ] B, Enzyme activity of β-glucocerebrosidasc (GBA) on Gaucher disease patienlsderived cells [662] The present inventors performed following experiment to confirm the recovery of βglucocerebrosidase enzyme activity on Gaucher disease palients-derived cells when treated with GBA::EXPLOR.

[663] Gaucher disease palients-derived fibroblast was cultivated al the density of 2x 10⁵cells in 60mm dish. Then, mCherry: :EXPLORs (2x10° exosomes) or GBA::EXPLORs (1.2xl0¹⁰ exosomes) were treated to Gaucher disease palients-derived fibroblast cultured in scrum-free DMEM medium. Hydrolysis activity of GBA-mCh-CRY2 was measured by delecting the fluorescence using substrate

4-methylumbelliferyl^-D-glucopyranoside (4-MUG; Sigma), Enzyme reaction was performed on 0.2 ml of 0.2 M citrate phosphate buffer (pH 0.5) containing 50 ul cell lysate of 0.15 %(v/v) Triton X-100 (Sigma), 0.8 %(w/v) sodium taurocholate (Sigma), 10 mM 4-MUG. After I h incubation at 37°C, the enzyme activity was slopped using 100 ui of 0.1 M glycine, 0,1 M NaOH (pH 10.3). Enzyme reaction product, 4-mcthylumbcllifciOnc (4-MU) was measured al excitation 365 nm, emission 460 nm condition.

[664] As a result, β-glucoccrebiOsidasc enzyme activity of GBA-loaded GBA::EXPLOR treated Gaucher disease palients-derived cells was recovered (FIG. 30).

[665] [666] Experimental Example 9: Mitogen activated kinases: p38 MAP kinase [667] The present inventors confirm the binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and p38 MAP kinase-mCherry-Cry2 at 488 nm wavelength blue light, and verify the loading of p38 MAP kinase within exosome.

[668] For the massive production of p38 MAP kinase-loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and p38 MAP kinasc-mCherry-CRY2 gene arc established, and exosomes are isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[669] Functional analysis of p38 MAP kinase-loaded exosomes is performed in target cells [670] Treatment of p38 MAP kinase-loaded exosomes to target cells shows the functional activity.

[671] Adminisralion of p38 MAP kinase-loaded exosomes by i.p. or i.v. to animal model shows therapeutic effect.

[672] [673] Experimental Example 10: Inhibitor kappa B kinase (IKK) [674] The binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and IKKrrtCherry-Cry2 al 488 nm wavelength blue light, and the loading of IKK within the exosome is evaluated.

[675] For the massive production of IKK-Ioaded exosomes, cells stably expressing C1BNEGFP-CD9 gene and IKK-mCherry-CRY2 gene are established, and exosomes are isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[676] Functional analysis of IKK kinasc-loadcd exosomes is performed in target cells:

[677] Target cells are treated with the IKK-loaded exosomes to show the functional activity, [678] Animal models are administered with the IKK-loadcd exosomes by i.p. or i.v. to show therapeutic effect.

[679] [680] Experimental Example 11: PTEN phosphatase [681] The present inventors confirmed the binding of CIBN and CRY2 in ceils expressing CIBN-EGFP-CD9 and PTEN-Cry2 al 488 nm wavelength blue light, and the loading of PTEN within exosome.

[682] For the massive production of PTEN-Ioaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and PTEN-CRY2 gene were established (FIG. 31), and exosomes were isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[683] Functional analysis of PTEN kinase-loaded exosomes is performed in target cells [684] Treatment of PTEN-loaded exosomes to target cells shows the functional activity.

[685] Adminisration of PTEN-loadcd exosomes by i.p. or i.v. to animal model shows therapeutic effect.

1686] [687] Experimental Example 12: Janus kinase (JNK) [688] The binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and JNKmChcrry-Cry2 al 488 nm wavelength blue light, and the loading of JNK within the exosome is evaluated.

[689] For the massive production of JNK-loaded exosomes, cells stably expressing CIBNEGFP-CD9 gene and JNK-mChcrry-CRY2 gene are established, and exosomes are isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[690] Functional analysis of JNK-loaded exosomes is performed in target cells:

[691 ] Target cells arc treated with the JNK-loaded exosomes to show the functional activity.

[692] Animal models arc administered with the JNK-loadcd exosomes by i.p. or i.v. to showthcrapculic effect.

[693] [694] Experimental Example 13: Ubiquitin ligases (695 ] The binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and Ubiquitin ligase-mCherry-Cry2 at 488 nm wavelength blue light, and the loading of Ubiquitin ligases within the exosome is evaluated.

1696] For the massive production of Ubiquitin ligase-loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and Ubiquitin ligase-mCherry-CRY2 gene arc established, and exosomes arc isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

1697] Functional analysis of Ubiquitin llgasc-loadcd exosomes is performed in target cells:

[698] Target cells arc treated with the Ubiquitin ligase-loaded exosomes to show the functional activity, [699] Animal models are administered with the Ubiquitin ligase-loaded exosomes by i.p, or i.v. to show therapeutic effect.

[700] [701] Experimental Example 14: Luciferase [702] The present inventors confirmed the binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and luciferase-mehcrry-Cry2 at 488 nm wavelength blue light, and the loading of luciferase within exosome (FIG, 32).

[703] For the massive production of luciferase-loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and luciferase-mcherry-CRY2 gene were established, and exosomes were isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[704] Quantitative luciferase activity based on the number of luciferase molecules was analyzed (FIG. 33).

[705] [706] Experimental Example 15: Pcroxircdoxin [707] <15-1> Production of Prx 1 or Prx 11-loaded exosome (Prx l/IFEXPLOR) [708] A, Confirmation of Prx Ϊ/1Ι within exosome ]709] The present inventors investigated the binding of CIBN and CRY2 expressing the CIBN-EGFP-CD9 and Prx I/II-mChcrry-CRY2 to confirm the loading of Prx I or Prx II, which is recorded in amino acid SEQ ID NO: 7 or 8.

[710] In particular, HEK293T exosome producing cells were additionally cultured 48 hrs in Dulbecco’s modified Eagle’s medium (DMEM) without fetal bovine serum (FBS), after 24 hrs culture with transfected pcDNA3.1(+) vector including C1BN-EGFP-CD9 gene and Prx I/II-mCherry-CRY2 gene in non-light condition. After finish culture.

position of red fluorescence from mChcrry was investigated by confocal microscopy before and after the irradiation of 488 nm wavelength blue light. This experiment was performed more than five limes, and thereby aggregation of Prx 1/11 protein by blue light stimulation was confirmed (FIG. 34). Therefore, Prx I/II protein was loaded in exosome by confirming the co-localization (yellow) of Prx I/II-mCherry-CRY2 (red) and C1BN-EGFP-CD9 (green).

[711] [712] B. Production of Prx 1/I1::EXPLOR [713] The present inventors performed following experiment to yield the Prx 1/Il-ioadcd exosomes.

[714] In particular, C1BN-EGRP-CD9 gene and Prx l/Il-mCherry-CRY2 gene included vectors were transfected on HEK293T exosome producing cells and these cells were cultured 24 hrs. After 24 hrs culture, cells were changed their medium as it without fetal bovine serum (FBS) and additionally cultured during 48 hrs on 50 pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. The supernatant was added ExoQuick-TC Exosome Precipitation Solution (System Biosciences, Mountain View, California, USA) with five times more volume and mixed during 18 hrs on 4°C. Suspended exosomes were obtained by suspending exosome pellet through centrifugation (1500xg, 30 min) of aforementioned supernatant and ExoQuick-TC mixture (FIG. 8).

[715] ]716] <15-2> Confirmation of inhibition effect on oxidative stress-induced cytotoxicity by

Prx I/II::EXPLOR

1717] The present inventors performed following experiment to confirm the inhibition effect on oxidative stress-induced cytotoxicity by Prx 1/II::EXPLOR.

[718] In particular, after changing the serum-free media of HeLa cells, 100 pg/mL of Prx 1/ II::EXPLORs was treated and cultivated for 18 hrs. H₂O₂ (0, 0.5, 1 mM) was treated and cultivated for additional 8 hrs. WST assays were used to analyze the cell viability.

[719] Due to pretreat of Prx l/ll::EXPLORs, the oxidative stress-induced cytotoxicity was significantly inhibited (FIG 35).

1720] [721] Experimental Example 16: NF-κΒ [722] The binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and NFKB-mCherry-Cry2 at 488 nm wavelength blue light, and the loading of NF-κΒ within the exosome is evaluated.

[723] For the massive production of NF-κΒ-loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and NF-K'B-mCherry-CRY2 gene are established, and exosomes arc isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

]724] Functional analysis of NF-tcB-loaded exosomes is performed in target cells:

[725] Target cells are treated with the NF-KB-loadcd exosomes to show the functional activity.

[726] Animal models arc administered with the NF-KB-loadcd exosomes by i.p. or i.v. to show therapeutic effect.

[727] [728] Experimental Example 17: MyoD [729] The present inventors confirmed the binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and MyoD-mcherry-Cry2 al 488 nm wavelength blue light (FIG. 36), and verify the loading of MyoD within exosome.

1730] For the massive production of MyoD-loadcd exosomes, cells stably expressing

CIBN-EGFP-CD9 gene and MyoD-mcherry-CRY2 gene were established, and exosomes were isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[731 ] Treatment of MyoD-loaded exosomes to target cells showed the functional activity (FIG. 37).

1732] [733] Experimental Example 18: TbxlS (T-box transcription factor 18) )734] The binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and

Tbxl8-mChcrry-Cry2 al 488 nm wavelength blue light, and the loading of Tbxl8 within the exosome is evaluated.

1735] For the massive production of Tbx 18-loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and Tbxl8-niChcrry-CRY2 gene arc established, and exosomes arc isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

1736] Functional analysis of Tbx 18-loaded exosomes is performed in target cells:

[737] Target cells arc treated with the Tbxl8-loadcd exosomes to show the functional activity.

1738] Animal models are administered with the Tbx 18-loaded exosomes by i.p. or i.v. to show therapeutic effect.

[739] [740] Experimental Example 19: p53 ]741 ] The present inventors confirmed the binding of CIBN and CRY2 in cells expressing

CIBN-EGFP-CD9 and p53-mcherry-Cry2 at 488 nm wavelength blue light (FIG. 38), and the loading of PTEN within exosomc (FIG. 39)

1742] For the massive production of p53-loaded exosomes, cells stably expressing CIBN67

EGFP-CD9 gene and p53-mchcrry-CRY2 gene were established, and exosomes were isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[743] Treatment of p53-loaded exosomes to target cells showed the transcriptional activity (FIG. 40).

[744] Adminisration of p53-loaded exosomes by i.p. or i.v. to animal model shows therapeutic effect.

[745]

J746] Experimental Example 20: HMGB1 [747] The present inventors confirmed the binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and HMGB 1-Cry2 at 488 nm wavelength blue light, and the loading of HMGB1 within exosome (FIG. 41).

[748] For the massive production of HMGB 1-loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and HMGB1-CRY2 gene were established, and exosomes were isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[749] Functional analysis of HMGB 1-loaded exosomes is performed in target cells [750] Treatment of HMGB 1 -loaded exosomes to target cells shows the transcriptional activity.

[751] Adminisration of HMGB!-loaded exosomes by i.p. or i.v. Io animal model shows therapeutic effect, [752] [753] Experimental Example 21: Super-repressor IkB [754] <21-1> Production of super-repressor-1κΒ-loaded exosome (super repressor-It<B:EXPLOR) [755] A. Confirmation of supcr-rcprcssor-ΙκΈ in exosome [756] The present inventors investigated the binding of CIBN and CRY2 expressing the CIBN-EGFP-CD9 and super-repressor-lKB-mCherry-CRY2 to confirm the loading of super-reprcssor-Ικ'Β, which is recorded in amino acid SEQ ID NO: 5.

[757] In particular, HEK293T exosome producing cells were additionally cultured 48 hrs in Dulbecco’s modified Eagle’s medium (DMEM) without fetal bovine serum (FBS), after 24 hrs culture with transfected pcDNA3.1(+) vector including C1BN-EGFP-CD9 gene and super-rcprcssor-lKB-mChcrry-CRY2 gene in non-light condition. After finish culture, position of red fluorescence from mCherry was investigated by confocal microscopy before and after the irradiation of 488 nm wavelength blue light. This experiment was performed more than five times, and thereby aggregation of superrepressor-ΙκΒ protein by blue light stimulation was confirmed (FIG. 42). Therefore, super-repressor-ΙκΒ protein was loaded in exosome by confirming the co-localization (yellow) of super-rcprcssor-lKB-mCherry-CRY2 (red) and CIBN-EGFP-CD9 (green).

1758] [759] B, Production of super-repressor-K‘B::EXPLOR [760] The present inventors performed following experiment to yield the superrcpressor-IxB-loadcd exosomes.

[761 ] In particular, C1BN-EGRP-CD9 gene and super-rcpressor-K'B-mChcrry-CRY2 gene included vectors were transfected on HEK293T exosome producing cells and these cells were cultured 24 hrs. After 24 hrs culture, cells were changed their medium as it without fetal bovine scrum (FBS) and additionally cultured during 48 hrs on 50 pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. The supernatant was added ExoQuick-TC Exosome Precipitation Solution (System Bioscicnccs, Mountain View, California, USA) with five times more volume and mixed during 18 hrs on 4°C. Suspended exosomes were obtained by suspending exosome pellet through centrifugation (1500xg, 30 min) of aforementioned supernatant and ExoQuick-TC mixture (FIG. 8).

[762] In addition, HEK293T exosome producing cells which stably express CIBNEGFP-CD9 gene and super-repressor-lKB-mCherry-CRY2 gene were cultured in medium without fetal bovine serum during 48 - 72 hrs on 50 pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. To remove particles bigger than 200 nm from supernatant, it filtered by 0.2 ui PES membrane (Coming). Tangential Flow Filtration (TFF) method was applied in identical supernatant to remove particles smaller than 20 nm, condense and refine exosomes from filtrate. Vivaflow 50-100 kDa PES memebrane (Sartorius) was used in TFF. Exosomes were condensed and refined by rotation of Filtrate under 1.5-2 air pressure of TFF. Then, exosome concentrate was eliminated liquid by centrifugation (10000 - 14000 g, 5 min) on Amicon UIlra-0.5 (100 kDa) (Millipore) filter. Finally, exosomes were obtained by reverse-directional centrifugation (10000 - 14000 g, 5 min) with preferable buffer on experimental purpose.

[763] [764] <21-2> Confirmation of super-repressor-lKB:EXPLOR inhibition effect of TNF-« mediated NF-κΒ activity [765] The present inventors performed following experiments to confirm the TNF-ct mediated anti-inflammatory effect using super-repressor-lKB:EXPLOR.

[766] In particular, HeLa was cultured in 100 mg/mL of mCherry:EXPLORs or superrepressor-Ii<B-mChcrry:EXPLORs treated culture medium for 3 hrs. Then. TNF-α (10 ng/mL) was treated and incubated for additional 30 minutes. After fixing with 4% paraformaldehyde, NF-κΒ p65 was stained with Alexa Fluor 488-conjugated antibody and inspected using conl’ocal microscopy. To measure the binding activity of p65/c-Rcl (NF-kB), nuclei lysate was used in Trans AM NF-kB and AP-1 assay kit (ActiveMotif, Carlsbad, CA, USA) according to manufacturer’s protocol. Data was presented average ± SEM (n - 3), and applied using Tukey’s post hoc test and decided significant group (**, p < 0.01) through ANOVA test.

[767] By prelreat of super-repressor-lKB:EXPLOR on HeLa cells, TNF-a-aclivated NF-kB transport to nucleus and NF-κΒ DNA binding were inhibited (FIG. 43).

1768] [769] <21-3> Confirmation of anti-inflammatory effect of super-rcpressor-lKB:EXPLOR on Collagen-induced arthritis animal model [770] The present inventors performed the following experiment to confirm the antiinflammatory effect of super-rcprcssor-ΙκΒ:EXPLOR on Collagcn-induccd arthritis mouse model.

[771 ] In particular, mostly used rheumatoid arthritis model, collagen-induced arthritis mouse model was developed by immunization through injecting bovine collagen type II and adjuvant to tail subcutaneous tissue of DBA/1. super repressor IkB:EXPLOR was retro-orbitally injected 4 limes to two collagen-induced arthritis mouse models every 2 days. Progression of rheumatoid arthritis symptom was determined by clinical score as listed in Table 3. Mean Clinical Score is average value of clinical scores from mouse feet according to the aforement ioned table.

[772] When super repressor IκΒ:EXPLOR was retro-orbitally injected to collagcn-induccd arthritis mouse models, the rheumatoid arthritis mouse showed decreased symptom (FIG. 44).

[773] | Table 3]

Severity Score	Phenotypic signs
0	No evidence of erythema and swelling
I	Erythema and mild swelling confined to the larsals or ankle joint
2	Erythema and mild swelling extending from the ankle to the tarsals
3	Erythema and moderate swelling extending from the ankle to metatarsal joint
4	Erythema and severe swelling encompass the ankle, fool and digits, or ankylosis of the limb

[774] [775] <21 -4> Effect of srlkB-loaded exosomes on LPS-induced sepsis model [776] In addition, when super repressor IkB:EXPLOR was Intrapcriloncally injected to

LPS-induccd sepsis mouse models, the sepsis mouse showed significantly increased survival (FIG. 45).

[777] [778] Experimental Example 22: pySTAT3 inlrabody [779] The present inventors confirmed the binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and pySTAT3-mchcrry-Cry2 at 488 nm wavelength blue light, and the loading of pySTAT3 within exosome (FIG. 46), [780] For the massive production of pySTAT3-loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and pySTAT3-mchcrry-CRY2 gene were established, and exosomes were isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[781] Treatment of pySTAT3-loadcd exosomes to target cells shows the functional activity.

[782] Adminisralion of pySTAT3-loadcd exosomes by i.p. or i.v. to animal model shows therapeutic effect.

[783] [784] Experimental Example 23: Bcl-2-associatcd X protein [785 J <23-1> Production of Bax-loaded exosome (Bax::EXPLOR) [786] A, Confirmation of Bax in exosome [787] The present inventors investigated the binding of CIBN and CRY2 expressing the CIBN-EGFP-CD9 and Bax-mCheiry-CRY2 to confirm the loading of Bax, which is recorded in amino acid SEQ ID NO: 6.

[788] In particular, HEK293T exosome producing cells were additionally cultured 48 hrs in Dulbecco’s modified Eagle’s medium (DMEM) without fetal bovine serum (FBS), after 24 hrs culture with transfected pcDNA3.1(+) vector including C1BN-EGFP-CD9 gene and Bax-mCherry-CRY2 gene in non-light condition. After finish culture, position of red fluorescence from mChcrry was investigated by confocal microscopy before and after the irradiation of 488 nm wavelength blue light. This experiment was performed more than five times, and thereby aggregation of Bax protein by blue light stimulation was confirmed (FIG. 48). Therefore, Bax protein was loaded in exosome by confirming the binding of Bax-mChcrry-CRY2 (red) and C1BN-EGFP-CD9 (green).

[789] [790] B. Production of Bax::EXPLOR [791 ] The present inventors performed following experiment to yield the Bax-loaded exosomes, [792] In particular, CIBN-EGRP-CD9 gene and Bax-mCherry-CRY2 gene included vectors were transfected on HEK293T exosome producing cells and these cells were cultured 24 hrs. After 24 hrs culture, cells were changed their medium as it without fetal bovine scrum (FBS) and additionally cultured during 48 hrs on 50 pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. The supernatant was added ExoQuick-TC Exosome Precipitation Solution (System Biosciences, Mountain View, California, USA) with five times more volume and mixed during 18 hrs on 4°C. Suspended exosomes were obtained by suspending exosome pellet through centrifugation (1500xg, 30 min) of aforementioned supernatant and ExoQuick-TC mixture (FIG. 8).

1793] In addition, HEK293T exosome producing cells which stably express CIBNEGFP-CD9 gene and Bax-mCherry-CRY2 gene were cultured in medium without fetal bovine serum during 48 ~ 72 hrs on 50 pW power of 488 nm wavelength blue light. After finishing culture, supernatant removed cell debris was yielded by centrifuge (2000xg, 15 min) from isolated culture medium. To remove particles bigger than 200 nm from supernatant, it filtered by 0.2 ul PES membrane (Coming). Tangential Flow Filtration (TFF) method was applied in identical supernatant to remove particles smaller than 20 nm. condense and refine exosomes from filtrate. Vivaflow 50-100 kDa PES mcmebrane (Sartorius) was used in TFF. Exosomes were condensed and refined by rotation of filtrate under 1.5-2 air pressure of TFF. Then, exosome concentrate was eliminated liquid by centrifugation (10000 - 14000 g, 5 min) on Amicon Ultra-0.5 (100 kDa) (Milliporc) filler. Finally, exosomes were obtained by reverse-directional centrifugation (10000 - 14000 g, 5 min) with preferable buffer on experimental puipose.

]794] [795] <23-2> Confirmation of apoptosis by Bax:EXPLOR

1796] Bax is apoptotic regulator, thus the BAX overexpression release cytochrome c by binding to mitochondrial membrane, and inducing the apoptosis. The present inventors confirmed the excretion of cytochrome c using Bax:EXPLOR.

[797] In particular, HeLa in 0,1 mg/mL of mCherry:EXPLORs or Bax:EXPLORs-containing medium was cultured for 12 hrs. After fixing using 4% paraformaldehyde, to measure the excretion of cytochrome c, the HeLa was stained with Alexa Fluor 647-conjugated antibody and imaged using confocal microscope and the ratio of cytochrome c was analyzed by counting the number of cells (Scale bars, 20 pm). Dala was presented average + SEM (n - 3), and applied using Tukcy’s post hoc lest and decided significant group (**, p < 0.01) through ANOVA test.

[798] As a result, larger amount of cytochrome c release was observed in Bax:EXPLOR treated HeLa than mChcrry:EXPLOR-treated HeLa (FIG. 49).

1799] [800] Experimental Example 24: BcL-xL (801 ] The binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and BcLxL-mChcrry-Cry2 at 488 nm wavelength blue light, and the loading of BcL-xL within (he exosome is evaluated.

(802] For the massive production of BcL-xL-loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and BcL-xL-niChcrry-CRY2 gene are established, and exosomes are isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

1803] Functional analysis of BcL-xL-loaded exosomes is performed in target cells:

(804] Target cells are treated with BcL-xL-loaded exosomes to show the functional activity.

(805] Animal models are administered with BcL-xL-loaded exosomes by i.p. or i.v. to show therapeutic effect.

1806]

1807] Experimental Example 25: AIMP

1808] The present inventors confirmed the binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and AIMP-mcherry-Cry2 at 488 nm wavelength blue light (FIG. 50), and the loading of AIMP within exosome (FIG. 51).

1809] For the massive production of AIMP -loaded exosomes, cells stably expressing CIBN-EGFP-CD9 gene and AlMP-mcherry-CRY2 gene were established, and exosomes were isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant, [810] Treatment of AIMP-Ioaded exosomes to target cells shows the functional activity. ]811] Adminisration of AIMP-loaded exosomes by i.p. or i.v. to animal model shows therapeutic effect.

1812] [813] Experimental Example 26: meherry (fluorescent protein)

1814] The present inventors confirmed the binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and mcherry-Cry2 al 488 nm wavelength blue light (FIG. 52), and the loading of AIMP within exosome.

[815] For the massive production of mchcrry-loadcd exosomes, cells stably expressing CIBN-EGFP-CD9 gene and mcherry-CRY2 gene were established, and exosomes were isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

1816]

1817] Experimental Example 27: Nucleic acid-hinding proteins

1818] The binding of CIBN and CRY2 in cells expressing CIBN-EGFP-CD9 and Nucleic acid-binding protein-mChcrry-Cry2 al 488 nm wavelength blue light, and the loading of Nucleic acid-binding protein within the exosome is evaluated.

[819] For the massive production of Nucleic acid-binding protein-loaded exosomes, cells stably expressing C1BN-EGFP-CD9 gene and Nucleic acid-binding prolcinmCherry-CRY2 gene are established, and exosomes are isolated and purified by Tangential Flow Filtration (TFF) method from culture supernatant.

[820] Functional analysis of Nucleic acid-binding protein-loaded exosomes is performed in target cells:

1821 ] Target cells are treated with Nucleic acid-binding protein-loaded exosomes to show the functional activity.

[822] Animal models arc administered with Nucleic acid-binding protein-loaded exosomes by i.p. or i.v. lo show therapeutic effect.

1823] [824] Those skilled in the art will appreciate that the conceptions and specific embodiments disclosed in the foregoing description may be readily utilized as a basis for modifying or designing other embodiments for carrying out the same purposes of the present invention. Those skilled in the art will also appreciate that such equivalent embodiments do not depart from the spirit and scope of the invention as set forth in the appended Claims.

[Claim 1J [Claim 2] [Claim 3[ [Claim 4] [Claim 5] [Claim 6[

Claims

Claims

A method for the mass-production of exosome containing a cargo protein on its membrane, comprising the following steps:

a) preparing transformed cells by introducing a polynucleotide encoding the fusion protein composed of an exosomc specific marker and a cargo protein in the exosome production cells;

b) culturing the transformed cells of step a); and

c) Separating the cargo protein into the inside of the exosomal membrane.

The method for the mass-production of exosome containing a cargo protein according to claim 1, wherein the cargo protein is superrepressor- IkB protein inhibiting NF-κΒ, Bax(Bcl-2-associaled X protein), Peroxiredoxin I, Peroxiredoxin II, ere recombinase, Cas9 (CRISPR associated protein 9), Cpfl (CRISPR from Prcvotella and Francisclla 1) or GBA(p-glucoccrebrosidasc).

The method for the mass-production of exosome according to claim 1, wherein the exosome production cell is one or more cells selected from the group consisting of B-lymphocyles, T-Iymphocytcs, dendritic cells, megakaryocytes, and macrophages, stem cells, and tumor cells.

The method for the mass-production of exosome according to claim 1, wherein the exosome specific marker is CD9, CD63, CD81, or CD82.

A method for the mass-production of exosomc containing a cargo protein, comprising the following steps:

(a) introducing the polynucleopeplide encoding the fusion protein (fusion protein I) composed of an exosome specific marker and the first photo-specific binding protein, and the polynucleotide encoding the fusion protein (fusion protein II) composed of a cargo protein and the second photo-specific binding protein that can be linked to the first photo-specific binding protein in the exosome production cell;

(b) irradiating the exosome production cell with light that can cause the conjugation between the first photo-specific binding protein and the second photo-specific binding protein; and (c) terminating the irradiation after the production of exosome finished in the exosome production cell.

The method for the mass-production of exosomc containing a cargo protein according to claim 5, wherein the first photo-specific binding protein is one or more proteins selected from the group consisting of [Claim 7] [Claim 8] [Claim 9] [Claim 10] [Claim 1 1 ] [Claim 12] [Claim 13]

CIB (cryptochromc-intcracting basichclix-loop-hclix protein), CIBN (N-lerminal domain of CIB), PhyB (phytochromc B), PIF {phytochrome interacting factor), FKF1 {Flavinbinding, Keich repeal, Fbox 1), GIGANTEA, CRY (chryptochrome), and PHR (phytolyase homologous region).

The method for the mass-production of exosome containing a cargo protein according to claim 5, wherein when the first photo-specific binding protein is CIB or CIBN, the second photo-specific binding protein is CRY or PHR, and the binding of the first photo-specific binding protein and the second photo-specific binding protein is achieved by the irradiation of the light with the wavelength of 460 490 nm.

The method for the mass-production of exosome containing a cargo protein according to claim 5, wherein when the first photo-specific binding protein is PhyB, the second photo-specific binding protein is PIF, and the binding of the first photo-specific binding protein and the second photo-specific binding protein is achieved by the irradiation of the light with the wavelength of 600 ~ 650 nm.

The method for the mass-production of exosome containing a cargo protein according to claim 5, wherein when the first pholo-spccific binding protein is GIGANTEA, the second photo-specific binding protein is FKF1, and the binding of the first photo-specific binding protein and the second photo-specific binding protein is achieved by the irradiation of (he light with the wavelength of 460 ~ 490 nm.

The method for the mass-production of exosome containing a cargo protein according to claim 5, wherein the cargo protein is superrepressor- IkB protein inhibiting NF-κΒ, Bax(Bcl-2-associated X protein), Peroxi redox in I, Peroxi redox in II, ere recombinase, Cas9 (CRISPR associated protein 9), Cpfl (CRISPR from Prcvotclla and Francisella 1) or GBA(p-glucoeercbiOsidase),

A method for delivering a protein drug to cytosol using the exosome prepared by the method of claim I or claim 5.

A pharmaceutical composition for delivering a protein drug containing the exosome prepared by the method of claim I or claim 5 as an active ingredient to cytosol.

A vector for the production of exosome comprising:

(a) the first expression vector containing the polynucleotide encoding the fusion protein of the exosome specific marker and the first photo76 [Claim 14] [Claim 15] ]Claim 16] [Claim 17] [Claim 18] (Claim 19] [Claim 20] (Claim 21] specific binding protein (the first fusion protein); and (b) the second expression vector containing the mullicloning site to which the polynucleotide encoding the cargo protein can be introduced and the polynucleotide encoding (he second photo-specific binding protein to be linked to (he first photo-specific binding protein above. The vector for the production of exosome according to claim 13, wherein the second expression vector is to express the fusion protein (the second fusion protein) composed of the second photo-specific binding protein and the cargo protein in the exosome production cell. An exosome containing a cargo protein prepared by the methods of claim 1 or claim 5,

A composition for producing a conditional knockout allele of a target gene comprising the exosome containing Crc recombinase prepared by the methods of claim 1 or claim 5 as an active ingredient.

A DNA sequence manipulating composition comprising the exosome containing Cas9 or Cpl'l protein prepared by the methods of claim 1 or claim 5 and a guide RNA specific to the target DNA sequence.

A method for treating or preventing Gaucher’s disease comprising the step of administering a pharmaceutically effective dose of the exosome containing β-glucoccrebrosidasc prepared by the methods of claim 1 or claim 5 as an active ingredient.

A method for treating or preventing reactive oxygen-related diseases comprising the step of administering a pharmaceutically effective dose of the exosome containing Peroxiredoxin I or Peroxiredoxin Π protein prepared by the methods of claim 1 or claim 5 as an active ingredient. A method for treating or preventing inflammatory diseases comprising the step of administering a pharmaceutically effective dose of the exosome containing Super-repressor IkB protein prepared by the methods of claim 1 or claim 5 as an active ingredient.

A method for treating or preventing cancer comprising the step of administering a pharmaceutically effective dose of the exosome containing Bax(Bcl-2-associaled X protein) protein prepared by the methods of claim 1 or claim 5 as an active ingredient.

1/21 [Fig· 1]

Refolding (active)

LFig. 2]

Extraeellular matrix NPs stable .¼. -χ- /ft at

1 ,, V^·· cytosol NPs stable k * / Endocytosis'^--—

X.

) Endosome / NPs stable ί4-, <i >/h '· ?> H*

Ph drop +

Protease

Digsesion Lysosome

Drug release NPs agglomerate i Fluorescence release nucleus
2/21 [Fig. 4]
3/21 [Fig- 5] avaa?amniOTsmnjui3TO?mjW5Wyaajuay”in aaaaaaaaaaaaaaaaaataaialag , CIBN _r/%o

Cargo CRY2 protein

Protein carrying exosome ,0PE

Light

Light OFF oTOj^mWW'WUDwuwswWaJu

................taaaaaaalalaaaaaaai ij4flY2 (photoactivated)

J I Light OFF

Endosome formation

Late endosome ,Λ’Λ

Endosome maturity ’>1 cytosol
4/21 [Fig. 7J

No Light + Blue Light [Fig- 8] in blue I ight [Fig. 9| mCherry-encapsuIated exosomes + Blue Light a-mCherry a-CD9

No Light 5 20 50 200 τ
5/21 [Fig. 10] [Fig. 11]

Control + mCherry-OPEs (250 gg ml') (a) (b) [Fig. 12]

Gigantea-EGFP-CD9 mCherry-FKF1/LOV Overlay
6/21 [Fig- 13]

Control Overlay XP EXPLOR (a)

10 pg of total proteins lOOng of total proteins (b) (c) [Fig. 14]

1 x 10’particles of 1 x 10⁹particles of cell-derived exosome (x 10³) cel I-derived exosome (a) (b)
7/21

I Fig· 15]

Luciferase in exosomes I luciferases in exosomes producing cells

Loading efficiency (AU)

I Fig. 16]

EXPLOR

Control Overlay XP ON OFF (a) (b)
8/21 [Fig. 17]

CIBN-EGFP-C09 Luciferase-mCherry-CRY2 Merge

Blue Light OFF Blue Light ON Blue Light ON [Fig. 18]

CIBN-E6FP-CD9 Cre-mCherry-CRY2 Merge

Blue Light OFF Blue Light ON Blue Light ON [Fig. 19a]

HT1080 cells +pCAG-IoxP-STOP-IoxP-ZsGreen
9/21 [Fig. 19b]

HeLa cells +pCAG-1oxP-STOP-1oxP-ZsGr een [Fig. 20]

Primary rat embryonic neurons +pCAG-1 oxP-STOP-1 oxP-ZsGreen
10/21

I Fig· 21]

Control:EXPLORs CreiXPLORs

I Fig. 22] eYFP NEuN Merged eYFP GFA Merged [Fig. 23]

CIBN-EGFP-CD9

Cas9-mCherry-CRY2 Merge

Blue Light OFF Blue Light ON Blue Light ON
11/21 [Fig. 24]

6462bp

Cas9 | mCherry | Cryptochrome~

4194bp f 699bp |

45bp 27bp

1497bp

Al ix

95kDa tB® φΒτ ίβΙΒΒτ

GAPDH '* 37kDa [Fig. 26]

CD9-CIBN-EGFP

GBA-mcherry-CRY2

Merge

Blue Light ON

Blue Light ON
12/21 [Fig· 27]

Anti-GAPDH [Fig. 28]

Cell

Exosome

Exo Exo Exo anti-GBA anti-GAPDH [Fig. 29]

0.0
13/21 [Fig. 30]

Gaucher fibroblast [Fig. 31] pEX2-vector

Phase Green

Stable cells producing PTEN-loaded exosome
14/21

I Fig· 32]

CIBN-EGFP-CD9

Lucifer ase-mChe r r y-CRY2

Merge

Blue Light OFF Blue Light ON Blue Light ON

I Fig. 33]

Quantitative luciferase activity based on the number of luciferase molecules [Fig. 34]

Peroxiredoxin CIBN-EGFP-CD9 Merged

-mCherry-CRY2
15/21 [Fig. 35]

CZ3 None Wfa Cre-Explor 823 Prx I-Explor Ml Prx II-Explor ^h2°2 treatment to HeLa [Fig. 36]

MyoD-mCher r y-CRY2 Me r ge

CIBN-EGFP-CD9 No light +448 nm light +448 nm light
16/21 [Fig. 38]

CIBN-EGFP-CD9 p53-mCherry-CRY2 [Fig. 39]

Exosome

Stable cell mCherry p53

Ant i-p53

Anti-GAPDH p53-mCherry-CRY2 (147 kDa) [Fig. 40] p<0.05

Doxorubicin
17/21 [Fig. 41] pEX2-vector

Phase Green

Stable cells producing HMGBI-loaded exosome [Fig. 42]

CIBN-EGFP-CD9

Super IkB-mCherry-CRY2

Merge +448 nm Iight +448 nm Iight

No I ight
18/21 [Fig. 43]

Mean clinical arthritic index TNF-a(+) TNF-a(-)

0 5 10 1 5 20 25 30 35 40 45 50

Day after primary immunization
19/21 [Fig. 45]

Survival after LPS 40mg/kg injection

100 -T _ 80 £O

Ϊ 60co

S 40o o
20—T“

Hours

SrIkB exosome(n=6) Naive exosometn=6) -«-No exosome(n=5) [Fig. 461 pYST AT3 i n t r abody-mChe r r y-CRY2 Merge

CIBN-EGFP-CD9 -Blue Light OFF Blue Light ON Blue Light ON

20/21 [Fig. 48]

CIBN-EGFP-CD9

Bax-mCherry-CRY2

Merge

Blue light OFF Blue light ON Blue light ON [Fig. 49] mCherry Bax :EXPLORs :EXPLORs

Τ777Ά Mitochondria ivu cytosol ** ** mCherry Bax rEXPLORs :EXPLORs [Fig. 50]

CIBN-EGFP-CD9

AIMP-mCherry-CRY2 Merge +448 nm Iight +448 nm Iight

21/21 [Fig· 51]

A//

6?' «Τ’ </, / Α Ά Α ΑΙΜΡΙ recombinant protein 0.5ng 1ng 2ng 5ng

AIMP-mCher ry-CRY2 Fusion protein (132kDa)

AIMP (38kDa)

GAPDH «Β·*»·;

(Fig. 52] mCherry-CRY2

Merge

CIBN-EGFP-CD9

No I ight +448 nm I ight +448 nm Iight <110>

<120>

METHODS

CELLEX LIFE SCIENCES, INCORPORATED

COMPOSITIONS CONTAINING PROTEIN LOADED EXOSME AND FOR

PREPARING AND DELIVERING THE SAME <130>

<150>

<151>

<150>

<151>

<150>

<151>

<150>

<151>

<150>

<151>

<150>

<151>

<160>

<170>

<210>

<211>

<212>

<213>

<400> Met Phe Pro

Arg Asp Ser

2017FPO-09-017_PCT

KR 10-2016-0126335 2016-09-30

KR 10-2016-0126921 2016-09-30

KR 10-2016-0126961 2016-09-30

KR 10-2016-0127486 2016-10-04

KR 10-2016-0132616

2016- 10-13

KR 10-2017-0018637

2017- 02-10

PatentIn version 3.2 1

317

PRT

Homo sapiens

Gly Leu Glu

Leu Gln Glu

Pro Trp Leu

1 Gln Ala Ala Glu Arg Pro 5 Gly Leu Lys Lys Glu Arg 20 Asp Ser Met Lys Asp Glu 35 40 Glu Ile Arg Leu Glu Pro 55 Lys Gln Gln Leu Thr Glu

Gln Glu 10 Trp Ala Met Glu Gly 15 Leu Leu Asp Asp Arg His Asp 25 30 Glu Tyr Glu Gln Met Val Lys 45 Gln Glu Val Pro Arg Gly Ser 60 Asp Gly Asp Ser Phe Leu His 75

Ala Gln Ile Ile His Glu 85 Glu Lys Ala Leu Thr 90 Met Glu Val Ile Arg 95 Val Lys Gly Asp Leu Ala Phe Leu Asn Phe Gln Asn Asn Leu Gln Gln 100 105 110 Thr Pro Leu His Leu Ala Val Ile Thr Asn Gln Pro Glu Ile Ala Glu 115 120 125 Ala Leu Leu Gly Ala Gly Cys Asp Pro Glu Leu Arg Asp Phe Arg Gly 130 135 140 Asn Thr Pro Leu His Leu Ala Cys Glu Gln Gly Cys Leu Ala Ser Val 145 150 155 160 Gly Val Leu Thr Gln Ser Cys Thr Thr Pro His Leu His Ser Ile Leu 165 170 175 Lys Ala Thr Asn Tyr Asn Gly His Thr Cys Leu His Leu Ala Ser Ile 180 185 190 His Gly Tyr Leu Gly Ile Val Glu Leu Leu Val Ser Leu Gly Ala Asp 195 200 205 Val Asn Ala Gln Glu Pro Cys Asn Gly Arg Thr Ala Leu His Leu Ala 210 215 220 Val Asp Leu Gln Asn Pro Asp Leu Val Ser Leu Leu Leu Lys Cys Gly 225 230 235 240 Ala Asp Val Asn Arg Val Thr Tyr Gln Gly Tyr Ser Pro Tyr Gln Leu 245 250 255 Thr Trp Gly Arg Pro Ser Thr Arg Ile Gln Gln Gln Leu Gly Gln Leu 260 265 270 Thr Leu Glu Asn Leu Gln Met Leu Pro Glu Ser Glu Asp Glu Glu Ser 275 280 285 Tyr Asp Thr Glu Ser Glu Phe Thr Glu Phe Thr Glu Asp Glu Leu

Pro

290 295

Tyr Asp Asp Cys Val Phe Gly 305 310 <210> 2 <211> 356 <212> PRT <213> Homo sapiens

<400> 2 Gly Val Ala 5 Cys Leu Met Trp 1 Ala Cys Asp Ser Gly Leu Gly Ser Gly 20 Gly Pro Gly Leu Gly Ala Glu Pro 35 Leu Val Phe Gly Tyr Val Thr Leu 50 55 Ala Val Ile His Gln His Glu Phe 65 70 80 Ser Ala Gly Thr Glu Tyr Met Thr 85 Ala Leu His Leu Ala Ala Ile Lys 100 Leu Tyr Ala Ala Gly Ala Gly His 115 Thr Ala Leu His Leu Ala Cys Arg 130 135 Ala Leu Leu Gln Pro Arg Pro Thr 145 150 160 Tyr Leu Ala Gln Gly Pro Asp

300

Gly Gln Arg Leu 315 Thr Leu Gly Lys Ala Ala Asp Ala Asp Glu 10 15 Leu Gly Pro Asp Ala Ala Ala Pro 25 30 Leu Gly Pro Gly Leu Ser Trp Ala 40 45 Glu Asp Gly Asp Thr Ala Leu His 60 Pro Phe Leu Asp Phe Leu Leu Gly 75 Asp Leu Gln Asn Asp Leu Gly Gln 90 95 Leu Gly Glu Thr Ser Thr Val Glu 105 110 Leu Cys Val Ala Glu Arg Arg Gly 120 125 Arg Val Gly Ala His Ala Cys Ala 140 Arg Arg Pro Arg Glu Ala Pro Asp 155 Arg Thr Pro Asp Thr Asn His Thr

Pro

165 170 175 Val Ala Leu Tyr Pro Asp Ser Asp Leu Glu Lys Glu Glu Glu Glu Ser 180 185 190 Glu Glu Asp Trp Lys Leu Gln Leu Glu Ala Glu Asn Tyr Glu Gly His 195 200 205 Thr Pro Leu His Val Ala Val Ile His Lys Asp Val Glu Met Val Arg 210 215 220 Leu Leu Arg Asp Ala Gly Ala Asp Leu Asp Lys Pro Glu Pro Thr Cys 225 230 235 240 Gly Arg Ser Pro Leu His Leu Ala Val Glu Ala Gln Ala Ala Asp Val 245 250 255 Leu Glu Leu Leu Leu Arg Ala Gly Ala Asn Pro Ala Ala Arg Met Tyr 260 265 270 Gly Gly Arg Thr Pro Leu Gly Ser Ala Met Leu Arg Pro Asn Pro Ile 275 280 285 Leu Ala Arg Leu Leu Arg Ala His Gly Ala Pro Glu Pro Glu Gly Glu 290 295 300 Asp Glu Lys Ser Gly Pro Cys Ser Ser Ser Ser Asp Ser Asp Ser Gly 305 310 315 320 Asp Glu Gly Asp Glu Tyr Asp Asp Ile Val Val His Ser Ser Arg Ser 325 330 335 Gln Thr Arg Leu Pro Pro Thr Pro Ala Ser Lys Pro Leu Pro Asp Asp 340 345 350

