AU2017280065B2 - Recombinant cytomegalovirus vectors as vaccines for tuberculosis - Google Patents
Recombinant cytomegalovirus vectors as vaccines for tuberculosis Download PDFInfo
- Publication number
- AU2017280065B2 AU2017280065B2 AU2017280065A AU2017280065A AU2017280065B2 AU 2017280065 B2 AU2017280065 B2 AU 2017280065B2 AU 2017280065 A AU2017280065 A AU 2017280065A AU 2017280065 A AU2017280065 A AU 2017280065A AU 2017280065 B2 AU2017280065 B2 AU 2017280065B2
- Authority
- AU
- Australia
- Prior art keywords
- rhcmv
- vector
- hcmv
- mtb
- vaccine vector
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 239000013598 vector Substances 0.000 title claims abstract description 351
- 229960005486 vaccine Drugs 0.000 title claims description 194
- 201000008827 tuberculosis Diseases 0.000 title claims description 191
- 241000701022 Cytomegalovirus Species 0.000 title abstract description 162
- 108091007433 antigens Proteins 0.000 claims description 168
- 239000000427 antigen Substances 0.000 claims description 167
- 102000036639 antigens Human genes 0.000 claims description 167
- 150000007523 nucleic acids Chemical group 0.000 claims description 125
- 108090000623 proteins and genes Proteins 0.000 claims description 120
- 210000004027 cell Anatomy 0.000 claims description 110
- 102000039446 nucleic acids Human genes 0.000 claims description 82
- 108020004707 nucleic acids Proteins 0.000 claims description 82
- 230000014509 gene expression Effects 0.000 claims description 54
- 230000028993 immune response Effects 0.000 claims description 54
- 238000012217 deletion Methods 0.000 claims description 43
- 230000037430 deletion Effects 0.000 claims description 43
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 42
- 241000701024 Human betaherpesvirus 5 Species 0.000 claims description 39
- 125000003729 nucleotide group Chemical group 0.000 claims description 34
- 239000002773 nucleotide Substances 0.000 claims description 33
- 230000010076 replication Effects 0.000 claims description 26
- 239000002679 microRNA Substances 0.000 claims description 20
- 101150088904 UL130 gene Proteins 0.000 claims description 19
- 230000012010 growth Effects 0.000 claims description 17
- 108091070501 miRNA Proteins 0.000 claims description 16
- 239000008194 pharmaceutical composition Substances 0.000 claims description 16
- 108700011259 MicroRNAs Proteins 0.000 claims description 15
- 210000003169 central nervous system Anatomy 0.000 claims description 14
- 230000035772 mutation Effects 0.000 claims description 14
- 108700026244 Open Reading Frames Proteins 0.000 claims description 13
- 230000003190 augmentative effect Effects 0.000 claims description 12
- 239000003814 drug Substances 0.000 claims description 12
- 101150088910 UL82 gene Proteins 0.000 claims description 11
- 230000002950 deficient Effects 0.