Pro Arg Pro Val 355 <210> 3 <211> 500 <212> PRT <213>

Homo sapiens

<400> 3 Gln Arg Arg 5 Ser Glu Ser Arg Pro 10 Gly Asn His Arg Leu 15 Met Gln 1 Asn Ala Tyr Ala Glu Pro Gly Lys Gly Asp Ser Gly Gly Ala Gly Pro Leu 20 25 30 Ser Gly Ser Ala Arg Arg Gly Arg Gly Gly Gly Gly Ala Ile Arg Val 35 40 45 Arg Arg Pro Cys Trp Ser Gly Gly Ala Gly Arg Gly Gly Gly Pro Ala 50 55 60 Trp Ala Val Arg Leu Pro Thr Val Thr Ala Gly Trp Thr Trp Pro Ala 65 70 75 80 Leu Arg Thr Leu Ser Ser Leu Arg Ala Gly Pro Ser Glu Pro His Ser 85 90 95 Pro Gly Arg Arg Pro Pro Arg Ala Gly Arg Pro Leu Cys Gln Ala Asp 100 105 110 Pro Gln Pro Gly Lys Ala Ala Arg Arg Ser Leu Glu Pro Asp Pro Ala 115 120 125 Gln Thr Gly Pro Arg Pro Ala Arg Ala Ala Gly Met Ser Glu Ala Arg 130 135 140 Lys Gly Pro Asp Glu Ala Glu Glu Ser Gln Tyr Asp Ser Gly Ile Glu 145 150 155 160 Ser Leu Arg Ser Leu Arg Ser Leu Pro Glu Ser Thr Ser Ala Pro Ala 165 170 175 Ser Gly Pro Ser Asp Gly Ser Pro Gln Pro Cys Thr His Pro Pro Gly 180 185 190 Pro Val Lys Glu Pro Gln Glu Lys Glu Asp Ala Asp Gly Glu Arg Ala 195 200 205

Asp Leu Ser 210 Thr Tyr Gly Ser Ser 215 Gly Gly Pro Glu Ala Glu Asp His 225 230 240 Val Gly Ala Leu Ser Pro Gln Ser 245 Glu Asp Gly Asp Thr Leu Val Pro 260 Ala Val Leu Leu Cys Cys Leu Asp 275 Ile Gln Asn Asn Leu Tyr Gln Leu 290 295 Asp Gln Pro Gly Ala Val Arg Arg 305 310 320 Ala Leu Gln Asp Arg His Gly Gln 325 Arg Gln His Leu Ala Cys Ala Glu 340 Pro Gly Arg Gly Thr Ser His Trp 355 Gln Gly Leu Ala Cys Leu His Pro 370 375 Leu Met Glu Leu Leu Leu Arg Glu 385 390 400 Gly Thr Ser Gly Lys Thr Ala Glu 405

Leu Thr Tyr Thr Leu Ser Leu 220 Ala Pro Arg Leu Pro Leu Pro 235 Leu Glu Ala Leu Thr Tyr Ile 250 255 Leu Ala Val Ile His Glu Ala 265 270 Leu Leu Pro Gln Glu Val Leu 285 Ala Leu His Leu Ala Val His 300 Leu Val Leu Lys Gly Ala Ser 315 Thr Ala Leu His Val Ala Cys 330 335 Cys Leu Leu Glu Gly Arg Pro 345 350 Leu Asp Leu Gln Leu Gln Asn 365 Ala Thr Leu Gln Lys Asn Gln 380 Gly Ala Asp Ile Asp Val Gln 395 His Leu Ala Val Glu Thr Gln 410 415

Arg Ala Gly Leu Val 420 Gln Phe Leu Leu Gln 425 Ala Gly Ala Gln Val 430 Asp Arg Met Leu Asn Gly Cys Thr Pro Leu His Leu Ala Ala Gly Arg Gly 435 440 445 Leu Met Gly Ile Ser Ser Thr Leu Cys Lys Ala Gly Ala Asp Ser Leu 450 455 460 Leu Arg Asn Val Glu Asp Glu Thr Pro Gln Asp Leu Thr Glu Glu Ser 465 470 475 480 Leu Val Leu Leu Pro Phe Asp Asp Leu Lys Ile Ser Gly Lys Leu Leu 485 490 495 Leu Cys Thr Asp 500

<210> 4 <211> 454 <212> PRT <213> Homo sapiens <400> 4 Met Pro Leu Arg Cys Pro Ala Gly Ala Met Asp Glu Gly Pro Val Asp 1 5 10 15 Arg Thr Arg Pro Lys Ala Ala Gly Leu Pro Gly Ala Ala Leu Pro Leu 20 25 30 Arg Lys Arg Arg Pro Leu Arg Ala Pro Ser Pro Glu Pro Ala Ala Pro 35 40 45 Gly Ala Cys Ala Gly Leu Val Val Pro Leu Asp Pro Leu Arg Gly Gly 50 55 60 Asp Leu Glu Pro Ala Val Pro Gly Pro Pro His Gly Leu Ala Arg Pro 65 70 75 80 Ala Leu Tyr Tyr Pro Gly Ala Leu Leu Pro Leu Tyr Pro Thr Arg

Ala

85 90 95

Met Pro Gly Ser Pro 100 Phe Pro Leu Met Met Cys Pro Met Glu His Ala 115 Thr Arg Ala Asp Glu Asp Gly Val 130 135 Gln Gly Asn Leu Pro Ala Val Gln 145 150 160 Gly Gly Arg Glu Leu Asp Ile Leu 165 His Leu Ala Val Ile Thr Thr Val 180 Thr Ala Gly Ala Ser Pro Met Ala 195 Ala His Leu Ala Cys Glu His Leu 210 215 Leu Asp Ser Ala Ala Pro Gly Tyr 225 230 240 Asp Gly Leu Thr Ala Leu His Glu 245 Thr Val Gln Leu Leu Leu Glu Asp 260 Ile Lys Ser Gly Arg Ser Pro Ser 275 Leu Ser Met Val Gln Leu Leu Ala 290 295 Gln Met Tyr Ser Gly Ser Ser Gly

Asn Leu Pro Thr Pro Leu Tyr 105 110 Leu Ser Ala Asp Ile Ala Met 125 Thr Pro Leu His Ile Ala Val 140 Arg Leu Val Asn Leu Phe Gln 155 Asn Asn Leu Arg Gln Thr Pro 170 175 Pro Ser Val Val Arg Leu Leu 185 190 Leu Asp Arg His Gly Gln Thr 205 Ser Pro Thr Cys Leu Arg Ala 220 Leu Asp Leu Glu Ala Arg Asn 235 Ala Val Asn Thr Glu Cys Gln 250 255 Gly Ala Asp Ile Asp Ala Val 265 270 Ile His Ala Val Glu Asn Asn 285 Gln His Gly Ala Asn Val Asn 300 Leu His Ser Ala Ser Gly Arg

305 310 315

320

Leu Ser Leu Pro Leu Val 325 Arg Thr Leu Val Arg 330 Ser Gly Ala Asp Ser 335 Leu Lys Asn Cys His Asn Asp Thr Pro Leu Met Val Ala Arg Ser Arg 340 345 350 Arg Val Ile Asp Ile Leu Arg Gly Lys Ala Thr Arg Pro Ala Ser Thr 355 360 365 Ser Gln Pro Asp Pro Ser Pro Asp Arg Ser Ala Asn Thr Ser Pro Glu 370 375 380 Ser Ser Ser Arg Leu Ser Ser Asn Gly Leu Leu Ser Ala Ser Pro Ser 385 390 395 400 Ser Ser Pro Ser Gln Ser Pro Pro Arg Asp Pro Pro Gly Phe Pro Met 405 410 415 Ala Pro Pro Asn Phe Phe Leu Pro Ser Pro Ser Pro Pro Ala Phe Leu 420 425 430 Pro Phe Ala Gly Val Leu Arg Gly Pro Gly Arg Pro Val Pro Pro Ser 435 440 445 Pro Ala Pro Gly Gly Ser 450

<210> 5 <211> 317 <212> PRT <213> Homo sapiens <400> 5 Met Phe Pro Gln Ala Ala Glu Arg Pro Gln Glu Trp Ala Met Glu Gly 1 5 10 15 Arg Asp Ala Gly Leu Lys Lys Glu Arg Leu Leu Asp Asp Arg His Asp 20 25 30 Gly Leu Asp Ala Met Lys Asp Glu Glu Tyr Glu Gln Met Val Lys

Glu

Leu Glu Gln 50 Glu Ile Arg Leu Glu 55 Pro Gln Glu Val Pro 60 Arg Gly Ser Pro Trp Lys Gln Gln Leu Thr Glu Asp Gly Asp Ser Phe Leu His Leu 65 70 75 80 Ala Ile Ile His Glu Glu Lys Ala Leu Thr Met Glu Val Ile Arg Gln 85 90 95 Val Lys Gly Asp Leu Ala Phe Leu Asn Phe Gln Asn Asn Leu Gln Gln 100 105 110 Thr Pro Leu His Leu Ala Val Ile Thr Asn Gln Pro Glu Ile Ala Glu 115 120 125 Ala Leu Leu Gly Ala Gly Cys Asp Pro Glu Leu Arg Asp Phe Arg Gly 130 135 140 Asn Thr Pro Leu His Leu Ala Cys Glu Gln Gly Cys Leu Ala Ser Val 145 150 155 160 Gly Val Leu Thr Gln Ser Cys Thr Thr Pro His Leu His Ser Ile Leu 165 170 175 Lys Ala Thr Asn Tyr Asn Gly His Thr Cys Leu His Leu Ala Ser Ile 180 185 190 His Gly Tyr Leu Gly Ile Val Glu Leu Leu Val Ser Leu Gly Ala Asp 195 200 205 Val Asn Ala Gln Glu Pro Cys Asn Gly Arg Thr Ala Leu His Leu Ala 210 215 220 Val Asp Leu Gln Asn Pro Asp Leu Val Ser Leu Leu Leu Lys Cys Gly 225 230 235 240 Ala Asp Val Asn Arg Val Thr Tyr Gln Gly Tyr Ser Pro Tyr Gln Leu 245 250 255

Thr Leu Trp Gly Arg 260 Pro Ser Thr Arg Ile 265 Gln Gln Gln Leu Gly 270 Gln Thr Leu Glu Asn Leu Gln Met Leu Pro Glu Ser Glu Asp Glu Glu Ser 275 280 285 Tyr Asp Thr Glu Ser Glu Phe Thr Glu Phe Thr Glu Asp Glu Leu Pro 290 295 300 Tyr Asp Asp Cys Val Phe Gly Gly Gln Arg Leu Thr Leu 305 310 315

<210> 6 <211> 192 <212> PRT <213> Homo sapiens <400> 6 Met Asp Gly Ser Gly Glu Gln Pro Arg Gly Gly Gly Pro Thr Ser Ser 1 5 10 15 Glu Gln Ile Met Lys Thr Gly Ala Leu Leu Leu Gln Gly Phe Ile Gln 20 25 30 Asp Arg Ala Gly Arg Met Gly Gly Glu Ala Pro Glu Leu Ala Leu Asp 35 40 45 Pro Val Pro Gln Asp Ala Ser Thr Lys Lys Leu Ser Glu Cys Leu Lys 50 55 60 Arg Ile Gly Asp Glu Leu Asp Ser Asn Met Glu Leu Gln Arg Met Ile 65 70 75 80 Ala Ala Val Asp Thr Asp Ser Pro Arg Glu Val Phe Phe Arg Val Ala 85 90 95 Ala Asp Met Phe Ser Asp Gly Asn Phe Asn Trp Gly Arg Val Val Ala 100 105 110 Leu Phe Tyr Phe Ala Ser Lys Leu Val Leu Lys Ala Leu Cys Thr Lys 115 120 125

Val Leu Pro 130 Glu Leu Ile Arg Thr 135 Ile Met Gly Trp Thr 140 Leu Asp Phe Arg Glu Arg Leu Leu Gly Trp Ile Gln Asp Gln Gly Gly Trp Asp Gly 145 150 155 160 Leu Leu Ser Tyr Phe Gly Thr Pro Thr Trp Gln Thr Val Thr Ile Phe 165 170 175 Val Ala Gly Val Leu Thr Ala Ser Leu Thr Ile Trp Lys Lys Met Gly 180 185 190

<210> 7 <211> 199 <212> PRT <213> Homo sapiens <400> 7 Met Ser Ser Gly Asn Ala Lys Ile Gly His Pro Ala Pro Asn Phe Lys 1 5 10 15 Ala Thr Ala Val Met Pro Asp Gly Gln Phe Lys Asp Ile Ser Leu Ser 20 25 30 Asp Tyr Lys Gly Lys Tyr Val Val Phe Phe Phe Tyr Pro Leu Asp Phe 35 40 45 Thr Phe Val Cys Pro Thr Glu Ile Ile Ala Phe Ser Asp Arg Ala Glu 50 55 60 Glu Phe Lys Lys Leu Asn Cys Gln Val Ile Gly Ala Ser Val Asp Ser 65 70 75 80 His Phe Cys His Leu Ala Trp Val Asn Thr Pro Lys Lys Gln Gly Gly 85 90 95 Leu Gly Pro Met Asn Ile Pro Leu Val Ser Asp Pro Lys Arg Thr Ile 100 105 110 Ala Gln Asp Tyr Gly Val Leu Lys Ala Asp Glu Gly Ile Ser Phe

Arg

115

120

125

Gly Val Leu 130 Phe Ile Ile Asp Asp 135 Lys Gly Ile Leu Arg 140 Gln Ile Thr Asn Asp Leu Pro Val Gly Arg Ser Val Asp Glu Thr Leu Arg Leu Val 145 150 155 160 Gln Ala Phe Gln Phe Thr Asp Lys His Gly Glu Val Cys Pro Ala Gly 165 170 175 Trp Lys Pro Gly Ser Asp Thr Ile Lys Pro Asp Val Gln Lys Ser Lys 180 185 190 Glu Tyr Phe Ser Lys Gln Lys 195

<210> 8 <211> 198 <212> PRT <213> Homo sapiens

<400> 8 Ser Gly Asn 5 Ala Arg Ile Gly Lys 10 Pro Ala Pro Asp Phe 15 Met Lys 1 Ala Ala Thr Ala Val Val Asp Gly Ala Phe Lys Glu Val Lys Leu Ser Asp 20 25 30 Tyr Lys Gly Lys Tyr Val Val Leu Phe Phe Tyr Pro Leu Asp Phe Thr 35 40 45 Phe Val Cys Pro Thr Glu Ile Ile Ala Phe Ser Asn Arg Ala Glu Asp 50 55 60 Phe Arg Lys Leu Gly Cys Glu Val Leu Gly Val Ser Val Asp Ser Gln 65 70 75 80 Phe Thr His Leu Ala Trp Ile Asn Thr Pro Arg Lys Glu Gly Gly Leu 85 90 95

Gly Pro Leu Asn Ile

Pro Leu

Leu Ala

Asp Val Thr Arg Arg Leu

Ser

100 105 110 Glu Asp Tyr Gly Val Leu Lys Thr Asp Glu Gly Ile Ala Tyr Arg Gly 115 120 125 Leu Phe Ile Ile Asp Gly Lys Gly Val Leu Arg Gln Ile Thr Val Asn 130 135 140 Asp Leu Pro Val Gly Arg Ser Val Asp Glu Ala Leu Arg Leu Val Gln 145 150 155 160 Ala Phe Gln Tyr Thr Asp Glu His Gly Glu Val Cys Pro Ala Gly Trp 165 170 175 Lys Pro Gly Ser Asp Thr Ile Lys Pro Asn Val Asp Asp Ser Lys Glu 180 185 190 Tyr Phe Ser Lys His Asn 195

<210> 9 <211> 343 <212> PRT <213> Bacteriophage P1 <400> 9 Met Ser Val Asn Leu Leu Thr Val His Gln Asn Leu Pro Ala Leu Pro 1 5 10 15 Asp Ala Arg Thr Ser Asp Glu Val Arg Lys Asn Leu Met Asp Met Phe 20 25 30 Asp Arg Gln Ala Phe Ser Glu His Thr Trp Lys Met Leu Leu Ser Val 35 40 45 Cys Arg Phe Ser Trp Ala Ala Trp Cys Lys Leu Asn Asn Arg Lys Trp 50 55 60 Pro Ala Ala Glu Pro Glu Asp Val Arg Asp Tyr Leu Leu Tyr Leu Gln 65 70 75 80 Arg Gly Leu Ala Val Lys Thr Ile Gln Gln His Leu Gly Gln Leu

Asn

Met Ala Leu His Arg 100 Arg Ser Gly Leu Pro 105 Arg Pro Ser Asp Ser 110 Asn Val Ser Leu Val Met Arg Arg Ile Arg Lys Glu Asn Val Asp Ala Gly 115 120 125 Glu Arg Ala Lys Gln Ala Leu Ala Phe Glu Arg Thr Asp Phe Asp Gln 130 135 140 Val Arg Ser Leu Met Glu Asn Ser Asp Arg Cys Gln Asp Ile Arg Asn 145 150 155 160 Leu Ala Phe Leu Gly Ile Ala Tyr Asn Thr Leu Leu Arg Ile Ala Glu 165 170 175 Ile Ala Arg Ile Arg Val Lys Asp Ile Ser Arg Thr Asp Gly Gly Arg 180 185 190 Met Leu Ile His Ile Gly Arg Thr Lys Thr Leu Val Ser Thr Ala Gly 195 200 205 Val Glu Lys Ala Leu Ser Leu Gly Val Thr Lys Leu Val Glu Arg Trp 210 215 220 Ile Ser Val Ser Gly Val Ala Asp Asp Pro Asn Asn Tyr Leu Phe Cys 225 230 235 240 Arg Val Arg Lys Asn Gly Val Ala Ala Pro Ser Ala Thr Ser Gln Leu 245 250 255 Ser Thr Arg Ala Leu Glu Gly Ile Phe Glu Ala Thr His Arg Leu Ile 260 265 270 Tyr Gly Ala Lys Asp Asp Ser Gly Gln Arg Tyr Leu Ala Trp Ser Gly 275 280 285 His Ser Ala Arg Val Gly Ala Ala Arg Asp Met Ala Arg Ala Gly

Val

290 295 300

Ser Ile 305 320 Ile Pro Glu Ile Met 310 Gln Ala Gly Gly Trp 315 Thr Asn Val Asn Val Met Asn Tyr Ile Arg Asn Leu Asp Ser Glu Thr Gly Ala Met Val 325 330 335 Arg Leu Leu Glu Asp Gly Asp

340 <210> 10 <211> 469 <212> PRT <213> Streptococcus pyogenes

<400> 10 Ser Phe Pro 5 Pro Leu Leu Leu Leu 10 Leu Phe Trp Gly Val 15 Met Val 1 His Ser His Ser Phe Pro Ala Thr Leu Glu Thr Gln Glu Gln Asp Val Asp 20 25 30 Leu Val Gln Lys Tyr Leu Glu Lys Tyr Tyr Asn Leu Lys Asn Asp Gly 35 40 45 Arg Gln Val Glu Lys Arg Arg Asn Ser Gly Pro Val Val Glu Lys Leu 50 55 60 Lys Gln Met Gln Glu Phe Phe Gly Leu Lys Val Thr Gly Lys Pro Asp 65 70 75 80 Ala Glu Thr Leu Lys Val Met Lys Gln Pro Arg Cys Gly Val Pro Asp 85 90 95 Val Ala Gln Phe Val Leu Thr Glu Gly Asn Pro Arg Trp Glu Gln Thr 100 105 110 His Leu Thr Tyr Arg Ile Glu Asn Tyr Thr Pro Asp Leu Pro Arg Ala 115 120 125 Asp Val Asp His Ala Ile Glu Lys Ala Phe Gln Leu Trp Ser Asn Val 130 135 140

Thr Met 145 160 Pro Leu Thr Phe Thr 150 Lys Val Ser Glu Gly 155 Gln Ala Asp Ile Ile Ser Phe Val Arg Gly Asp His Arg Asp Asn Ser Pro Phe Asp Gly 165 170 175 Pro Gly Gly Asn Leu Ala His Ala Phe Gln Pro Gly Pro Gly Ile Gly 180 185 190 Gly Asp Ala His Phe Asp Glu Asp Glu Arg Trp Thr Asn Asn Phe Arg 195 200 205 Glu Tyr Asn Leu His Arg Val Ala Ala His Glu Leu Gly His Ser Leu 210 215 220 Gly Leu Ser His Ser Thr Asp Ile Gly Ala Leu Met Tyr Pro Ser Tyr 225 230 235 240 Thr Phe Ser Gly Asp Val Gln Leu Ala Gln Asp Asp Ile Asp Gly Ile 245 250 255 Gln Ala Ile Tyr Gly Arg Ser Gln Asn Pro Val Gln Pro Ile Gly Pro 260 265 270 Gln Thr Pro Lys Ala Cys Asp Ser Lys Leu Thr Phe Asp Ala Ile Thr 275 280 285 Thr Ile Arg Gly Glu Val Met Phe Phe Lys Asp Arg Phe Tyr Met Arg 290 295 300 Thr Asn Pro Phe Tyr Pro Glu Val Glu Leu Asn Phe Ile Ser Val Phe 305 310 315 320 Trp Pro Gln Leu Pro Asn Gly Leu Glu Ala Ala Tyr Glu Phe Ala Asp 325 330 335 Arg Asp Glu Val Arg Phe Phe Lys Gly Asn Lys Tyr Trp Ala Val Gln 340 345 350

Gly Phe Gln Asn 355 Val Leu His Gly Tyr 360 Pro Lys Asp Ile Tyr 365 Ser Ser Gly Phe Pro Arg Thr Val Lys His Ile Asp Ala Ala Leu Ser Glu Glu 370 375 380 Asn Thr Gly Lys Thr Tyr Phe Phe Val Ala Asn Lys Tyr Trp Arg Tyr 385 390 395 400 Asp Glu Tyr Lys Arg Ser Met Asp Pro Gly Tyr Pro Lys Met Ile Ala 405 410 415 His Asp Phe Pro Gly Ile Gly His Lys Val Asp Ala Val Phe Met Lys 420 425 430 Asp Gly Phe Phe Tyr Phe Phe His Gly Thr Arg Gln Tyr Lys Phe Asp 435 440 445 Pro Lys Thr Lys Arg Ile Leu Thr Leu Gln Lys Ala Asn Ser Trp Phe 450 455 460

Asn Cys Arg Lys Asn 465 <210> 11 <211> 1300 <212> PRT <213> Francisella tularensis

<400> 11 Ile Tyr Gln 5 Glu Phe Val Asn Lys 10 Tyr Ser Leu Ser Lys 15 Met Thr 1 Ser Leu Arg Phe Glu Leu Ile Pro Gln Gly Lys Thr Leu Glu Asn Ile Lys 20 25 30 Ala Arg Gly Leu Ile Leu Asp Asp Glu Lys Arg Ala Lys Asp Tyr Lys 35 40 45 Lys Ala Lys Gln Ile Ile Asp Lys Tyr His Gln Phe Phe Ile Glu Glu 50 55 60 Ile Leu Ser Ser Val Cys Ile Ser Glu Asp Leu Leu Gln Asn Tyr

Ser

65 70 75

Asp Lys Val Tyr Phe Lys 85 Leu Lys Lys Ser Asp 90 Asp Asp Asn Leu Gln 95 Asp Phe Lys Ser Ala Lys Asp Thr Ile Lys Lys Gln Ile Ser Glu Tyr 100 105 110 Ile Lys Asp Ser Glu Lys Phe Lys Asn Leu Phe Asn Gln Asn Leu Ile 115 120 125 Asp Ala Lys Lys Gly Gln Glu Ser Asp Leu Ile Leu Trp Leu Lys Gln 130 135 140 Ser Lys Asp Asn Gly Ile Glu Leu Phe Lys Ala Asn Ser Asp Ile Thr 145 150 155 160 Asp Ile Asp Glu Ala Leu Glu Ile Ile Lys Ser Phe Lys Gly Trp Thr 165 170 175 Thr Tyr Phe Lys Gly Phe His Glu Asn Arg Lys Asn Val Tyr Ser Ser 180 185 190 Asn Asp Ile Pro Thr Ser Ile Ile Tyr Arg Ile Val Asp Asp Asn Leu 195 200 205 Pro Lys Phe Leu Glu Asn Lys Ala Lys Tyr Glu Ser Leu Lys Asp Lys 210 215 220 Ala Pro Glu Ala Ile Asn Tyr Glu Gln Ile Lys Lys Asp Leu Ala Glu 225 230 235 240 Glu Leu Thr Phe Asp Ile Asp Tyr Lys Thr Ser Glu Val Asn Gln Arg 245 250 255 Val Phe Ser Leu Asp Glu Val Phe Glu Ile Ala Asn Phe Asn Asn Tyr 260 265 270 Leu Asn Gln Ser Gly Ile Thr Lys Phe Asn Thr Ile Ile Gly Gly

Lys

275

280

285

Phe Ile Val 290 Asn Gly Glu Asn Thr 295 Lys Arg Lys Gly Ile 300 Asn Glu Tyr Asn Lys 305 Leu Tyr Ser Gln Gln 310 Ile Asn Asp Lys Thr 315 Leu Lys Lys Tyr 320 Met Ser Val Leu Phe Lys Gln Ile Leu Ser Asp Thr Glu Ser Lys Ser 325 330 335 Phe Met Val Ile Asp Lys Leu Glu Asp Asp Ser Asp Val Val Thr Thr 340 345 350 Gln Ser Phe Tyr Glu Gln Ile Ala Ala Phe Lys Thr Val Glu Glu Lys 355 360 365 Ser Gln Ile Lys Glu Thr Leu Ser Leu Leu Phe Asp Asp Leu Lys Ala 370 375 380 Lys Thr Leu Asp Leu Ser Lys Ile Tyr Phe Lys Asn Asp Lys Ser Leu 385 390 395 400 Asp Ala Leu Ser Gln Gln Val Phe Asp Asp Tyr Ser Val Ile Gly Thr 405 410 415 Val Leu Glu Tyr Ile Thr Gln Gln Ile Ala Pro Lys Asn Leu Asp Asn 420 425 430 Pro Ala Ser Lys Lys Glu Gln Glu Leu Ile Ala Lys Lys Thr Glu Lys 435 440 445 Lys Tyr Leu Ser Leu Glu Thr Ile Lys Leu Ala Leu Glu Glu Phe Asn 450 455 460 Lys Ala His Arg Asp Ile Asp Lys Gln Cys Arg Phe Glu Glu Ile Leu 465 470 475 480 Asn Phe Ala Ala Ile Pro Met Ile Phe Asp Glu Ile Ala Gln Asn Lys 485 490 495

Asp Lys Asn Leu Ala 500 Gln Ile Ser Ile Lys 505 Tyr Gln Asn Gln Gly 510 Lys Asp Leu Leu Gln Ala Ser Ala Glu Asp Asp Val Lys Ala Ile Lys Asp 515 520 525 Leu Leu Asp Gln Thr Asn Asn Leu Leu His Lys Leu Lys Ile Phe His 530 535 540 Ile Ser Gln Ser Glu Asp Lys Ala Asn Ile Leu Asp Lys Asp Glu His 545 550 555 560 Phe Tyr Leu Val Phe Glu Glu Cys Tyr Phe Glu Leu Ala Asn Ile Val 565 570 575 Pro Leu Tyr Asn Lys Ile Arg Asn Tyr Ile Thr Gln Lys Pro Tyr Ser 580 585 590 Asp Glu Lys Phe Lys Leu Asn Phe Glu Asn Ser Thr Leu Ala Asn Gly 595 600 605 Trp Asp Lys Asn Lys Glu Pro Asp Asn Thr Ala Ile Leu Phe Ile Lys 610 615 620 Asp Asp Lys Tyr Tyr Leu Gly Val Met Asn Lys Lys Asn Asn Lys Ile 625 630 635 640 Phe Asp Asp Lys Ala Ile Lys Glu Asn Lys Gly Glu Gly Tyr Lys Lys 645 650 655 Ile Val Tyr Lys Leu Leu Pro Gly Ala Asn Lys Met Leu Pro Lys Val 660 665 670 Phe Phe Ser Ala Lys Ser Ile Lys Phe Tyr Asn Pro Ser Glu Asp Ile 675 680 685 Leu Arg Ile Arg Asn His Ser Thr His Thr Lys Asn Gly Ser Pro Gln 690 695 700 Lys Gly Tyr Glu Lys Phe Glu Phe Asn Ile Glu Asp Cys Arg Lys

Phe

705 710 715

720

Ile Asp Asp Phe Tyr Lys 725 Gln Ser Ile Ser Lys 730 His Pro Glu Trp Lys 735 Phe Gly Phe Arg Phe Ser Asp Thr Gln Arg Tyr Asn Ser Ile Asp Glu 740 745 750 Phe Tyr Arg Glu Val Glu Asn Gln Gly Tyr Lys Leu Thr Phe Glu Asn 755 760 765 Ile Ser Glu Ser Tyr Ile Asp Ser Val Val Asn Gln Gly Lys Leu Tyr 770 775 780 Leu Phe Gln Ile Tyr Asn Lys Asp Phe Ser Ala Tyr Ser Lys Gly Arg 785 790 795 800 Pro Asn Leu His Thr Leu Tyr Trp Lys Ala Leu Phe Asp Glu Arg Asn 805 810 815 Leu Gln Asp Val Val Tyr Lys Leu Asn Gly Glu Ala Glu Leu Phe Tyr 820 825 830 Arg Lys Gln Ser Ile Pro Lys Lys Ile Thr His Pro Ala Lys Glu Ala 835 840 845 Ile Ala Asn Lys Asn Lys Asp Asn Pro Lys Lys Glu Ser Val Phe Glu 850 855 860 Tyr Asp Leu Ile Lys Asp Lys Arg Phe Thr Glu Asp Lys Phe Phe Phe 865 870 875 880 His Cys Pro Ile Thr Ile Asn Phe Lys Ser Ser Gly Ala Asn Lys Phe 885 890 895 Asn Asp Glu Ile Asn Leu Leu Leu Lys Glu Lys Ala Asn Asp Val His 900 905 910 Ile Leu Ser Ile Asp Arg Gly Glu Arg His Leu Ala Tyr Tyr Thr

Leu

915

920

925

Val Ile Asp 930 Gly Lys Gly Asn Ile 935 Ile Lys Gln Asp Thr 940 Phe Asn Ile Gly Asn Asp Arg Met Lys Thr Asn Tyr His Asp Lys Leu Ala Ala Ile 945 950 955 960 Glu Lys Asp Arg Asp Ser Ala Arg Lys Asp Trp Lys Lys Ile Asn Asn 965 970 975 Ile Lys Glu Met Lys Glu Gly Tyr Leu Ser Gln Val Val His Glu Ile 980 985 990 Ala Lys Leu Val Ile Glu Tyr Asn Ala Ile Val Val Phe Glu Asp Leu 995 1000 1005 Asn Phe Gly Phe Lys Arg Gly Arg Phe Lys Val Glu Lys Gln Val Tyr 1010 1015 1020 Gln Lys Leu Glu Lys Met Leu Ile Glu Lys Leu Asn Tyr Leu Val

Phe

1025 1030 1035

1040

Lys Gln Asp Asn Glu Phe 1045 Asp Lys Thr Gly Gly 1050 Val Leu Arg Ala Tyr 1055 Leu Thr Ala Pro Phe Glu Thr Phe Lys Lys Met Gly Lys Gln Thr Gly 1060 1065 1070 Ile Ile Tyr Tyr Val Pro Ala Gly Phe Thr Ser Lys Ile Cys Pro Val 1075 1080 1085 Thr Gly Phe Val Asn Gln Leu Tyr Pro Lys Tyr Glu Ser Val Ser Lys 1090 1095 1100 Ser Gln Glu Phe Phe Ser Lys Phe Asp Lys Ile Cys Tyr Asn Leu Asp 1105 1110 1115 1120 Lys Gly Tyr Phe Glu Phe Ser Phe Asp Tyr Lys Asn Phe Gly Asp

Lys

1125 1130 1135

Ala Ile Ala Lys Gly 1140 Lys Trp Thr Ile Ala 1145 Ser Phe Gly Ser Arg 1150 Leu Asn Phe Arg Asn Ser Asp Lys Asn His Asn Trp Asp Thr Arg Glu Val 1155 1160 1165 Tyr Pro Thr Lys Glu Leu Glu Lys Leu Leu Lys Asp Tyr Ser Ile Glu 1170 1175 1180 Tyr Gly His Gly Glu Cys Ile Lys Ala Ala Ile Cys Gly Glu Ser Asp 1185 1190 1195 1200 Lys Lys Phe Phe Ala Lys Leu Thr Ser Val Leu Asn Thr Ile Leu Gln 1205 1210 1215 Met Arg Asn Ser Lys Thr Gly Thr Glu Leu Asp Tyr Leu Ile Ser Pro 1220 1225 1230 Val Ala Asp Val Asn Gly Asn Phe Phe Asp Ser Arg Gln Ala Pro Lys 1235 1240 1245 Asn Met Pro Gln Asp Ala Asp Ala Asn Gly Ala Tyr His Ile Gly Leu 1250 1255 1260 Lys Gly Leu Met Leu Leu Gly Arg Ile Lys Asn Asn Gln Glu Gly Lys 1265 1270 1275 1280 Lys Leu Asn Leu Val Ile Lys Asn Glu Glu Tyr Phe Glu Phe Val

Gln

1285 1290 1295

Asn Arg Asn Asn 1300

<210> 12 <211> 536 <212> PRT <213> Homo sapiens <400> 12 Met Glu Phe Ser Ser Pro Ser Arg Glu Glu Cys Pro Lys Pro Leu Ser 1 5 10 15

Arg Gln Val Ser Ile 20 Met Ala Gly Ser Leu 25 Thr Gly Leu Leu Leu 30 Leu Ala Val Ser Trp Ala Ser Gly Ala Arg Pro Cys Ile Pro Lys Ser Phe 35 40 45 Gly Tyr Ser Ser Val Val Cys Val Cys Asn Ala Thr Tyr Cys Asp Ser 50 55 60 Phe Asp Pro Pro Thr Phe Pro Ala Leu Gly Thr Phe Ser Arg Tyr Glu 65 70 75 80 Ser Thr Arg Ser Gly Arg Arg Met Glu Leu Ser Met Gly Pro Ile Gln 85 90 95 Ala Asn His Thr Gly Thr Gly Leu Leu Leu Thr Leu Gln Pro Glu Gln 100 105 110 Lys Phe Gln Lys Val Lys Gly Phe Gly Gly Ala Met Thr Asp Ala Ala 115 120 125 Ala Leu Asn Ile Leu Ala Leu Ser Pro Pro Ala Gln Asn Leu Leu Leu 130 135 140 Lys Ser Tyr Phe Ser Glu Glu Gly Ile Gly Tyr Asn Ile Ile Arg Val 145 150 155 160 Pro Met Ala Ser Cys Asp Phe Ser Ile Arg Thr Tyr Thr Tyr Ala Asp 165 170 175 Thr Pro Asp Asp Phe Gln Leu His Asn Phe Ser Leu Pro Glu Glu Asp 180 185 190 Thr Lys Leu Lys Ile Pro Leu Ile His Arg Ala Leu Gln Leu Ala Gln 195 200 205 Arg Pro Val Ser Leu Leu Ala Ser Pro Trp Thr Ser Pro Thr Trp Leu 210 215 220 Lys Thr Asn Gly Ala Val Asn Gly Lys Gly Ser Leu Lys Gly Gln

Pro

225 230 235

240

Gly Leu Asp Ile Tyr His 245 Gln Thr Trp Ala Arg 250 Tyr Phe Val Lys Phe 255 Asp Ala Tyr Ala Glu His Lys Leu Gln Phe Trp Ala Val Thr Ala Glu 260 265 270 Asn Glu Pro Ser Ala Gly Leu Leu Ser Gly Tyr Pro Phe Gln Cys Leu 275 280 285 Gly Phe Thr Pro Glu His Gln Arg Asp Phe Ile Ala Arg Asp Leu Gly 290 295 300 Pro Thr Leu Ala Asn Ser Thr His His Asn Val Arg Leu Leu Met Leu 305 310 315 320 Asp Asp Gln Arg Leu Leu Leu Pro His Trp Ala Lys Val Val Leu Thr 325 330 335 Asp Pro Glu Ala Ala Lys Tyr Val His Gly Ile Ala Val His Trp Tyr 340 345 350 Leu Asp Phe Leu Ala Pro Ala Lys Ala Thr Leu Gly Glu Thr His Arg 355 360 365 Leu Phe Pro Asn Thr Met Leu Phe Ala Ser Glu Ala Cys Val Gly Ser 370 375 380 Lys Phe Trp Glu Gln Ser Val Arg Leu Gly Ser Trp Asp Arg Gly Met 385 390 395 400 Gln Tyr Ser His Ser Ile Ile Thr Asn Leu Leu Tyr His Val Val Gly 405 410 415 Trp Thr Asp Trp Asn Leu Ala Leu Asn Pro Glu Gly Gly Pro Asn Trp 420 425 430 Val Arg Asn Phe Val Asp Ser Pro Ile Ile Val Asp Ile Thr Lys

Asp

435 440 445 Thr Phe Tyr Lys Gln Pro Met Phe Tyr His Leu Gly His Phe Ser Lys 450 455 460 Phe Ile Pro Glu Gly Ser Gln Arg Val Gly Leu Val Ala Ser Gln Lys 465 470 475 480 Asn Asp Leu Asp Ala Val Ala Leu Met His Pro Asp Gly Ser Ala Val 485 490 495 Val Val Val Leu Asn Arg Ser Ser Lys Asp Val Pro Leu Thr Ile Lys 500 505 510 Asp Pro Ala Val Gly Phe Leu Glu Thr Ile Ser Pro Gly Tyr Ser Ile 515 520 525 His Thr Tyr Leu Trp Arg Arg Gln 530 535

<210> 13 <211> 469 <212> PRT <213> Homo sapiens

<400> 13 Ser Phe Pro 5 Pro Leu Leu Leu Leu 10 Leu Phe Trp Gly Val 15 Met Val 1 His Ser His Ser Phe Pro Ala Thr Leu Glu Thr Gln Glu Gln Asp Val Asp 20 25 30 Leu Val Gln Lys Tyr Leu Glu Lys Tyr Tyr Asn Leu Lys Asn Asp Gly 35 40 45 Arg Gln Val Glu Lys Arg Arg Asn Ser Gly Pro Val Val Glu Lys Leu 50 55 60 Lys Gln Met Gln Glu Phe Phe Gly Leu Lys Val Thr Gly Lys Pro Asp 65 70 75 80 Ala Glu Thr Leu Lys Val Met Lys Gln Pro Arg Cys Gly Val Pro Asp

Val Thr Ala Gln Phe 100 Val Leu Thr Glu Gly 105 Asn Pro Arg Trp Glu 110 Gln His Leu Thr Tyr Arg Ile Glu Asn Tyr Thr Pro Asp Leu Pro Arg Ala 115 120 125 Asp Val Asp His Ala Ile Glu Lys Ala Phe Gln Leu Trp Ser Asn Val 130 135 140 Thr Pro Leu Thr Phe Thr Lys Val Ser Glu Gly Gln Ala Asp Ile Met 145 150 155 160 Ile Ser Phe Val Arg Gly Asp His Arg Asp Asn Ser Pro Phe Asp Gly 165 170 175 Pro Gly Gly Asn Leu Ala His Ala Phe Gln Pro Gly Pro Gly Ile Gly 180 185 190 Gly Asp Ala His Phe Asp Glu Asp Glu Arg Trp Thr Asn Asn Phe Arg 195 200 205 Glu Tyr Asn Leu His Arg Val Ala Ala His Glu Leu Gly His Ser Leu 210 215 220 Gly Leu Ser His Ser Thr Asp Ile Gly Ala Leu Met Tyr Pro Ser Tyr 225 230 235 240 Thr Phe Ser Gly Asp Val Gln Leu Ala Gln Asp Asp Ile Asp Gly Ile 245 250 255 Gln Ala Ile Tyr Gly Arg Ser Gln Asn Pro Val Gln Pro Ile Gly Pro 260 265 270 Gln Thr Pro Lys Ala Cys Asp Ser Lys Leu Thr Phe Asp Ala Ile Thr 275 280 285 Thr Ile Arg Gly Glu Val Met Phe Phe Lys Asp Arg Phe Tyr Met

Arg

290 295 300

Thr Asn Phe 305 320

Trp Pro Asp

Arg Asp Gln

Gly Gln Phe

Gly Phe Glu

370

Asn Thr Tyr 385 400

Asp Glu Ala

His Asp Lys

Asp Gly Asp

Pro Lys Phe

450

Asn Cys 465

Pro Phe Tyr Pro 310 Glu Val Glu Leu Asn 315 Phe Ile Ser Val Gln Leu Pro Asn Gly Leu Glu Ala Ala Tyr Glu Phe Ala 325 330 335 Glu Val Arg Phe Phe Lys Gly Asn Lys Tyr Trp Ala Val 340 345 350 Asn Val Leu His Gly Tyr Pro Lys Asp Ile Tyr Ser Ser 355 360 365 Pro Arg Thr Val Lys His Ile Asp Ala Ala Leu Ser Glu 375 380 Gly Lys Thr Tyr Phe Phe Val Ala Asn Lys Tyr Trp Arg 390 395 Tyr Lys Arg Ser Met Asp Pro Gly Tyr Pro Lys Met Ile 405 410 415 Phe Pro Gly Ile Gly His Lys Val Asp Ala Val Phe Met 420 425 430 Phe Phe Tyr Phe Phe His Gly Thr Arg Gln Tyr Lys Phe 435 440 445 Thr Lys Arg Ile Leu Thr Leu Gln Lys Ala Asn Ser Trp 455 460 Arg Lys Asn

<210>

<211>

<212>

<213>

<400> Met Ala Trp

207

PRT

Homo sapiens

14 Pro Phe Glu Pro Leu Ala Ser Gly Ile Leu Leu Leu Leu 5 10 15

Leu Gln Ile Ala Pro 20 Ser Thr Ala Phe Cys Asn Gly 35 Thr Pro Glu Val Asn Lys 50 Met Thr Lys Met Tyr Asp 65 80 Ile Arg Phe Val Tyr Phe 85 His Arg Ser His Asn Leu 100 Gln Asp Gly Leu Leu Trp 115 Asn Ser Leu Ser Leu Thr 130 Val Gly Cys Glu Glu Cys 145 160 Lys Leu Gln Ser Gly Gln 165 Gly Ser Glu Lys Gly Arg 180 Glu Pro Gly Leu Cys 195 <210> 15

<211> 220 <212> PRT <213> Homo sapi

Arg Ala Cys Thr 25 Cys Ser Asp Leu 40 Val Ile Gln Thr 55 Thr Leu Tyr Lys Gly Phe Gln Ala 70 Thr Pro Ala Met Glu 90 Arg Ser Glu Glu 105 Phe His Ile Thr 120 Thr Cys Ala Gln 135 Arg Arg Gly Cys Thr Val Phe Pro 150 Thr His Cys Leu Trp 170 Phe Gln Ser Arg 185 His Thr Trp Gln 200 Ser Leu

Val Pro Pro His 30 Pro Arg Ala Lys 45 Phe Val Gln Arg 60 Tyr Glu Ile Leu Gly Asp Ala Ala 75 Ser Val Cys Gly Tyr 95 Leu Ile Ala Gly 110 Lys Ser Phe Val 125 Ala Pro Phe Thr 140 Lys Thr Tyr Cys Leu Ser Ile Pro 155 Thr Asp Gln Leu Leu 175 Leu Ala Cys Leu 190 Pro Arg Ser Gln 205 Ile Ala

<400> 15 Ala Ala Ala 5 Arg Thr Leu Arg Leu 10 Ala Leu Gly Leu Leu 15 Met Leu 1 Gly Leu Ala Thr Leu Leu Arg Pro Ala Asp Ala Cys Ser Cys Ser Pro Val 20 25 30 His Pro Gln Gln Ala Phe Cys Asn Ala Asp Val Val Ile Arg Ala Lys 35 40 45 Ala Val Ser Glu Lys Glu Val Asp Ser Gly Asn Asp Ile Tyr Gly Asn 50 55 60 Pro Ile Lys Arg Ile Gln Tyr Glu Ile Lys Gln Ile Lys Met Phe Lys 65 70 75 80 Gly Pro Glu Lys Asp Ile Glu Phe Ile Tyr Thr Ala Pro Ser Ser Ala 85 90 95 Val Cys Gly Val Ser Leu Asp Val Gly Gly Lys Lys Glu Tyr Leu Ile 100 105 110 Ala Gly Lys Ala Glu Gly Asp Gly Lys Met His Ile Thr Leu Cys Asp 115 120 125 Phe Ile Val Pro Trp Asp Thr Leu Ser Thr Thr Gln Lys Lys Ser Leu 130 135 140 Asn His Arg Tyr Gln Met Gly Cys Glu Cys Lys Ile Thr Arg Cys Pro 145 150 155 160 Met Ile Pro Cys Tyr Ile Ser Ser Pro Asp Glu Cys Leu Trp Met Asp 165 170 175 Trp Val Thr Glu Lys Asn Ile Asn Gly His Gln Ala Lys Phe Phe Ala 180 185 190 Cys Ile Lys Arg Ser Asp Gly Ser Cys Ala Trp Tyr Arg Gly Ala Ala 195 200 205

Pro Pro Lys Gln Glu Phe Leu Asp Ile Glu Asp Pro 210 215 220 <210> 16 <211> 211 <212> PRT <213> Homo sapiens

<400> 16 Pro Trp Leu 5 Gly Leu Ile Val Leu 10 Leu Gly Ser Trp Ser 15 Met Leu 1 Thr Gly Asp Trp Gly Ala Glu Ala Cys Thr Cys Ser Pro Ser His Pro Gln 20 25 30 Asp Ala Phe Cys Asn Ser Asp Ile Val Ile Arg Ala Lys Val Val Gly 35 40 45 Lys Lys Leu Val Lys Glu Gly Pro Phe Gly Thr Leu Val Tyr Thr Ile 50 55 60 Lys Gln Met Lys Met Tyr Arg Gly Phe Thr Lys Met Pro His Val Gln 65 70 75 80 Tyr Ile His Thr Glu Ala Ser Glu Ser Leu Cys Gly Leu Lys Leu Glu 85 90 95 Val Asn Lys Tyr Gln Tyr Leu Leu Thr Gly Arg Val Tyr Asp Gly Lys 100 105 110 Met Tyr Thr Gly Leu Cys Asn Phe Val Glu Arg Trp Asp Gln Leu Thr 115 120 125 Leu Ser Gln Arg Lys Gly Leu Asn Tyr Arg Tyr His Leu Gly Cys Asn 130 135 140 Cys Lys Ile Lys Ser Cys Tyr Tyr Leu Pro Cys Phe Val Thr Ser Lys 145 150 155 160 Asn Glu Cys Leu Trp Thr Asp Met Leu Ser Asn Phe Gly Tyr Pro Gly 165 170 175

Tyr Cys Gln Ser Lys 180 His Tyr Ala Cys Ile 185 Arg Gln Lys Gly Gly 190 Tyr Ser Trp Tyr Arg Gly Trp Ala Pro Pro Asp Lys Ser Ile Ile Asn Ala 195 200 205

Thr Asp Pro 210 <210> 17 <211> 224 <212> PRT <213> Homo sapiens

<400> 17 Gly Ser Pro 5 Arg Pro Ala Pro Ser 10 Trp Val Leu Leu Leu 15 Met Arg 1 Pro Leu Leu Ala Leu Leu Arg Pro Pro Gly Leu Gly Glu Ala Cys Ser Cys 20 25 30 Ala Pro Ala His Pro Gln Gln His Ile Cys His Ser Ala Leu Val Ile 35 40 45 Arg Ala Lys Ile Ser Ser Glu Lys Val Val Pro Ala Ser Ala Asp Pro 50 55 60 Ala Asp Thr Glu Lys Met Leu Arg Tyr Glu Ile Lys Gln Ile Lys Met 65 70 75 80 Phe Lys Gly Phe Glu Lys Val Lys Asp Val Gln Tyr Ile Tyr Thr Pro 85 90 95 Phe Asp Ser Ser Leu Cys Gly Val Lys Leu Glu Ala Asn Ser Gln Lys 100 105 110 Gln Tyr Leu Leu Thr Gly Gln Val Leu Ser Asp Gly Lys Val Phe Ile 115 120 125 His Leu Cys Asn Tyr Ile Glu Pro Trp Glu Asp Leu Ser Leu Val Gln 130 135 140 Arg Glu Ser Leu Asn His His Tyr His Leu Asn Cys Gly Cys Gln

Ile

145 160 150 155 Thr Thr Cys Tyr Thr Val Pro Cys Thr Ile Ser Ala Pro Asn Cys 165 170 Leu Trp Thr Asp Trp Leu Leu Glu Arg Lys Leu Tyr Gly Tyr Ala 180 185 190 Gln His Tyr Val Cys Met Lys His Val Asp Gly Thr Cys Ser Tyr 195 200 205 Arg Gly His Leu Pro Leu Arg Lys Glu Phe Val Asp Ile Val Pro 210 215 220

Glu

175

Gln

Trp

Gln

<210> 18 <211> 404 <212> PRT <213> Homo sapiens <400> 18 Met Ala Ser Asp Lys Val Leu Lys Glu Lys Arg Lys Leu Phe Ile 1 5 10 Met Gly Glu Gly Thr Ile Asn Gly Leu Leu Asp Glu Leu Leu Thr 20 25 30 Arg Val Leu Asn Lys Glu Glu Met Glu Lys Val Lys Arg Glu Ala 35 40 45 Thr Val Lys Met Asp Lys Thr Arg Ala Leu Ile Asp Ser Val Ile 50 55 60 Gly Ala Asp Gln Ala Cys Gln Ile Cys Ile Thr Tyr Ile Cys Glu 65 70 75 80 Ser Tyr Gly Leu Ala Gly Thr Leu Gly Leu Ser Ala Asp Gln Thr 85 90 Asn Tyr Pro Leu Asn Met Gln Asp Ser Gln Gly Val Leu Ser Ser

Arg

Gln

Asn

Pro

Glu

Ser

Phe

100

105

110

Ala Gly Pro Gln 115 Ala Val Gln Asp Asn 120 Pro Ala Met Pro Thr 125 Ser Ser Ser Glu Gly Asn Val Lys Leu Cys Ser Leu Glu Glu Ala Gln Arg Ile 130 135 140 Trp Lys Gln Lys Ser Ala Glu Ile Tyr Pro Ile Met Asp Lys Ser Ser 145 150 155 160 Arg Thr Arg Leu Ala Leu Ile Ile Cys Asn Glu Glu Phe Asp Ser Ile 165 170 175 Pro Arg Arg Thr Gly Ala Glu Val Asp Ile Thr Gly Met Thr Met Leu 180 185 190 Leu Gln Asn Leu Gly Tyr Ser Val Asp Val Lys Lys Asn Leu Thr Ala 195 200 205 Ser Asp Met Thr Thr Glu Leu Glu Ala Phe Ala His Arg Pro Glu His 210 215 220 Lys Thr Ser Asp Ser Thr Phe Leu Val Phe Met Ser His Gly Ile Arg 225 230 235 240 Glu Gly Ile Cys Gly Lys Lys His Ser Glu Gln Val Pro Asp Ile Leu 245 250 255 Gln Leu Asn Ala Ile Phe Asn Met Leu Asn Thr Lys Asn Cys Pro Ser 260 265 270 Leu Lys Asp Lys Pro Lys Val Ile Ile Ile Gln Ala Cys Arg Gly Asp 275 280 285 Ser Pro Gly Val Val Trp Phe Lys Asp Ser Val Gly Val Ser Gly Asn 290 295 300 Leu Ser Leu Pro Thr Thr Glu Glu Phe Glu Asp Asp Ala Ile Lys

Lys

305 310 315

320

Ala His Asp

Asn Val Arg

Leu Ile Glu

Ile Phe Ala

370

Gln Met Leu 385 400

Phe Pro

Ile Glu Lys 325 Asp Phe Ile Ala Phe 330 Cys Ser Ser Thr Pro 335 Ser Trp Arg His Pro Thr Met Gly Ser Val Phe Ile Gly 340 345 350 Glu His Met Gln Glu Tyr Ala Cys Ser Cys Asp Val Glu 355 360 365 Arg Lys Val Arg Phe Ser Phe Glu Gln Pro Asp Gly Arg 375 380 Pro Thr Thr Glu Arg Val Thr Leu Thr Arg Cys Phe Tyr

390 395

Gly His <210>

<211>

<212>

<213>

<400> Met Ala Glu

Leu Met Met

452

PRT

Homo sapiens

His Pro Ala

Lys Gln Asp

Ile Ile Ser

Phe Ser Pro

19 Ala Pro Ser Ala Gly Ser Trp Ser Thr Phe Gln His Lys 5 10 15 Ala Ala Asp Arg Gly Arg Arg Ile Leu Gly Val Cys Gly 20 25 30 His His Gln Glu Thr Leu Lys Lys Asn Arg Val Val Leu 35 40 45 Leu Leu Leu Ser Glu Leu Leu Glu His Leu Leu Glu Lys 55 60 Thr Leu Glu Met Arg Glu Leu Ile Gln Ala Lys Val Gly 70 75 Gln Asn Val Glu Leu Leu Asn Leu Leu Pro Lys Arg Gly 85 90 95

Gln Gly Ala Phe Asp 100 Ala Phe Cys Glu Ala 105 Leu Arg Glu Thr Lys 110 Gln His Leu Glu Asp Met Leu Leu Thr Thr Leu Ser Gly Leu Gln His Val 115 120 125 Leu Pro Pro Leu Ser Cys Asp Tyr Asp Leu Ser Leu Pro Phe Pro Val 130 135 140 Cys Glu Ser Cys Pro Leu Tyr Lys Lys Leu Arg Leu Ser Thr Asp Thr 145 150 155 160 Val Glu His Ser Leu Asp Asn Lys Asp Gly Pro Val Cys Leu Gln Val 165 170 175 Lys Pro Cys Thr Pro Glu Phe Tyr Gln Thr His Phe Gln Leu Ala Tyr 180 185 190 Arg Leu Gln Ser Arg Pro Arg Gly Leu Ala Leu Val Leu Ser Asn Val 195 200 205 His Phe Thr Gly Glu Lys Glu Leu Glu Phe Arg Ser Gly Gly Asp Val 210 215 220 Asp His Ser Thr Leu Val Thr Leu Phe Lys Leu Leu Gly Tyr Asp Val 225 230 235 240 His Val Leu Cys Asp Gln Thr Ala Gln Glu Met Gln Glu Lys Leu Gln 245 250 255 Asn Phe Ala Gln Leu Pro Ala His Arg Val Thr Asp Ser Cys Ile Val 260 265 270 Ala Leu Leu Ser His Gly Val Glu Gly Ala Ile Tyr Gly Val Asp Gly 275 280 285 Lys Leu Leu Gln Leu Gln Glu Val Phe Gln Leu Phe Asp Asn Ala Asn 290 295 300 Cys Pro Ser Leu Gln Asn Lys Pro Lys Met Phe Phe Ile Gln Ala

Cys

305 310 315

320

Arg Asn Gly Asp Glu Thr Asp Arg 325 Gly Val Asp 330 Gln Gln Asp Gly Lys 335 His Ala Gly Ser Pro Gly Cys Glu Glu Ser Asp Ala Gly Lys Glu Lys 340 345 350 Leu Pro Lys Met Arg Leu Pro Thr Arg Ser Asp Met Ile Cys Gly Tyr 355 360 365 Ala Cys Leu Lys Gly Thr Ala Ala Met Arg Asn Thr Lys Arg Gly Ser 370 375 380 Trp Tyr Ile Glu Ala Leu Ala Gln Val Phe Ser Glu Arg Ala Cys Asp 385 390 395 400 Met His Val Ala Asp Met Leu Val Lys Val Asn Ala Leu Ile Lys Asp 405 410 415 Arg Glu Gly Tyr Ala Pro Gly Thr Glu Phe His Arg Cys Lys Glu Met 420 425 430 Ser Glu Tyr Cys Ser Thr Leu Cys Arg His Leu Tyr Leu Phe Pro Gly 435 440 445 His Pro Pro Thr 450

<210> 20 <211> 277 <212> PRT <213> Homo sapiens <400> 20 Met Glu Leu Asn Thr Glu Asn Ser Val Asp Ser Lys Ser Ile Lys Asn 1 5 10 15 Glu Pro Lys Ile Ile His Gly Ser Glu Ser Met Asp Ser Gly Ile Ser 20 25 30 Leu Asp Asn Ser Tyr Lys Met Asp Tyr Pro Glu Met Gly Leu Cys

Ile

Arg

Ser

Asn

Leu

Ile

35 40 45

Ile Asn Asn Lys Asn Phe His Lys Ser Thr Gly Met Thr Ser

50 55 60

Gly Thr Asp Val Asp Ala Ala Asn Leu Arg Glu Thr Phe Arg

70 75

Val

Ser

Phe

Gly

Arg

Gly

Ile

145

160

Gln

Ser

Lys Tyr Glu Val 85 Arg Asn Lys Asn Asp 90 Leu Thr Arg Glu Glu 95 Glu Leu Met Arg Asp Val Ser Lys Glu Asp His Ser Lys Arg 100 105 110 Phe Val Cys Val Leu Leu Ser His Gly Glu Glu Gly Ile Ile 115 120 125 Thr Asn Gly Pro Val Asp Leu Lys Lys Ile Thr Asn Phe Phe 130 135 140 Asp Arg Cys Arg Ser Leu Thr Gly Lys Pro Lys Leu Phe Ile 150 155

Gly

Asp

Phe

Asn

Ser

Lys

Gln

Asn

225

240

Arg

Phe

Ala Cys Arg Gly 165 Thr Glu Leu Asp Cys 170 Gly Ile Glu Thr Asp 175 Val Asp Asp Asp Met Ala Cys His Lys Ile Pro Val Glu Ala 180 185 190 Leu Tyr Ala Tyr Ser Thr Ala Pro Gly Tyr Tyr Ser Trp Arg 195 200 205 Lys Asp Gly Ser Trp Phe Ile Gln Ser Leu Cys Ala Met Leu 210 215 220 Tyr Ala Asp Lys Leu Glu Phe Met His Ile Leu Thr Arg Val 230 235

Lys Val Ala Thr Glu

Phe

Glu Ser

Phe Ser Phe Asp Ala Thr

245

250

255

His Ala Lys Lys Gln Ile Pro Cys Ile Val Ser Met Leu Thr Lys Glu

260 265 270

Leu Tyr Phe Tyr His 275 <210> 21 <211> 377 <212> PRT <213> Homo sapiens

<400> 21 Glu Gly Asn 5 His Arg Lys Lys Pro 10 Leu Lys Val Leu Glu 15 Met Ser 1 Ala Leu Gly Lys Asp Phe Leu Thr Gly Val Leu Asp Asn Leu Val Glu Gln 20 25 30 Asn Val Leu Asn Trp Lys Glu Glu Glu Lys Lys Lys Tyr Tyr Asp Ala 35 40 45 Lys Thr Glu Asp Lys Val Arg Val Met Ala Asp Ser Met Gln Glu Lys 50 55 60 Gln Arg Met Ala Gly Gln Met Leu Leu Gln Thr Phe Phe Asn Ile Asp 65 70 75 80 Gln Ile Ser Pro Asn Lys Lys Ala His Pro Asn Met Glu Ala Gly Pro 85 90 95 Pro Glu Ser Gly Glu Ser Thr Asp Ala Leu Lys Leu Cys Pro His Glu 100 105 110 Glu Phe Leu Arg Leu Cys Lys Glu Arg Ala Glu Glu Ile Tyr Pro Ile 115 120 125 Lys Glu Arg Asn Asn Arg Thr Arg Leu Ala Leu Ile Ile Cys Asn Thr 130 135 140 Glu Phe Asp His Leu Pro Pro Arg Asn Gly Ala Asp Phe Asp Ile Thr 145 150 155

160

Gly Glu Met Lys Glu Leu 165 Leu Glu Gly Leu Asp 170 Tyr Ser Val Asp Val 175 Glu Asn Leu Thr Ala Arg Asp Met Glu Ser Ala Leu Arg Ala Phe Ala 180 185 190 Thr Arg Pro Glu His Lys Ser Ser Asp Ser Thr Phe Leu Val Leu Met 195 200 205 Ser His Gly Ile Leu Glu Gly Ile Cys Gly Thr Val His Asp Glu Lys 210 215 220 Lys Pro Asp Val Leu Leu Tyr Asp Thr Ile Phe Gln Ile Phe Asn Asn 225 230 235 240 Arg Asn Cys Leu Ser Leu Lys Asp Lys Pro Lys Val Ile Ile Val Gln 245 250 255 Ala Cys Arg Gly Ala Asn Arg Gly Glu Leu Trp Val Arg Asp Ser Pro 260 265 270 Ala Ser Leu Glu Val Ala Ser Ser Gln Ser Ser Glu Asn Leu Glu Glu 275 280 285 Asp Ala Val Tyr Lys Thr His Val Glu Lys Asp Phe Ile Ala Phe Cys 290 295 300 Ser Ser Thr Pro His Asn Val Ser Trp Arg Asp Ser Thr Met Gly Ser 305 310 315 320 Ile Phe Ile Thr Gln Leu Ile Thr Cys Phe Gln Lys Tyr Ser Trp Cys 325 330 335 Cys His Leu Glu Glu Val Phe Arg Lys Val Gln Gln Ser Phe Glu Thr 340 345 350 Pro Arg Ala Lys Ala Gln Met Pro Thr Ile Glu Arg Leu Ser Met Thr 355 360 365

Arg Tyr Phe Tyr Leu Phe Pro Gly Asn 370 375 <210> 22 <211> 434 <212> PRT <213> Homo sapiens

<400> 22 Glu Asp Ser 5 Gly Lys Lys Lys Arg 10 Arg Lys Asn Phe Glu 15 Met Ala 1 Ala Met Phe Lys Gly Ile Leu Gln Ser Gly Leu Asp Asn Phe Val Ile Asn 20 25 30 His Met Leu Lys Asn Asn Val Ala Gly Gln Thr Ser Ile Gln Thr Leu 35 40 45 Val Pro Asn Thr Asp Gln Lys Ser Thr Ser Val Lys Lys Asp Asn His 50 55 60 Lys Lys Lys Thr Val Lys Met Leu Glu Tyr Leu Gly Lys Asp Val Leu 65 70 75 80 His Gly Val Phe Asn Tyr Leu Ala Lys His Asp Val Leu Thr Leu Lys 85 90 95 Glu Glu Glu Lys Lys Lys Tyr Tyr Asp Thr Lys Ile Glu Asp Lys Ala 100 105 110 Leu Ile Leu Val Asp Ser Leu Arg Lys Asn Arg Val Ala His Gln Met 115 120 125 Phe Thr Gln Thr Leu Leu Asn Met Asp Gln Lys Ile Thr Ser Val Lys 130 135 140 Pro Leu Leu Gln Ile Glu Ala Gly Pro Pro Glu Ser Ala Glu Ser Thr 145 150 155 160 Asn Ile Leu Lys Leu Cys Pro Arg Glu Glu Phe Leu Arg Leu Cys Lys 165 170 175

Lys Arg Asn His Asp 180 Glu Ile Tyr Pro Ile 185 Lys Lys Arg Glu Asp 190 Arg Arg Leu Ala Leu Ile Ile Cys Asn Thr Lys Phe Asp His Leu Pro Ala 195 200 205 Arg Asn Gly Ala His Tyr Asp Ile Val Gly Met Lys Arg Leu Leu Gln 210 215 220 Gly Leu Gly Tyr Thr Val Val Asp Glu Lys Asn Leu Thr Ala Arg Asp 225 230 235 240 Met Glu Ser Val Leu Arg Ala Phe Ala Ala Arg Pro Glu His Lys Ser 245 250 255 Ser Asp Ser Thr Phe Leu Val Leu Met Ser His Gly Ile Leu Glu Gly 260 265 270 Ile Cys Gly Thr Ala His Lys Lys Lys Lys Pro Asp Val Leu Leu Tyr 275 280 285 Asp Thr Ile Phe Gln Ile Phe Asn Asn Arg Asn Cys Leu Ser Leu Lys 290 295 300 Asp Lys Pro Lys Val Ile Ile Val Gln Ala Cys Arg Gly Glu Lys His 305 310 315 320 Gly Glu Leu Trp Val Arg Asp Ser Pro Ala Ser Leu Ala Leu Ile Ser 325 330 335 Ser Gln Ser Ser Glu Asn Leu Glu Ala Asp Ser Val Cys Lys Ile His 340 345 350 Glu Glu Lys Asp Phe Ile Ala Phe Cys Ser Ser Thr Pro His Asn Val 355 360 365 Ser Trp Arg Asp Arg Thr Arg Gly Ser Ile Phe Ile Thr Glu Leu Ile 370 375 380 Thr Cys Phe Gln Lys Tyr Ser Cys Cys Cys His Leu Met Glu Ile Phe

385 390 395

400

Arg Met Lys Val Gln Lys 405 Ser Phe Glu Val Pro 410 Gln Ala Lys Ala Gln 415 Pro Thr Ile Glu Arg Ala Thr Leu Thr Arg Asp Phe Tyr Leu Phe

Pro

420 425 430

Gly Asn <210> 23 <211> 293 <212> PRT <213> Homo sapiens <400> 23

Met Glu 1 Ser Ser Ala Ser 5 Gly Leu Arg Arg Gly 10 His Pro Ala Gly Gly 15 Glu Asn Met Thr Glu Thr Asp Ala Phe Tyr Lys Arg Glu Met Phe Asp 20 25 30 Pro Ala Glu Lys Tyr Lys Met Asp His Arg Arg Arg Gly Ile Ala Leu 35 40 45 Ile Phe Asn His Glu Arg Phe Phe Trp His Leu Thr Leu Pro Glu Arg 50 55 60 Arg Gly Thr Cys Ala Asp Arg Asp Asn Leu Thr Arg Arg Phe Ser Asp 65 70 75 80 Leu Gly Phe Glu Val Lys Cys Phe Asn Asp Leu Lys Ala Glu Glu Leu 85 90 95 Leu Leu Lys Ile His Glu Val Ser Thr Val Ser His Ala Asp Ala Asp 100 105 110 Cys Phe Val Cys Val Phe Leu Ser His Gly Glu Gly Asn His Ile Tyr 115 120 125 Ala Tyr Asp Ala Lys Ile Glu Ile Gln Thr Leu Thr Gly Leu Phe

Lys

130

135

140

Gly Ile 145 160 Asp Lys Cys His Ser 150 Leu Val Gly Lys Pro 155 Lys Ile Phe Ile Gln Ala Cys Arg Gly Asn Gln His Asp Val Pro Val Ile Pro Leu Asp 165 170 175 Val Val Asp Asn Gln Thr Glu Lys Leu Asp Thr Asn Ile Thr Glu Val 180 185 190 Asp Ala Ala Ser Val Tyr Thr Leu Pro Ala Gly Ala Asp Phe Leu Met 195 200 205 Cys Tyr Ser Val Ala Glu Gly Tyr Tyr Ser His Arg Glu Thr Val Asn 210 215 220 Gly Ser Trp Tyr Ile Gln Asp Leu Cys Glu Met Leu Gly Lys Tyr Gly 225 230 235 240 Ser Ser Leu Glu Phe Thr Glu Leu Leu Thr Leu Val Asn Arg Lys Val 245 250 255 Ser Gln Arg Arg Val Asp Phe Cys Lys Asp Pro Ser Ala Ile Gly Lys 260 265 270 Lys Gln Val Pro Cys Phe Ala Ser Met Leu Thr Lys Lys Leu His Phe 275 280 285 Phe Pro Lys Ser Asn 290

<210> 24 <211> 303 <212> PRT <213> Homo sapiens <400> 24 Met Ala Ser Asp Asp Gln Gly Cys Ile Glu Glu Gln Gly Val Glu Asp 1 5 10 15 Ala Asn Glu Asp Ser Val Asp Ala Lys Pro Asp Arg Ser Ser Phe

Val

Pro Ile Ser Leu 35 Phe Ser Lys Lys Lys 40 Lys Asn Val Thr Met 45 Arg Ser Lys Thr Thr Arg Asp Arg Val Pro Thr Tyr Gln Tyr Asn Met Asn Phe 50 55 60 Glu Lys Leu Gly Lys Cys Ile Ile Ile Asn Asn Lys Asn Phe Asp Lys 65 70 75 80 Val Thr Gly Met Gly Val Arg Asn Gly Thr Asp Lys Asp Ala Glu Ala 85 90 95 Leu Phe Lys Cys Phe Arg Ser Leu Gly Phe Asp Val Ile Val Tyr Asn 100 105 110 Asp Cys Ser Cys Ala Lys Met Gln Asp Leu Leu Lys Lys Ala Ser Glu 115 120 125 Glu Asp His Thr Asn Ala Ala Cys Phe Ala Cys Ile Leu Leu Ser His 130 135 140 Gly Glu Glu Asn Val Ile Tyr Gly Lys Asp Gly Val Thr Pro Ile Lys 145 150 155 160 Asp Leu Thr Ala His Phe Arg Gly Asp Arg Cys Lys Thr Leu Leu Glu 165 170 175 Lys Pro Lys Leu Phe Phe Ile Gln Ala Cys Arg Gly Thr Glu Leu Asp 180 185 190 Asp Gly Ile Gln Ala Asp Ser Gly Pro Ile Asn Asp Thr Asp Ala Asn 195 200 205 Pro Arg Tyr Lys Ile Pro Val Glu Ala Asp Phe Leu Phe Ala Tyr Ser 210 215 220 Thr Val Pro Gly Tyr Tyr Ser Trp Arg Ser Pro Gly Arg Gly Ser

Trp

225 230 235

240

Phe Leu Val Gln Ala Leu 245 Cys Ser Ile Leu Glu 250 Glu His Gly Lys Asp 255 Glu Ile Met Gln Ile Leu Thr Arg Val Asn Asp Arg Val Ala Arg His 260 265 270 Phe Glu Ser Gln Ser Asp Asp Pro His Phe His Glu Lys Lys Gln Ile 275 280 285 Pro Cys Val Val Ser Met Leu Thr Lys Glu Leu Tyr Phe Ser Gln 290 295 300

<210> 25 <211> 479 <212> PRT <213> Homo sapiens

<400> 25 Phe Ser Arg 5 Asn Leu Tyr Asp Ile 10 Gly Glu Gln Leu Asp 15 Met Ser 1 Asp Glu Asp Leu Ala Ser Leu Lys Phe Leu Ser Leu Asp Tyr Ile Pro Gln 20 25 30 Arg Lys Gln Glu Pro Ile Lys Asp Ala Leu Met Leu Phe Gln Arg Leu 35 40 45 Gln Glu Lys Arg Met Leu Glu Glu Ser Asn Leu Ser Phe Leu Lys Glu 50 55 60 Leu Leu Phe Arg Ile Asn Arg Leu Asp Leu Leu Ile Thr Tyr Leu Asn 65 70 75 80 Thr Arg Lys Glu Glu Met Glu Arg Glu Leu Gln Thr Pro Gly Arg Ala 85 90 95 Gln Ile Ser Ala Tyr Arg Val Met Leu Tyr Gln Ile Ser Glu Glu Val 100 105 110 Ser Arg Ser Glu Leu Arg Ser Phe Lys Phe Leu Leu Gln Glu Glu Ile

115

120

125

Ser Ile Lys 130 Cys Lys Leu Asp Asp Asp Met 135 Asn Leu Leu 140 Asp Ile Phe Glu Met Glu Lys Arg Val Ile Leu Gly Glu Gly Lys Leu Asp Ile Leu 145 150 155 160 Lys Arg Val Cys Ala Gln Ile Asn Lys Ser Leu Leu Lys Ile Ile Asn 165 170 175 Asp Tyr Glu Glu Phe Ser Lys Glu Arg Ser Ser Ser Leu Glu Gly Ser 180 185 190 Pro Asp Glu Phe Ser Asn Gly Glu Glu Leu Cys Gly Val Met Thr Ile 195 200 205 Ser Asp Ser Pro Arg Glu Gln Asp Ser Glu Ser Gln Thr Leu Asp Lys 210 215 220 Val Tyr Gln Met Lys Ser Lys Pro Arg Gly Tyr Cys Leu Ile Ile Asn 225 230 235 240 Asn His Asn Phe Ala Lys Ala Arg Glu Lys Val Pro Lys Leu His Ser 245 250 255 Ile Arg Asp Arg Asn Gly Thr His Leu Asp Ala Gly Ala Leu Thr Thr 260 265 270 Thr Phe Glu Glu Leu His Phe Glu Ile Lys Pro His Asp Asp Cys Thr 275 280 285 Val Glu Gln Ile Tyr Glu Ile Leu Lys Ile Tyr Gln Leu Met Asp His 290 295 300 Ser Asn Met Asp Cys Phe Ile Cys Cys Ile Leu Ser His Gly Asp Lys 305 310 315 320 Gly Ile Ile Tyr Gly Thr Asp Gly Gln Glu Ala Pro Ile Tyr Glu Leu 325 330 335

Thr Pro Ser Gln Phe 340 Thr Gly Leu Lys Cys 345 Pro Ser Leu Ala Gly 350 Lys Lys Val Phe Phe Ile Gln Ala Cys Gln Gly Asp Asn Tyr Gln Lys Gly 355 360 365 Ile Pro Val Glu Thr Asp Ser Glu Glu Gln Pro Tyr Leu Glu Met Asp 370 375 380 Leu Ser Ser Pro Gln Thr Arg Tyr Ile Pro Asp Glu Ala Asp Phe Leu 385 390 395 400 Leu Gly Met Ala Thr Val Asn Asn Cys Val Ser Tyr Arg Asn Pro Ala 405 410 415 Glu Gly Thr Trp Tyr Ile Gln Ser Leu Cys Gln Ser Leu Arg Glu Arg 420 425 430 Cys Pro Arg Gly Asp Asp Ile Leu Thr Ile Leu Thr Glu Val Asn Tyr 435 440 445 Glu Val Ser Asn Lys Asp Asp Lys Lys Asn Met Gly Lys Gln Met Pro 450 455 460 Gln Pro Thr Phe Thr Leu Arg Lys Lys Leu Val Phe Pro Ser Asp 465 470 475

<210> 26 <211> 416 <212> PRT <213> Homo sapiens

<400> 26 Glu Ala Asp 5 Arg Arg Leu Leu Arg Arg 10 Cys Arg Leu Arg 15 Met Leu 1 Asp Val Glu Glu Leu Gln Val Asp Gln Leu Trp Asp Ala Leu Leu Ser Arg 20 25 30 Glu Leu Phe Arg Pro His Met Ile Glu Asp Ile Gln Arg Ala Gly Ser 35 40 45

Gly Thr Ser 50 Arg Arg Asp Gln Ala 55 Arg Gln Leu Ile Ile 60 Asp Leu Glu Arg Gly Ser Gln Ala Leu Pro Leu Phe Ile Ser Cys Leu Glu Asp Thr 65 70 75 80 Gly Gln Asp Met Leu Ala Ser Phe Leu Arg Thr Asn Arg Gln Ala Ala 85 90 95 Lys Leu Ser Lys Pro Thr Leu Glu Asn Leu Thr Pro Val Val Leu Arg 100 105 110 Pro Glu Ile Arg Lys Pro Glu Val Leu Arg Pro Glu Thr Pro Arg Pro 115 120 125 Val Asp Ile Gly Ser Gly Gly Phe Gly Asp Val Gly Ala Leu Glu Ser 130 135 140 Leu Arg Gly Asn Ala Asp Leu Ala Tyr Ile Leu Ser Met Glu Pro Cys 145 150 155 160 Gly His Cys Leu Ile Ile Asn Asn Val Asn Phe Cys Arg Glu Ser Gly 165 170 175 Leu Arg Thr Arg Thr Gly Ser Asn Ile Asp Cys Glu Lys Leu Arg Arg 180 185 190 Arg Phe Ser Ser Leu His Phe Met Val Glu Val Lys Gly Asp Leu Thr 195 200 205 Ala Lys Lys Met Val Leu Ala Leu Leu Glu Leu Ala Gln Gln Asp His 210 215 220 Gly Ala Leu Asp Cys Cys Val Val Val Ile Leu Ser His Gly Cys Gln 225 230 235 240 Ala Ser His Leu Gln Phe Pro Gly Ala Val Tyr Gly Thr Asp Gly Cys 245 250 255 Pro Val Ser Val Glu Lys Ile Val Asn Ile Phe Asn Gly Thr Ser

Cys

260 265 270 Pro Ser Leu Gly Gly Lys Pro Lys Leu Phe Phe Ile Gln Ala Cys Gly 275 280 285 Gly Glu Gln Lys Asp His Gly Phe Glu Val Ala Ser Thr Ser Pro Glu 290 295 300 Asp Glu Ser Pro Gly Ser Asn Pro Glu Pro Asp Ala Thr Pro Phe Gln 305 310 315 320 Glu Gly Leu Arg Thr Phe Asp Gln Leu Asp Ala Ile Ser Ser Leu Pro 325 330 335 Thr Pro Ser Asp Ile Phe Val Ser Tyr Ser Thr Phe Pro Gly Phe Val 340 345 350 Ser Trp Arg Asp Pro Lys Ser Gly Ser Trp Tyr Val Glu Thr Leu Asp 355 360 365 Asp Ile Phe Glu Gln Trp Ala His Ser Glu Asp Leu Gln Ser Leu Leu 370 375 380 Leu Arg Val Ala Asn Ala Val Ser Val Lys Gly Ile Tyr Lys Gln Met 385 390 395 400 Pro Gly Cys Phe Asn Phe Leu Arg Lys Lys Leu Phe Phe Lys Thr Ser 405 410 415

<210> 27 <211> 521 <212> PRT <213> Homo sapiens <400> 27 Met Lys Ser Gln Gly Gln His Trp Tyr Ser Ser Ser Asp Lys Asn Cys 1 5 10 15 Lys Val Ser Phe Arg Glu Lys Leu Leu Ile Ile Asp Ser Asn Leu

Gly

20 25 30

Val Pro Gln Asp 35 Val Glu Asn Leu Lys 40 Phe Leu Cys Ile Gly 45 Leu Val Asn Lys Lys Leu Glu Lys Ser Ser Ser Ala Ser Asp Val Phe Glu His 50 55 60 Leu Leu Ala Glu Asp Leu Leu Ser Glu Glu Asp Pro Phe Phe Leu Ala 65 70 75 80 Glu Leu Leu Tyr Ile Ile Arg Gln Lys Lys Leu Leu Gln His Leu Asn 85 90 95 Cys Thr Lys Glu Glu Val Glu Arg Leu Leu Pro Thr Arg Gln Arg Val 100 105 110 Ser Leu Phe Arg Asn Leu Leu Tyr Glu Leu Ser Glu Gly Ile Asp Ser 115 120 125 Glu Asn Leu Lys Asp Met Ile Phe Leu Leu Lys Asp Ser Leu Pro Lys 130 135 140 Thr Glu Met Thr Ser Leu Ser Phe Leu Ala Phe Leu Glu Lys Gln Gly 145 150 155 160 Lys Ile Asp Glu Asp Asn Leu Thr Cys Leu Glu Asp Leu Cys Lys Thr 165 170 175 Val Val Pro Lys Leu Leu Arg Asn Ile Glu Lys Tyr Lys Arg Glu Lys 180 185 190 Ala Ile Gln Ile Val Thr Pro Pro Val Asp Lys Glu Ala Glu Ser Tyr 195 200 205 Gln Gly Glu Glu Glu Leu Val Ser Gln Thr Asp Val Lys Thr Phe Leu 210 215 220 Glu Ala Leu Pro Gln Glu Ser Trp Gln Asn Lys His Ala Gly Ser Asn 225 230 235 240 Gly Asn Arg Ala Thr Asn Gly Ala Pro Ser Leu Val Ser Arg Gly

Met

245 250 255 Gln Gly Ala Ser Ala Asn Thr Leu Asn Ser Glu Thr Ser Thr Lys Arg 260 265 270 Ala Ala Val Tyr Arg Met Asn Arg Asn His Arg Gly Leu Cys Val Ile 275 280 285 Val Asn Asn His Ser Phe Thr Ser Leu Lys Asp Arg Gln Gly Thr His 290 295 300 Lys Asp Ala Glu Ile Leu Ser His Val Phe Gln Trp Leu Gly Phe Thr 305 310 315 320 Val His Ile His Asn Asn Val Thr Lys Val Glu Met Glu Met Val Leu 325 330 335 Gln Lys Gln Lys Cys Asn Pro Ala His Ala Asp Gly Asp Cys Phe Val 340 345 350 Phe Cys Ile Leu Thr His Gly Arg Phe Gly Ala Val Tyr Ser Ser Asp 355 360 365 Glu Ala Leu Ile Pro Ile Arg Glu Ile Met Ser His Phe Thr Ala Leu 370 375 380 Gln Cys Pro Arg Leu Ala Glu Lys Pro Lys Leu Phe Phe Ile Gln Ala 385 390 395 400 Cys Gln Gly Glu Glu Ile Gln Pro Ser Val Ser Ile Glu Ala Asp Ala 405 410 415 Leu Asn Pro Glu Gln Ala Pro Thr Ser Leu Gln Asp Ser Ile Pro Ala 420 425 430 Glu Ala Asp Phe Leu Leu Gly Leu Ala Thr Val Pro Gly Tyr Val Ser 435 440 445 Phe Arg His Val Glu Glu Gly Ser Trp Tyr Ile Gln Ser Leu Cys

Asn

450 455 460

His Thr 465 480 Leu Lys Lys Leu Val 470 Pro Arg Met Leu Lys 475 Phe Leu Glu Lys Met Glu Ile Arg Gly Arg Lys Arg Thr Val Trp Gly Ala Lys Gln Ile 485 490 495 Ser Ala Thr Ser Leu Pro Thr Ala Ile Ser Ala Gln Thr Pro Arg Pro 500 505 510

Trp Ser

Ser

Pro Met Arg Arg 515

Ser Val 520 <210> 28 <211> 373 <212> PRT <213> Homo sapiens

<400> 28 Glu Asn Lys 5 His Pro Asp Lys Pro 10 Leu Lys Val Leu Glu 15 Met Gln 1 Ala Leu Gly Lys Glu Val Leu Thr Glu Tyr Leu Glu Lys Leu Val Gln Ser 20 25 30 Asn Val Leu Lys Leu Lys Glu Glu Asp Lys Gln Lys Phe Asn Asn Ala 35 40 45 Glu Arg Ser Asp Lys Arg Trp Val Phe Val Asp Ala Met Lys Lys Lys 50 55 60 His Ser Lys Val Gly Glu Met Leu Leu Gln Thr Phe Phe Ser Val Asp 65 70 75 80 Pro Gly Ser His His Gly Glu Ala Asn Leu Glu Met Glu Glu Pro Glu 85 90 95 Glu Ser Leu Asn Thr Leu Lys Leu Cys Ser Pro Glu Glu Phe Thr Arg 100 105 110 Leu Cys Arg Glu Lys Thr Gln Glu Ile Tyr Pro Ile Lys Glu Ala Asn 115 120 125

Gly His Arg 130 Thr Arg Lys Ala Leu 135 Ile Ile Cys Asn Thr 140 Glu Phe Lys Leu Ser Leu Arg Tyr Gly Ala Asn Phe Asp Ile Ile Gly Met Lys Gly 145 150 155 160 Leu Leu Glu Asp Leu Gly Tyr Asp Val Val Val Lys Glu Glu Leu Thr 165 170 175 Ala Glu Gly Met Glu Ser Glu Met Lys Asp Phe Ala Ala Leu Ser Glu 180 185 190 His Gln Thr Ser Asp Ser Thr Phe Leu Val Leu Met Ser His Gly Thr 195 200 205 Leu His Gly Ile Cys Gly Thr Met His Ser Glu Lys Thr Pro Asp Val 210 215 220 Leu Gln Tyr Asp Thr Ile Tyr Gln Ile Phe Asn Asn Cys His Cys Pro 225 230 235 240 Gly Leu Arg Asp Lys Pro Lys Val Ile Ile Val Gln Ala Cys Arg Gly 245 250 255 Gly Asn Ser Gly Glu Met Trp Ile Arg Glu Ser Ser Lys Pro Gln Leu 260 265 270 Cys Arg Gly Val Asp Leu Pro Arg Asn Met Glu Ala Asp Ala Val Lys 275 280 285 Leu Ser His Val Glu Lys Asp Phe Ile Ala Phe Tyr Ser Thr Thr Pro 290 295 300 His His Leu Ser Tyr Arg Asp Lys Thr Gly Gly Ser Tyr Phe Ile Thr 305 310 315 320 Arg Leu Ile Ser Cys Phe Arg Lys His Ala Cys Ser Cys His Leu Phe 325 330 335

Asp His Ile Phe Leu 340 Lys Val Gln Gln Ser Gln Met Pro Thr Ile Asp Arg Tyr 355 360 Leu Phe Pro Gly Asn 370

Ser Phe Glu Lys Ala Ser Ile 345 350 Ala Thr Leu Thr Arg Tyr Phe 365

<210> <211> <212> <213> 29 341 PRT Homo sapiens <400> 29 Met Ala Asp Glu Lys Pro Ser Asn Gly Val Leu Val His Met Val Lys 1 5 10 15 Leu Leu Ile Lys Thr Phe Leu Asp Gly Ile Phe Asp Asp Leu Met Glu 20 25 30 Asn Asn Val Leu Asn Thr Asp Glu Ile His Leu Ile Gly Lys Cys Leu 35 40 45 Lys Phe Val Val Ser Asn Ala Glu Asn Leu Val Asp Asp Ile Thr Glu 50 55 60 Thr Ala Gln Thr Ala Gly Lys Ile Phe Arg Glu His Leu Trp Asn Ser 65 70 75 80 Lys Lys Gln Leu Ser Ser Asp Ile Ser Ser Asp Gly Glu Arg Glu Ala 85 90 95 Asn Met Pro Gly Leu Asn Ile Arg Asn Lys Glu Phe Asn Tyr Leu His 100 105 110 Asn Arg Asn Gly Ser Glu Leu Asp Leu Leu Gly Met Arg Asp Leu Leu 115 120 125 Glu Asn Leu Gly Tyr Ser Val Val Ile Lys Glu Asn Leu Thr Ala Gln 130 135 140 Glu Met Glu Thr Ala Leu Arg Gln Phe Ala Ala His Pro Glu His

Gln

145 150 155

160

Ser Asn Ser Asp Ser Thr 165 Phe Leu Val Phe Met 170 Ser His Ser Ile Leu 175 Gly Ile Cys Gly Thr Lys His Trp Asp Gln Glu Pro Asp Val Leu His 180 185 190 Asp Asp Thr Ile Phe Glu Ile Phe Asn Asn Arg Asn Cys Gln Ser Leu 195 200 205 Lys Asp Lys Pro Lys Val Ile Ile Met Gln Ala Cys Arg Gly Asn Gly 210 215 220 Ala Gly Ile Val Trp Phe Thr Thr Asp Ser Gly Lys Ala Gly Ala Asp 225 230 235 240 Thr His Gly Arg Leu Leu Gln Gly Asn Ile Cys Asn Asp Ala Val Thr 245 250 255 Lys Ala His Val Glu Lys Asp Phe Ile Ala Phe Lys Ser Ser Thr Pro 260 265 270 His Asn Val Ser Trp Arg His Glu Thr Asn Gly Ser Val Phe Ile Ser 275 280 285 Gln Ile Ile Tyr Tyr Phe Arg Glu Tyr Ser Trp Ser His His Leu Glu 290 295 300 Glu Ile Phe Gln Lys Val Gln His Ser Phe Glu Thr Pro Asn Ile Leu 305 310 315 320 Thr Gln Leu Pro Thr Ile Glu Arg Leu Ser Met Thr Arg Tyr Phe Tyr 325 330 335 Leu Phe Pro Gly Asn

<210> 30 <211> 377

340

<212> PRT <213> Homo sapiens <400> 30 Met Ala Glu Asp Lys His Asn Lys Asn Pro Leu Lys Met Leu Glu Ser 1 5 10 15 Leu Gly Lys Glu Leu Ile Ser Gly Leu Leu Asp Asp Phe Val Glu Lys 20 25 30 Asn Val Leu Lys Leu Glu Glu Glu Glu Lys Lys Lys Ile Tyr Asp Ala 35 40 45 Lys Leu Gln Asp Lys Ala Arg Val Leu Val Asp Ser Ile Arg Gln Lys 50 55 60 Asn Gln Glu Ala Gly Gln Val Phe Val Gln Thr Phe Leu Asn Ile Asp 65 70 75 80 Lys Asn Ser Thr Ser Ile Lys Ala Pro Glu Glu Thr Val Ala Gly Pro 85 90 95 Asp Glu Ser Val Gly Ser Ala Ala Thr Leu Lys Leu Cys Pro His Glu 100 105 110 Glu Phe Leu Lys Leu Cys Lys Glu Arg Ala Gly Glu Ile Tyr Pro Ile 115 120 125 Lys Glu Arg Lys Asp Arg Thr Arg Leu Ala Leu Ile Ile Cys Asn Thr 130 135 140 Glu Phe Asp His Met Pro Pro Arg Asn Gly Ala Ala Leu Asp Ile Leu 145 150 155 160 Gly Met Lys Gln Leu Leu Glu Gly Leu Gly Tyr Thr Val Glu Val Glu 165 170 175 Glu Lys Leu Thr Ala Arg Asp Met Glu Ser Val Leu Trp Lys Phe Ala 180 185 190 Ala Arg Glu Glu His Lys Ser Ser Asp Ser Thr Phe Leu Val Phe Met

195 200 205 Ser His Gly Ile Leu Asp Gly Ile Cys Gly Thr Met His Ser Glu Glu 210 215 220 Glu Pro Asp Val Leu Pro Tyr Asp Thr Ile Phe Arg Thr Phe Asn Asn 225 230 235 240 Arg Asn Cys Leu Ser Leu Lys Asp Lys Pro Lys Val Ile Ile Val Gln 245 250 255 Ala Cys Arg Gly Ala Asn Arg Gly Glu Leu Trp Val Ser Asp Ser Pro 260 265 270 Pro Ala Leu Ala Asp Ser Phe Ser Gln Ser Ser Glu Asn Leu Glu Glu 275 280 285 Asp Ala Val Tyr Lys Thr His Val Glu Lys Asp Phe Ile Ala Phe Cys 290 295 300 Ser Ser Thr Pro His Asn Val Ser Trp Arg Asp Ile Lys Lys Gly Ser 305 310 315 320 Leu Phe Ile Thr Arg Leu Ile Thr Cys Phe Gln Lys Tyr Ala Trp Cys 325 330 335 Cys His Leu Glu Glu Val Phe Arg Lys Val Gln Gln Ser Phe Glu Lys 340 345 350 Pro Asn Val Lys Ala Gln Met Pro Thr Val Glu Arg Leu Ser Met Thr 355 360 365 Arg Tyr Phe Tyr Leu Phe Pro Gly Asn 370 375

<210> 31 <211> 242 <212> PRT <213> Homo sapiens <400> 31 Met Ser Asn Pro Arg Ser Leu Glu Glu Gly

Glu Lys Tyr Asp Met Ser

1 5 10 15 Ala Arg Leu Ala Leu Ile Leu Cys Val Thr Lys Ala Arg Glu Gly Ser 20 25 30 Glu Glu Asp Leu Asp Ala Leu Glu His Met Phe Arg Gln Leu Arg Phe 35 40 45 Glu Ser Thr Met Lys Arg Asp Pro Thr Ala Glu Gln Phe Gln Glu Glu 50 55 60 Leu Glu Lys Phe Gln Gln Ala Ile Asp Ser Arg Glu Asp Pro Val Ser 65 70 75 80 Cys Ala Phe Val Val Leu Met Ala His Gly Arg Glu Gly Phe Leu Lys 85 90 95 Gly Glu Asp Gly Glu Met Val Lys Leu Glu Asn Leu Phe Glu Ala Leu 100 105 110 Asn Asn Lys Asn Cys Gln Ala Leu Arg Ala Lys Pro Lys Val Tyr Ile 115 120 125 Ile Gln Ala Cys Arg Gly Glu Gln Arg Asp Pro Gly Glu Thr Val Gly 130 135 140 Gly Asp Glu Ile Val Met Val Ile Lys Asp Ser Pro Gln Thr Ile Pro 145 150 155 160 Thr Tyr Thr Asp Ala Leu His Val Tyr Ser Thr Val Glu Gly Tyr Ile 165 170 175 Ala Tyr Arg His Asp Gln Lys Gly Ser Cys Phe Ile Gln Thr Leu Val 180 185 190 Asp Val Phe Thr Lys Arg Lys Gly His Ile Leu Glu Leu Leu Thr Glu 195 200 205 Val Thr Arg Arg Met Ala Glu Ala Glu Leu Val Gln Glu Gly Lys

Ala

210 215 220

Arg Lys Thr Asn Pro Glu Ile Gln Ser Thr Leu Arg Lys Arg Leu Tyr

225 230 235

240

Leu Gln <210> 32 <211> 480 <212> PRT <213> Homo sapiens

<400> 32 Arg Ala Ala 5 Pro Pro Pro Leu Phe 10 Leu Leu Leu Leu Leu 15 Met Leu 1 Ile Leu Leu Leu Val Ser Trp Ala Ser Arg Gly Glu Ala Ala Pro Asp Gln 20 25 30 Asp Glu Ile Gln Arg Leu Pro Gly Leu Ala Lys Gln Pro Ser Phe Arg 35 40 45 Gln Tyr Ser Gly Tyr Leu Lys Gly Ser Gly Ser Lys His Leu His Tyr 50 55 60 Trp Phe Val Glu Ser Gln Lys Asp Pro Glu Asn Ser Pro Val Val Leu 65 70 75 80 Trp Leu Asn Gly Gly Pro Gly Cys Ser Ser Leu Asp Gly Leu Leu Thr 85 90 95 Glu His Gly Pro Phe Leu Val Gln Pro Asp Gly Val Thr Leu Glu Tyr 100 105 110 Asn Pro Tyr Ser Trp Asn Leu Ile Ala Asn Val Leu Tyr Leu Glu Ser 115 120 125 Pro Ala Gly Val Gly Phe Ser Tyr Ser Asp Asp Lys Phe Tyr Ala Thr 130 135 140 Asn Asp Thr Glu Val Ala Gln Ser Asn Phe Glu Ala Leu Gln Asp Phe 145 150 155 160

Phe Arg Leu Phe Pro Gly

165

Glu Ser Tyr Ala Gly Met

180

Gln Asp Pro Ser Met Leu

195

Ser Ser Tyr Glu Gln Tyr

210

His Gly Leu Leu Gly

Cys

225

240

Cys Ser Gln Asn Lys Cys

245

Val Thr Asn Leu Gln Leu

260

Asn Ile Tyr Asn Leu His

275

Phe Arg Tyr Glu Lys Ile

290

Phe Thr Arg Leu Pro

Arg

305

320

Ser Gly Asp Lys Val Ala

325

Glu Tyr Lys Asn Asn

170

Ile Tyr Ile Pro Thr

185

Asn Leu Gln Gly Leu

200

Asn Asp Asn Ser Leu

215

Asn Arg Leu Trp Ser

230

Cys Asn Phe Tyr Asp

250

Glu Val Ala Arg Ile

265

Tyr Ala Pro Cys Ala

280

Asp Thr Val Val Val

295

Leu Lys Arg Met Trp

310

Arg Met Asp Pro Pro

330

Lys Leu Phe Leu Thr

175

Leu Ala Val Leu Val

190

Ala Val Gly Asn Gly

205

Val Tyr Phe Ala Tyr

220

Ser Leu Gln Thr His

235

Asn Lys Asp Leu Glu

255

Val Gly Asn Ser Gly

270

Gly Gly Val Pro Ser

285

Gln Asp Leu Gly Asn

300

His Gln Ala Leu Leu

315

Cys Thr Asn Thr Thr

335

Ala

Ile

Ser Thr Tyr

Leu Asn Asn

Pro

Tyr Val Arg Lys Ala

Leu Asn

340

345

350

Pro Glu Gln Leu Pro Leu

355

Gln Trp Asp Met

360

Cys Asn

Phe

Leu Val Asn

365

Gln Tyr Arg Arg

Leu Tyr Arg

Ser Met

Asn

Ser Gln Tyr Leu Lys

Leu

370 375 Leu Ser Ser Gln Lys Tyr Gln Asp 385 390 400 Met Ala Cys Asn Phe Met Gly Asn 405 Gln Lys Met Glu Val Gln Arg Asp 420 Ser Gly Glu Gln Ile Ala Gly Ala 435 Phe Leu Thr Ile Lys Gly Ala Pro 450 455 Leu Ala Ala Phe Thr Met Phe Tyr 465 470 480

380

Ile Leu Leu Tyr Asn Gly Asp

395

Asp Glu Trp Phe Val Asp Ser

410

Arg Pro Trp Leu Val Lys Tyr

425 430

Phe Val Lys Glu Phe Ser His

440 445

Gly His Met Val Pro Thr Asp

460

Ser Arg Phe Leu Asn Lys Gln

475

Val

Leu

415

Gly

Ile

Lys

Pro

<210> <211> <212> <213> 33 339 PRT Homo sapiens <400> 33 Met Trp Gln Leu Trp Ala Ser Asn 1 5 Ala Arg Ser Arg Pro Ser Phe Asn 20 Tyr Val Asn Lys Arg Asn Thr Tyr 35 Asn Val Asp Met Ser Tyr Leu Gly 50 55 Gly Pro Lys Pro Pro Gln Arg Leu 65 70

Leu Cys Cys Leu Leu Val Leu

His Pro Leu Ser Asp Glu Leu

25 30

Thr Trp Gln Ala Gly His Asn

40 45

Lys Arg Leu Cys Gly Thr Phe

Val Met Phe Thr Glu Asp Leu

Ala

Val

Phe

Leu

Lys

Pro Ile Ala Ser Phe Asp 85 Ala Arg Glu Gln Trp 90 Pro Gln Cys Pro Thr 95 Lys Glu Ile Arg Asp Gln Gly Ser Cys Gly Ser Cys Trp Ala Phe Gly 100 105 110 Ala Val Glu Ala Ile Ser Asp Arg Ile Cys Ile His Thr Asn Ala His 115 120 125 Val Ser Val Glu Val Ser Ala Glu Asp Leu Leu Thr Cys Cys Gly Ser 130 135 140 Met Cys Gly Asp Gly Cys Asn Gly Gly Tyr Pro Ala Glu Ala Trp Asn 145 150 155 160 Phe Trp Thr Arg Lys Gly Leu Val Ser Gly Gly Leu Tyr Glu Ser His 165 170 175 Val Gly Cys Arg Pro Tyr Ser Ile Pro Pro Cys Glu His His Val Asn 180 185 190 Gly Ser Arg Pro Pro Cys Thr Gly Glu Gly Asp Thr Pro Lys Cys Ser 195 200 205 Lys Ile Cys Glu Pro Gly Tyr Ser Pro Thr Tyr Lys Gln Asp Lys His 210 215 220 Tyr Gly Tyr Asn Ser Tyr Ser Val Ser Asn Ser Glu Lys Asp Ile Met 225 230 235 240 Ala Glu Ile Tyr Lys Asn Gly Pro Val Glu Gly Ala Phe Ser Val Tyr 245 250 255 Ser Asp Phe Leu Leu Tyr Lys Ser Gly Val Tyr Gln His Val Thr Gly 260 265 270 Glu Met Met Gly Gly His Ala Ile Arg Ile Leu Gly Trp Gly Val Glu 275 280 285 Asn Gly Thr Pro Tyr Trp Leu Val Ala Asn Ser Trp Asn Thr Asp

Trp

290 Gly Gly 305 320 Asp Asn Ile Trp Glu Ser Glu Lys Ile

Gly Phe Phe

310

Glu Val Val

325

295

300

Lys Ile Leu

Ala Gly Ile

Arg Gly 315 Gln Pro Arg Thr 330

Asp His Cys Asp Gln Tyr 335

<210> 34 <211> 463 <212> PRT <213> Homo sapiens

<400> 34 Ala Gly Pro 5 Ser Leu Leu Leu Ala 10 Ala Leu Leu Leu Leu 15 Met Leu 1 Gly Ser Gly Asp Gly Ala Val Arg Cys Asp Thr Pro Ala Asn Cys Thr Tyr 20 25 30 Leu Asp Leu Leu Gly Thr Trp Val Phe Gln Val Gly Ser Ser Gly Ser 35 40 45 Gln Arg Asp Val Asn Cys Ser Val Met Gly Pro Gln Glu Lys Lys Val 50 55 60 Val Val Tyr Leu Gln Lys Leu Asp Thr Ala Tyr Asp Asp Leu Gly Asn 65 70 75 80 Ser Gly His Phe Thr Ile Ile Tyr Asn Gln Gly Phe Glu Ile Val Leu 85 90 95 Asn Asp Tyr Lys Trp Phe Ala Phe Phe Lys Tyr Lys Glu Glu Gly Ser 100 105 110 Lys Val Thr Thr Tyr Cys Asn Glu Thr Met Thr Gly Trp Val His Asp 115 120 125 Val Leu Gly Arg Asn Trp Ala Cys Phe Thr Gly Lys Lys Val Gly

Thr

130 135 140

Ala Gln 145 160 Ser Glu Asn Val Tyr 150 Val Asn Ile Ala His 155 Leu Lys Asn Ser Glu Lys Tyr Ser Asn Arg Leu Tyr Lys Tyr Asp His Asn Phe Val Lys 165 170 175 Ala Ile Asn Ala Ile Gln Lys Ser Trp Thr Ala Thr Thr Tyr Met Glu 180 185 190 Tyr Glu Thr Leu Thr Leu Gly Asp Met Ile Arg Arg Ser Gly Gly His 195 200 205 Ser Arg Lys Ile Pro Arg Pro Lys Pro Ala Pro Leu Thr Ala Glu Ile 210 215 220 Gln Gln Lys Ile Leu His Leu Pro Thr Ser Trp Asp Trp Arg Asn Val 225 230 235 240 His Gly Ile Asn Phe Val Ser Pro Val Arg Asn Gln Ala Ser Cys Gly 245 250 255 Ser Cys Tyr Ser Phe Ala Ser Met Gly Met Leu Glu Ala Arg Ile Arg 260 265 270 Ile Leu Thr Asn Asn Ser Gln Thr Pro Ile Leu Ser Pro Gln Glu Val 275 280 285 Val Ser Cys Ser Gln Tyr Ala Gln Gly Cys Glu Gly Gly Phe Pro Tyr 290 295 300 Leu Ile Ala Gly Lys Tyr Ala Gln Asp Phe Gly Leu Val Glu Glu Ala 305 310 315 320 Cys Phe Pro Tyr Thr Gly Thr Asp Ser Pro Cys Lys Met Lys Glu Asp 325 330 335 Cys Phe Arg Tyr Tyr Ser Ser Glu Tyr His Tyr Val Gly Gly Phe

Tyr

340 345 350 Gly Gly Cys Asn Glu Ala Leu Met Lys Leu Glu Leu Val His His Gly 355 360 365 Pro Met Ala Val Ala Phe Glu Val Tyr Asp Asp Phe Leu His Tyr Lys 370 375 380 Lys Gly Ile Tyr His His Thr Gly Leu Arg Asp Pro Phe Asn Pro Phe 385 390 395 400 Glu Leu Thr Asn His Ala Val Leu Leu Val Gly Tyr Gly Thr Asp Ser 405 410 415 Ala Ser Gly Met Asp Tyr Trp Ile Val Lys Asn Ser Trp Gly Thr Gly 420 425 430 Trp Gly Glu Asn Gly Tyr Phe Arg Ile Arg Arg Gly Thr Asp Glu Cys 435 440 445 Ala Ile Glu Ser Ile Ala Val Ala Ala Thr Pro Ile Pro Lys Leu 450 455 460

<210> 35 <211> 412 <212> PRT <213> Homo sapiens

<400> 35 Pro Ser Ser 5 Leu Leu Pro Leu Ala 10 Leu Cys Leu Leu Ala 15 Met Ala 1 Gln Pro Ala Ser Ala Leu Val Arg Ile Pro Leu His Lys Phe Thr Ser Ile 20 25 30 Arg Arg Thr Met Ser Glu Val Gly Gly Ser Val Glu Asp Leu Ile Ala 35 40 45 Lys Gly Pro Val Ser Lys Tyr Ser Gln Ala Val Pro Ala Val Thr Glu 50 55 60 Gly Pro Ile Pro Glu Val Leu Lys Asn Tyr Met Asp Ala Gln Tyr

Tyr

65 70 75

Gly Phe Glu Ile Gly Ile 85 Gly Thr Pro Pro Gln 90 Cys Phe Thr Val Val 95 Asp Thr Gly Ser Ser Asn Leu Trp Val Pro Ser Ile His Cys Lys Leu 100 105 110 Leu Asp Ile Ala Cys Trp Ile His His Lys Tyr Asn Ser Asp Lys Ser 115 120 125 Ser Thr Tyr Val Lys Asn Gly Thr Ser Phe Asp Ile His Tyr Gly Ser 130 135 140 Gly Ser Leu Ser Gly Tyr Leu Ser Gln Asp Thr Val Ser Val Pro Cys 145 150 155 160 Gln Ser Ala Ser Ser Ala Ser Ala Leu Gly Gly Val Lys Val Glu Arg 165 170 175 Gln Val Phe Gly Glu Ala Thr Lys Gln Pro Gly Ile Thr Phe Ile Ala 180 185 190 Ala Lys Phe Asp Gly Ile Leu Gly Met Ala Tyr Pro Arg Ile Ser Val 195 200 205 Asn Asn Val Leu Pro Val Phe Asp Asn Leu Met Gln Gln Lys Leu Val 210 215 220 Asp Gln Asn Ile Phe Ser Phe Tyr Leu Ser Arg Asp Pro Asp Ala Gln 225 230 235 240 Pro Gly Gly Glu Leu Met Leu Gly Gly Thr Asp Ser Lys Tyr Tyr Lys 245 250 255 Gly Ser Leu Ser Tyr Leu Asn Val Thr Arg Lys Ala Tyr Trp Gln Val 260 265 270 His Leu Asp Gln Val Glu Val Ala Ser Gly Leu Thr Leu Cys Lys

Glu

275

280

285

Gly Pro Cys 290 Glu Ala Ile Val Asp 295 Thr Gly Thr Ser Leu Met 300 Val Gly Val Asp Glu Val Arg Glu Leu Gln Lys Ala Ile Gly Ala Val Pro Leu 305 310 315 320 Ile Gln Gly Glu Tyr Met Ile Pro Cys Glu Lys Val Ser Thr Leu Pro 325 330 335 Ala Ile Thr Leu Lys Leu Gly Gly Lys Gly Tyr Lys Leu Ser Pro Glu 340 345 350 Asp Tyr Thr Leu Lys Val Ser Gln Ala Gly Lys Thr Leu Cys Leu Ser 355 360 365 Gly Phe Met Gly Met Asp Ile Pro Pro Pro Ser Gly Pro Leu Trp Ile 370 375 380 Leu Gly Asp Val Phe Ile Gly Arg Tyr Tyr Thr Val Phe Asp Arg Asp 385 390 395 400 Asn Asn Arg Val Gly Phe Ala Glu Ala Ala Arg Leu 405 410

<210> <211> <212> <213> 36 401 PRT Homo sapiens <400> 36 Met Lys Thr Leu Leu Leu Leu Glu 1 5 Ala Gln Gly Ser Leu His Arg Leu 20

Leu Leu Val 10 Leu Leu Glu Leu Gly 15 Val Pro Leu Arg Arg His Pro Ser 25 30

Lys Ser Lys Lys 35 Leu Arg Ala Arg Ser 40 His Asn Leu Asp Met Ile Gln Phe Gln

Gln Leu Ser Glu Phe 45 Trp Lys Thr Glu Ser Cys Ser Met Asp

50 55 60

Ser Gly 65 80 Ala Lys Glu Pro Leu 70 Ile Asn Tyr Leu Asp 75 Met Glu Tyr Phe Thr Ile Ser Ile Gly Ser Pro Pro Gln Asn Phe Thr Val Ile Phe Asp 85 90 95 Thr Gly Ser Ser Asn Leu Trp Val Pro Ser Val Tyr Cys Thr Ser Pro 100 105 110 Ala Cys Lys Thr His Ser Arg Phe Gln Pro Ser Gln Ser Ser Thr Tyr 115 120 125 Ser Gln Pro Gly Gln Ser Phe Ser Ile Gln Tyr Gly Thr Gly Ser Leu 130 135 140 Ser Gly Ile Ile Gly Ala Asp Gln Val Ser Ala Phe Ala Thr Gln Val 145 150 155 160 Glu Gly Leu Thr Val Val Gly Gln Gln Phe Gly Glu Ser Val Thr Glu 165 170 175 Pro Gly Gln Thr Phe Val Asp Ala Glu Phe Asp Gly Ile Leu Gly Leu 180 185 190 Gly Tyr Pro Ser Leu Ala Val Gly Gly Val Thr Pro Val Phe Asp Asn 195 200 205 Met Met Ala Gln Asn Leu Val Asp Leu Pro Met Phe Ser Val Tyr Met 210 215 220 Ser Ser Asn Pro Glu Gly Gly Ala Gly Ser Glu Leu Ile Phe Gly Gly 225 230 235 240 Tyr Asp His Ser His Phe Ser Gly Ser Leu Asn Trp Val Pro Val Thr 245 250 255 Lys Gln Ala Tyr Trp Gln Ile Ala Leu Asp Asn Ile Gln Val Gly Gly 260 265 270

Thr Gly Val Met 275 Phe Cys Ser Glu Gly 280 Cys Gln Ala Ile Val 285 Asp Thr Thr Ser Leu Ile Thr Gly Pro Ser Asp Lys Ile Lys Gln Leu Gln Asn 290 295 300 Ala Ile Gly Ala Ala Pro Val Asp Gly Glu Tyr Ala Val Glu Cys Ala 305 310 315 320 Asn Leu Asn Val Met Pro Asp Val Thr Phe Thr Ile Asn Gly Val Pro 325 330 335 Tyr Thr Leu Ser Pro Thr Ala Tyr Thr Leu Leu Asp Phe Val Asp Gly 340 345 350 Met Gln Phe Cys Ser Ser Gly Phe Gln Gly Leu Asp Ile His Pro Pro 355 360 365 Ala Gly Pro Leu Trp Ile Leu Gly Asp Val Phe Ile Arg Gln Phe Tyr 370 375 380 Ser Val Phe Asp Arg Gly Asn Asn Arg Val Gly Leu Ala Pro Ala Val 385 390 395 400 Pro

<210> 37 <211> 484 <212> PRT <213> Homo sapiens <400> 37 Met Ala Pro Trp Leu Gln Leu Leu Ser Leu Leu Gly Leu Leu Pro Gly 1 5 10 15 Ala Val Ala Ala Pro Ala Gln Pro Arg Ala Ala Ser Phe Gln Ala Trp 20 25 30 Gly Pro Pro Ser Pro Glu Leu Leu Ala Pro Thr Arg Phe Ala Leu

Glu

35 40 45

Met Leu Phe 50 Asn Arg Gly Arg Ala 55 Ala Gly Thr Arg Ala 60 Val Leu Gly Val Arg Gly Arg Val Arg Arg Ala Gly Gln Gly Ser Leu Tyr Ser Leu 65 70 75 80 Glu Ala Thr Leu Glu Glu Pro Pro Cys Asn Asp Pro Met Val Cys Arg 85 90 95 Leu Pro Val Ser Lys Lys Thr Leu Leu Cys Ser Phe Gln Val Leu Asp 100 105 110 Glu Leu Gly Arg His Val Leu Leu Arg Lys Asp Cys Gly Pro Val Asp 115 120 125 Thr Lys Val Pro Gly Ala Gly Glu Pro Lys Ser Ala Phe Thr Gln Gly 130 135 140 Ser Ala Met Ile Ser Ser Leu Ser Gln Asn His Pro Asp Asn Arg Asn 145 150 155 160 Glu Thr Phe Ser Ser Val Ile Ser Leu Leu Asn Glu Asp Pro Leu Ser 165 170 175 Gln Asp Leu Pro Val Lys Met Ala Ser Ile Phe Lys Asn Phe Val Ile 180 185 190 Thr Tyr Asn Arg Thr Tyr Glu Ser Lys Glu Glu Ala Arg Trp Arg Leu 195 200 205 Ser Val Phe Val Asn Asn Met Val Arg Ala Gln Lys Ile Gln Ala Leu 210 215 220 Asp Arg Gly Thr Ala Gln Tyr Gly Val Thr Lys Phe Ser Asp Leu Thr 225 230 235 240 Glu Glu Glu Phe Arg Thr Ile Tyr Leu Asn Thr Leu Leu Arg Lys Glu 245 250 255

Pro Pro Gly Asn Lys 260 Met Lys Gln Ala Lys 265 Ser Val Gly Asp Leu 270 Ala Pro Glu Trp Asp Trp Arg Ser Lys Gly Ala Val Thr Lys Val Lys Asp 275 280 285 Gln Gly Met Cys Gly Ser Cys Trp Ala Phe Ser Val Thr Gly Asn Val 290 295 300 Glu Gly Gln Trp Phe Leu Asn Gln Gly Thr Leu Leu Ser Leu Ser Glu 305 310 315 320 Gln Glu Leu Leu Asp Cys Asp Lys Met Asp Lys Ala Cys Met Gly Gly 325 330 335 Leu Pro Ser Asn Ala Tyr Ser Ala Ile Lys Asn Leu Gly Gly Leu Glu 340 345 350 Thr Glu Asp Asp Tyr Ser Tyr Gln Gly His Met Gln Ser Cys Asn Phe 355 360 365 Ser Ala Glu Lys Ala Lys Val Tyr Ile Asn Asp Ser Val Glu Leu Ser 370 375 380 Gln Asn Glu Gln Lys Leu Ala Ala Trp Leu Ala Lys Arg Gly Pro Ile 385 390 395 400 Ser Val Ala Ile Asn Ala Phe Gly Met Gln Phe Tyr Arg His Gly Ile 405 410 415 Ser Arg Pro Leu Arg Pro Leu Cys Ser Pro Trp Leu Ile Asp His Ala 420 425 430 Val Leu Leu Val Gly Tyr Gly Asn Arg Ser Asp Val Pro Phe Trp Ala 435 440 445 Ile Lys Asn Ser Trp Gly Thr Asp Trp Gly Glu Lys Gly Tyr Tyr Tyr 450 455 460 Leu His Arg Gly Ser Gly Ala Cys Gly Val Asn Thr Met Ala Ser Ser

465 470 475

480

Ala Val Val Asp

<210> 38 <211> 255 <212> PRT <213> Homo sapiens <400> 38 Met Gln Pro Leu Leu Leu Leu Leu Ala Phe Leu Leu Pro Thr Gly Ala 1 5 10 15 Glu Ala Gly Glu Ile Ile Gly Gly Arg Glu Ser Arg Pro His Ser Arg 20 25 30 Pro Tyr Met Ala Tyr Leu Gln Ile Gln Ser Pro Ala Gly Gln Ser Arg 35 40 45 Cys Gly Gly Phe Leu Val Arg Glu Asp Phe Val Leu Thr Ala Ala His 50 55 60 Cys Trp Gly Ser Asn Ile Asn Val Thr Leu Gly Ala His Asn Ile Gln 65 70 75 80 Arg Arg Glu Asn Thr Gln Gln His Ile Thr Ala Arg Arg Ala Ile Arg 85 90 95 His Pro Gln Tyr Asn Gln Arg Thr Ile Gln Asn Asp Ile Met Leu Leu 100 105 110 Gln Leu Ser Arg Arg Val Arg Arg Asn Arg Asn Val Asn Pro Val Ala 115 120 125 Leu Pro Arg Ala Gln Glu Gly Leu Arg Pro Gly Thr Leu Cys Thr Val 130 135 140 Ala Gly Trp Gly Arg Val Ser Met Arg Arg Gly Thr Asp Thr Leu Arg 145 150 155 160

Glu Val

Gln Leu Arg Val

Gln

Arg Asp

Arg Gln Cys Leu Arg

Ile

Phe

165 170 175 Gly Ser Tyr Asp Pro Arg Arg Gln Ile Cys Val Gly Asp Arg Arg Glu 180 185 190 Arg Lys Ala Ala Phe Lys Gly Asp Ser Gly Gly Pro Leu Leu Cys Asn 195 200 205 Asn Val Ala His Gly Ile Val Ser Tyr Gly Lys Ser Ser Gly Val Pro 210 215 220 Pro Glu Val Phe Thr Arg Val Ser Ser Phe Leu Pro Trp Ile Arg Thr 225 230 235 240 Thr Met Arg Ser Phe Lys Leu Leu Asp Gln Met Glu Thr Pro Leu 245 250 255

<210> 39 <211> 335 <212> PRT <213> Homo sapiens

<400> 39 Ala Thr Leu 5 Pro Leu Leu Cys Ala 10 Gly Ala Trp Leu Leu 15 Met Gly 1 Trp Val Pro Val Cys Gly Ala Ala Glu Leu Cys Val Asn Ser Leu Glu Lys 20 25 30 Phe His Phe Lys Ser Trp Met Ser Lys His Arg Lys Thr Tyr Ser Thr 35 40 45 Glu Glu Tyr His His Arg Leu Gln Thr Phe Ala Ser Asn Trp Arg Lys 50 55 60 Ile Asn Ala His Asn Asn Gly Asn His Thr Phe Lys Met Ala Leu Asn 65 70 75 80 Gln Phe Ser Asp Met Ser Phe Ala Glu Ile Lys His Lys Tyr Leu Trp 85 90 95 Ser Glu Pro Gln Asn Cys Ser Ala Thr Lys Ser Asn Tyr Leu Arg

Gly

100 105 110 Thr Gly Pro Tyr Pro Pro Ser Val Asp Trp Arg Lys Lys Gly Asn Phe 115 120 125 Val Ser Pro Val Lys Asn Gln Gly Ala Cys Gly Ser Cys Trp Thr Phe 130 135 140 Ser Thr Thr Gly Ala Leu Glu Ser Ala Ile Ala Ile Ala Thr Gly Lys 145 150 155 160 Met Leu Ser Leu Ala Glu Gln Gln Leu Val Asp Cys Ala Gln Asp Phe 165 170 175 Asn Asn His Gly Cys Gln Gly Gly Leu Pro Ser Gln Ala Phe Glu Tyr 180 185 190 Ile Leu Tyr Asn Lys Gly Ile Met Gly Glu Asp Thr Tyr Pro Tyr Gln 195 200 205 Gly Lys Asp Gly Tyr Cys Lys Phe Gln Pro Gly Lys Ala Ile Gly Phe 210 215 220 Val Lys Asp Val Ala Asn Ile Thr Ile Tyr Asp Glu Glu Ala Met Val 225 230 235 240 Glu Ala Val Ala Leu Tyr Asn Pro Val Ser Phe Ala Phe Glu Val Thr 245 250 255 Gln Asp Phe Met Met Tyr Arg Thr Gly Ile Tyr Ser Ser Thr Ser Cys 260 265 270 His Lys Thr Pro Asp Lys Val Asn His Ala Val Leu Ala Val Gly Tyr 275 280 285 Gly Glu Lys Asn Gly Ile Pro Tyr Trp Ile Val Lys Asn Ser Trp Gly 290 295 300 Pro Gln Trp Gly Met Asn Gly Tyr Phe Leu Ile Glu Arg Gly Lys

Asn

305 310 315

320

Met Cys Gly Leu Ala Ala Cys Ala Ser Tyr Pro Ile Pro Leu Val 325 330 335 <210> 40 <211> 329 <212> PRT <213> Homo sapiens <400> 40 Met Trp Gly Leu Lys Val Leu Leu Leu Pro Val Val Ser Phe Ala Leu 1 5 10 15 Tyr Pro Glu Glu Ile Leu Asp Thr His Trp Glu Leu Trp Lys Lys Thr 20 25 30 His Arg Lys Gln Tyr Asn Asn Lys Val Asp Glu Ile Ser Arg Arg Leu 35 40 45 Ile Trp Glu Lys Asn Leu Lys Tyr Ile Ser Ile His Asn Leu Glu Ala 50 55 60 Ser Leu Gly Val His Thr Tyr Glu Leu Ala Met Asn His Leu Gly Asp 65 70 75 80 Met Thr Ser Glu Glu Val Val Gln Lys Met Thr Gly Leu Lys Val Pro 85 90 95 Leu Ser His Ser Arg Ser Asn Asp Thr Leu Tyr Ile Pro Glu Trp Glu 100 105 110 Gly Arg Ala Pro Asp Ser Val Asp Tyr Arg Lys Lys Gly Tyr Val Thr 115 120 125 Pro Val Lys Asn Gln Gly Gln Cys Gly Ser Cys Trp Ala Phe Ser Ser 130 135 140 Val Gly Ala Leu Glu Gly Gln Leu Lys Lys Lys Thr Gly Lys Leu Leu 145 150 155 160 Asn Leu Ser Pro Gln Asn Leu Val Asp Cys Val Ser Glu Asn Asp

Gly

ΊΊ

165

170

175

Cys Asn Gly Gly Gly 180 Tyr Met Thr Asn Ala 185 Phe Gln Tyr Val Gln 190 Lys Arg Gly Ile Asp Ser Glu Asp Ala Tyr Pro Tyr Val Gly Gln Glu Glu 195 200 205 Ser Cys Met Tyr Asn Pro Thr Gly Lys Ala Ala Lys Cys Arg Gly Tyr 210 215 220 Arg Glu Ile Pro Glu Gly Asn Glu Lys Ala Leu Lys Arg Ala Val Ala 225 230 235 240 Arg Val Gly Pro Val Ser Val Ala Ile Asp Ala Ser Leu Thr Ser Phe 245 250 255 Gln Phe Tyr Ser Lys Gly Val Tyr Tyr Asp Glu Ser Cys Asn Ser Asp 260 265 270 Asn Leu Asn His Ala Val Leu Ala Val Gly Tyr Gly Ile Gln Lys Gly 275 280 285 Asn Lys His Trp Ile Ile Lys Asn Ser Trp Gly Glu Asn Trp Gly Asn 290 295 300 Lys Gly Tyr Ile Leu Met Ala Arg Asn Lys Asn Asn Ala Cys Gly Ile 305 310 315 320 Ala Asn Leu Ala Ser Phe Pro Lys Met 325

<210> 41 <211> 333 <212> PRT <213> Homo sapiens <400> 41 Met Asn Ser Pro Thr Leu Ile Leu Ala Ala Phe Cys Leu Gly Ile Ala 1 5 10 15 Ala Thr Leu Thr Phe Asp His Ser Leu Glu Ala Gln Trp Thr Lys

Trp

Lys Arg Ala Met 35 His Asn Arg Leu Tyr 40 Gly Met Asn Glu Glu 45 Gly Trp Arg Ala Val Trp Glu Lys Asn Met Lys Met Ile Glu Leu His Asn Gln 50 55 60 Glu Tyr Arg Glu Gly Lys His Ser Phe Thr Met Ala Met Asn Ala Phe 65 70 75 80 Gly Asp Met Thr Ser Glu Glu Phe Arg Gln Val Met Asn Gly Phe Gln 85 90 95 Asn Arg Lys Pro Arg Lys Gly Lys Val Phe Gln Glu Pro Leu Phe Tyr 100 105 110 Glu Ala Pro Arg Ser Val Asp Trp Arg Glu Lys Gly Tyr Val Thr Pro 115 120 125 Val Lys Asn Gln Gly Gln Cys Gly Ser Cys Trp Ala Phe Ser Ala Thr 130 135 140 Gly Ala Leu Glu Gly Gln Met Phe Arg Lys Thr Gly Arg Leu Ile Ser 145 150 155 160 Leu Ser Glu Gln Asn Leu Val Asp Cys Ser Gly Pro Gln Gly Asn Glu 165 170 175 Gly Cys Asn Gly Gly Leu Met Asp Tyr Ala Phe Gln Tyr Val Gln Asp 180 185 190 Asn Gly Gly Leu Asp Ser Glu Glu Ser Tyr Pro Tyr Glu Ala Thr Glu 195 200 205 Glu Ser Cys Lys Tyr Asn Pro Lys Tyr Ser Val Ala Asn Asp Thr Gly 210 215 220 Phe Val Asp Ile Pro Lys Gln Glu Lys Ala Leu Met Lys Ala Val

Ala

225 230 235

240

Thr Phe Val Gly Pro Ile 245 Ser Val Ala Ile Asp 250 Ala Gly His Glu Ser 255 Leu Phe Tyr Lys Glu Gly Ile Tyr Phe Glu Pro Asp Cys Ser Ser Glu 260 265 270 Asp Met Asp His Gly Val Leu Val Val Gly Tyr Gly Phe Glu Ser Thr 275 280 285 Glu Ser Asp Asn Asn Lys Tyr Trp Leu Val Lys Asn Ser Trp Gly Glu 290 295 300 Glu Trp Gly Met Gly Gly Tyr Val Lys Met Ala Lys Asp Arg Arg Asn 305 310 315 320 His Cys Gly Ile Ala Ser Ala Ala Ser Tyr Pro Thr Val 325 330

<210> 42 <211> 334 <212> PRT <213> Homo sapiens <400> 42 Met Asn Ser Leu Ser Leu Val Leu Ala Ala Phe Cys Leu Gly Ile Ala 1 5 10 15 Ala Val Pro Lys Phe Asp Gln Asn Leu Asp Thr Lys Trp Tyr Gln Trp 20 25 30 Lys Ala Arg Thr His Arg Arg Leu Tyr Gly Ala Asn Glu Glu Gly Trp 35 40 45 Arg Ala Gly Val Trp Glu Lys Asn Met Lys Met Ile Glu Leu His Asn 50 55 60 Glu Tyr Phe Ser Gln Gly Lys His Gly Phe Thr Met Ala Met Asn Ala 65 70 75 80 Gly Asp Met Thr Asn Glu Glu Phe Arg Gln Met Met Gly Cys Phe

Arg

85 90 95

Asn Leu Gln Lys Phe 100 Arg Lys Gly Lys Val 105 Phe Arg Glu Pro Leu 110 Phe Asp Leu Pro Lys Ser Val Asp Trp Arg Lys Lys Gly Tyr Val Thr Pro 115 120 125 Val Lys Asn Gln Lys Gln Cys Gly Ser Cys Trp Ala Phe Ser Ala Thr 130 135 140 Gly Ala Leu Glu Gly Gln Met Phe Arg Lys Thr Gly Lys Leu Val Ser 145 150 155 160 Leu Ser Glu Gln Asn Leu Val Asp Cys Ser Arg Pro Gln Gly Asn Gln 165 170 175 Gly Cys Asn Gly Gly Phe Met Ala Arg Ala Phe Gln Tyr Val Lys Glu 180 185 190 Asn Gly Gly Leu Asp Ser Glu Glu Ser Tyr Pro Tyr Val Ala Val Asp 195 200 205 Glu Ile Cys Lys Tyr Arg Pro Glu Asn Ser Val Ala Asn Asp Thr Gly 210 215 220 Phe Thr Val Val Ala Pro Gly Lys Glu Lys Ala Leu Met Lys Ala Val 225 230 235 240 Ala Thr Val Gly Pro Ile Ser Val Ala Met Asp Ala Gly His Ser Ser 245 250 255 Phe Gln Phe Tyr Lys Ser Gly Ile Tyr Phe Glu Pro Asp Cys Ser Ser 260 265 270 Lys Asn Leu Asp His Gly Val Leu Val Val Gly Tyr Gly Phe Glu Gly 275 280 285 Ala Asn Ser Asn Asn Ser Lys Tyr Trp Leu Val Lys Asn Ser Trp Gly 290 295 300 Pro Glu Trp Gly Ser Asn Gly Tyr Val Lys Ile Ala Lys Asp Lys

Asn

305

320

310

315

Asn His Cys Gly Ile Ala Thr Ala Ala Ser Tyr Pro Asn Val 325 330 <210> 43 <211> 321 <212> PRT <213> Homo sapiens <400> 43 Met Asp Val Arg Ala Leu Pro Trp Leu Pro Trp Leu Leu Trp Leu Leu 1 5 10 15 Cys Arg Gly Gly Gly Asp Ala Asp Ser Arg Ala Pro Phe Thr Pro Thr 20 25 30 Trp Pro Arg Ser Arg Glu Arg Glu Ala Ala Ala Phe Arg Glu Ser Leu 35 40 45 Asn Arg His Arg Tyr Leu Asn Ser Leu Phe Pro Ser Glu Asn Ser Thr 50 55 60 Ala Phe Tyr Gly Ile Asn Gln Phe Ser Tyr Leu Phe Pro Glu Glu Phe 65 70 75 80 Lys Ala Ile Tyr Leu Arg Ser Lys Pro Ser Lys Phe Pro Arg Tyr Ser 85 90 95 Ala Glu Val His Met Ser Ile Pro Asn Val Ser Leu Pro Leu Arg Phe 100 105 110 Asp Trp Arg Asp Lys Gln Val Val Thr Gln Val Arg Asn Gln Gln Met 115 120 125 Cys Gly Gly Cys Trp Ala Phe Ser Val Val Gly Ala Val Glu Ser Ala 130 135 140 Tyr Ala Ile Lys Gly Lys Pro Leu Glu Asp Leu Ser Val Gln Gln

Val

145

160

150

155

Ile Leu Asp Cys Ser Tyr 165 Asn Asn Asn Ala Leu Asn Trp Leu Asn Asp 180 Ser Glu Tyr Pro Phe Lys Ala Ser 195 Gly Ser His Ser Gly Phe Ser Phe 210 215 Ser Asp Gln Glu Asp Glu Met Pro 225 230 240 Leu Val Val Ile Val Asp Ala Gly 245 Ile Ile Gln His His Cys Ser Leu 260 Ile Thr Gly Phe Asp Lys Thr Arg 275 Asn Ser Trp Gly Ser Ser Trp Lys 290 295 Met Gly Ser Asn Val Cys Gly Phe 305 310

320

Val

Gly Cys Asn Gly Gly Ser Thr

170 175

Met Gln Val Lys Leu Val Lys

185 190

Asn Gly Leu Cys His Tyr Phe

205

Lys Gly Tyr Ser Ala Tyr Asp

220

Lys Ala Leu Leu Thr Phe Gly

235

Ser Trp Gln Asp Tyr Leu Gly

250 255

Gly Glu Ala Asn His Ala Val

265 270

Ser Thr Pro Tyr Trp Ile Val

285

Val Asp Gly Tyr Ala His Val

300

Ala Asp Ser Val Ser Ser Ile

315 <210> 44 <211> 331 <212> PRT <213> Homo sapiens <400> 44

Met Lys Arg Leu Val Cys Val Ala

1 5

Leu Val Cys Ser Ser Ala Val

10 15

Gln Lys Leu His Lys 20 Asp Pro Thr Leu Asp 25 His His Trp His Leu 30 Trp Lys Thr Tyr Gly Lys Gln Tyr Lys Glu Lys Asn Glu Glu Ala Val Arg 35 40 45 Arg Leu Ile Trp Glu Lys Asn Leu Lys Phe Val Met Leu His Asn Leu 50 55 60 Glu His Ser Met Gly Met His Ser Tyr Asp Leu Gly Met Asn His Leu 65 70 75 80 Gly Asp Met Thr Ser Glu Glu Val Met Ser Leu Met Ser Ser Leu Arg 85 90 95 Val Pro Ser Gln Trp Gln Arg Asn Ile Thr Tyr Lys Ser Asn Pro Asn 100 105 110 Arg Ile Leu Pro Asp Ser Val Asp Trp Arg Glu Lys Gly Cys Val Thr 115 120 125 Glu Val Lys Tyr Gln Gly Ser Cys Gly Ala Cys Trp Ala Phe Ser Ala 130 135 140 Val Gly Ala Leu Glu Ala Gln Leu Lys Leu Lys Thr Gly Lys Leu Val 145 150 155 160 Ser Leu Ser Ala Gln Asn Leu Val Asp Cys Ser Thr Glu Lys Tyr Gly 165 170 175 Asn Lys Gly Cys Asn Gly Gly Phe Met Thr Thr Ala Phe Gln Tyr Ile 180 185 190 Ile Asp Asn Lys Gly Ile Asp Ser Asp Ala Ser Tyr Pro Tyr Lys Ala 195 200 205 Met Asp Gln Lys Cys Gln Tyr Asp Ser Lys Tyr Arg Ala Ala Thr Cys 210 215 220 Ser Lys Tyr Thr Glu Leu Pro Tyr Gly Arg Glu Asp Val Leu Lys Glu

225 230 235

240

Ala His Val Ala Asn Lys 245 Gly Pro Val Ser Val 250 Gly Val Asp Ala Arg 255 Pro Ser Phe Phe Leu Tyr Arg Ser Gly Val Tyr Tyr Glu Pro Ser Cys 260 265 270 Thr Gln Asn Val Asn His Gly Val Leu Val Val Gly Tyr Gly Asp Leu 275 280 285 Asn Gly Lys Glu Tyr Trp Leu Val Lys Asn Ser Trp Gly His Asn Phe 290 295 300 Gly Glu Glu Gly Tyr Ile Arg Met Ala Arg Asn Lys Gly Asn His Cys 305 310 315 320 Gly Ile Ala Ser Phe Pro Ser Tyr Pro Glu Ile 325 330

<210> 45 <211> 376 <212> PRT <213> Homo sapiens <400> 45 Met Ala Leu Thr Ala His Pro Ser Cys Leu Leu Ala Leu Leu Val Ala 1 5 10 15 Gly Leu Ala Gln Gly Ile Arg Gly Pro Leu Arg Ala Gln Asp Leu Gly 20 25 30 Pro Gln Pro Leu Glu Leu Lys Glu Ala Phe Lys Leu Phe Gln Ile Gln 35 40 45 Phe Asn Arg Ser Tyr Leu Ser Pro Glu Glu His Ala His Arg Leu Asp 50 55 60 Ile Phe Ala His Asn Leu Ala Gln Ala Gln Arg Leu Gln Glu Glu Asp 65 70 75 80 Leu Gly Thr Ala Glu Phe Gly Val Thr Pro Phe Ser Asp Leu Thr

Glu

Glu Val Glu Phe Gly Gln 100 Leu Tyr Gly Tyr 105 Arg Arg Ala Ala Gly 110 Gly Pro Ser Met Gly Arg Glu Ile Arg Ser Glu Glu Pro Glu Glu Ser Val 115 120 125 Pro Phe Ser Cys Asp Trp Arg Lys Val Ala Ser Ala Ile Ser Pro Ile 130 135 140 Lys Asp Gln Lys Asn Cys Asn Cys Cys Trp Ala Met Ala Ala Ala Gly 145 150 155 160 Asn Ile Glu Thr Leu Trp Arg Ile Ser Phe Trp Asp Phe Val Asp Val 165 170 175 Ser Val Gln Glu Leu Leu Asp Cys Gly Arg Cys Gly Asp Gly Cys His 180 185 190 Gly Gly Phe Val Trp Asp Ala Phe Ile Thr Val Leu Asn Asn Ser Gly 195 200 205 Leu Ala Ser Glu Lys Asp Tyr Pro Phe Gln Gly Lys Val Arg Ala His 210 215 220 Arg Cys His Pro Lys Lys Tyr Gln Lys Val Ala Trp Ile Gln Asp Phe 225 230 235 240 Ile Met Leu Gln Asn Asn Glu His Arg Ile Ala Gln Tyr Leu Ala Thr 245 250 255 Tyr Gly Pro Ile Thr Val Thr Ile Asn Met Lys Pro Leu Gln Leu Tyr 260 265 270 Arg Lys Gly Val Ile Lys Ala Thr Pro Thr Thr Cys Asp Pro Gln Leu 275 280 285 Val Asp His Ser Val Leu Leu Val Gly Phe Gly Ser Val Lys Ser Glu 290 295 300

Glu Pro 305 320 Gly Ile Trp Ala Glu 310 Thr Val Ser Ser Gln 315 Ser Gln Pro Gln Pro His Pro Thr Pro Tyr Trp Ile Leu Lys Asn Ser Trp Gly Ala Gln 325 330 335 Trp Gly Glu Lys Gly Tyr Phe Arg Leu His Arg Gly Ser Asn Thr Cys 340 345 350 Gly Ile Thr Lys Phe Pro Leu Thr Ala Arg Val Gln Lys Pro Asp Met 355 360 365 Lys Pro Arg Val Ser Cys Pro Pro 370 375

<210> 46 <211> 303 <212> PRT <213> Homo sapiens

<400> 46 Arg Arg Gly 5 Pro Gly Trp Arg Pro 10 Leu Leu Leu Leu Val 15 Met Leu 1 Ala Leu Ala Gly Ala Ala Gln Gly Gly Leu Tyr Phe Arg Arg Gly Gln Thr 20 25 30 Cys Tyr Arg Pro Leu Arg Gly Asp Gly Leu Ala Pro Leu Gly Arg Ser 35 40 45 Thr Tyr Pro Arg Pro His Glu Tyr Leu Ser Pro Ala Asp Leu Pro Lys 50 55 60 Ser Trp Asp Trp Arg Asn Val Asp Gly Val Asn Tyr Ala Ser Ile Thr 65 70 75 80 Arg Asn Gln His Ile Pro Gln Tyr Cys Gly Ser Cys Trp Ala His Ala 85 90 95 Ser Thr Ser Ala Met Ala Asp Arg Ile Asn Ile Lys Arg Lys Gly Ala 100 105 110

Trp Asn Pro Ser 115 Thr Leu Leu Ser Val 120 Gln Asn Val Ile Asp 125 Cys Gly Ala Gly Ser Cys Glu Gly Gly Asn Asp Leu Ser Val Trp Asp Tyr Ala 130 135 140 His Gln His Gly Ile Pro Asp Glu Thr Cys Asn Asn Tyr Gln Ala Lys 145 150 155 160 Asp Gln Glu Cys Asp Lys Phe Asn Gln Cys Gly Thr Cys Asn Glu Phe 165 170 175 Lys Glu Cys His Ala Ile Arg Asn Tyr Thr Leu Trp Arg Val Gly Asp 180 185 190 Tyr Gly Ser Leu Ser Gly Arg Glu Lys Met Met Ala Glu Ile Tyr Ala 195 200 205 Asn Gly Pro Ile Ser Cys Gly Ile Met Ala Thr Glu Arg Leu Ala Asn 210 215 220 Tyr Thr Gly Gly Ile Tyr Ala Glu Tyr Gln Asp Thr Thr Tyr Ile Asn 225 230 235 240 His Val Val Ser Val Ala Gly Trp Gly Ile Ser Asp Gly Thr Glu Tyr 245 250 255 Trp Ile Val Arg Asn Ser Trp Gly Glu Pro Trp Gly Glu Arg Gly Trp 260 265 270 Leu Arg Ile Val Thr Ser Thr Tyr Lys Asp Gly Lys Gly Ala Arg Tyr 275 280 285 Asn Leu Ala Ile Glu Glu His Cys Thr Phe Gly Asp Pro Ile Val 290 295 300

<210> 47 <211> 338 <212> PRT <213>

Homo sapiens

<400> 47 Gln Lys Pro 5 Lys Ser Val Lys Leu 10 Arg Ala Leu Arg Ser 15 Met Pro 1 Leu Arg Lys Phe Gly Val Ala Gly Arg Ser Cys Gln Glu Val Leu Arg Lys 20 25 30 Gly Cys Leu Arg Phe Gln Leu Pro Glu Arg Gly Ser Arg Leu Cys Leu 35 40 45 Tyr Glu Asp Gly Thr Glu Leu Thr Glu Asp Tyr Phe Pro Ser Val Pro 50 55 60 Asp Asn Ala Glu Leu Val Leu Leu Thr Leu Gly Gln Ala Trp Gln Gly 65 70 75 80 Tyr Val Ser Asp Ile Arg Arg Phe Leu Ser Ala Phe His Glu Pro Gln 85 90 95 Val Gly Leu Ile Gln Ala Ala Gln Gln Leu Leu Cys Asp Glu Gln Ala 100 105 110 Pro Gln Arg Gln Arg Leu Leu Ala Asp Leu Leu His Asn Val Ser Gln 115 120 125 Asn Ile Ala Ala Glu Thr Arg Ala Glu Asp Pro Pro Trp Phe Glu Gly 130 135 140 Leu Glu Ser Arg Phe Gln Ser Lys Ser Gly Tyr Leu Arg Tyr Ser Cys 145 150 155 160 Glu Ser Arg Ile Arg Ser Tyr Leu Arg Glu Val Ser Ser Tyr Pro Ser 165 170 175 Thr Val Gly Ala Glu Ala Gln Glu Glu Phe Leu Arg Val Leu Gly Ser 180 185 190 Met Cys Gln Arg Leu Arg Ser Met Gln Tyr Asn Gly Ser Tyr Phe Asp 195 200 205

Arg Phe Gly 210 Ala Lys Gly Gly Ser 215 Arg Leu Cys Thr Pro 220 Glu Gly Trp Ser Cys Gln Gly Pro Phe Asp Met Asp Ser Cys Leu Ser Arg His Ser 225 230 235 240 Ile Asn Pro Tyr Ser Asn Arg Glu Ser Arg Ile Leu Phe Ser Thr Trp 245 250 255 Asn Leu Asp His Ile Ile Glu Lys Lys Arg Thr Ile Ile Pro Thr Leu 260 265 270 Val Glu Ala Ile Lys Glu Gln Asp Gly Arg Glu Val Asp Trp Glu Tyr 275 280 285 Phe Tyr Gly Leu Leu Phe Thr Ser Glu Asn Leu Lys Leu Val His Ile 290 295 300 Val Cys His Lys Lys Thr Thr His Lys Leu Asn Cys Asp Pro Ser Arg 305 310 315 320 Ile Tyr Lys Pro Gln Thr Arg Leu Lys Arg Lys Gln Pro Val Arg Lys 325 330 335 Arg Gln

<210> 48 <211> 360 <212> PRT <213> Homo sapiens <400> 48 Met Ser Thr Gln Glu Arg Pro Thr Phe Tyr Arg Gln Glu Leu Asn Lys 1 5 10 15 Ile Trp Glu Val Pro Glu Arg Tyr Gln Asn Leu Ser Pro Val Gly Ser 20 25 30 Gly Ala Tyr Gly Ser Val Cys Ala Ala Phe Asp Thr Lys Thr Gly Leu 35 40 45

Arg His Val 50 Ala Val Lys Lys Leu 55 Ser Arg Pro Phe Gln 60 Ser Ile Ile Ala Lys Arg Thr Tyr Arg Glu Leu Arg Leu Leu Lys His Met Lys His 65 70 75 80 Glu Asn Val Ile Gly Leu Leu Asp Val Phe Thr Pro Ala Arg Ser Leu 85 90 95 Glu Glu Phe Asn Asp Val Tyr Leu Val Thr His Leu Met Gly Ala Asp 100 105 110 Leu Asn Asn Ile Val Lys Cys Gln Lys Leu Thr Asp Asp His Val Gln 115 120 125 Phe Leu Ile Tyr Gln Ile Leu Arg Gly Leu Lys Tyr Ile His Ser Ala 130 135 140 Asp Ile Ile His Arg Asp Leu Lys Pro Ser Asn Leu Ala Val Asn Glu 145 150 155 160 Asp Cys Glu Leu Lys Ile Leu Asp Phe Gly Leu Ala Arg His Thr Asp 165 170 175 Asp Glu Met Thr Gly Tyr Val Ala Thr Arg Trp Tyr Arg Ala Pro Glu 180 185 190 Ile Met Leu Asn Trp Met His Tyr Asn Gln Thr Val Asp Ile Trp Ser 195 200 205 Val Gly Cys Ile Met Ala Glu Leu Leu Thr Gly Arg Thr Leu Phe Pro 210 215 220 Gly Thr Asp His Ile Asp Gln Leu Lys Leu Ile Leu Arg Leu Val Gly 225 230 235 240 Thr Pro Gly Ala Glu Leu Leu Lys Lys Ile Ser Ser Glu Ser Ala Arg 245 250 255

Asn Asn Tyr Ile Gln 260 Ser Leu Thr Gln Met 265 Pro Lys Met Asn Phe 270 Ala Val Phe Ile Gly Ala Asn Pro Leu Ala Val Asp Leu Leu Glu Lys Met 275 280 285 Leu Val Leu Asp Ser Asp Lys Arg Ile Thr Ala Ala Gln Ala Leu Ala 290 295 300 His Ala Tyr Phe Ala Gln Tyr His Asp Pro Asp Asp Glu Pro Val Ala 305 310 315 320 Asp Pro Tyr Asp Gln Ser Phe Glu Ser Arg Asp Leu Leu Ile Asp Glu 325 330 335 Trp Lys Ser Leu Thr Tyr Asp Glu Val Ile Ser Phe Val Pro Pro Pro 340 345 350 Leu Asp Gln Glu Glu Met Glu Ser 355 360

<210> 49 <211> 364 <212> PRT <213> Homo sapiens <400> 49 Met Ser Thr Gly Pro Arg Ala Gly Phe Tyr Arg Gln Glu Leu Asn Lys 1 5 10 15 Val Trp Glu Val Pro Gln Arg Leu Gln Gly Leu Arg Pro Val Gly Ser 20 25 30 Gly Ala Tyr Gly Ser Val Cys Ser Ala Tyr Asp Ala Arg Leu Arg Gln 35 40 45 Lys Val His Ala Val Lys Lys Leu Ser Arg Pro Phe Gln Ser Leu Ile 50 55 60 Ala Arg Arg Thr Tyr Arg Glu Leu Arg Leu Leu Lys His Leu Lys

His

65 70 75

Glu Ile Asn Val Ile Gly 85 Leu Leu Asp Val Phe 90 Thr Pro Ala Thr Ser 95 Glu Asp Phe Ser Glu Val Tyr Leu Val Thr Thr Leu Met Gly Ala Asp 100 105 110 Leu Asn Asn Ile Val Lys Cys Gln Ala Leu Ser Asp Glu His Val Gln 115 120 125 Phe Leu Val Tyr Gln Leu Leu Arg Gly Leu Lys Tyr Ile His Ser Ala 130 135 140 Gly Ile Ile His Arg Asp Leu Lys Pro Ser Asn Val Ala Val Asn Glu 145 150 155 160 Asp Cys Glu Leu Arg Ile Leu Asp Phe Gly Leu Ala Arg Gln Ala Asp 165 170 175 Glu Glu Met Thr Gly Tyr Val Ala Thr Arg Trp Tyr Arg Ala Pro Glu 180 185 190 Ile Met Leu Asn Trp Met His Tyr Asn Gln Thr Val Asp Ile Trp Ser 195 200 205 Val Gly Cys Ile Met Ala Glu Leu Leu Gln Gly Lys Ala Leu Phe Pro 210 215 220 Gly Ser Asp Tyr Ile Asp Gln Leu Lys Arg Ile Met Glu Val Val Gly 225 230 235 240 Thr Pro Ser Pro Glu Val Leu Ala Lys Ile Ser Ser Glu His Ala Arg 245 250 255 Thr Tyr Ile Gln Ser Leu Pro Pro Met Pro Gln Lys Asp Leu Ser Ser 260 265 270 Ile Phe Arg Gly Ala Asn Pro Leu Ala Ile Asp Leu Leu Gly Arg Met 275 280 285 Leu Val Leu Asp Ser Asp Gln Arg Val Ser Ala Ala Glu Ala Leu Ala

290

295

300

His Ala 305 320 Ala Tyr Phe Ser Gln 310 Tyr His Asp Pro Glu 315 Asp Glu Pro Glu Glu Pro Tyr Asp Glu Ser Val Glu Ala Lys Glu Arg Thr Leu Glu Glu 325 330 335 Trp Lys Glu Leu Thr Tyr Gln Glu Val Leu Ser Phe Lys Pro Pro Glu 340 345 350 Pro Pro Lys Pro Pro Gly Ser Leu Glu Ile Glu Gln 355 360

<210> 50 <211> 367 <212> PRT <213> Homo sapiens

<400> 50 Ser Pro Pro 5 Pro Ala Arg Ser Gly 10 Phe Tyr Arg Gln Glu 15 Met Val 1 Ser Thr Lys Thr Ala Trp Glu Val Arg Ala Val Tyr Arg Asp Leu Gln Pro 20 25 30 Val Gly Ser Gly Ala Tyr Gly Ala Val Cys Ser Ala Val Asp Gly Arg 35 40 45 Thr Gly Ala Lys Val Ala Ile Lys Lys Leu Tyr Arg Pro Phe Gln Ser 50 55 60 Glu Leu Phe Ala Lys Arg Ala Tyr Arg Glu Leu Arg Leu Leu Lys His 65 70 75 80 Met Arg His Glu Asn Val Ile Gly Leu Leu Asp Val Phe Thr Pro Asp 85 90 95 Glu Thr Leu Asp Asp Phe Thr Asp Phe Tyr Leu Val Met Pro Phe Met 100 105 110 Gly Thr Asp Leu Gly Lys Leu Met Lys His Glu Lys Leu Gly Glu Asp

115

120

125

Arg Ile Ile 130 Gln Phe Leu Val Tyr 135 Gln Met Leu Lys Gly 140 Leu Arg Tyr His Ala Ala Gly Ile Ile His Arg Asp Leu Lys Pro Gly Asn Leu Ala 145 150 155 160 Val Asn Glu Asp Cys Glu Leu Lys Ile Leu Asp Phe Gly Leu Ala Arg 165 170 175 Gln Ala Asp Ser Glu Met Thr Gly Tyr Val Val Thr Arg Trp Tyr Arg 180 185 190 Ala Pro Glu Val Ile Leu Asn Trp Met Arg Tyr Thr Gln Thr Val Asp 195 200 205 Ile Trp Ser Val Gly Cys Ile Met Ala Glu Met Ile Thr Gly Lys Thr 210 215 220 Leu Phe Lys Gly Ser Asp His Leu Asp Gln Leu Lys Glu Ile Met Lys 225 230 235 240 Val Thr Gly Thr Pro Pro Ala Glu Phe Val Gln Arg Leu Gln Ser Asp 245 250 255 Glu Ala Lys Asn Tyr Met Lys Gly Leu Pro Glu Leu Glu Lys Lys Asp 260 265 270 Phe Ala Ser Ile Leu Thr Asn Ala Ser Pro Leu Ala Val Asn Leu Leu 275 280 285 Glu Lys Met Leu Val Leu Asp Ala Glu Gln Arg Val Thr Ala Gly Glu 290 295 300 Ala Leu Ala His Pro Tyr Phe Glu Ser Leu His Asp Thr Glu Asp Glu 305 310 315 320 Pro Gln Val Gln Lys Tyr Asp Asp Ser Phe Asp Asp Val Asp Arg Thr 325 330 335

Leu Lys Asp Glu Trp 340 Lys Arg Val Thr Tyr 345 Lys Glu Val Leu Ser 350 Phe Pro Pro Arg Gln Leu Gly Ala Arg Val Ser Lys Glu Thr Pro Leu

355 360 365 <210> 51 <211> 365 <212> PRT <213> Homo sapiens

<400> 51 Leu Ile Arg 5 Lys Lys Gly Phe Tyr 10 Lys Gln Asp Val Asn 15 Met Lys 1 Ser Thr Ala Trp Glu Leu Pro Lys Thr Tyr Val Ser Pro Thr His Val Gly 20 25 30 Ser Gly Ala Tyr Gly Ser Val Cys Ser Ala Ile Asp Lys Arg Ser Gly 35 40 45 Glu Lys Val Ala Ile Lys Lys Leu Ser Arg Pro Phe Gln Ser Glu Ile 50 55 60 Phe Ala Lys Arg Ala Tyr Arg Glu Leu Leu Leu Leu Lys His Met Gln 65 70 75 80 His Glu Asn Val Ile Gly Leu Leu Asp Val Phe Thr Pro Ala Ser Ser 85 90 95 Leu Arg Asn Phe Tyr Asp Phe Tyr Leu Val Met Pro Phe Met Gln Thr 100 105 110 Asp Leu Gln Lys Ile Met Gly Met Glu Phe Ser Glu Glu Lys Ile Gln 115 120 125 Tyr Leu Val Tyr Gln Met Leu Lys Gly Leu Lys Tyr Ile His Ser Ala 130 135 140 Gly Val Val His Arg Asp Leu Lys Pro Gly Asn Leu Ala Val Asn Glu

145 150 155

160

Asp Asp Cys Glu Leu Lys 165 Ile Leu Asp Phe Gly 170 Leu Ala Arg His Ala 175 Ala Glu Met Thr Gly Tyr Val Val Thr Arg Trp Tyr Arg Ala Pro Glu 180 185 190 Val Ile Leu Ser Trp Met His Tyr Asn Gln Thr Val Asp Ile Trp Ser 195 200 205 Val Gly Cys Ile Met Ala Glu Met Leu Thr Gly Lys Thr Leu Phe Lys 210 215 220 Gly Lys Asp Tyr Leu Asp Gln Leu Thr Gln Ile Leu Lys Val Thr Gly 225 230 235 240 Val Pro Gly Thr Glu Phe Val Gln Lys Leu Asn Asp Lys Ala Ala Lys 245 250 255 Ser Tyr Ile Gln Ser Leu Pro Gln Thr Pro Arg Lys Asp Phe Thr Gln 260 265 270 Leu Phe Pro Arg Ala Ser Pro Gln Ala Ala Asp Leu Leu Glu Lys Met 275 280 285 Leu Glu Leu Asp Val Asp Lys Arg Leu Thr Ala Ala Gln Ala Leu Thr 290 295 300 His Pro Phe Phe Glu Pro Phe Arg Asp Pro Glu Glu Glu Thr Glu Ala 305 310 315 320 Gln Gln Pro Phe Asp Asp Ser Leu Glu His Glu Lys Leu Thr Val Asp 325 330 335 Glu Trp Lys Gln His Ile Tyr Lys Glu Ile Val Asn Phe Ser Pro Ile 340 345 350 Ala Arg Lys Asp Ser Arg Arg Arg Ser Gly Met Lys Leu 355 360 365

<210> 52 <211> 403 <212> PRT <213> Homo sapiens <400> 52 Met Thr Ala Ile Ile Lys Glu Ile Val Ser Arg Asn Lys Arg Arg Tyr 1 5 10 15 Gln Glu Asp Gly Phe Asp Leu Asp Leu Thr Tyr Ile Tyr Pro Asn Ile 20 25 30 Ile Ala Met Gly Phe Pro Ala Glu Arg Leu Glu Gly Val Tyr Arg Asn 35 40 45 Asn Ile Asp Asp Val Val Arg Phe Leu Asp Ser Lys His Lys Asn His 50 55 60 Tyr Lys Ile Tyr Asn Leu Cys Ala Glu Arg His Tyr Asp Thr Ala Lys 65 70 75 80 Phe Asn Cys Arg Val Ala Gln Tyr Pro Phe Glu Asp His Asn Pro Pro 85 90 95 Gln Leu Glu Leu Ile Lys Pro Phe Cys Glu Asp Leu Asp Gln Trp Leu 100 105 110 Ser Glu Asp Asp Asn His Val Ala Ala Ile His Cys Lys Ala Gly Lys 115 120 125 Gly Arg Thr Gly Val Met Ile Cys Ala Tyr Leu Leu His Arg Gly Lys 130 135 140 Phe Leu Lys Ala Gln Glu Ala Leu Asp Phe Tyr Gly Glu Val Arg Thr 145 150 155 160 Arg Asp Lys Lys Gly Val Thr Ile Pro Ser Gln Arg Arg Tyr Val Tyr 165 170 175 Tyr Tyr Ser Tyr Leu Leu Lys Asn His Leu Asp Tyr Arg Pro Val Ala 180 185 190

Leu Leu Phe His Lys Met Met Phe Glu Thr Ile Pro Met Phe Ser Gly

195 200 205

Gly Thr Cys Asn Pro Gln Phe Val Val Cys Gln Leu Lys Val Lys Ile

210 215 220

Tyr Ser Ser Asn Ser Gly Pro Thr Arg Arg Glu Asp Lys Phe Met Tyr

225 230 235

240

Phe Glu Phe Pro Gln Pro Leu Pro Val Cys Gly Asp Ile Lys Val Glu

245 250 255

Phe Phe His Lys Gln Asn Lys Met Leu Lys Lys Asp Lys Met Phe His

260 265 270

Phe Trp Val Asn Thr Phe Phe Ile Pro Gly Pro Glu Glu Thr Ser Glu

275 280 285

Lys Val Glu Asn Gly Ser Leu Cys Asp Gln Glu Ile Asp Ser Ile Cys

290 295 300

Ser Ile Glu Arg Ala Asp Asn Asp Lys Glu Tyr Leu Val Leu Thr Leu

305 310 315

320

Thr Lys Asn Asp Leu Asp Lys Ala Asn Lys Asp Lys Ala Asn Arg Tyr

325 330 335

Phe Ser Pro Asn Phe Lys Val Lys Leu Tyr Phe Thr Lys Thr Val Glu

340 345 350

Glu Asp Pro Ser 355 Asn Pro Glu Ala Ser 360 Val Ser Asp Asn Glu Pro Asp His Asp 370 375 Ser Asp Pro Glu Asn Glu Pro Phe Ile 385 390 400

Ser Ser Thr Ser Val Thr Pro 365 Tyr Arg Tyr Ser 380 Asp Thr Thr Asp Glu Asp 395 Gln His Thr Gln

Thr Lys Val <210> 53 <211> 1154 <212> PRT <213> Homo sapiens

<400> 53 Tyr Leu Asn 5 Ile Lys Glu Asp Cys 10 Asn Ala Met Ala Phe 15 Met Cys 1 Gln Ala Lys Met Arg Ser Ser Lys Lys Thr Glu Val Asn Leu Glu Ala Pro 20 25 30 Glu Pro Gly Val Glu Val Ile Phe Tyr Leu Ser Asp Arg Glu Pro Leu 35 40 45 Arg Leu Gly Ser Gly Glu Tyr Thr Ala Glu Glu Leu Cys Ile Arg Ala 50 55 60 Ala Gln Ala Cys Arg Ile Ser Pro Leu Cys His Asn Leu Phe Ala Leu 65 70 75 80 Tyr Asp Glu Asn Thr Lys Leu Trp Tyr Ala Pro Asn Arg Thr Ile Thr 85 90 95 Val Asp Asp Lys Met Ser Leu Arg Leu His Tyr Arg Met Arg Phe Tyr 100 105 110 Phe Thr Asn Trp His Gly Thr Asn Asp Asn Glu Gln Ser Val Trp Arg 115 120 125 His Ser Pro Lys Lys Gln Lys Asn Gly Tyr Glu Lys Lys Lys Ile Pro 130 135 140 Asp Ala Thr Pro Leu Leu Asp Ala Ser Ser Leu Glu Tyr Leu Phe Ala 145 150 155 160 Gln Gly Gln Tyr Asp Leu Val Lys Cys Leu Ala Pro Ile Arg Asp Pro 165 170 175

100

Lys Met Thr Glu Gln 180 Asp Gly His Asp Ile 185 Glu Asn Glu Cys Leu 190 Gly Ala Val Leu Ala Ile Ser His Tyr Ala Met Met Lys Lys Met Gln Leu 195 200 205 Pro Glu Leu Pro Lys Asp Ile Ser Tyr Lys Arg Tyr Ile Pro Glu Thr 210 215 220 Leu Asn Lys Ser Ile Arg Gln Arg Asn Leu Leu Thr Arg Met Arg Ile 225 230 235 240 Asn Asn Val Phe Lys Asp Phe Leu Lys Glu Phe Asn Asn Lys Thr Ile 245 250 255 Cys Asp Ser Ser Val Ser Thr His Asp Leu Lys Val Lys Tyr Leu Ala 260 265 270 Thr Leu Glu Thr Leu Thr Lys His Tyr Gly Ala Glu Ile Phe Glu Thr 275 280 285 Ser Met Leu Leu Ile Ser Ser Glu Asn Glu Met Asn Trp Phe His Ser 290 295 300 Asn Asp Gly Gly Asn Val Leu Tyr Tyr Glu Val Met Val Thr Gly Asn 305 310 315 320 Leu Gly Ile Gln Trp Arg His Lys Pro Asn Val Val Ser Val Glu Lys 325 330 335 Glu Lys Asn Lys Leu Lys Arg Lys Lys Leu Glu Asn Lys His Lys Lys 340 345 350 Asp Glu Glu Lys Asn Lys Ile Arg Glu Glu Trp Asn Asn Phe Ser Tyr 355 360 365 Phe Pro Glu Ile Thr His Ile Val Ile Lys Glu Ser Val Val Ser Ile 370 375 380 Asn Lys Gln Asp Asn Lys Lys Met Glu Leu Lys Leu Ser Ser His Glu

101

385 390 395

400

Glu Thr Ala Leu Ser Phe 405 Val Ser Leu Val Asp 410 Gly Tyr Phe Arg Leu 415 Ala Asp Ala His His Tyr Leu Cys Thr Asp Val Ala Pro Pro Leu Ile 420 425 430 Val His Asn Ile Gln Asn Gly Cys His Gly Pro Ile Cys Thr Glu Tyr 435 440 445 Ala Ile Asn Lys Leu Arg Gln Glu Gly Ser Glu Glu Gly Met Tyr Val 450 455 460 Leu Arg Trp Ser Cys Thr Asp Phe Asp Asn Ile Leu Met Thr Val Thr 465 470 475 480 Cys Phe Glu Lys Ser Glu Gln Val Gln Gly Ala Gln Lys Gln Phe Lys 485 490 495 Asn Phe Gln Ile Glu Val Gln Lys Gly Arg Tyr Ser Leu His Gly Ser 500 505 510 Asp Arg Ser Phe Pro Ser Leu Gly Asp Leu Met Ser His Leu Lys Lys 515 520 525 Gln Ile Leu Arg Thr Asp Asn Ile Ser Phe Met Leu Lys Arg Cys Cys 530 535 540 Gln Pro Lys Pro Arg Glu Ile Ser Asn Leu Leu Val Ala Thr Lys Lys 545 550 555 560 Ala Gln Glu Trp Gln Pro Val Tyr Pro Met Ser Gln Leu Ser Phe Asp 565 570 575 Arg Ile Leu Lys Lys Asp Leu Val Gln Gly Glu His Leu Gly Arg Gly 580 585 590 Thr Arg Thr His Ile Tyr Ser Gly Thr Leu Met Asp Tyr Lys Asp Asp 595 600 605

102

Glu Leu Gly 610 Thr Ser Glu Glu Lys 615 Lys Ile Lys Val Ile 620 Leu Lys Val Asp Pro Ser His Arg Asp Ile Ser Leu Ala Phe Phe Glu Ala Ala Ser 625 630 635 640 Met Met Arg Gln Val Ser His Lys His Ile Val Tyr Leu Tyr Gly Val 645 650 655 Cys Val Arg Asp Val Glu Asn Ile Met Val Glu Glu Phe Val Glu Gly 660 665 670 Gly Pro Leu Asp Leu Phe Met His Arg Lys Ser Asp Val Leu Thr Thr 675 680 685 Pro Trp Lys Phe Lys Val Ala Lys Gln Leu Ala Ser Ala Leu Ser Tyr 690 695 700 Leu Glu Asp Lys Asp Leu Val His Gly Asn Val Cys Thr Lys Asn Leu 705 710 715 720 Leu Leu Ala Arg Glu Gly Ile Asp Ser Glu Cys Gly Pro Phe Ile Lys 725 730 735 Leu Ser Asp Pro Gly Ile Pro Ile Thr Val Leu Ser Arg Gln Glu Cys 740 745 750 Ile Glu Arg Ile Pro Trp Ile Ala Pro Glu Cys Val Glu Asp Ser Lys 755 760 765 Asn Leu Ser Val Ala Ala Asp Lys Trp Ser Phe Gly Thr Thr Leu Trp 770 775 780 Glu Ile Cys Tyr Asn Gly Glu Ile Pro Leu Lys Asp Lys Thr Leu Ile 785 790 795 800 Glu Lys Glu Arg Phe Tyr Glu Ser Arg Cys Arg Pro Val Thr Pro Ser 805 810 815

103

Cys Pro Lys Glu Leu 820 Ala Asp Leu Met Thr 825 Arg Cys Met Asn Tyr 830 Asp Asn Gln Arg Pro Phe Phe Arg Ala Ile Met Arg Asp Ile Asn Lys Leu 835 840 845 Glu Glu Gln Asn Pro Asp Ile Val Ser Glu Lys Lys Pro Ala Thr Glu 850 855 860 Val Asp Pro Thr His Phe Glu Lys Arg Phe Leu Lys Arg Ile Arg Asp 865 870 875 880 Leu Gly Glu Gly His Phe Gly Lys Val Glu Leu Cys Arg Tyr Asp Pro 885 890 895 Glu Gly Asp Asn Thr Gly Glu Gln Val Ala Val Lys Ser Leu Lys Pro 900 905 910 Glu Ser Gly Gly Asn His Ile Ala Asp Leu Lys Lys Glu Ile Glu Ile 915 920 925 Leu Arg Asn Leu Tyr His Glu Asn Ile Val Lys Tyr Lys Gly Ile Cys 930 935 940 Thr Glu Asp Gly Gly Asn Gly Ile Lys Leu Ile Met Glu Phe Leu Pro 945 950 955 960 Ser Gly Ser Leu Lys Glu Tyr Leu Pro Lys Asn Lys Asn Lys Ile Asn 965 970 975 Leu Lys Gln Gln Leu Lys Tyr Ala Val Gln Ile Cys Lys Gly Met Asp 980 985 990 Tyr Leu Gly Ser Arg Gln Tyr Val His Arg Asp Leu Ala Ala Arg Asn 995 1000 1005 Val Leu Val Glu Ser Glu His Gln Val Lys Ile Gly Asp Phe Gly Leu 1010 1015 1020 Thr Lys Ala Ile Glu Thr Asp Lys Glu Tyr Tyr Thr Val Lys Asp Asp

104

1025

1040

1030

1035

Arg Ser Asp Ser Pro Val 1045 Phe Trp Tyr Ala Pro 1050 Glu Cys Leu Met Gln 1055 Lys Phe Tyr Ile Ala Ser Asp Val Trp Ser Phe Gly Val Thr Leu His 1060 1065 1070 Glu Leu Leu Thr Tyr Cys Asp Ser Asp Ser Ser Pro Met Ala Leu Phe

1075 1080 1085

Leu Lys Met Ile Gly Pro Thr His Gly Gln Met Thr Val Thr Arg Leu 1090 1095 1100 Val Asn Thr Leu Lys Glu Gly Lys Arg Leu Pro Cys Pro Pro Asn

Cys

1105 1110 1115

1120

Pro Asp Glu Val Tyr Gln Leu Met Arg Lys Cys Trp Glu Phe Gln Pro 1125 1130 1135 Ser Asn Arg Thr Ser Phe Gln Asn Leu Ile Glu Gly Phe Glu Ala Leu 1140 1145 1150 Leu Lys

<210> 54 <211> 1132 <212> PRT <213> Homo sapiens <400> 54 Met Gly Met Ala Cys Leu Thr Met Thr Glu Met Glu Gly Thr Ser Thr 1 5 10 15 Ser Ser Ile Tyr Gln Asn Gly Asp Ile Ser Gly Asn Ala Asn Ser Met 20 25 30 Lys Gln Ile Asp Pro Val Leu Gln Val Tyr Leu Tyr His Ser Leu Gly 35 40 45 Lys Ser Glu Ala Asp Tyr Leu Thr Phe Pro Ser Gly Glu Tyr Val

Ala

105

50 55 60

Glu Val 65 80 Glu Ile Cys Ile Ala 70 Ala Ser Lys Ala Cys 75 Gly Ile Thr Pro Tyr His Asn Met Phe Ala Leu Met Ser Glu Thr Glu Arg Ile Trp Tyr 85 90 95 Pro Pro Asn His Val Phe His Ile Asp Glu Ser Thr Arg His Asn Val 100 105 110 Leu Tyr Arg Ile Arg Phe Tyr Phe Pro Arg Trp Tyr Cys Ser Gly Ser 115 120 125 Asn Arg Ala Tyr Arg His Gly Ile Ser Arg Gly Ala Glu Ala Pro Leu 130 135 140 Leu Asp Asp Phe Val Met Ser Tyr Leu Phe Ala Gln Trp Arg His Asp 145 150 155 160 Phe Val His Gly Trp Ile Lys Val Pro Val Thr His Glu Thr Gln Glu 165 170 175 Glu Cys Leu Gly Met Ala Val Leu Asp Met Met Arg Ile Ala Lys Glu 180 185 190 Asn Asp Gln Thr Pro Leu Ala Ile Tyr Asn Ser Ile Ser Tyr Lys Thr 195 200 205 Phe Leu Pro Lys Cys Ile Arg Ala Lys Ile Gln Asp Tyr His Ile Leu 210 215 220 Thr Arg Lys Arg Ile Arg Tyr Arg Phe Arg Arg Phe Ile Gln Gln Phe 225 230 235 240 Ser Gln Cys Lys Ala Thr Ala Arg Asn Leu Lys Leu Lys Tyr Leu Ile 245 250 255 Asn Leu Glu Thr Leu Gln Ser Ala Phe Tyr Thr Glu Lys Phe Glu Val 260 265 270

106

Lys Ile Glu Pro 275 Gly Ser Gly Pro Ser 280 Gly Glu Glu Ile Phe 285 Ala Thr Ile Ile Thr Gly Asn Gly Gly Ile Gln Trp Ser Arg Gly Lys His Lys 290 295 300 Glu Ser Glu Thr Leu Thr Glu Gln Asp Leu Gln Leu Tyr Cys Asp Phe 305 310 315 320 Pro Asn Ile Ile Asp Val Ser Ile Lys Gln Ala Asn Gln Glu Gly Ser 325 330 335 Asn Glu Ser Arg Val Val Thr Ile His Lys Gln Asp Gly Lys Asn Leu 340 345 350 Glu Ile Glu Leu Ser Ser Leu Arg Glu Ala Leu Ser Phe Val Ser Leu 355 360 365 Ile Asp Gly Tyr Tyr Arg Leu Thr Ala Asp Ala His His Tyr Leu Cys 370 375 380 Lys Glu Val Ala Pro Pro Ala Val Leu Glu Asn Ile Gln Ser Asn Cys 385 390 395 400 His Gly Pro Ile Ser Met Asp Phe Ala Ile Ser Lys Leu Lys Lys Ala 405 410 415 Gly Asn Gln Thr Gly Leu Tyr Val Leu Arg Cys Ser Pro Lys Asp Phe 420 425 430 Asn Lys Tyr Phe Leu Thr Phe Ala Val Glu Arg Glu Asn Val Ile Glu 435 440 445 Tyr Lys His Cys Leu Ile Thr Lys Asn Glu Asn Glu Glu Tyr Asn Leu 450 455 460 Ser Gly Thr Lys Lys Asn Phe Ser Ser Leu Lys Asp Leu Leu Asn

Cys

465 470 475

480

107

Tyr Thr Gln Met Glu Thr 485 Val Arg Ser Asp Asn 490 Ile Ile Phe Gln Phe 495 Lys Cys Cys Pro Pro Lys Pro Lys Asp Lys Ser Asn Leu Leu Val Phe 500 505 510 Arg Thr Asn Gly Val Ser Asp Val Pro Thr Ser Pro Thr Leu Gln Arg 515 520 525 Pro Thr His Met Asn Gln Met Val Phe His Lys Ile Arg Asn Glu Asp 530 535 540 Leu Ile Phe Asn Glu Ser Leu Gly Gln Gly Thr Phe Thr Lys Ile Phe 545 550 555 560 Lys Gly Val Arg Arg Glu Val Gly Asp Tyr Gly Gln Leu His Glu Thr 565 570 575 Glu Val Leu Leu Lys Val Leu Asp Lys Ala His Arg Asn Tyr Ser Glu 580 585 590 Ser Phe Phe Glu Ala Ala Ser Met Met Ser Lys Leu Ser His Lys His 595 600 605 Leu Val Leu Asn Tyr Gly Val Cys Val Cys Gly Asp Glu Asn Ile Leu 610 615 620 Val Gln Glu Phe Val Lys Phe Gly Ser Leu Asp Thr Tyr Leu Lys Lys 625 630 635 640 Asn Lys Asn Cys Ile Asn Ile Leu Trp Lys Leu Glu Val Ala Lys Gln 645 650 655 Leu Ala Trp Ala Met His Phe Leu Glu Glu Asn Thr Leu Ile His Gly 660 665 670 Asn Val Cys Ala Lys Asn Ile Leu Leu Ile Arg Glu Glu Asp Arg Lys 675 680 685 Thr Gly Asn Pro Pro Phe Ile Lys Leu Ser Asp Pro Gly Ile Ser Ile

108

690 695 700

Thr Pro 705 720 Val Leu Pro Lys Asp 710 Ile Leu Gln Glu Arg 715 Ile Pro Trp Val Pro Glu Cys Ile Glu Asn Pro Lys Asn Leu Asn Leu Ala Thr Asp Lys 725 730 735 Trp Ser Phe Gly Thr Thr Leu Trp Glu Ile Cys Ser Gly Gly Asp Lys 740 745 750 Pro Leu Ser Ala Leu Asp Ser Gln Arg Lys Leu Gln Phe Tyr Glu Asp 755 760 765 Arg His Gln Leu Pro Ala Pro Lys Trp Ala Glu Leu Ala Asn Leu Ile 770 775 780 Asn Asn Cys Met Asp Tyr Glu Pro Asp Phe Arg Pro Ser Phe Arg Ala 785 790 795 800 Ile Ile Arg Asp Leu Asn Ser Leu Phe Thr Pro Asp Tyr Glu Leu Leu 805 810 815 Thr Glu Asn Asp Met Leu Pro Asn Met Arg Ile Gly Ala Leu Gly Phe 820 825 830 Ser Gly Ala Phe Glu Asp Arg Asp Pro Thr Gln Phe Glu Glu Arg His 835 840 845 Leu Lys Phe Leu Gln Gln Leu Gly Lys Gly Asn Phe Gly Ser Val Glu 850 855 860 Met Cys Arg Tyr Asp Pro Leu Gln Asp Asn Thr Gly Glu Val Val Ala 865 870 875 880 Val Lys Lys Leu Gln His Ser Thr Glu Glu His Leu Arg Asp Phe Glu 885 890 895 Arg Glu Ile Glu Ile Leu Lys Ser Leu Gln His Asp Asn Ile Val Lys 900 905 910

109

Tyr Ile Lys Gly 915 Val Cys Tyr Ser Ala 920 Gly Arg Arg Asn Leu 925 Lys Leu Met Glu Tyr Leu Pro Tyr Gly Ser Leu Arg Asp Tyr Leu Gln Lys His 930 935 940 Lys Glu Arg Ile Asp His Ile Lys Leu Leu Gln Tyr Thr Ser Gln Ile 945 950 955 960 Cys Lys Gly Met Glu Tyr Leu Gly Thr Lys Arg Tyr Ile His Arg Asp 965 970 975 Leu Ala Thr Arg Asn Ile Leu Val Glu Asn Glu Asn Arg Val Lys Ile 980 985 990 Gly Asp Phe Gly Leu Thr Lys Val Leu Pro Gln Asp Lys Glu Tyr Tyr 995 1000 1005 Lys Val Lys Glu Pro Gly Glu Ser Pro Ile Phe Trp Tyr Ala Pro Glu 1010 1015 1020 Ser Leu Thr Glu Ser Lys Phe Ser Val Ala Ser Asp Val Trp Ser

Phe

1025 1030 1035

1040

Gly Ser Val Val Leu Tyr 1045 Glu Leu Phe Thr Tyr 1050 Ile Glu Lys Ser Lys 1055 Pro Pro Ala Glu Phe Met Arg Met Ile Gly Asn Asp Lys Gln Gly Gln 1060 1065 1070 Met Ile Val Phe His Leu Ile Glu Leu Leu Lys Asn Asn Gly Arg Leu 1075 1080 1085 Pro Arg Pro Asp Gly Cys Pro Asp Glu Ile Tyr Met Ile Met Thr Glu 1090 1095 1100 Cys Trp Asn Asn Asn Val Asn Gln Arg Pro Ser Phe Arg Asp Leu

Ala

1105 1110 1115

1120

110

Leu Arg Val Asp Gln Ile Arg Asp Asn Met Ala Gly 1125 1130 <210> 55 <211> 1124 <212> PRT <213> Homo sapiens

<400> 55 Pro Pro Ser 5 Glu Glu Thr Pro Leu 10 Ile Pro Gln Arg Ser 15 Met Cys 1 Ala Ser Leu Leu Ser Thr Glu Ala Gly Ala Leu His Val Leu Leu Pro Ala 20 25 30 Arg Gly Pro Gly Pro Pro Gln Arg Leu Ser Phe Ser Phe Gly Asp His 35 40 45 Leu Ala Glu Asp Leu Cys Val Gln Ala Ala Lys Ala Ser Gly Ile Leu 50 55 60 Pro Val Tyr His Ser Leu Phe Ala Leu Ala Thr Glu Asp Leu Ser Cys 65 70 75 80 Trp Phe Pro Pro Ser His Ile Phe Ser Val Glu Asp Ala Ser Thr Gln 85 90 95 Val Leu Leu Tyr Arg Ile Arg Phe Tyr Phe Pro Asn Trp Phe Gly Leu 100 105 110 Glu Lys Cys His Arg Phe Gly Leu Arg Lys Asp Leu Ala Ser Ala Ile 115 120 125 Leu Asp Leu Pro Val Leu Glu His Leu Phe Ala Gln His Arg Ser Asp 130 135 140 Leu Val Ser Gly Arg Leu Pro Val Gly Leu Ser Leu Lys Glu Gln Gly 145 150 155 160 Glu Cys Leu Ser Leu Ala Val Leu Asp Leu Ala Arg Met Ala Arg Glu 165 170 175

111

Gln Ala Ala Gln Arg 180 Pro Gly Glu Leu Leu 185 Lys Thr Val Ser Tyr 190 Lys Cys Leu Pro Pro Ser Leu Arg Asp Leu Ile Gln Gly Leu Ser Phe Val 195 200 205 Thr Arg Arg Arg Ile Arg Arg Thr Val Arg Arg Ala Leu Arg Arg Val 210 215 220 Ala Ala Cys Gln Ala Asp Arg His Ser Leu Met Ala Lys Tyr Ile Met 225 230 235 240 Asp Leu Glu Arg Leu Asp Pro Ala Gly Ala Ala Glu Thr Phe His Val 245 250 255 Gly Leu Pro Gly Ala Leu Gly Gly His Asp Gly Leu Gly Leu Leu Arg 260 265 270 Val Ala Gly Asp Gly Gly Ile Ala Trp Thr Gln Gly Glu Gln Glu Val 275 280 285 Leu Gln Pro Phe Cys Asp Phe Pro Glu Ile Val Asp Ile Ser Ile Lys 290 295 300 Gln Ala Pro Arg Val Gly Pro Ala Gly Glu His Arg Leu Val Thr Val 305 310 315 320 Thr Arg Thr Asp Asn Gln Ile Leu Glu Ala Glu Phe Pro Gly Leu Pro 325 330 335 Glu Ala Leu Ser Phe Val Ala Leu Val Asp Gly Tyr Phe Arg Leu Thr 340 345 350 Thr Asp Ser Gln His Phe Phe Cys Lys Glu Val Ala Pro Pro Arg Leu 355 360 365 Leu Glu Glu Val Ala Glu Gln Cys His Gly Pro Ile Thr Leu Asp Phe 370 375 380 Ala Ile Asn Lys Leu Lys Thr Gly Gly Ser Arg Pro Gly Ser Tyr Val

112

385 390 395

400

Leu Cys Arg Arg Ser Pro 405 Gln Asp Phe Asp Ser 410 Phe Leu Leu Thr Val 415 Val Gln Asn Pro Leu Gly Pro Asp Tyr Lys Gly Cys Leu Ile Arg Arg 420 425 430 Ser Pro Thr Gly Thr Phe Leu Leu Val Gly Leu Ser Arg Pro His Ser 435 440 445 Ser Leu Arg Glu Leu Leu Ala Thr Cys Trp Asp Gly Gly Leu His Val 450 455 460 Asp Gly Val Ala Val Thr Leu Thr Ser Cys Cys Ile Pro Arg Pro Lys 465 470 475 480 Glu Lys Ser Asn Leu Ile Val Val Gln Arg Gly His Ser Pro Pro Thr 485 490 495 Ser Ser Leu Val Gln Pro Gln Ser Gln Tyr Gln Leu Ser Gln Met Thr 500 505 510 Phe His Lys Ile Pro Ala Asp Ser Leu Glu Trp His Glu Asn Leu Gly 515 520 525 His Gly Ser Phe Thr Lys Ile Tyr Arg Gly Cys Arg His Glu Val Val 530 535 540 Asp Gly Glu Ala Arg Lys Thr Glu Val Leu Leu Lys Val Met Asp Ala 545 550 555 560 Lys His Lys Asn Cys Met Glu Ser Phe Leu Glu Ala Ala Ser Leu Met 565 570 575 Ser Gln Val Ser Tyr Arg His Leu Val Leu Leu His Gly Val Cys Met 580 585 590 Ala Gly Asp Ser Thr Met Val Gln Glu Phe Val His Leu Gly Ala Ile 595 600 605

113

Asp Lys Met 610 Tyr Leu Arg Lys Arg 615 Gly His Leu Val Pro 620 Ala Ser Trp Leu Gln Val Val Lys Gln Leu Ala Tyr Ala Leu Asn Tyr Leu Glu Asp 625 630 635 640 Lys Gly Leu Pro His Gly Asn Val Ser Ala Arg Lys Val Leu Leu Ala 645 650 655 Arg Glu Gly Ala Asp Gly Ser Pro Pro Phe Ile Lys Leu Ser Asp Pro 660 665 670 Gly Val Ser Pro Ala Val Leu Ser Leu Glu Met Leu Thr Asp Arg Ile 675 680 685 Pro Trp Val Ala Pro Glu Cys Leu Arg Glu Ala Gln Thr Leu Ser Leu 690 695 700 Glu Ala Asp Lys Trp Gly Phe Gly Ala Thr Val Trp Glu Val Phe Ser 705 710 715 720 Gly Val Thr Met Pro Ile Ser Ala Leu Asp Pro Ala Lys Lys Leu Gln 725 730 735 Phe Tyr Glu Asp Arg Gln Gln Leu Pro Ala Pro Lys Trp Thr Glu Leu 740 745 750 Ala Leu Leu Ile Gln Gln Cys Met Ala Tyr Glu Pro Val Gln Arg Pro 755 760 765 Ser Phe Arg Ala Val Ile Arg Asp Leu Asn Ser Leu Ile Ser Ser Asp 770 775 780 Tyr Glu Leu Leu Ser Asp Pro Thr Pro Gly Ala Leu Ala Pro Arg Asp 785 790 795 800 Gly Leu Trp Asn Gly Ala Gln Leu Tyr Ala Cys Gln Asp Pro Thr Ile 805 810 815

114

Phe Asn Glu Glu Arg 820 His Leu Lys Tyr Ile 825 Ser Gln Leu Gly Lys 830 Gly Phe Gly Ser Val Glu Leu Cys Arg Tyr Asp Pro Leu Gly Asp Asn Thr 835 840 845 Gly Ala Leu Val Ala Val Lys Gln Leu Gln His Ser Gly Pro Asp Gln 850 855 860 Gln Arg Asp Phe Gln Arg Glu Ile Gln Ile Leu Lys Ala Leu His Ser 865 870 875 880 Asp Phe Ile Val Lys Tyr Arg Gly Val Ser Tyr Gly Pro Gly Arg Gln 885 890 895 Ser Leu Arg Leu Val Met Glu Tyr Leu Pro Ser Gly Cys Leu Arg Asp 900 905 910 Phe Leu Gln Arg His Arg Ala Arg Leu Asp Ala Ser Arg Leu Leu Leu 915 920 925 Tyr Ser Ser Gln Ile Cys Lys Gly Met Glu Tyr Leu Gly Ser Arg Arg 930 935 940 Cys Val His Arg Asp Leu Ala Ala Arg Asn Ile Leu Val Glu Ser Glu 945 950 955 960 Ala His Val Lys Ile Ala Asp Phe Gly Leu Ala Lys Leu Leu Pro Leu 965 970 975 Asp Lys Asp Tyr Tyr Val Val Arg Glu Pro Gly Gln Ser Pro Ile Phe 980 985 990 Trp Tyr Ala Pro Glu Ser Leu Ser Asp Asn Ile Phe Ser Arg Gln Ser 995 1000 1005 Asp Val Trp Ser Phe Gly Val Val Leu Tyr Glu Leu Phe Thr Tyr Cys 1010 1015 1020 Asp Lys Ser Cys Ser Pro Ser Ala Glu Phe Leu Arg Met Met Gly Cys

115

1025

1040

1030

1035

Glu Glu Arg Asp Val Pro 1045 Ala Leu Cys Arg Leu 1050 Leu Glu Leu Leu Glu 1055 Gly Gln Arg Leu Pro Ala Pro Pro Ala Cys Pro Ala Glu Val His Glu 1060 1065 1070 Leu Met Lys Leu Cys Trp Ala Pro Ser Pro Gln Asp Arg Pro Ser Phe 1075 1080 1085 Ser Ala Leu Gly Pro Gln Leu Asp Met Leu Trp Ser Gly Ser Arg Gly 1090 1095 1100 Cys Glu Thr His Ala Phe Thr Ala His Pro Glu Gly Lys His His Ser 1105 1110 1115 1120 Leu Ser Phe Ser

<210> 56 <211> 1187 <212> PRT <213> Homo sapiens <400> 56 Met Pro Gly Leu Arg His Trp Gly Met Ala Arg Gly Ser Lys Pro Val 1 5 10 15 Asp Gly Ala Gln Pro Met Ala Ala Met Gly Gly Leu Lys Val Leu Leu 20 25 30 His Trp Ala Gly Pro Gly Gly Gly Glu Pro Trp Val Thr Phe Ser Glu 35 40 45 Ser Ser Val Leu Thr Ala Glu Glu Val Cys Ile His Ile Ala His Lys 50 55 60 Gly Ile Gln Thr Pro Pro Cys Phe Asn Leu Phe Ala Leu Phe Asp Ala 65 70 75 80 Ala Gln Val Trp Leu Pro Pro Asn His Ile Leu Glu Ile Pro Arg

116

Asp

Ala Trp Ser Leu Met 100 Leu Tyr Phe Arg Ile 105 Arg Phe Tyr Phe Arg 110 Asn His Gly Met Asn Pro Arg Glu Pro Ala Val Tyr Arg Cys Gly Pro Pro 115 120 125 Gly Thr Glu Ala Ser Ser Asp Gln Thr Ala Gln Gly Met Gln Leu Leu 130 135 140 Asp Pro Ala Ser Phe Glu Tyr Leu Phe Glu Gln Gly Lys His Glu Phe 145 150 155 160 Val Asn Asp Val Ala Ser Leu Trp Glu Leu Ser Thr Glu Glu Glu Ile 165 170 175 His His Phe Lys Asn Glu Ser Leu Gly Met Ala Phe Leu His Leu Cys 180 185 190 His Leu Ala Leu Arg His Gly Ile Pro Leu Glu Glu Val Ala Lys Lys 195 200 205 Thr Ser Phe Lys Asp Cys Ile Pro Arg Ser Phe Arg Arg His Ile Arg 210 215 220 Gln His Ser Ala Leu Thr Arg Leu Arg Leu Arg Asn Val Phe Arg Arg 225 230 235 240 Phe Leu Arg Asp Phe Gln Pro Gly Arg Leu Ser Gln Gln Met Val Met 245 250 255 Val Lys Tyr Leu Ala Thr Leu Glu Arg Leu Ala Pro Arg Phe Gly Thr 260 265 270 Glu Arg Val Pro Val Cys His Leu Arg Leu Leu Ala Gln Ala Glu Gly 275 280 285 Glu Pro Cys Tyr Ile Arg Asp Ser Gly Val Ala Pro Thr Asp Pro

Gly

290 295 300

117

Pro Gly 305 320 Glu Ser Ala Ala Gly 310 Pro Pro Thr His Glu 315 Val Leu Val Thr Thr Gly Gly Ile Gln Trp Trp Pro Val Glu Glu Glu Val Asn Lys Glu 325 330 335 Glu Gly Ser Ser Gly Ser Ser Gly Arg Asn Pro Gln Ala Ser Leu Phe 340 345 350 Gly Lys Lys Ala Lys Ala His Lys Ala Val Gly Gln Pro Ala Asp Arg 355 360 365 Pro Arg Glu Pro Leu Trp Ala Tyr Phe Cys Asp Phe Arg Asp Ile Thr 370 375 380 His Val Val Leu Lys Glu His Cys Val Ser Ile His Arg Gln Asp Asn 385 390 395 400 Lys Cys Leu Glu Leu Ser Leu Pro Ser Arg Ala Ala Ala Leu Ser Phe 405 410 415 Val Ser Leu Val Asp Gly Tyr Phe Arg Leu Thr Ala Asp Ser Ser His 420 425 430 Tyr Leu Cys His Glu Val Ala Pro Pro Arg Leu Val Met Ser Ile Arg 435 440 445 Asp Gly Ile His Gly Pro Leu Leu Glu Pro Phe Val Gln Ala Lys Leu 450 455 460 Arg Pro Glu Asp Gly Leu Tyr Leu Ile His Trp Ser Thr Ser His Pro 465 470 475 480 Tyr Arg Leu Ile Leu Thr Val Ala Gln Arg Ser Gln Ala Pro Asp Gly 485 490 495 Met Gln Ser Leu Arg Leu Arg Lys Phe Pro Ile Glu Gln Gln Asp Gly 500 505 510

118

Ala Glu Phe Val 515 Leu Glu Gly Trp Gly 520 Arg Ser Phe Pro Ser 525 Val Arg Leu Gly Ala Ala Leu Gln Gly Cys Leu Leu Arg Ala Gly Asp Asp Cys 530 535 540 Phe Ser Leu Arg Arg Cys Cys Leu Pro Gln Pro Gly Glu Thr Ser Asn 545 550 555 560 Leu Ile Ile Met Arg Gly Ala Arg Ala Ser Pro Arg Thr Leu Asn Leu 565 570 575 Ser Gln Leu Ser Phe His Arg Val Asp Gln Lys Glu Ile Thr Gln Leu 580 585 590 Ser His Leu Gly Gln Gly Thr Arg Thr Asn Val Tyr Glu Gly Arg Leu 595 600 605 Arg Val Glu Gly Ser Gly Asp Pro Glu Glu Gly Lys Met Asp Asp Glu 610 615 620 Asp Pro Leu Val Pro Gly Arg Asp Arg Gly Gln Glu Leu Arg Val Val 625 630 635 640 Leu Lys Val Leu Asp Pro Ser His His Asp Ile Ala Leu Ala Phe Tyr 645 650 655 Glu Thr Ala Ser Leu Met Ser Gln Val Ser His Thr His Leu Ala Phe 660 665 670 Val His Gly Val Cys Val Arg Gly Pro Glu Asn Ile Met Val Thr Glu 675 680 685 Tyr Val Glu His Gly Pro Leu Asp Val Trp Leu Arg Arg Glu Arg Gly 690 695 700 His Val Pro Met Ala Trp Lys Met Val Val Ala Gln Gln Leu Ala Ser 705 710 715 720 Ala Leu Ser Tyr Leu Glu Asn Lys Asn Leu Val His Gly Asn Val

119

Cys

725

730

735

Gly Arg Asn Ile Ser

740

Leu Leu Ala Arg

Leu Gly Leu Ala Glu

Gly Thr

745

750

Pro Phe Ser

Ile Lys

Leu Ser Asp

Pro Gly Val

Gly Leu Gly Ala Leu

755

760

765

Arg Glu Glu Arg Val Leu

770

Glu Arg

775

Ile

Pro Trp Leu Ala Pro Glu Cys

780

Pro Phe 785 800 Gly Gly Ala Asn Ser 790 Leu Ser Thr Ala Met 795 Asp Lys Trp Gly Gly Ala Thr Leu Leu Glu Ile Cys Phe Asp Gly Glu Ala Pro Leu Gln 805 810 815 Ser Arg Ser Pro Ser Glu Lys Glu His Phe Tyr Gln Arg Gln His Arg 820 825 830 Leu Pro Glu Pro Ser Cys Pro Gln Leu Ala Thr Leu Thr Ser Gln Cys 835 840 845 Leu Thr Tyr Glu Pro Thr Gln Arg Pro Ser Phe Arg Thr Ile Leu Arg 850 855 860 Asp Leu Thr Arg Leu Gln Pro His Asn Leu Ala Asp Val Leu Thr Val 865 870 875 880 Asn Pro Asp Ser Pro Ala Ser Asp Pro Thr Val Phe His Lys Arg Tyr 885 890 895 Leu Lys Lys Ile Arg Asp Leu Gly Glu Gly His Phe Gly Lys Val Ser 900 905 910 Leu Tyr Cys Tyr Asp Pro Thr Asn Asp Gly Thr Gly Glu Met Val Ala 915 920 925 Val Lys Ala Leu Lys Ala Asp Cys Gly Pro Gln His Arg Ser Gly

Trp

930 935 940

120

Lys Ile 945 960 Gln Glu Ile Asp Ile 950 Leu Arg Thr Leu Tyr 955 His Glu His Ile Lys Tyr Lys Gly Cys Cys Glu Asp Gln Gly Glu Lys Ser Leu Gln Leu 965 970 975 Val Met Glu Tyr Val Pro Leu Gly Ser Leu Arg Asp Tyr Leu Pro Arg 980 985 990 His Ser Ile Gly Leu Ala Gln Leu Leu Leu Phe Ala Gln Gln Ile Cys 995 1000 1005 Glu Gly Met Ala Tyr Leu His Ala Gln His Tyr Ile His Arg Asp Leu 1010 1015 1020 Ala Ala Arg Asn Val Leu Leu Asp Asn Asp Arg Leu Val Lys Ile

Gly

1025 1030 1035

1040

Asp Arg Phe Gly Leu Ala 1045 Lys Ala Val Pro Glu 1050 Gly His Glu Tyr Tyr 1055 Val Arg Glu Asp Gly Asp Ser Pro Val Phe Trp Tyr Ala Pro Glu Cys 1060 1065 1070 Leu Lys Glu Tyr Lys Phe Tyr Tyr Ala Ser Asp Val Trp Ser Phe Gly 1075 1080 1085 Val Thr Leu Tyr Glu Leu Leu Thr His Cys Asp Ser Ser Gln Ser Pro 1090 1095 1100 Pro Thr Lys Phe Leu Glu Leu Ile Gly Ile Ala Gln Gly Gln Met

Thr

1105 1110 1115

1120

Val Leu Arg Leu Thr Glu Leu Leu Glu Arg Gly Glu Arg Leu Pro Arg 1125 1130 1135 Pro Asp Lys Cys Pro Cys Glu Val Tyr His Leu Met Lys Asn Cys

Trp

1140 1145 1150

121

Glu Thr Glu Ala Ser Phe Arg Pro Thr Phe Glu Asn Leu Ile Pro Ile

1155 1160 1165

Leu Lys Thr Val His Glu Lys Tyr Gln Gly Gln Ala Pro Ser Val Phe

1170 1175 1180

Ser Val Cys

1185 <210> 57 <211> 906 <212> PRT <213> Homo sapiens

<400> 57 Gly Asn Val 5 Lys Lys Ser Ser Gly 10 Ala Gly Gly Gly Ser 15 Met Gly 1 Ala Ser Gly Gly Ser Gly Ser Gly Gly Leu Ile Gly Leu Met Lys Asp Ala 20 25 30 Phe Gln Pro His His His His His His His Leu Ser Pro His Pro Pro 35 40 45 Gly Thr Val Asp Lys Lys Met Val Glu Lys Cys Trp Lys Leu Met Asp 50 55 60 Lys Val Val Arg Leu Cys Gln Asn Pro Lys Leu Ala Leu Lys Asn Ser 65 70 75 80 Pro Pro Tyr Ile Leu Asp Leu Leu Pro Asp Thr Tyr Gln His Leu Arg 85 90 95 Thr Ile Leu Ser Arg Tyr Glu Gly Lys Met Glu Thr Leu Gly Glu Asn 100 105 110 Glu Tyr Phe Arg Val Phe Met Glu Asn Leu Met Lys Lys Thr Lys Gln 115 120 125 Thr Ile Ser Leu Phe Lys Glu Gly Lys Glu Arg Met Tyr Glu Glu Asn 130 135 140 Ser Gln Pro Arg Arg Asn Leu Thr Lys Leu Ser Leu Ile Phe Ser

122

His

145

160

150

155

Met Leu Ala Glu Leu Lys Gly Ile Phe Pro Ser Gly Leu Phe Gln Gly

165 170 175

Asp Thr Phe Arg Ile Thr Lys Ala Asp Ala Ala Glu Phe Trp Arg Lys

180 185 190

Ala Phe Gly Glu Lys Thr Ile Val Pro Trp Lys Ser Phe Arg Gln Ala

195 200 205

Leu His Glu Val His Pro Ile Ser Ser Gly Leu Glu Ala Met Ala Leu

210 215 220

Lys Ser Thr Ile Asp Leu Thr Cys Asn Asp Tyr Ile Ser Val Phe Glu

225 230 235

240

Phe Asp Ile Phe Thr Arg Leu Phe Gln Pro Trp Ser Ser Leu Leu Arg

245 250 255

Asn Trp Asn Ser Leu Ala Val Thr His Pro Gly Tyr Met Ala Phe Leu

260 265 270

Thr Tyr Asp Glu Val Lys Ala Arg Leu Gln Lys Phe Ile His Lys Pro

275 280 285

Gly Ser Tyr Ile Phe Arg Leu Ser Cys Thr Arg Leu Gly Gln Trp Ala

290 295 300

Ile Gly Tyr Val Thr Ala Asp Gly Asn Ile Leu Gln Thr Ile Pro His

305 310 315

320

Asn Lys Pro Leu Phe Gln Ala Leu Ile Asp Gly Phe Arg Glu Gly Phe

325 330 335

Tyr Leu Leu Phe Pro 340 Asp Gly Arg Asn Cys Glu Pro Thr Pro Gln Asp His Tyr

Gln Asn Pro Asp Leu Thr Gly 345 350 Ile Lys Val Thr Gln Glu Gln

123

355

360

365

Glu Cys Leu 370 Tyr Cys Glu Met Gly 375 Ser Thr Phe Gln Leu 380 Cys Lys Ile Ala Glu Asn Asp Lys Asp Val Lys Ile Glu Pro Cys Gly His Leu Met 385 390 395 400 Cys Thr Ser Cys Leu Thr Ser Trp Gln Glu Ser Glu Gly Gln Gly Cys 405 410 415 Pro Phe Cys Arg Cys Glu Ile Lys Gly Thr Glu Pro Ile Val Val Asp 420 425 430 Pro Phe Asp Pro Arg Gly Ser Gly Ser Leu Leu Arg Gln Gly Ala Glu 435 440 445 Gly Ala Pro Ser Pro Asn Tyr Asp Asp Asp Asp Asp Glu Arg Ala Asp 450 455 460 Asp Thr Leu Phe Met Met Lys Glu Leu Ala Gly Ala Lys Val Glu Arg 465 470 475 480 Pro Pro Ser Pro Phe Ser Met Ala Pro Gln Ala Ser Leu Pro Pro Val 485 490 495 Pro Pro Arg Leu Asp Leu Leu Pro Gln Arg Val Cys Val Pro Ser Ser 500 505 510 Ala Ser Ala Leu Gly Thr Ala Ser Lys Ala Ala Ser Gly Ser Leu His 515 520 525 Lys Asp Lys Pro Leu Pro Val Pro Pro Thr Leu Arg Asp Leu Pro Pro 530 535 540 Pro Pro Pro Pro Asp Arg Pro Tyr Ser Val Gly Ala Glu Ser Arg Pro 545 550 555 560 Gln Arg Arg Pro Leu Pro Cys Thr Pro Gly Asp Cys Pro Ser Arg Asp 565 570 575

124

Lys Pro Leu Pro Pro 580 Val Pro Ser Ser Arg 585 Leu Gly Asp Ser Trp 590 Leu Arg Pro Ile Pro Lys Val Pro Val Ser Ala Pro Ser Ser Ser Asp Pro 595 600 605 Trp Thr Gly Arg Glu Leu Thr Asn Arg His Ser Leu Pro Phe Ser Leu 610 615 620 Pro Ser Gln Met Glu Pro Arg Pro Asp Val Pro Arg Leu Gly Ser Thr 625 630 635 640 Phe Ser Leu Asp Thr Ser Met Ser Met Asn Ser Ser Pro Leu Val Gly 645 650 655 Pro Glu Cys Asp His Pro Lys Ile Lys Pro Ser Ser Ser Ala Asn Ala 660 665 670 Ile Tyr Ser Leu Ala Ala Arg Pro Leu Pro Val Pro Lys Leu Pro Pro 675 680 685 Gly Glu Gln Cys Glu Gly Glu Glu Asp Thr Glu Tyr Met Thr Pro Ser 690 695 700 Ser Arg Pro Leu Arg Pro Leu Asp Thr Ser Gln Ser Ser Arg Ala Cys 705 710 715 720 Asp Cys Asp Gln Gln Ile Asp Ser Cys Thr Tyr Glu Ala Met Tyr Asn 725 730 735 Ile Gln Ser Gln Ala Pro Ser Ile Thr Glu Ser Ser Thr Phe Gly Glu 740 745 750 Gly Asn Leu Ala Ala Ala His Ala Asn Thr Gly Pro Glu Glu Ser Glu 755 760 765 Asn Glu Asp Asp Gly Tyr Asp Val Pro Lys Pro Pro Val Pro Ala Val 770 775 780 Leu Ala Arg Arg Thr Leu Ser Asp Ile Ser Asn Ala Ser Ser Ser

125

Phe

785

800

790

795

Gly Gly Trp Leu Ser Leu 805 Asp Gly Asp Pro Thr 810 Thr Asn Val Thr Glu 815 Ser Gln Val Pro Glu Arg Pro Pro Lys Pro Phe Pro Arg Arg Ile Asn 820 825 830 Ser Glu Arg Lys Ala Gly Ser Cys Gln Gln Gly Ser Gly Pro Ala Ala 835 840 845 Ser Ala Ala Thr Ala Ser Pro Gln Leu Ser Ser Glu Ile Glu Asn Leu 850 855 860 Met Ser Gln Gly Tyr Ser Tyr Gln Asp Ile Gln Lys Ala Leu Val Ile 865 870 875 880 Ala Gln Asn Asn Ile Glu Met Ala Lys Asn Ile Leu Arg Glu Phe Val 885 890 895 Ser Ile Ser Ser Pro Ala His Val Ala Thr 900 905

<210> 58 <211> 465 <212> PRT <213> Homo sapiens <400> 58 Met Ile Glu Val Phe Val Arg Phe Asn Ser Ser His Gly Phe Pro Val 1 5 10 15 Val Asp Ser Asp Thr Ser Ile Phe Gln Leu Lys Glu Val Val Ala Lys 20 25 30 Arg Gln Gly Val Pro Ala Asp Gln Leu Arg Val Ile Phe Ala Gly Lys 35 40 45 Glu Leu Gln Arg Asn Asp Trp Thr Val Gln Asn Cys Asp Leu Asp Gln 50 55 60 Ser Ile Val His Ile Val Gln Arg Pro Trp Arg Lys Gly Gln Glu

126

Met

65 70 75

Asn Glu Ala Thr Gly Gly Asp Asp 85 Pro Arg Asn 90 Ala Ala Gly Gly Cys 95 Arg Glu Pro Gln Ser Leu Thr Arg Val Asp Leu Ser Ser Ser Val Leu 100 105 110 Pro Gly Asp Ser Val Gly Leu Ala Val Ile Leu His Thr Asp Ser Arg 115 120 125 Lys Asp Ser Pro Pro Ala Gly Ser Pro Ala Gly Arg Ser Ile Tyr Asn 130 135 140 Ser Phe Tyr Val Tyr Cys Lys Gly Pro Cys Gln Arg Val Gln Pro Gly 145 150 155 160 Lys Leu Arg Val Gln Cys Ser Thr Cys Arg Gln Ala Thr Leu Thr Leu 165 170 175 Thr Gln Gly Pro Ser Cys Trp Asp Asp Val Leu Ile Pro Asn Arg Met 180 185 190 Ser Gly Glu Cys Gln Ser Pro His Cys Pro Gly Thr Ser Ala Glu Phe 195 200 205 Phe Phe Lys Cys Gly Ala His Pro Thr Ser Asp Lys Glu Thr Ser Val 210 215 220 Ala Leu His Leu Ile Ala Thr Asn Ser Arg Asn Ile Thr Cys Ile Thr 225 230 235 240 Cys Thr Asp Val Arg Ser Pro Val Leu Val Phe Gln Cys Asn Ser Arg 245 250 255 His Val Ile Cys Leu Asp Cys Phe His Leu Tyr Cys Val Thr Arg Leu 260 265 270 Asn Asp Arg Gln Phe Val His Asp Pro Gln Leu Gly Tyr Ser Leu

Pro

127

275 280 285 Cys Val Ala Gly Cys Pro Asn Ser Leu Ile Lys Glu Leu His His Phe 290 295 300 Arg Ile Leu Gly Glu Glu Gln Tyr Asn Arg Tyr Gln Gln Tyr Gly Ala 305 310 315 320 Glu Glu Cys Val Leu Gln Met Gly Gly Val Leu Cys Pro Arg Pro Gly 325 330 335 Cys Gly Ala Gly Leu Leu Pro Glu Pro Asp Gln Arg Lys Val Thr Cys 340 345 350 Glu Gly Gly Asn Gly Leu Gly Cys Gly Phe Ala Phe Cys Arg Glu Cys 355 360 365 Lys Glu Ala Tyr His Glu Gly Glu Cys Ser Ala Val Phe Glu Ala Ser 370 375 380 Gly Thr Thr Thr Gln Ala Tyr Arg Val Asp Glu Arg Ala Ala Glu Gln 385 390 395 400 Ala Arg Trp Glu Ala Ala Ser Lys Glu Thr Ile Lys Lys Thr Thr Lys 405 410 415 Pro Cys Pro Arg Cys His Val Pro Val Glu Lys Asn Gly Gly Cys Met 420 425 430 His Met Lys Cys Pro Gln Pro Gln Cys Arg Leu Glu Trp Cys Trp Asn 435 440 445 Cys Gly Cys Glu Trp Asn Arg Val Cys Met Gly Asp His Trp Phe

Asp

450 455 460

Val

465 <210> 59 <211> 108 <212> PRT <213> Homo sapiens

128 <400> 59

Met Gly 1 Ala Ala Ala Met 5 Asp Val Asp Thr Pro 10 Ser Gly Thr Asn Ser 15 Ala Gly Lys Lys Arg Phe Glu Val Lys Lys Trp Asn Ala Val Ala Leu 20 25 30 Trp Ala Trp Asp Ile Val Val Asp Asn Cys Ala Ile Cys Arg Asn His 35 40 45 Ile Met Asp Leu Cys Ile Glu Cys Gln Ala Asn Gln Ala Ser Ala Thr 50 55 60 Ser Glu Glu Cys Thr Val Ala Trp Gly Val Cys Asn His Ala Phe His 65 70 75 80 Phe His Cys Ile Ser Arg Trp Leu Lys Thr Arg Gln Val Cys Pro Leu 85 90 95 Asp Asn Arg Glu Trp Glu Phe Gln Lys Tyr Gly His 100 105

<210> 60 <211> 501 <212> PRT <213> Homo sapiens <400> 60 Met Ala Gln Ala Ala Ser Val Thr Pro Pro Gly Ser Leu Glu Leu Leu 1 5 10 15 Pro Gly Tyr Phe Ser Lys Thr Leu Leu Gly Thr Lys Leu Glu Ala Lys 20 25 30 Leu Cys Gln Ser Ala Cys Arg Asn Val Leu Arg Arg Pro Phe Gln Ala 35 40 45 Cys Gly Ser His Arg Tyr Cys Ser Phe Cys Leu Ala Ser Ile Leu Ser 50 55 60 Gly Pro Gln Asn Cys Ala Ala Cys Val His Glu Gly Ile Tyr Glu

Glu

65 70 75

129

Gly Ala Ile Ser Ile Leu 85 Glu Ser Ser Ser Ala 90 Phe Pro Asp Asn Ala 95 Arg Arg Glu Val Glu Ser Leu Pro Ala Val Cys Pro Ser Asp Gly Cys 100 105 110 Thr Trp Lys Gly Thr Leu Lys Glu Tyr Glu Ser Cys His Glu Gly Arg 115 120 125 Cys Pro Leu Met Leu Thr Glu Cys Pro Ala Cys Lys Gly Leu Val Arg 130 135 140 Leu Gly Glu Lys Glu Arg His Leu Glu His Glu Cys Pro Glu Arg Ser 145 150 155 160 Leu Ser Cys Arg His Cys Arg Ala Pro Cys Cys Gly Ala Asp Val Lys 165 170 175 Ala His His Glu Val Cys Pro Lys Phe Pro Leu Thr Cys Asp Gly Cys 180 185 190 Gly Lys Lys Lys Ile Pro Arg Glu Lys Phe Gln Asp His Val Lys Thr 195 200 205 Cys Gly Lys Cys Arg Val Pro Cys Arg Phe His Ala Ile Gly Cys Leu 210 215 220 Glu Thr Val Glu Gly Glu Lys Gln Gln Glu His Glu Val Gln Trp Leu 225 230 235 240 Arg Glu His Leu Ala Met Leu Leu Ser Ser Val Leu Glu Ala Lys Pro 245 250 255 Leu Leu Gly Asp Gln Ser His Ala Gly Ser Glu Leu Leu Gln Arg Cys 260 265 270 Glu Ser Leu Glu Lys Lys Thr Ala Thr Phe Glu Asn Ile Val Cys Val 275 280 285

130

Leu Asn Arg Glu Val Glu Arg 295 Val Ala Met Thr Ala 300 Glu Ala Cys Ser 290 Arg Gln His Arg Leu Asp Gln Asp Lys Ile Glu Ala Leu Ser Ser Lys 305 310 315 320 Val Gln Gln Leu Glu Arg Ser Ile Gly Leu Lys Asp Leu Ala Met Ala 325 330 335 Asp Leu Glu Gln Lys Val Leu Glu Met Glu Ala Ser Thr Tyr Asp Gly 340 345 350 Val Phe Ile Trp Lys Ile Ser Asp Phe Ala Arg Lys Arg Gln Glu Ala 355 360 365 Val Ala Gly Arg Ile Pro Ala Ile Phe Ser Pro Ala Phe Tyr Thr Ser 370 375 380 Arg Tyr Gly Tyr Lys Met Cys Leu Arg Ile Tyr Leu Asn Gly Asp Gly 385 390 395 400 Thr Gly Arg Gly Thr His Leu Ser Leu Phe Phe Val Val Met Lys Gly 405 410 415 Pro Asn Asp Ala Leu Leu Arg Trp Pro Phe Asn Gln Lys Val Thr Leu 420 425 430 Met Leu Leu Asp Gln Asn Asn Arg Glu His Val Ile Asp Ala Phe Arg 435 440 445 Pro Asp Val Thr Ser Ser Ser Phe Gln Arg Pro Val Asn Asp Met Asn 450 455 460 Ile Ala Ser Gly Cys Pro Leu Phe Cys Pro Val Ser Lys Met Glu Ala 465 470 475 480 Lys Asn Ser Tyr Val Arg Asp Asp Ala Ile Phe Ile Lys Ala Ile Val 485 490 495

Asp Leu Thr Gly Leu

131

500 <210> 61 <211> 491 <212> PRT

<213> Homo sapiens <400> 61 Met Cys Asn Thr Asn Met Ser Val Pro Thr Asp Gly Ala Val Thr Thr 1 5 10 15 Ser Gln Ile Pro Ala Ser Glu Gln Glu Thr Leu Val Arg Pro Lys Pro 20 25 30 Leu Leu Leu Lys Leu Leu Lys Ser Val Gly Ala Gln Lys Asp Thr Tyr 35 40 45 Thr Met Lys Glu Val Leu Phe Tyr Leu Gly Gln Tyr Ile Met Thr Lys 50 55 60 Arg Leu Tyr Asp Glu Lys Gln Gln His Ile Val Tyr Cys Ser Asn Asp 65 70 75 80 Leu Leu Gly Asp Leu Phe Gly Val Pro Ser Phe Ser Val Lys Glu His 85 90 95 Arg Lys Ile Tyr Thr Met Ile Tyr Arg Asn Leu Val Val Val Asn Gln 100 105 110 Gln Glu Ser Ser Asp Ser Gly Thr Ser Val Ser Glu Asn Arg Cys His 115 120 125 Leu Glu Gly Gly Ser Asp Gln Lys Asp Leu Val Gln Glu Leu Gln Glu 130 135 140 Glu Lys Pro Ser Ser Ser His Leu Val Ser Arg Pro Ser Thr Ser Ser 145 150 155 160 Arg Arg Arg Ala Ile Ser Glu Thr Glu Glu Asn Ser Asp Glu Leu Ser 165 170 175 Gly Glu Arg Gln Arg Lys Arg His Lys Ser Asp Ser Ile Ser Leu

132

Ser

180 185 190 Phe Asp Glu Ser Leu Ala Leu Cys Val Ile Arg Glu Ile Cys Cys Glu 195 200 205 Arg Ser Ser Ser Ser Glu Ser Thr Gly Thr Pro Ser Asn Pro Asp Leu 210 215 220 Asp Ala Gly Val Ser Glu His Ser Gly Asp Trp Leu Asp Gln Asp Ser 225 230 235 240 Val Ser Asp Gln Phe Ser Val Glu Phe Glu Val Glu Ser Leu Asp Ser 245 250 255 Glu Asp Tyr Ser Leu Ser Glu Glu Gly Gln Glu Leu Ser Asp Glu Asp 260 265 270 Asp Glu Val Tyr Gln Val Thr Val Tyr Gln Ala Gly Glu Ser Asp Thr 275 280 285 Asp Ser Phe Glu Glu Asp Pro Glu Ile Ser Leu Ala Asp Tyr Trp Lys 290 295 300 Cys Thr Ser Cys Asn Glu Met Asn Pro Pro Leu Pro Ser His Cys Asn 305 310 315 320 Arg Cys Trp Ala Leu Arg Glu Asn Trp Leu Pro Glu Asp Lys Gly Lys 325 330 335 Asp Lys Gly Glu Ile Ser Glu Lys Ala Lys Leu Glu Asn Ser Thr Gln 340 345 350 Ala Glu Glu Gly Phe Asp Val Pro Asp Cys Lys Lys Thr Ile Val Asn 355 360 365 Asp Ser Arg Glu Ser Cys Val Glu Glu Asn Asp Asp Lys Ile Thr Gln 370 375 380 Ala Ser Gln Ser Gln Glu Ser Glu Asp Tyr Ser Gln Pro Ser Thr

Ser

385 390 395

133

400

Ser Arg Ser Ile Ile Tyr 405 Ser Ser Gln Glu Asp 410 Val Lys Glu Phe Glu 415 Glu Glu Thr Gln Asp Lys Glu Glu Ser Val Glu Ser Ser Leu Pro Leu 420 425 430 Asn Ala Ile Glu Pro Cys Val Ile Cys Gln Gly Arg Pro Lys Asn Gly 435 440 445 Cys Ile Val His Gly Lys Thr Gly His Leu Met Ala Cys Phe Thr Cys 450 455 460 Ala Lys Lys Leu Lys Lys Arg Asn Lys Pro Cys Pro Val Cys Arg Gln 465 470 475 480 Pro Ile Gln Met Ile Val Leu Thr Tyr Phe Pro 485 490

<210> 62 <211> 240 <212> PRT <213> Renilla reniformis

<400> 62 Ser Lys Val 5 Tyr Asp Pro Glu Gln 10 Arg Lys Arg Met Ile 15 Met Thr 1 Thr Gly Pro Gln Trp Trp Ala Arg Cys Lys Gln Met Asn Val Leu Asp Ser 20 25 30 Phe Ile Asn Tyr Tyr Asp Ser Glu Lys His Ala Glu Asn Ala Val Ile 35 40 45 Phe Leu His Gly Asn Ala Ala Ser Ser Tyr Leu Trp Arg His Val Val 50 55 60 Pro His Ile Glu Pro Val Ala Arg Cys Ile Ile Pro Asp Leu Ile Gly 65 70 75 80 Met Gly Lys Ser Gly Lys Ser Gly Asn Gly Ser Tyr Arg Leu Leu Asp

134

His Lys Tyr Lys Tyr 100 Leu Thr Ala Trp Phe 105 Glu Leu Leu Asn Leu 110 Pro Lys Ile Ile Phe Val Gly His Asp Trp Gly Ala Cys Leu Ala Phe His 115 120 125 Tyr Ser Tyr Glu His Gln Asp Lys Ile Lys Ala Ile Val His Ala Glu 130 135 140 Ser Val Val Asp Val Ile Glu Ser Trp Asp Glu Trp Pro Asp Ile Glu 145 150 155 160 Glu Asp Ile Ala Leu Ile Lys Ser Glu Glu Gly Glu Lys Met Val Leu 165 170 175 Glu Asn Asn Phe Phe Val Glu Thr Met Leu Pro Ser Lys Ile Met Arg 180 185 190 Lys Leu Glu Pro Glu Glu Phe Ala Ala Tyr Leu Glu Pro Phe Lys Glu 195 200 205 Lys Gly Glu Val Arg Arg Pro Thr Leu Ser Trp Pro Arg Glu Ile Pro 210 215 220 Leu Val Lys Gly Gly Lys Pro Asp Val Val Gln Ile Val Arg Asn Tyr 225 230 235

240 <210> 63 <211> 320 <212> PRT <213> Homo sapiens

<400> 63 Leu Leu Ser 5 Pro Pro Leu Arg Asp 10 Val Asp Leu Thr Ala 15 Met Pro 1 Glu Asp Gly Ser Leu Cys Ser Phe Ala Thr Thr Asp Asp Phe Tyr Asp Asp 20 25 30 Pro Cys Phe Asp Ser Pro Asp Leu Arg Phe Phe Glu Asp Leu Asp

135

Pro

Arg His Leu 50 Met His Val Gly Ala 55 Leu Leu Lys Pro Glu 60 Glu His Ser Phe Pro Ala Ala Val His Pro Ala Pro Gly Ala Arg Glu Asp Glu His 65 70 75 80 Val Arg Ala Pro Ser Gly His His Gln Ala Gly Arg Cys Leu Leu Trp 85 90 95 Ala Cys Lys Ala Cys Lys Arg Lys Thr Thr Asn Ala Asp Arg Arg Lys 100 105 110 Ala Ala Thr Met Arg Glu Arg Arg Arg Leu Ser Lys Val Asn Glu Ala 115 120 125 Phe Glu Thr Leu Lys Arg Cys Thr Ser Ser Asn Pro Asn Gln Arg Leu 130 135 140 Pro Lys Val Glu Ile Leu Arg Asn Ala Ile Arg Tyr Ile Glu Gly Leu 145 150 155 160 Gln Ala Leu Leu Arg Asp Gln Asp Ala Ala Pro Pro Gly Ala Ala Ala 165 170 175 Ala Phe Tyr Ala Pro Gly Pro Leu Pro Pro Gly Arg Gly Gly Glu His 180 185 190 Tyr Ser Gly Asp Ser Asp Ala Ser Ser Pro Arg Ser Asn Cys Ser Asp 195 200 205 Gly Met Met Asp Tyr Ser Gly Pro Pro Ser Gly Ala Arg Arg Arg Asn 210 215 220 Cys Tyr Glu Gly Ala Tyr Tyr Asn Glu Ala Pro Ser Glu Pro Arg Pro 225 230 235 240 Gly Lys Ser Ala Ala Val Ser Ser Leu Asp Cys Leu Ser Ser Ile Val

136

245

250

255

Glu Ala Arg Ile Ser 260 Thr Glu Ser Pro Ala 265 Ala Pro Ala Leu Leu 270 Leu Asp Val Pro Ser Glu Ser Pro Pro Arg Arg Gln Glu Ala Ala Ala Pro 275 280 285 Ser Glu Gly Glu Ser Ser Gly Asp Pro Thr Gln Ser Pro Asp Ala Ala 290 295 300 Pro Gln Cys Pro Ala Gly Ala Asn Pro Asn Pro Ile Tyr Gln Val Leu 305 310 315

320 <210> 64 <211> 607 <212> PRT <213> Homo sapiens

<400> 64 Glu Lys Arg 5 Arg Gly Ser Pro Cys 10 Ser Met Leu Ser Leu 15 Met Lys 1 Ala Ala His Ala Phe Ser Val Glu Ala Leu Ile Gly Ala Glu Lys Gln Gln 20 25 30 Gln Leu Gln Lys Lys Arg Arg Lys Leu Gly Ala Glu Glu Ala Ala Gly 35 40 45 Ala Val Asp Asp Gly Gly Cys Ser Arg Gly Gly Gly Ala Gly Glu Lys 50 55 60 Gly Ser Ser Glu Gly Asp Glu Gly Ala Ala Leu Pro Pro Pro Ala Gly 65 70 75 80 Ala Thr Ser Gly Pro Ala Arg Ser Gly Ala Asp Leu Glu Arg Gly Ala 85 90 95 Ala Gly Gly Cys Glu Asp Gly Phe Gln Gln Gly Ala Ser Pro Leu Ala 100 105 110 Ser Pro Gly Gly Ser Pro Lys Gly Ser Pro Ala Arg Ser Leu Ala

137

Arg

115 120 125 Pro Gly Thr Pro Leu Pro Ser Pro Gln Ala Pro Arg Val Asp Leu Gln 130 135 140 Gly Ala Glu Leu Trp Lys Arg Phe His Glu Ile Gly Thr Glu Met Ile 145 150 155 160 Ile Thr Lys Ala Gly Arg Arg Met Phe Pro Ala Met Arg Val Lys Ile 165 170 175 Ser Gly Leu Asp Pro His Gln Gln Tyr Tyr Ile Ala Met Asp Ile Val 180 185 190 Pro Val Asp Asn Lys Arg Tyr Arg Tyr Val Tyr His Ser Ser Lys Trp 195 200 205 Met Val Ala Gly Asn Ala Asp Ser Pro Val Pro Pro Arg Val Tyr Ile 210 215 220 His Pro Asp Ser Pro Ala Ser Gly Glu Thr Trp Met Arg Gln Val Ile 225 230 235 240 Ser Phe Asp Lys Leu Lys Leu Thr Asn Asn Glu Leu Asp Asp Gln Gly 245 250 255 His Ile Ile Leu His Ser Met His Lys Tyr Gln Pro Arg Val His Val 260 265 270 Ile Arg Lys Asp Cys Gly Asp Asp Leu Ser Pro Ile Lys Pro Val Pro 275 280 285 Ser Gly Glu Gly Val Lys Ala Phe Ser Phe Pro Glu Thr Val Phe Thr 290 295 300 Thr Val Thr Ala Tyr Gln Asn Gln Gln Ile Thr Arg Leu Lys Ile Asp 305 310 315 320 Arg Asn Pro Phe Ala Lys Gly Phe Arg Asp Ser Gly Arg Asn Arg Met

138

325

330

335

Gly Leu Leu Glu Ala 340 Leu Val Glu Ser Tyr 345 Ala Phe Trp Arg Pro 350 Ser Arg Thr Leu Thr Phe Glu Asp Ile Pro Gly Ile Pro Lys Gln Gly Asn 355 360 365 Ala Ser Ser Ser Thr Leu Leu Gln Gly Thr Gly Asn Gly Val Pro Ala 370 375 380 Thr His Pro His Leu Leu Ser Gly Ser Ser Cys Ser Ser Pro Ala Phe 385 390 395 400 His Leu Gly Pro Asn Thr Ser Gln Leu Cys Ser Leu Ala Pro Ala Asp 405 410 415 Tyr Ser Ala Cys Ala Arg Ser Gly Leu Thr Leu Asn Arg Tyr Ser Thr 420 425 430 Ser Leu Ala Glu Thr Tyr Asn Arg Leu Thr Asn Gln Ala Gly Glu Thr 435 440 445 Phe Ala Pro Pro Arg Thr Pro Ser Tyr Val Gly Val Ser Ser Ser Thr 450 455 460 Ser Val Asn Met Ser Met Gly Gly Thr Asp Gly Asp Thr Phe Ser Cys 465 470 475 480 Pro Gln Thr Ser Leu Ser Met Gln Ile Ser Gly Met Ser Pro Gln Leu 485 490 495 Gln Tyr Ile Met Pro Ser Pro Ser Ser Asn Ala Phe Ala Thr Asn Gln 500 505 510 Thr His Gln Gly Ser Tyr Asn Thr Phe Arg Leu His Ser Pro Cys Ala 515 520 525 Leu Tyr Gly Tyr Asn Phe Ser Thr Ser Pro Lys Leu Ala Ala Ser

Pro

530 535 540

139

Glu Ser 545 560 Lys Ile Val Ser Ser 550 Gln Gly Ser Phe Leu 555 Gly Ser Ser Pro Gly Thr Met Thr Asp Arg Gln Met Leu Pro Pro Val Glu Gly Val His 565 570 575 Leu Leu Ser Ser Gly Gly Gln Gln Ser Phe Phe Asp Ser Arg Thr Leu 580 585 590 Gly Ser Leu Thr Leu Ser Ser Ser Gln Val Ser Ala His Met Val 595 600 605

<210> 65 <211> 393 <212> PRT <213> Homo sapiens

<400> 65 Glu Pro Gln 5 Ser Asp Pro Ser Val 10 Glu Pro Pro Leu Ser 15 Met Gln 1 Glu Glu Thr Phe Ser Asp Leu Trp Lys Leu Leu Pro Glu Asn Asn Val Leu 20 25 30 Ser Pro Leu Pro Ser Gln Ala Met Asp Asp Leu Met Leu Ser Pro Asp 35 40 45 Asp Ile Glu Gln Trp Phe Thr Glu Asp Pro Gly Pro Asp Glu Ala Pro 50 55 60 Arg Met Pro Glu Ala Ala Pro Pro Val Ala Pro Ala Pro Ala Ala Pro 65 70 75 80 Thr Pro Ala Ala Pro Ala Pro Ala Pro Ser Trp Pro Leu Ser Ser Ser 85 90 95 Val Pro Ser Gln Lys Thr Tyr Gln Gly Ser Tyr Gly Phe Arg Leu Gly 100 105 110 Phe Leu His Ser Gly Thr Ala Lys Ser Val Thr Cys Thr Tyr Ser Pro

140

115

120

125

Ala Gln Leu 130 Asn Lys Met Phe Cys 135 Gln Leu Ala Lys Thr 140 Cys Pro Val Leu Trp Val Asp Ser Thr Pro Pro Pro Gly Thr Arg Val Arg Ala Met 145 150 155 160 Ala Ile Tyr Lys Gln Ser Gln His Met Thr Glu Val Val Arg Arg Cys 165 170 175 Pro His His Glu Arg Cys Ser Asp Ser Asp Gly Leu Ala Pro Pro Gln 180 185 190 His Leu Ile Arg Val Glu Gly Asn Leu Arg Val Glu Tyr Leu Asp Asp 195 200 205 Arg Asn Thr Phe Arg His Ser Val Val Val Pro Tyr Glu Pro Pro Glu 210 215 220 Val Gly Ser Asp Cys Thr Thr Ile His Tyr Asn Tyr Met Cys Asn Ser 225 230 235 240 Ser Cys Met Gly Gly Met Asn Arg Arg Pro Ile Leu Thr Ile Ile Thr 245 250 255 Leu Glu Asp Ser Ser Gly Asn Leu Leu Gly Arg Asn Ser Phe Glu Val 260 265 270 Arg Val Cys Ala Cys Pro Gly Arg Asp Arg Arg Thr Glu Glu Glu Asn 275 280 285 Leu Arg Lys Lys Gly Glu Pro His His Glu Leu Pro Pro Gly Ser Thr 290 295 300 Lys Arg Ala Leu Pro Asn Asn Thr Ser Ser Ser Pro Gln Pro Lys Lys 305 310 315 320 Lys Pro Leu Asp Gly Glu Tyr Phe Thr Leu Gln Ile Arg Gly Arg Glu 325 330 335

141

Arg Asp Phe Glu Met 340 Phe Arg Glu Ala Gln Ala Gly Lys Glu Pro His 355 Leu Lys Ser Lys Lys Gly Gln Met 370 375 Phe Lys Thr Glu Gly Pro Asp 385 390

Ser Asp

Leu Asn 345 Glu Ala Leu Glu Leu 350 Lys Gly Gly Ser Arg Ala His Ser Ser 360 365 Ser Thr Ser Arg His Lys Lys Leu

380

<210> 66 <211> 215 <212> PRT <213> Homo sapiens <400> 66 Met Gly Lys Gly Asp Pro Lys Tyr 1 5 Ala Phe Phe Val Gln Thr Cys Pro 20 Asp Ala Ser Val Asn Phe Ser Arg 35 Trp Lys Thr Met Ser Ala Lys Ala 50 55 Lys Ala Asp Lys Ala Arg Tyr Pro 65 70 80 Pro Lys Gly Glu Thr Lys Lys Lys 85 Arg Pro Pro Ser Ala Phe Phe Lys 100 Ile Lys Gly Glu His Pro Gly Lys 115

Lys Pro Arg 10 Gly Lys Met Ser Ser 15 Arg Glu Glu His Lys Lys Lys His 25 30 Glu Phe Ser Lys Lys Cys Ser Glu 40 45 Glu Lys Gly Lys Phe Glu Asp Met 60 Glu Arg Glu Met Lys Thr Tyr Ile 75 Lys Phe Lys Asp Pro Asn Ala Pro 90 95 Leu Phe Cys Ser Glu Tyr Arg Pro 105 110 Leu Ser Ile Gly Asp Val Ala Lys 120 125

142

Leu Gly Tyr

130

Glu Lys

Ala

145

160

Ala Tyr Val

Lys Ala Glu

Asp Glu Glu

Glu Glu 210

Glu Met Trp Asn Asn Thr Ala Ala Asp Asp Lys Gln Pro 135 140 Lys Ala Ala Lys Leu Lys Glu Lys Tyr Glu Lys Asp Ile 150 155 Arg Ala Lys Gly Lys Pro Asp Ala Ala Lys Lys Gly Val 165 170 175 Glu Lys Ser Lys Lys Lys Lys Glu Glu Glu Glu Asp Glu 180 185 190 Glu Asp Glu Glu Glu Glu Glu Asp Glu Glu Asp Glu Asp 195 200 205 Asp Asp Asp Asp Glu

<210>

<211>

<212>

<213>

<400> Met Thr Pro

Gln Gly Glu

215

356

PRT

Homo sapiens

Glu His Ala

Glu Glu Glu

Asp Leu Lys

Pro Lys Leu

67 Lys Ser Tyr Ser Glu Ser Gly Leu Met Gly Glu Pro Gln 5 10 15 Pro Pro Ser Trp Thr Asp Glu Cys Leu Ser Ser Gln Asp 20 25 30 Glu Ala Asp Lys Lys Glu Asp Asp Leu Glu Thr Met Asn 35 40 45 Asp Ser Leu Arg Asn Gly Gly Glu Glu Glu Asp Glu Asp 55 60 Glu Glu Glu Glu Glu Glu Glu Glu Glu Asp Asp Asp Gln 70 75 Arg Arg Gly Pro Lys Lys Lys Lys Met Thr Lys Ala Arg 85 90 95

143

Glu

Asn

Arg

Val

Pro

Arg

Leu

Gly

145

160

Lys

Leu

Arg Phe Lys Leu Arg Arg Met Lys Ala Asn Ala Arg Glu Arg

100 105 110

Met His Gly Leu Asn Ala Ala Leu Asp Asn Leu Arg Lys Val

115 120 125

Cys Tyr Ser Lys Thr Gln Lys Leu Ser Lys Ile Glu Thr Leu 130 135 140

Ala Lys Asn Tyr Ile Trp Ala Leu Ser Glu Ile Leu Arg Ser 150 155

Ser

Pro

Arg

Pro

Thr

Pro

Gly

Phe

225

240

His

Phe

Pro

Leu

Glu

Pro

Ala

Gly

Ser Pro Asp Leu 165 Val Ser Phe Val Gln 170 Thr Leu Cys Lys Gly 175 Gln Pro Thr Thr Asn Leu Val Ala Gly Cys Leu Gln Leu Asn 180 185 190 Thr Phe Leu Pro Glu Gln Asn Gln Asp Met Pro Pro His Leu 195 200 205 Ala Ser Ala Ser Phe Pro Val His Pro Tyr Ser Tyr Gln Ser 210 215 220 Leu Pro Ser Pro Pro Tyr Gly Thr Met Asp Ser Ser His Val 230 235 Val Lys Pro Pro Pro His Ala Tyr Ser Ala Ala Leu Glu Pro 245 250 255 Glu Ser Pro Leu Thr Asp Cys Thr Ser Pro Ser Phe Asp Gly 260 265 270 Ser Pro Pro Leu Ser Ile Asn Gly Asn Phe Ser Phe Lys His 275 280 285 Ser Ala Glu Phe Glu Lys Asn Tyr Ala Phe Thr Met His Tyr 290 295 300 Ala Thr Leu Ala Gly Ala Gln Ser His Gly Ser Ile Phe Ser

144

305

320

310

315

Thr Phe Ala Ala Pro Arg 325 Cys Glu Ile Pro Ile 330 Asp Asn Ile Met Ser 335 Asp Ser His Ser His His Glu Arg Val Met Ser Ala Gln Leu Asn Ala 340 345 350

Ile Phe His Asp 355 <210> 68 <211> 498 <212> PRT <213> Homo sapiens

<400> 68 Gln Ser Ile 5 Pro Val Ala Pro Thr 10 Pro Pro Arg Arg Val 15 Met Arg 1 Asn Leu Lys Pro Trp Leu Val Ala Gln Val Asn Ser Cys Gln Tyr Pro Gly 20 25 30 Leu Gln Trp Val Asn Gly Glu Lys Lys Leu Phe Cys Ile Pro Trp Arg 35 40 45 His Ala Thr Arg His Gly Pro Ser Gln Asp Gly Asp Asn Thr Ile Phe 50 55 60 Lys Ala Trp Ala Lys Glu Thr Gly Lys Tyr Thr Glu Gly Val Asp Glu 65 70 75 80 Ala Asp Pro Ala Lys Trp Lys Ala Asn Leu Arg Cys Ala Leu Asn Lys 85 90 95 Ser Arg Asp Phe Arg Leu Ile Tyr Asp Gly Pro Arg Asp Met Pro Pro 100 105 110 Gln Pro Tyr Lys Ile Tyr Glu Val Cys Ser Asn Gly Pro Ala Pro Thr 115 120 125 Asp Ser Gln Pro Pro Glu Asp Tyr Ser Phe Gly Ala Gly Glu Glu Glu

145

130 135 140

Glu Thr 145 160 Glu Glu Glu Glu Leu 150 Gln Arg Met Leu Pro 155 Ser Leu Ser Leu Glu Asp Val Lys Trp Pro Pro Thr Leu Gln Pro Pro Thr Leu Arg Pro 165 170 175 Pro Thr Leu Gln Pro Pro Thr Leu Gln Pro Pro Val Val Leu Gly Pro 180 185 190 Pro Ala Pro Asp Pro Ser Pro Leu Ala Pro Pro Pro Gly Asn Pro Ala 195 200 205 Gly Phe Arg Glu Leu Leu Ser Glu Val Leu Glu Pro Gly Pro Leu Pro 210 215 220 Ala Ser Leu Pro Pro Ala Gly Glu Gln Leu Leu Pro Asp Leu Leu Ile 225 230 235 240 Ser Pro His Met Leu Pro Leu Thr Asp Leu Glu Ile Lys Phe Gln Tyr 245 250 255 Arg Gly Arg Pro Pro Arg Ala Leu Thr Ile Ser Asn Pro His Gly Cys 260 265 270 Arg Leu Phe Tyr Ser Gln Leu Glu Ala Thr Gln Glu Gln Val Glu Leu 275 280 285 Phe Gly Pro Ile Ser Leu Glu Gln Val Arg Phe Pro Ser Pro Glu Asp 290 295 300 Ile Pro Ser Asp Lys Gln Arg Phe Tyr Thr Asn Gln Leu Leu Asp Val 305 310 315 320 Leu Asp Arg Gly Leu Ile Leu Gln Leu Gln Gly Gln Asp Leu Tyr Ala 325 330 335 Ile Arg Leu Cys Gln Cys Lys Val Phe Trp Ser Gly Pro Cys Ala Ser 340 345 350

146

Ala Lys His Asp 355 Ser Cys Pro Asn Pro 360 Ile Gln Arg Glu Val 365 Lys Thr Leu Phe Ser Leu Glu His Phe Leu Asn Glu Leu Ile Leu Phe Gln Lys 370 375 380 Gly Gln Thr Asn Thr Pro Pro Pro Phe Glu Ile Phe Phe Cys Phe Gly 385 390 395 400 Glu Glu Trp Pro Asp Arg Lys Pro Arg Glu Lys Lys Leu Ile Thr Val 405 410 415 Gln Val Val Pro Val Ala Ala Arg Leu Leu Leu Glu Met Phe Ser Gly 420 425 430 Glu Leu Ser Trp Ser Ala Asp Ser Ile Arg Leu Gln Ile Ser Asn Pro 435 440 445 Asp Leu Lys Asp Arg Met Val Glu Gln Phe Lys Glu Leu His His Ile 450 455 460 Trp Gln Ser Gln Gln Arg Leu Gln Pro Val Ala Gln Ala Pro Pro Gly 465 470 475 480 Ala Gly Leu Gly Val Gly Gln Gly Pro Trp Pro Met His Pro Ala Gly 485 490 495 Met Gln

<210> 69 <211> 427 <212> PRT <213> Homo sapiens <400> 69 Met Gly Thr Pro Lys Pro Arg Ile Leu Pro Trp Leu Val Ser Gln Leu 1 5 10 15 Asp Leu Gly Gln Leu Glu Gly Val Ala Trp Val Asn Lys Ser Arg

Thr

20 25 30

147

Arg Gln Phe Arg 35 Ile Pro Trp Lys His 40 Gly Leu Arg Gln Asp 45 Ala Gln Glu Asp Phe Gly Ile Phe Gln Ala Trp Ala Glu Ala Thr Gly Ala Tyr 50 55 60 Val Pro Gly Arg Asp Lys Pro Asp Leu Pro Thr Trp Lys Arg Asn Phe 65 70 75 80 Arg Ser Ala Leu Asn Arg Lys Glu Gly Leu Arg Leu Ala Glu Asp Arg 85 90 95 Ser Lys Asp Pro His Asp Pro His Lys Ile Tyr Glu Phe Val Asn Ser 100 105 110 Gly Val Gly Asp Phe Ser Gln Pro Asp Thr Ser Pro Asp Thr Asn Gly 115 120 125 Gly Gly Ser Thr Ser Asp Thr Gln Glu Asp Ile Leu Asp Glu Leu Leu 130 135 140 Gly Asn Met Val Leu Ala Pro Leu Pro Asp Pro Gly Pro Pro Ser Leu 145 150 155 160 Ala Val Ala Pro Glu Pro Cys Pro Gln Pro Leu Arg Ser Pro Ser Leu 165 170 175 Asp Asn Pro Thr Pro Phe Pro Asn Leu Gly Pro Ser Glu Asn Pro Leu 180 185 190 Lys Arg Leu Leu Val Pro Gly Glu Glu Trp Glu Phe Glu Val Thr Ala 195 200 205 Phe Tyr Arg Gly Arg Gln Val Phe Gln Gln Thr Ile Ser Cys Pro Glu 210 215 220 Gly Leu Arg Leu Val Gly Ser Glu Val Gly Asp Arg Thr Leu Pro

Gly

225 230 235

240

148

Trp Gly Pro Val Thr Leu 245 Pro Asp Pro Gly Met 250 Ser Leu Thr Asp Arg 255 Val Met Ser Tyr Val Arg His Val Leu Ser Cys Leu Gly Gly Gly Leu 260 265 270 Ala Leu Trp Arg Ala Gly Gln Trp Leu Trp Ala Gln Arg Leu Gly His 275 280 285 Cys His Thr Tyr Trp Ala Val Ser Glu Glu Leu Leu Pro Asn Ser Gly 290 295 300 His Gly Pro Asp Gly Glu Val Pro Lys Asp Lys Glu Gly Gly Val Phe 305 310 315 320 Asp Leu Gly Pro Phe Ile Val Asp Leu Ile Thr Phe Thr Glu Gly Ser 325 330 335 Gly Arg Ser Pro Arg Tyr Ala Leu Trp Phe Cys Val Gly Glu Ser Trp 340 345 350 Pro Gln Asp Gln Pro Trp Thr Lys Arg Leu Val Met Val Lys Val Val 355 360 365 Pro Thr Cys Leu Arg Ala Leu Val Glu Met Ala Arg Val Gly Gly Ala 370 375 380 Ser Ser Leu Glu Asn Thr Val Asp Leu His Ile Ser Asn Ser His Pro 385 390 395 400 Leu Ser Leu Thr Ser Asp Gln Tyr Lys Ala Tyr Leu Gln Asp Leu Val 405 410 415 Glu Gly Met Asp Phe Gln Gly Pro Gly Glu Ser 420 425

<210> 70 <211> 750 <212> PRT <213> Homo sapiens <400> 70

149

Met Glu 1 Ser Gln Trp Tyr 5 Glu Leu Gln Gln Leu 10 Asp Ser Lys Phe Leu 15 Gln Val His Gln Leu Tyr Asp Asp Ser Phe Pro Met Glu Ile Arg Gln 20 25 30 Tyr Leu Ala Gln Trp Leu Glu Lys Gln Asp Trp Glu His Ala Ala Asn 35 40 45 Asp Val Ser Phe Ala Thr Ile Arg Phe His Asp Leu Leu Ser Gln Leu 50 55 60 Asp Asp Gln Tyr Ser Arg Phe Ser Leu Glu Asn Asn Phe Leu Leu Gln 65 70 75 80 His Asn Ile Arg Lys Ser Lys Arg Asn Leu Gln Asp Asn Phe Gln Glu 85 90 95 Asp Pro Ile Gln Met Ser Met Ile Ile Tyr Ser Cys Leu Lys Glu Glu 100 105 110 Arg Lys Ile Leu Glu Asn Ala Gln Arg Phe Asn Gln Ala Gln Ser Gly 115 120 125 Asn Ile Gln Ser Thr Val Met Leu Asp Lys Gln Lys Glu Leu Asp Ser 130 135 140 Lys Val Arg Asn Val Lys Asp Lys Val Met Cys Ile Glu His Glu Ile 145 150 155 160 Lys Ser Leu Glu Asp Leu Gln Asp Glu Tyr Asp Phe Lys Cys Lys Thr 165 170 175 Leu Gln Asn Arg Glu His Glu Thr Asn Gly Val Ala Lys Ser Asp Gln 180 185 190 Lys Gln Glu Gln Leu Leu Leu Lys Lys Met Tyr Leu Met Leu Asp Asn 195 200 205 Lys Arg Lys Glu Val Val His Lys Ile Ile Glu Leu Leu Asn Val Thr

150

210 215 220

Glu Lys 225 240 Leu Thr Gln Asn Ala 230 Leu Ile Asn Asp Glu 235 Leu Val Glu Trp Arg Arg Gln Gln Ser Ala Cys Ile Gly Gly Pro Pro Asn Ala Cys Leu 245 250 255 Asp Gln Leu Gln Asn Trp Phe Thr Ile Val Ala Glu Ser Leu Gln Gln 260 265 270 Val Arg Gln Gln Leu Lys Lys Leu Glu Glu Leu Glu Gln Lys Tyr Thr 275 280 285 Tyr Glu His Asp Pro Ile Thr Lys Asn Lys Gln Val Leu Trp Asp Arg 290 295 300 Thr Phe Ser Leu Phe Gln Gln Leu Ile Gln Ser Ser Phe Val Val Glu 305 310 315 320 Arg Gln Pro Cys Met Pro Thr His Pro Gln Arg Pro Leu Val Leu Lys 325 330 335 Thr Gly Val Gln Phe Thr Val Lys Leu Arg Leu Leu Val Lys Leu Gln 340 345 350 Glu Leu Asn Tyr Asn Leu Lys Val Lys Val Leu Phe Asp Lys Asp Val 355 360 365 Asn Glu Arg Asn Thr Val Lys Gly Phe Arg Lys Phe Asn Ile Leu Gly 370 375 380 Thr His Thr Lys Val Met Asn Met Glu Glu Ser Thr Asn Gly Ser Leu 385 390 395 400 Ala Ala Glu Phe Arg His Leu Gln Leu Lys Glu Gln Lys Asn Ala Gly 405 410 415 Thr Arg Thr Asn Glu Gly Pro Leu Ile Val Thr Glu Glu Leu His Ser 420 425 430

151

Leu Leu Ser Phe 435 Glu Thr Gln Leu Cys 440 Gln Pro Gly Leu Val 445 Ile Asp Glu Thr Thr Ser Leu Pro Val Val Val Ile Ser Asn Val Ser Gln Leu 450 455 460 Pro Ser Gly Trp Ala Ser Ile Leu Trp Tyr Asn Met Leu Val Ala Glu 465 470 475 480 Pro Arg Asn Leu Ser Phe Phe Leu Thr Pro Pro Cys Ala Arg Trp Ala 485 490 495 Gln Leu Ser Glu Val Leu Ser Trp Gln Phe Ser Ser Val Thr Lys Arg 500 505 510 Gly Leu Asn Val Asp Gln Leu Asn Met Leu Gly Glu Lys Leu Leu Gly 515 520 525 Pro Asn Ala Ser Pro Asp Gly Leu Ile Pro Trp Thr Arg Phe Cys Lys 530 535 540 Glu Asn Ile Asn Asp Lys Asn Phe Pro Phe Trp Leu Trp Ile Glu Ser 545 550 555 560 Ile Leu Glu Leu Ile Lys Lys His Leu Leu Pro Leu Trp Asn Asp Gly 565 570 575 Cys Ile Met Gly Phe Ile Ser Lys Glu Arg Glu Arg Ala Leu Leu Lys 580 585 590 Asp Gln Gln Pro Gly Thr Phe Leu Leu Arg Phe Ser Glu Ser Ser Arg 595 600 605 Glu Gly Ala Ile Thr Phe Thr Trp Val Glu Arg Ser Gln Asn Gly Gly 610 615 620 Glu Pro Asp Phe His Ala Val Glu Pro Tyr Thr Lys Lys Glu Leu

Ser

625 630 635

640

152

Ala Ala Val Thr Phe Pro 645 Asp Ile Ile Arg Asn 650 Tyr Lys Val Met Glu Asn Ile Pro Glu Asn Pro Leu Lys Tyr Leu Tyr Pro Asn Asp 660 665 670 Lys Asp His Ala Phe Gly Lys Tyr Tyr Ser Arg Pro Lys Glu Pro 675 680 685 Glu Pro Met Glu Leu Asp Gly Pro Lys Gly Thr Gly Tyr Ile Thr 690 695 700 Glu Leu Ile Ser Val Ser Glu Val His Pro Ser Arg Leu Gln Thr 705 710 715 720 Asp Asn Leu Leu Pro Met Ser Pro Glu Glu Phe Asp Glu Val Arg 725 730 Ile Val Gly Ser Val Glu Phe Asp Ser Met Met Asn Thr Val 740 745 750

Ala

655

Ile

Ala

Lys

Thr

Ser

735

<210> 71 <211> 225 <212> PRT <213> Homo sapiens <400> 71 Met Val Leu Thr His Ser Lys Phe Pro Ala Ala Gly Met Ser Arg 1 5 10 Asp Thr Gln Ser Leu Arg Leu Lys Thr Phe Ser Ser Lys Ser Glu 20 25 30 Leu Val Val Asn Ala Val Arg Lys Leu Gln Glu Ser Gly Phe Trp 35 40 45 Ser Ala Pro Val Thr Gly Gly Glu Ala Asn Leu Leu Leu Ser Ala 50 55 60 Ala Gly Phe Thr Phe Leu Ile Arg Asp Ser Ser Asp Gln Arg His 65 70 75

Pro

Tyr

Glu

Phe

153

Thr Gln Leu Ser Val Lys 85 Thr Gln Ser Gly Thr 90 Lys Asn Leu Arg Ile 95 Cys Glu Gly Gly Ser Phe Ser Leu Gln Ser Asp Pro Arg Ser Thr Gln 100 105 110 Pro Val Pro Arg Phe Asp Cys Val Leu Lys Leu Val His His Tyr Met 115 120 125 Pro Pro Pro Gly Ala Pro Ser Phe Pro Ser Pro Pro Thr Glu Pro Ser 130 135 140 Ser Glu Val Pro Glu Gln Pro Ser Ala Gln Pro Leu Pro Gly Ser Pro 145 150 155 160 Pro Arg Arg Ala Tyr Tyr Ile Tyr Ser Gly Gly Glu Lys Ile Pro Leu 165 170 175 Val Leu Ser Arg Pro Leu Ser Ser Asn Val Ala Thr Leu Gln His Leu 180 185 190 Cys Arg Lys Thr Val Asn Gly His Leu Asp Ser Tyr Glu Lys Val Thr 195 200 205 Gln Leu Pro Gly Pro Ile Arg Glu Phe Leu Asp Gln Tyr Asp Ala Pro 210 215 220 Leu 225

<210> 72 <211> 770 <212> PRT <213> Homo sapiens <400> 72 Met Ala Glu Gln Trp Asn Gln Leu Gln Gln Leu Asp Thr Arg Tyr Leu 1 5 10 15 Gln Leu His Gln Leu Tyr Ser Asp Ser Phe Pro Met Glu Leu Arg Gln 20 25 30 Phe Leu Ala Pro Trp Ile Glu Ser Gln Asp Trp Ala Tyr Ala Ala

154

Ser

Lys Ile Glu 50 Ser His Ala Thr Leu 55 Val Phe His Asn Leu 60 Leu Gly Glu Asp Gln Gln Tyr Ser Arg Phe Leu Gln Glu Ser Asn Val Leu Tyr Gln 65 70 75 80 His Asn Leu Arg Arg Ile Lys Gln Phe Leu Gln Ser Arg Tyr Leu Glu 85 90 95 Lys Pro Met Glu Ile Ala Arg Ile Val Ala Arg Cys Leu Trp Glu Glu 100 105 110 Ser Arg Leu Leu Gln Thr Ala Ala Thr Ala Ala Gln Gln Gly Gly Gln 115 120 125 Ala Asn His Pro Thr Ala Ala Val Val Thr Glu Lys Gln Gln Met Leu 130 135 140 Glu Gln His Leu Gln Asp Val Arg Lys Arg Val Gln Asp Leu Glu Gln 145 150 155 160 Lys Met Lys Val Val Glu Asn Leu Gln Asp Asp Phe Asp Phe Asn Tyr 165 170 175 Lys Thr Leu Lys Ser Gln Gly Asp Met Gln Asp Leu Asn Gly Asn Asn 180 185 190 Gln Ser Val Thr Arg Gln Lys Met Gln Gln Leu Glu Gln Met Leu Thr 195 200 205 Ala Leu Asp Gln Met Arg Arg Ser Ile Val Ser Glu Leu Ala Gly Leu 210 215 220 Leu Ser Ala Met Glu Tyr Val Gln Lys Thr Leu Thr Asp Glu Glu Leu 225 230 235 240 Ala Asp Trp Lys Arg Arg Gln Gln Ile Ala Cys Ile Gly Gly Pro Pro

155

245

250

255

Asn Glu Ile Cys Leu 260 Asp Arg Leu Glu Asn 265 Trp Ile Thr Ser Leu 270 Ala Ser Gln Leu Gln Thr Arg Gln Gln Ile Lys Lys Leu Glu Glu Leu Gln 275 280 285 Gln Lys Val Ser Tyr Lys Gly Asp Pro Ile Val Gln His Arg Pro Met 290 295 300 Leu Glu Glu Arg Ile Val Glu Leu Phe Arg Asn Leu Met Lys Ser Ala 305 310 315 320 Phe Val Val Glu Arg Gln Pro Cys Met Pro Met His Pro Asp Arg Pro 325 330 335 Leu Val Ile Lys Thr Gly Val Gln Phe Thr Thr Lys Val Arg Leu Leu 340 345 350 Val Lys Phe Pro Glu Leu Asn Tyr Gln Leu Lys Ile Lys Val Cys Ile 355 360 365 Asp Lys Asp Ser Gly Asp Val Ala Ala Leu Arg Gly Ser Arg Lys Phe 370 375 380 Asn Ile Leu Gly Thr Asn Thr Lys Val Met Asn Met Glu Glu Ser Asn 385 390 395 400 Asn Gly Ser Leu Ser Ala Glu Phe Lys His Leu Thr Leu Arg Glu Gln 405 410 415 Arg Cys Gly Asn Gly Gly Arg Ala Asn Cys Asp Ala Ser Leu Ile Val 420 425 430 Thr Glu Glu Leu His Leu Ile Thr Phe Glu Thr Glu Val Tyr His Gln 435 440 445 Gly Leu Lys Ile Asp Leu Glu Thr His Ser Leu Pro Val Val Val

Ile

450 455 460

156

Ser Tyr 465 480 Asn Ile Cys Gln Met 470 Pro Asn Ala Trp Ala 475 Ser Ile Leu Trp Asn Met Leu Thr Asn Asn Pro Lys Asn Val Asn Phe Phe Thr Lys Pro 485 490 495 Pro Ile Gly Thr Trp Asp Gln Val Ala Glu Val Leu Ser Trp Gln Phe 500 505 510 Ser Ser Thr Thr Lys Arg Gly Leu Ser Ile Glu Gln Leu Thr Thr Leu 515 520 525 Ala Glu Lys Leu Leu Gly Pro Gly Val Asn Tyr Ser Gly Cys Gln Ile 530 535 540 Thr Trp Ala Lys Phe Cys Lys Glu Asn Met Ala Gly Lys Gly Phe Ser 545 550 555 560 Phe Trp Val Trp Leu Asp Asn Ile Ile Asp Leu Val Lys Lys Tyr Ile 565 570 575 Leu Ala Leu Trp Asn Glu Gly Tyr Ile Met Gly Phe Ile Ser Lys Glu 580 585 590 Arg Glu Arg Ala Ile Leu Ser Thr Lys Pro Pro Gly Thr Phe Leu Leu 595 600 605 Arg Phe Ser Glu Ser Ser Lys Glu Gly Gly Val Thr Phe Thr Trp Val 610 615 620 Glu Lys Asp Ile Ser Gly Lys Thr Gln Ile Gln Ser Val Glu Pro Tyr 625 630 635 640 Thr Lys Gln Gln Leu Asn Asn Met Ser Phe Ala Glu Ile Ile Met Gly 645 650 655 Tyr Lys Ile Met Asp Ala Thr Asn Ile Leu Val Ser Pro Leu Val Tyr 660 665 670 Leu Tyr Pro Asp Ile Pro Lys Glu Glu Ala Phe Gly Lys Tyr Cys

157

Arg

675 680 685 Pro Glu Ser Gln Glu His Pro Glu Ala Asp Pro Gly Ser Ala Ala Pro 690 695 700 Tyr Leu Lys Thr Lys Phe Ile Cys Val Thr Pro Thr Thr Cys Ser Asn 705 710 715 720 Thr Ile Asp Leu Pro Met Ser Pro Arg Thr Leu Asp Ser Leu Met Gln 725 730 735 Phe Gly Asn Asn Gly Glu Gly Ala Glu Pro Ser Ala Gly Gly Gln Phe 740 745 750 Glu Ser Leu Thr Phe Asp Met Glu Leu Thr Ser Glu Cys Ala Thr Ser 755 760 765 Pro Met 770

<210> 73 <211> 246 <212> PRT <213> Homo sapiens <400> 73 Met Glu Val Leu Val Leu Thr Gln Thr Pro Ser Pro Val Ser Ala Val 1 5 10 15 Gly Gly Gly Thr Val Thr Ile Asn Cys Gln Ser Ser Gln Ser Val Trp 20 25 30 Asn Asn Arg Leu Ser Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Arg 35 40 45 Leu Leu Arg Met Tyr Tyr Ala Ser Asn Leu Ala Ser Gly Val Ser Ser 50 55 60 Phe Lys Asp Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser 65 70 75 80 Val Gln Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gly Gly Phe

158

Glu

Cys Glu Ser Gly Gly 100 Asp Cys Val Gly Phe 105 Gly Gly Gly Thr Glu 110 Leu Ile Leu Gly Gly Ser Ser Arg Ser Ser Ser Ser Gly Gly Gly Gly Ser 115 120 125 Gly Gly Gly Gly Gln Ser Val Glu Glu Ser Gly Gly Arg Leu Val Ala 130 135 140 Pro Gly Gly Ser Leu Thr Leu Thr Cys Thr Val Ser Gly Ile Asp Leu 145 150 155 160 Ser Ser Asp Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 165 170 175 Glu Trp Ile Gly Thr Ile Tyr Gly Ser Ala Gly Thr Tyr Tyr Ala Thr 180 185 190 Trp Ala Lys Gly Arg Phe Thr Ile Ser Lys Thr Ser Thr Thr Val Asp 195 200 205 Leu Lys Met Thr Ser Leu Thr Thr Glu Asp Thr Ala Thr Tyr Phe Cys 210 215 220 Thr Arg Ala Phe Ser Asn Thr Arg Leu Asp Leu Trp Gly Gln Gly Thr 225 230 235 240 Leu Val Thr Ile Ser Ser 245

<210> 74 <211> 233 <212> PRT <213> Homo sapiens <400> 74 Met Ser Gln Ser Asn Arg Glu Leu Val Val Asp Phe Leu Ser Tyr Lys 1 5 10 15 Leu Ser Gln Lys Gly Tyr Ser Trp Ser Gln Phe Ser Asp Val Glu

159

Glu

20 25 30

Asn Pro Arg Thr 35 Glu Ala Pro Glu Gly 40 Thr Glu Ser Glu Met 45 Glu Thr Ser Ala Ile Asn Gly Asn Pro Ser Trp His Leu Ala Asp Ser Pro Ala 50 55 60 Val Asn Gly Ala Thr Gly His Ser Ser Ser Leu Asp Ala Arg Glu Val 65 70 75 80 Ile Pro Met Ala Ala Val Lys Gln Ala Leu Arg Glu Ala Gly Asp Glu 85 90 95 Phe Glu Leu Arg Tyr Arg Arg Ala Phe Ser Asp Leu Thr Ser Gln Leu 100 105 110 His Ile Thr Pro Gly Thr Ala Tyr Gln Ser Phe Glu Gln Val Val Asn 115 120 125 Glu Leu Phe Arg Asp Gly Val Asn Trp Gly Arg Ile Val Ala Phe Phe 130 135 140 Ser Phe Gly Gly Ala Leu Cys Val Glu Ser Val Asp Lys Glu Met Gln 145 150 155 160 Val Leu Val Ser Arg Ile Ala Ala Trp Met Ala Thr Tyr Leu Asn Asp 165 170 175 His Leu Glu Pro Trp Ile Gln Glu Asn Gly Gly Trp Asp Thr Phe Val 180 185 190 Glu Leu Tyr Gly Asn Asn Ala Ala Ala Glu Ser Arg Lys Gly Gln Glu 195 200 205 Arg Phe Asn Arg Trp Phe Leu Thr Gly Met Thr Val Ala Gly Val Val 210 215 220 Leu Leu Gly Ser Leu Phe Ser Arg Lys

225 230

160

<210> 75 <211> 312 <212> PRT <213> Homo sapiens <400> 75 Met Ala Asn Asn Asp Ala Val Leu Lys Arg Leu Glu Gln Lys Gly Ala 1 5 10 15 Glu Ala Asp Gln Ile Ile Glu Tyr Leu Lys Gln Gln Val Ser Leu Leu 20 25 30 Lys Glu Lys Ala Ile Leu Gln Ala Thr Leu Arg Glu Glu Lys Lys Leu 35 40 45 Arg Val Glu Asn Ala Lys Leu Lys Lys Glu Ile Glu Glu Leu Lys Gln 50 55 60 Glu Leu Ile Gln Ala Glu Ile Gln Asn Gly Val Lys Gln Ile Pro Phe 65 70 75 80 Pro Ser Gly Thr Pro Leu His Ala Asn Ser Met Val Ser Glu Asn Val 85 90 95 Ile Gln Ser Thr Ala Val Thr Thr Val Ser Ser Gly Thr Lys Glu Gln 100 105 110 Ile Lys Gly Gly Thr Gly Asp Glu Lys Lys Ala Lys Glu Lys Ile Glu 115 120 125 Lys Lys Gly Glu Lys Lys Glu Lys Lys Gln Gln Ser Ile Ala Gly Ser 130 135 140 Ala Asp Ser Lys Pro Ile Asp Val Ser Arg Leu Asp Leu Arg Ile Gly 145 150 155 160 Cys Ile Ile Thr Ala Arg Lys His Pro Asp Ala Asp Ser Leu Tyr Val 165 170 175 Glu Glu Val Asp Val Gly Glu Ile Ala Pro Arg Thr Val Val Ser Gly 180 185 190

161

Leu Ile Val Asn 195 His Val Pro Leu Glu 200 Gln Met Gln Asn Arg 205 Met Val Leu Leu Cys Asn Leu Lys Pro Ala Lys Met Arg Gly Val Leu Ser Gln 210 215 220 Ala Met Val Met Cys Ala Ser Ser Pro Glu Lys Ile Glu Ile Leu Ala 225 230 235 240 Pro Pro Asn Gly Ser Val Pro Gly Asp Arg Ile Thr Phe Asp Ala Phe 245 250 255 Pro Gly Glu Pro Asp Lys Glu Leu Asn Pro Lys Lys Lys Ile Trp Glu 260 265 270 Gln Ile Gln Pro Asp Leu His Thr Asn Asp Glu Cys Val Ala Thr Tyr 275 280 285 Lys Gly Val Pro Phe Glu Val Lys Gly Lys Gly Val Cys Arg Ala Gln 290 295 300 Thr Met Ser Asn Ser Gly Ile Lys 305 310

<210> 76 <211> 320 <212> PRT <213> Homo sapiens <400> 76 Met Pro Leu Met Tyr Gln Val Lys 1 5 Arg Val Glu Leu Pro Thr Cys Gly 20 Arg Ser Tyr Gly Pro Ala Pro Ser 35 Asn Leu Ser Leu Gln Ala Leu Lys 50 55

Pro Tyr His 10 Gly Gly Gly Ala Pro 15 Met Tyr Arg Leu Pro Asn Val His 25 30 Gly Ala Gly His Val Gln Glu Glu 40 45 Glu Ser Arg Gln Asp Asp Ile Leu

162

Arg Ile 65 80 Leu Tyr Glu Leu Lys 70 Ala Ala Val Asp Gly 75 Leu Ser Lys Met Gln Thr Pro Asp Ala Asp Leu Asp Val Thr Asn Ile Ile Gln Ala Asp 85 90 95 Glu Pro Thr Thr Leu Thr Thr Asn Ala Leu Asp Leu Asn Ser Val Leu 100 105 110 Gly Lys Asp Tyr Gly Ala Leu Lys Asp Ile Val Ile Asn Ala Asn Pro 115 120 125 Ala Ser Pro Pro Leu Ser Leu Leu Val Leu His Arg Leu Leu Cys Glu 130 135 140 His Phe Arg Val Leu Ser Thr Val His Thr His Ser Ser Val Lys Ser 145 150 155 160 Val Pro Glu Asn Leu Leu Lys Cys Phe Gly Glu Gln Asn Lys Lys Gln 165 170 175 Pro Arg Gln Asp Tyr Gln Leu Gly Phe Thr Leu Ile Trp Lys Asn Val 180 185 190 Pro Lys Thr Gln Met Lys Phe Ser Ile Gln Thr Met Cys Pro Ile Glu 195 200 205 Gly Glu Gly Asn Ile Ala Arg Phe Leu Phe Ser Leu Phe Gly Gln Lys 210 215 220 His Asn Ala Val Asn Ala Thr Leu Ile Asp Ser Trp Val Asp Ile Ala 225 230 235 240 Ile Phe Gln Leu Lys Glu Gly Ser Ser Lys Glu Lys Ala Ala Val Phe 245 250 255 Arg Ser Met Asn Ser Ala Leu Gly Lys Ser Pro Trp Leu Ala Gly Asn 260 265 270 Glu Leu Thr Val Ala Asp Val Val Leu Trp Ser Val Leu Gln Gln

163

Ile

275 Gly Gly Cys Ser Val Thr Val Arg 290 295 Ser Cys Glu Asn Leu Ala Pro Lys 305 310 320

280 285 Pro Ala Asn Val Gln Arg Trp Met 300 Phe Asn Thr Ala Leu Lys Leu Leu 315

<210> 77 <211> 233 <212> PRT <213> Homo sapiens

<400> 77 Ser Lys Gly 5 Glu Glu Asp Asn Met 10 Ala Ile Ile Lys Glu 15 Met Phe 1 Val Met Arg Phe Lys Val His Met Glu Gly Ser Val Asn Gly His Glu Phe 20 25 30 Glu Ile Glu Gly Glu Gly Glu Gly Arg Pro Tyr Glu Gly Thr Gln Thr 35 40 45 Ala Lys Leu Lys Val Thr Lys Gly Gly Pro Leu Pro Phe Ala Trp Asp 50 55 60

Ile His 65 80 Leu Ser Pro Gln Phe 70 Met Tyr Gly Ser Lys 75 Ala Tyr Val Lys Pro Ala Asp Ile Pro Asp Tyr Leu Lys Leu Ser Phe Pro Glu Gly Phe 85 90 95 Lys Trp Glu Arg Val Met Asn Phe Glu Asp Gly Gly Val Val Thr Val 100 105 110 Thr Gln Asp Ser Ser Leu Gln Asp Gly Glu Phe Ile Tyr Lys Val Lys 115 120 125 Leu Arg Gly Thr Asn Phe Pro Ser Asp Gly Pro Val Met Gln Lys

Lys

130 135 140

164

Thr Gly 145 160 Met Gly Trp Glu Ala 150 Ser Ser Glu Arg Met 155 Tyr Pro Glu Asp Ala Leu Lys Gly Glu Ile Lys Gln Arg Leu Lys Leu Lys Asp Gly Gly 165 170 175 His Tyr Asp Ala Glu Val Lys Thr Thr Tyr Lys Ala Lys Lys Pro Val 180 185 190 Gln Leu Pro Gly Ala Tyr Asn Val Asn Ile Lys Leu Asp Ile Thr Ser 195 200 205 His Asn Glu Asp Tyr Thr Ile Val Glu Gln Tyr Glu Arg Ala Glu Gly 210 215 220 Arg His Ser Thr Gly Gly Met Asp Glu 225 230

<210> 78 <211> 267 <212> PRT <213> Homo sapiens

<400> 78 Ser Lys Gly 5 Glu Glu Leu Phe Thr 10 Gly Val Val Pro Ile 15 Met Leu 1 Val Val Glu Leu Asp Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly 20 25 30 Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile 35 40 45 Cys Thr Thr Gly Lys Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr 50 55 60 Leu Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys 65 70 75 80 Gln His Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu 85 90 95

165

Arg Glu Thr Ile Phe 100 Phe Lys Asp Asp Gly 105 Asn Tyr Lys Thr Arg 110 Ala Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly 115 120 125 Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr 130 135 140 Asn Tyr Asn Ser His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn 145 150 155 160 Gly Ile Lys Val Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser 165 170 175 Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly 180 185 190 Pro Val Leu Leu Pro Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu 195 200 205 Ser Lys Asp Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu Phe 210 215 220 Val Thr Ala Ala Gly Ile Thr Leu Gly Met Asp Glu Leu Tyr Lys Gly 225 230 235 240 Ser Gly Ser Gly Leu Arg Ser Arg Ala Gln Ala Ser Asn Ser Ala Val 245 250 255 Asp Gly Thr Ala Gly Pro Gly Ser Thr Gly Ser 260 265

<210> 79 <211> 425 <212> PRT <213> Homo sapiens <400> 79 Met Ala Asp Lys Glu Ala Ala Phe Asp Asp Ala Val Glu Glu Arg Val 1 5 10 15

166

Ile Tyr Asn Glu Glu 20 Tyr Lys Ile Trp Lys 25 Lys Asn Thr Pro Phe 30 Leu Asp Leu Val Met Thr His Ala Leu Glu Trp Pro Ser Leu Thr Ala Gln 35 40 45 Trp Leu Pro Asp Val Thr Arg Pro Glu Gly Lys Asp Phe Ser Ile His 50 55 60 Arg Leu Val Leu Gly Thr His Thr Ser Asp Glu Gln Asn His Leu Val 65 70 75 80 Ile Ala Ser Val Gln Leu Pro Asn Asp Asp Ala Gln Phe Asp Ala Ser 85 90 95 His Tyr Asp Ser Glu Lys Gly Glu Phe Gly Gly Phe Gly Ser Val Ser 100 105 110 Gly Lys Ile Glu Ile Glu Ile Lys Ile Asn His Glu Gly Glu Val Asn 115 120 125 Arg Ala Arg Tyr Met Pro Gln Asn Pro Cys Ile Ile Ala Thr Lys Thr 130 135 140 Pro Ser Ser Asp Val Leu Val Phe Asp Tyr Thr Lys His Pro Ser Lys 145 150 155 160 Pro Asp Pro Ser Gly Glu Cys Asn Pro Asp Leu Arg Leu Arg Gly His 165 170 175 Gln Lys Glu Gly Tyr Gly Leu Ser Trp Asn Pro Asn Leu Ser Gly His 180 185 190 Leu Leu Ser Ala Ser Asp Asp His Thr Ile Cys Leu Trp Asp Ile Ser 195 200 205 Ala Val Pro Lys Glu Gly Lys Val Val Asp Ala Lys Thr Ile Phe Thr 210 215 220 Gly His Thr Ala Val Val Glu Asp Val Ser Trp His Leu Leu His Glu

167

225 230 235

240

Ser Asp Leu Phe Gly Ser 245 Val Ala Asp Asp Gln 250 Lys Leu Met Ile Trp 255 Thr Arg Ser Asn Asn Thr Ser Lys Pro Ser His Ser Val Asp Ala His 260 265 270 Thr Ala Glu Val Asn Cys Leu Ser Phe Asn Pro Tyr Ser Glu Phe Ile 275 280 285 Leu Ala Thr Gly Ser Ala Asp Lys Thr Val Ala Leu Trp Asp Leu Arg 290 295 300 Asn Leu Lys Leu Lys Leu His Ser Phe Glu Ser His Lys Asp Glu Ile 305 310 315 320 Phe Gln Val Gln Trp Ser Pro His Asn Glu Thr Ile Leu Ala Ser Ser 325 330 335 Gly Thr Asp Arg Arg Leu Asn Val Trp Asp Leu Ser Lys Ile Gly Glu 340 345 350 Glu Gln Ser Pro Glu Asp Ala Glu Asp Gly Pro Pro Glu Leu Leu Phe 355 360 365 Ile His Gly Gly His Thr Ala Lys Ile Ser Asp Phe Ser Trp Asn Pro 370 375 380 Asn Glu Pro Trp Val Ile Cys Ser Val Ser Glu Asp Asn Ile Met Gln 385 390 395 400 Val Trp Gln Met Ala Glu Asn Ile Tyr Asn Asp Glu Asp Pro Glu Gly 405 410 415 Ser Val Asp Pro Glu Gly Gln Gly Ser

420 425

<210> 80 <211> 375 <212> PRT

168 <213>

Homo sapiens

<400> 80 Asp His Ser 5 Phe Ser Asp Gly Val 10 Pro Ser Asp Ser Val 15 Met Glu 1 Ala Ala Ala Lys Asn Ala Ser Asn Thr Glu Lys Leu Thr Asp Gln Val Met 20 25 30 Gln Asn Pro Arg Val Leu Ala Ala Leu Gln Glu Arg Leu Asp Asn Val 35 40 45 Pro His Thr Pro Ser Ser Tyr Ile Glu Thr Leu Pro Lys Ala Val Lys 50 55 60 Arg Arg Ile Asn Ala Leu Lys Gln Leu Gln Val Arg Cys Ala His Ile 65 70 75 80 Glu Ala Lys Phe Tyr Glu Glu Val His Asp Leu Glu Arg Lys Tyr Ala 85 90 95 Ala Leu Tyr Gln Pro Leu Phe Asp Lys Arg Arg Glu Phe Ile Thr Gly 100 105 110 Asp Val Glu Pro Thr Asp Ala Glu Ser Glu Trp His Ser Glu Asn Glu 115 120 125 Glu Glu Glu Lys Leu Ala Gly Asp Met Lys Ser Lys Val Val Val Thr 130 135 140 Glu Lys Ala Ala Ala Thr Ala Glu Glu Pro Asp Pro Lys Gly Ile Pro 145 150 155 160 Glu Phe Trp Phe Thr Ile Phe Arg Asn Val Asp Met Leu Ser Glu Leu 165 170 175 Val Gln Glu Tyr Asp Glu Pro Ile Leu Lys His Leu Gln Asp Ile Lys 180 185 190 Val Lys Phe Ser Asp Pro Gly Gln Pro Met Ser Phe Val Leu Glu Phe 195 200 205

169

His Thr Phe 210 Glu Pro Asn Asp Tyr 215 Phe Thr Asn Ser Val 220 Leu Thr Lys Tyr Lys Met Lys Ser Glu Pro Asp Lys Ala Asp Pro Phe Ser Phe Glu 225 230 235 240 Gly Pro Glu Ile Val Asp Cys Asp Gly Cys Thr Ile Asp Trp Lys Lys 245 250 255 Gly Lys Asn Val Thr Val Lys Thr Ile Lys Lys Lys Gln Lys His Lys 260 265 270 Gly Arg Gly Thr Val Arg Thr Ile Thr Lys Gln Val Pro Asn Glu Ser 275 280 285 Phe Phe Asn Phe Phe Asn Pro Leu Lys Ala Ser Gly Asp Gly Glu Ser 290 295 300 Leu Asp Glu Asp Ser Glu Phe Thr Leu Ala Ser Asp Phe Glu Ile Gly 305 310 315 320 His Phe Phe Arg Glu Arg Ile Val Pro Arg Ala Val Leu Tyr Phe Thr 325 330 335 Gly Glu Ala Ile Glu Asp Asp Asp Asn Phe Glu Glu Gly Glu Glu Gly 340 345 350 Glu Glu Glu Glu Leu Glu Gly Asp Glu Glu Gly Glu Asp Glu Asp Asp 355 360 365 Ala Glu Ile Asn Pro Lys Val 370 375

<210> 81 <211> 1132 <212> PRT <213> Homo sapiens <400> 81 Met Pro Arg Ala Pro Arg Cys Arg Ala Val Arg Ser 1 5 10

Ser Leu Leu Arg

170

His Gly Tyr Arg Glu 20 Val Leu Pro Leu Ala 25 Thr Phe Val Arg Arg 30 Leu Pro Gln Gly Trp Arg Leu Val Gln Arg Gly Asp Pro Ala Ala Phe Arg 35 40 45 Ala Leu Val Ala Gln Cys Leu Val Cys Val Pro Trp Asp Ala Arg Pro 50 55 60 Pro Pro Ala Ala Pro Ser Phe Arg Gln Val Ser Cys Leu Lys Glu Leu 65 70 75 80 Val Ala Arg Val Leu Gln Arg Leu Cys Glu Arg Gly Ala Lys Asn Val 85 90 95 Leu Ala Phe Gly Phe Ala Leu Leu Asp Gly Ala Arg Gly Gly Pro Pro 100 105 110 Glu Ala Phe Thr Thr Ser Val Arg Ser Tyr Leu Pro Asn Thr Val Thr 115 120 125 Asp Ala Leu Arg Gly Ser Gly Ala Trp Gly Leu Leu Leu Arg Arg Val 130 135 140 Gly Asp Asp Val Leu Val His Leu Leu Ala Arg Cys Ala Leu Phe Val 145 150 155 160 Leu Val Ala Pro Ser Cys Ala Tyr Gln Val Cys Gly Pro Pro Leu Tyr 165 170 175 Gln Leu Gly Ala Ala Thr Gln Ala Arg Pro Pro Pro His Ala Ser Gly 180 185 190 Pro Arg Arg Arg Leu Gly Cys Glu Arg Ala Trp Asn His Ser Val Arg 195 200 205 Glu Ala Gly Val Pro Leu Gly Leu Pro Ala Pro Gly Ala Arg Arg Arg 210 215 220 Gly Gly Ser Ala Ser Arg Ser Leu Pro Leu Pro Lys Arg Pro Arg

1Ί1

Arg

225 230 235

240

Gly Trp Ala Ala Pro Glu 245 Pro Glu Arg Thr Pro 250 Val Gly Gln Gly Ser 255 Ala His Pro Gly Arg Thr Arg Gly Pro Ser Asp Arg Gly Phe Cys Val 260 265 270 Val Ser Pro Ala Arg Pro Ala Glu Glu Ala Thr Ser Leu Glu Gly Ala 275 280 285 Leu Ser Gly Thr Arg His Ser His Pro Ser Val Gly Arg Gln His His 290 295 300 Ala Gly Pro Pro Ser Thr Ser Arg Pro Pro Arg Pro Trp Asp Thr Pro 305 310 315 320 Cys Pro Pro Val Tyr Ala Glu Thr Lys His Phe Leu Tyr Ser Ser Gly 325 330 335 Asp Lys Glu Gln Leu Arg Pro Ser Phe Leu Leu Ser Ser Leu Arg Pro 340 345 350 Ser Leu Thr Gly Ala Arg Arg Leu Val Glu Thr Ile Phe Leu Gly Ser 355 360 365 Arg Pro Trp Met Pro Gly Thr Pro Arg Arg Leu Pro Arg Leu Pro Gln 370 375 380 Arg Tyr Trp Gln Met Arg Pro Leu Phe Leu Glu Leu Leu Gly Asn His 385 390 395 400 Ala Gln Cys Pro Tyr Gly Val Leu Leu Lys Thr His Cys Pro Leu Arg 405 410 415 Ala Ala Val Thr Pro Ala Ala Gly Val Cys Ala Arg Glu Lys Pro Gln 420 425 430 Gly Ser Val Ala Ala Pro Glu Glu Glu Asp Thr Asp Pro Arg Arg

Leu

172

435

440

445

Val Phe Gln 450 Leu Leu Arg Gln His 455 Ser Ser Pro Trp Gln 460 Val Tyr Gly Val Arg Ala Cys Leu Arg Arg Leu Val Pro Pro Gly Leu Trp Gly Ser 465 470 475 480 Arg His Asn Glu Arg Arg Phe Leu Arg Asn Thr Lys Lys Phe Ile Ser 485 490 495 Leu Gly Lys His Ala Lys Leu Ser Leu Gln Glu Leu Thr Trp Lys Met 500 505 510 Ser Val Arg Asp Cys Ala Trp Leu Arg Arg Ser Pro Gly Val Gly Cys 515 520 525 Val Pro Ala Ala Glu His Arg Leu Arg Glu Glu Ile Leu Ala Lys Phe 530 535 540 Leu His Trp Leu Met Ser Val Tyr Val Val Glu Leu Leu Arg Ser Phe 545 550 555 560 Phe Tyr Val Thr Glu Thr Thr Phe Gln Lys Asn Arg Leu Phe Phe Tyr 565 570 575 Arg Lys Ser Val Trp Ser Lys Leu Gln Ser Ile Gly Ile Arg Gln His 580 585 590 Leu Lys Arg Val Gln Leu Arg Glu Leu Ser Glu Ala Glu Val Arg Gln 595 600 605 His Arg Glu Ala Arg Pro Ala Leu Leu Thr Ser Arg Leu Arg Phe Ile 610 615 620 Pro Lys Pro Asp Gly Leu Arg Pro Ile Val Asn Met Asp Tyr Val Val 625 630 635 640 Gly Ala Arg Thr Phe Arg Arg Glu Lys Arg Ala Glu Arg Leu Thr Ser 645 650 655

173

Arg Arg Val Lys Ala 660 Leu Phe Ser Pro Gly Leu Leu Gly Ala Ser Arg 675 Ala Trp Arg Thr Phe Val Leu Pro 690 695 Glu Leu Tyr Phe Val Lys Val Ile 705 710 720 Pro Gln Asp Arg Leu Thr Glu Gln 725 Asn Thr Tyr Cys Val Arg Arg His 740 Gly His Val Arg Lys Ala Phe Asp 755 Leu Gln Pro Tyr Met Arg Gln Ser 770 775 Pro Leu Arg Asp Ala Val Val Glu 785 790 800 Ala Ser Ser Gly Leu Phe Asp His 805 Ala Val Arg Ile Arg Gly Lys Pro 820 Gln Gly Ser Ile Leu Ser Thr Asp 835 Met Glu Asn Lys Leu Phe Ala Leu 850 855 Arg Leu Val Asp Asp Phe Leu

Leu Asn Tyr Glu Arg Ala Arg 665 670 Leu Gly Leu Asp Asp Ile His 685 Val Arg Ala Gln Asp Pro Pro 700 Val Thr Gly Ala Tyr Asp Thr 715 Ile Ala Ser Ile Ile Lys Pro 730 735 Ala Val Val Gln Lys Ala Ala 745 750 Ser His Val Ser Thr Leu Thr 765 Val Ala His Leu Gln Glu Thr 780 Glu Gln Ser Ser Ser Leu Asn 795 Phe Leu Arg Phe Met Cys His 810 815 Tyr Val Gln Cys Gln Gly Ile 825 830 Leu Cys Ser Leu Cys Tyr Gly 845 Ile Arg Arg Asp Gly Leu Leu 860 Val Thr Pro His Leu Thr His

174

Ala

865 870 875

880

Lys Cys Thr Phe Leu Arg 885 Thr Leu Val Arg Gly 890 Val Pro Glu Tyr Gly 895 Val Val Asn Leu Arg Lys Thr Val Val Asn Phe Pro Val Glu Asp Glu 900 905 910 Ala Leu Gly Gly Thr Ala Phe Val Gln Met Pro Ala His Gly Leu Phe 915 920 925 Pro Trp Cys Gly Leu Leu Leu Asp Thr Arg Thr Leu Glu Val Gln Ser 930 935 940 Asp Tyr Ser Ser Tyr Ala Arg Thr Ser Ile Arg Ala Ser Leu Thr Phe 945 950 955 960 Asn Arg Gly Phe Lys Ala Gly Arg Asn Met Arg Arg Lys Leu Phe Gly 965 970 975 Val Leu Arg Leu Lys Cys His Ser Leu Phe Leu Asp Leu Gln Val Asn 980 985 990 Ser Leu Gln Thr Val Cys Thr Asn Ile Tyr Lys Ile Leu Leu Leu Gln 995 1000 1005 Ala Tyr Arg Phe His Ala Cys Val Leu Gln Leu Pro Phe His Gln Gln 1010 1015 1020 Val Trp Lys Asn Pro Thr Phe Phe Leu Arg Val Ile Ser Asp Thr

Ala

1025 1030 1035

1040

Ser Leu Leu Cys Tyr Ser 1045 Ile Leu Lys Ala Lys 1050 Asn Ala Gly Met Ser 1055 Gly Ala Lys Gly Ala Ala Gly Pro Leu Pro Ser Glu Ala Val Gln Trp 1060 1065 1070 Leu Cys His Gln Ala Phe Leu Leu Lys Leu Thr Arg His Arg Val Thr

175

1085

1075

1080

Tyr Val Pro Leu Leu Gly Ser Leu Arg Thr Ala Gln Ser 1090 1095 1100 Arg Lys Leu Pro Gly Thr Thr Leu Thr Ala Leu Glu

Asn

1105 1110 1115

1120

Thr

Ala

Gln

Leu

Ala

Pro Ala Leu Pro Ser 1125 Asp Phe Lys Thr Ile 1130 Leu Asp <210> 82 <211> 462 <212> PRT <213> Homo sapiens <400> 82 Met Glu Thr Glu Gln Pro Glu Glu Thr Phe Pro Asn Asn 1 5 10 Gly Glu Phe Gly Lys Arg Pro Ala Glu Asp Met Glu Ala 20 25 Phe Lys Arg Ser Arg Asn Thr Asp Glu Met Val Glu Leu 35 40 Leu Gln Ser Lys Asn Ala Gly Ala Val Ile Gly Lys Asn 50 55 60 Ile Lys Ala Leu Arg Thr Asp Tyr Asn Ala Ser Val Asp 65 70 75 80 Ser Ser Gly Pro Glu Arg Ile Leu Ser Ile Ser Ala Thr 85 90 Ile Gly Glu Ile Leu Lys Lys Ile Ile Pro Thr Leu Leu 100 105 Gln Leu Pro Ser Pro Thr Ala Thr Ser Gln Leu Pro Asp 115 120 Ala Val Glu Cys Leu Asn Tyr Gln His Tyr Lys Gly

Asp

Thr

Glu

Leu

Gly

Ser

Asp

Glu

Leu

125

Ser

Glu

Arg

Gly

Val

Ile

Glu

110

Glu

Asp

Thr

Gln

Ile

Lys

Pro

Glu

Gly

Ser

Phe

176

130 135 140

Cys Ile 145 160 Glu Leu Arg Leu Leu 150 Ile His Gln Ser Leu 155 Ala Gly Gly Ile Gly Val Lys Gly Ala Lys Ile Lys Glu Leu Arg Glu Asn Thr Gln Thr 165 170 175 Thr Ile Lys Leu Phe Gln Glu Cys Cys Pro His Ser Thr Asp Arg Val 180 185 190 Val Leu Ile Gly Gly Lys Pro Asp Arg Val Val Glu Cys Ile Lys Ile 195 200 205 Ile Leu Asp Leu Ile Ser Glu Ser Pro Ile Lys Gly Arg Ala Gln Pro 210 215 220 Tyr Asp Pro Asn Phe Tyr Asp Glu Thr Tyr Asp Tyr Gly Gly Phe Thr 225 230 235 240 Met Met Phe Asp Asp Arg Arg Gly Arg Pro Val Gly Phe Pro Met Arg 245 250 255 Gly Arg Gly Gly Phe Asp Arg Met Pro Pro Gly Arg Gly Gly Arg Pro 260 265 270 Met Pro Pro Ser Arg Arg Asp Tyr Asp Asp Met Ser Pro Arg Arg Gly 275 280 285 Pro Pro Pro Pro Pro Pro Gly Arg Gly Gly Arg Gly Gly Ser Arg Ala 290 295 300 Arg Asn Leu Pro Leu Pro Pro Pro Pro Pro Pro Arg Gly Gly Asp Leu 305 310 315 320 Met Ala Tyr Asp Arg Arg Gly Arg Pro Gly Asp Arg Tyr Asp Gly Met 325 330 335 Val Gly Phe Ser Ala Asp Glu Thr Trp Asp Ser Ala Ile Asp Thr Trp 340 345 350

177

Ser Gly Pro Ser 355 Glu Trp Gln Met Ala 360 Tyr Glu Pro Gln Gly 365 Gly Ser Tyr Asp Tyr Ser Tyr Ala Gly Gly Arg Gly Ser Tyr Gly Asp Leu Gly 370 375 380 Gly Pro Ile Ile Thr Thr Gln Val Thr Ile Pro Lys Asp Leu Ala Gly 385 390 395 400 Ser Ile Ile Gly Lys Gly Gly Gln Arg Ile Lys Gln Ile Arg His Glu 405 410 415 Ser Gly Ala Ser Ile Lys Ile Asp Glu Pro Leu Glu Gly Ser Glu Asp 420 425 430 Arg Ile Ile Thr Ile Thr Gly Thr Gln Asp Gln Ile Gln Asn Ala Gln 435 440 445 Tyr Leu Leu Gln Asn Ser Val Lys Gln Tyr Ser Gly Lys Phe 450 455 460

<210> 83 <211> 745 <212> PRT <213> Homo sapiens <400> 83 Met Glu Glu Arg Pro Pro Gly Leu Arg Pro Gly Ala Gly Gly Pro Trp 1 5 10 15 Met Arg Glu Arg Leu Gly Thr Gly Gly Phe Gly Asn Val Cys Leu Tyr 20 25 30 Gln His Arg Glu Leu Asp Leu Lys Ile Ala Ile Lys Ser Cys Arg Leu 35 40 45 Glu Leu Ile Ser Thr Lys Asn Arg Glu Arg Trp Cys His Glu Ile Gln 50 55 60 Met Lys Pro Lys Leu Asn His Ala Asn Val Val Lys Ala Cys Asp Val

178

65 70 75

Glu Glu Glu Leu Asn Ile 85 Leu Ile His Asp Val 90 Pro Leu Leu Ala Met 95 Tyr Cys Ser Gly Gly Asp Leu Arg Lys Leu Leu Asn Lys Pro Glu Asn 100 105 110 Cys Cys Gly Leu Lys Glu Ser Gln Ile Leu Ser Leu Leu Ser Asp Ile 115 120 125 Gly Ser Gly Ile Arg Tyr Leu His Glu Asn Lys Ile Ile His Arg Asp 130 135 140 Leu Lys Pro Glu Asn Ile Val Leu Gln Asp Val Gly Gly Lys Ile Ile 145 150 155 160 His Lys Ile Ile Asp Leu Gly Tyr Ala Lys Asp Val Asp Gln Gly Ser 165 170 175 Leu Cys Thr Ser Phe Val Gly Thr Leu Gln Tyr Leu Ala Pro Glu Leu 180 185 190 Phe Glu Asn Lys Pro Tyr Thr Ala Thr Val Asp Tyr Trp Ser Phe Gly 195 200 205 Thr Met Val Phe Glu Cys Ile Ala Gly Tyr Arg Pro Phe Leu His His 210 215 220 Leu Gln Pro Phe Thr Trp His Glu Lys Ile Lys Lys Lys Asp Pro Lys 225 230 235 240 Cys Ile Phe Ala Cys Glu Glu Met Ser Gly Glu Val Arg Phe Ser Ser 245 250 255 His Leu Pro Gln Pro Asn Ser Leu Cys Ser Leu Val Val Glu Pro Met 260 265 270 Glu Asn Trp Leu Gln Leu Met Leu Asn Trp Asp Pro Gln Gln Arg Gly 275 280 285

179

Gly Met Pro 290 Val Asp Leu Thr Leu 295 Lys Gln Pro Arg Cys 300 Phe Val Leu Asp His Ile Leu Asn Leu Lys Ile Val His Ile Leu Asn Met Thr Ser 305 310 315 320 Ala Lys Ile Ile Ser Phe Leu Leu Pro Pro Asp Glu Ser Leu His Ser 325 330 335 Leu Gln Ser Arg Ile Glu Arg Glu Thr Gly Ile Asn Thr Gly Ser Gln 340 345 350 Glu Leu Leu Ser Glu Thr Gly Ile Ser Leu Asp Pro Arg Lys Pro Ala 355 360 365 Ser Gln Cys Val Leu Asp Gly Val Arg Gly Cys Asp Ser Tyr Met Val 370 375 380 Tyr Leu Phe Asp Lys Ser Lys Thr Val Tyr Glu Gly Pro Phe Ala Ser 385 390 395 400 Arg Ser Leu Ser Asp Cys Val Asn Tyr Ile Val Gln Asp Ser Lys Ile 405 410 415 Gln Leu Pro Ile Ile Gln Leu Arg Lys Val Trp Ala Glu Ala Val His 420 425 430 Tyr Val Ser Gly Leu Lys Glu Asp Tyr Ser Arg Leu Phe Gln Gly Gln 435 440 445 Arg Ala Ala Met Leu Ser Leu Leu Arg Tyr Asn Ala Asn Leu Thr Lys 450 455 460 Met Lys Asn Thr Leu Ile Ser Ala Ser Gln Gln Leu Lys Ala Lys Leu 465 470 475 480 Glu Phe Phe His Lys Ser Ile Gln Leu Asp Leu Glu Arg Tyr Ser Glu 485 490 495

180

Gln Lys Met Thr Tyr 500 Gly Ile Ser Ser Glu 505 Lys Met Leu Lys Ala 510 Trp Glu Met Glu Glu Lys Ala Ile His Tyr Ala Glu Val Gly Val Ile Gly 515 520 525 Tyr Leu Glu Asp Gln Ile Met Ser Leu His Ala Glu Ile Met Glu Leu 530 535 540 Gln Lys Ser Pro Tyr Gly Arg Arg Gln Gly Asp Leu Met Glu Ser Leu 545 550 555 560 Glu Gln Arg Ala Ile Asp Leu Tyr Lys Gln Leu Lys His Arg Pro Ser 565 570 575 Asp His Ser Tyr Ser Asp Ser Thr Glu Met Val Lys Ile Ile Val His 580 585 590 Thr Val Gln Ser Gln Asp Arg Val Leu Lys Glu Leu Phe Gly His Leu 595 600 605 Ser Lys Leu Leu Gly Cys Lys Gln Lys Ile Ile Asp Leu Leu Pro Lys 610 615 620 Val Glu Val Ala Leu Ser Asn Ile Lys Glu Ala Asp Asn Thr Val Met 625 630 635 640 Phe Met Gln Gly Lys Arg Gln Lys Glu Ile Trp His Leu Leu Lys Ile 645 650 655 Ala Cys Thr Gln Ser Ser Ala Arg Ser Leu Val Gly Ser Ser Leu Glu 660 665 670 Gly Ala Val Thr Pro Gln Thr Ser Ala Trp Leu Pro Pro Thr Ser Ala 675 680 685 Glu His Asp His Ser Leu Ser Cys Val Val Thr Pro Gln Asp Gly Glu 690 695 700 Thr Ser Ala Gln Met Ile Glu Glu Asn Leu Asn Cys Leu Gly His Leu

181

705

720

710

715

Ser Thr Ile Ile His Glu Ala Asn Glu Glu Gln Gly Asn Ser Met Met 725 730 735 Asn Leu Asp Trp Ser Trp Leu Thr Glu 740 745

<210> 84 <211> 968 <212> PRT <213> Homo sapiens

<400> 84 Glu Asp Asp 5 Pro Tyr Leu Gly Arg 10 Pro Glu Gln Met Phe 15 Met His 1 Ala Leu Asp Pro Ser Leu Thr His Thr Ile Phe Asn Pro Glu Val Phe Gln 20 25 30 Pro Gln Met Ala Leu Pro Thr Asp Gly Pro Tyr Leu Gln Ile Leu Glu 35 40 45 Gln Pro Lys Gln Arg Gly Phe Arg Phe Arg Tyr Val Cys Glu Gly Pro 50 55 60 Ser His Gly Gly Leu Pro Gly Ala Ser Ser Glu Lys Asn Lys Lys Ser 65 70 75 80 Tyr Pro Gln Val Lys Ile Cys Asn Tyr Val Gly Pro Ala Lys Val Ile 85 90 95 Val Gln Leu Val Thr Asn Gly Lys Asn Ile His Leu His Ala His Ser 100 105 110 Leu Val Gly Lys His Cys Glu Asp Gly Ile Cys Thr Val Thr Ala Gly 115 120 125 Pro Lys Asp Met Val Val Gly Phe Ala Asn Leu Gly Ile Leu His Val 130 135 140 Thr Lys Lys Lys Val Phe Glu Thr Leu Glu Ala Arg Met Thr Glu Ala

182

145 150 155

160

Cys Ala Ile Arg Gly Tyr 165 Asn Pro Gly Leu Leu 170 Val His Pro Asp Leu 175 Tyr Leu Gln Ala Glu Gly Gly Gly Asp Arg Gln Leu Gly Asp Arg Glu 180 185 190 Lys Glu Leu Ile Arg Gln Ala Ala Leu Gln Gln Thr Lys Glu Met Asp 195 200 205 Leu Ser Val Val Arg Leu Met Phe Thr Ala Phe Leu Pro Asp Ser Thr 210 215 220 Gly Ser Phe Thr Arg Arg Leu Glu Pro Val Val Ser Asp Ala Ile Tyr 225 230 235 240 Asp Ser Lys Ala Pro Asn Ala Ser Asn Leu Lys Ile Val Arg Met Asp 245 250 255 Arg Thr Ala Gly Cys Val Thr Gly Gly Glu Glu Ile Tyr Leu Leu Cys 260 265 270 Asp Lys Val Gln Lys Asp Asp Ile Gln Ile Arg Phe Tyr Glu Glu Glu 275 280 285 Glu Asn Gly Gly Val Trp Glu Gly Phe Gly Asp Phe Ser Pro Thr Asp 290 295 300 Val His Arg Gln Phe Ala Ile Val Phe Lys Thr Pro Lys Tyr Lys Asp 305 310 315 320 Ile Asn Ile Thr Lys Pro Ala Ser Val Phe Val Gln Leu Arg Arg Lys 325 330 335 Ser Asp Leu Glu Thr Ser Glu Pro Lys Pro Phe Leu Tyr Tyr Pro Glu 340 345 350 Ile Lys Asp Lys Glu Glu Val Gln Arg Lys Arg Gln Lys Leu Met Pro 355 360 365

183

Asn Gly Phe 370 Ser Asp Ser Phe Gly 375 Gly Gly Ser Gly Ala 380 Gly Ala Gly Gly Gly Met Phe Gly Ser Gly Gly Gly Gly Gly Gly Thr Gly Ser Thr 385 390 395 400 Gly Pro Gly Tyr Ser Phe Pro His Tyr Gly Phe Pro Thr Tyr Gly Gly 405 410 415 Ile Thr Phe His Pro Gly Thr Thr Lys Ser Asn Ala Gly Met Lys His 420 425 430 Gly Thr Met Asp Thr Glu Ser Lys Lys Asp Pro Glu Gly Cys Asp Lys 435 440 445 Ser Asp Asp Lys Asn Thr Val Asn Leu Phe Gly Lys Val Ile Glu Thr 450 455 460 Thr Glu Gln Asp Gln Glu Pro Ser Glu Ala Thr Val Gly Asn Gly Glu 465 470 475 480 Val Thr Leu Thr Tyr Ala Thr Gly Thr Lys Glu Glu Ser Ala Gly Val 485 490 495 Gln Asp Asn Leu Phe Leu Glu Lys Ala Met Gln Leu Ala Lys Arg His 500 505 510 Ala Asn Ala Leu Phe Asp Tyr Ala Val Thr Gly Asp Val Lys Met Leu 515 520 525 Leu Ala Val Gln Arg His Leu Thr Ala Val Gln Asp Glu Asn Gly Asp 530 535 540 Ser Val Leu His Leu Ala Ile Ile His Leu His Ser Gln Leu Val Arg 545 550 555 560 Asp Leu Leu Glu Val Thr Ser Gly Leu Ile Ser Asp Asp Ile Ile Asn 565 570 575

184

Met Thr Arg Asn Asp 580 Leu Tyr Gln Thr Pro 585 Leu His Leu Ala Val 590 Ile Lys Gln Glu Asp Val Val Glu Asp Leu Leu Arg Ala Gly Ala Asp Leu 595 600 605 Ser Leu Leu Asp Arg Leu Gly Asn Ser Val Leu His Leu Ala Ala Lys 610 615 620 Glu Gly His Asp Lys Val Leu Ser Ile Leu Leu Lys His Lys Lys Ala 625 630 635 640 Ala Leu Leu Leu Asp His Pro Asn Gly Asp Gly Leu Asn Ala Ile His 645 650 655 Leu Ala Met Met Ser Asn Ser Leu Pro Cys Leu Leu Leu Leu Val Ala 660 665 670 Ala Gly Ala Asp Val Asn Ala Gln Glu Gln Lys Ser Gly Arg Thr Ala 675 680 685 Leu His Leu Ala Val Glu His Asp Asn Ile Ser Leu Ala Gly Cys Leu 690 695 700 Leu Leu Glu Gly Asp Ala His Val Asp Ser Thr Thr Tyr Asp Gly Thr 705 710 715 720 Thr Pro Leu His Ile Ala Ala Gly Arg Gly Ser Thr Arg Leu Ala Ala 725 730 735 Leu Leu Lys Ala Ala Gly Ala Asp Pro Leu Val Glu Asn Phe Glu Pro 740 745 750 Leu Tyr Asp Leu Asp Asp Ser Trp Glu Asn Ala Gly Glu Asp Glu Gly 755 760 765 Val Val Pro Gly Thr Thr Pro Leu Asp Met Ala Thr Ser Trp Gln Val 770 775 780 Phe Asp Ile Leu Asn Gly Lys Pro Tyr Glu Pro Glu Phe Thr Ser Asp

185

785 790 795

800

Asp Lys Leu Leu Ala Gln 805 Gly Asp Met Lys Gln 810 Leu Ala Glu Asp Val 815 Leu Gln Leu Tyr Lys Leu Leu Glu Ile Pro Asp Pro Asp Lys Asn Trp 820 825 830 Ala Thr Leu Ala Gln Lys Leu Gly Leu Gly Ile Leu Asn Asn Ala Phe 835 840 845 Arg Leu Ser Pro Ala Pro Ser Lys Thr Leu Met Asp Asn Tyr Glu Val 850 855 860 Ser Gly Gly Thr Val Arg Glu Leu Val Glu Ala Leu Arg Gln Met Gly 865 870 875 880 Tyr Thr Glu Ala Ile Glu Val Ile Gln Ala Ala Ser Ser Pro Val Lys 885 890 895 Thr Thr Ser Gln Ala His Ser Leu Pro Leu Ser Pro Ala Ser Thr Arg 900 905 910 Gln Gln Ile Asp Glu Leu Arg Asp Ser Asp Ser Val Cys Asp Ser Gly 915 920 925 Val Glu Thr Ser Phe Arg Lys Leu Ser Phe Thr Glu Ser Leu Thr Ser 930 935 940 Gly Ala Ser Leu Leu Thr Leu Asn Lys Met Pro His Asp Tyr Gly

Gln

945 950 955

960

Glu Gly Pro Leu Glu Gly Lys Ile 965

186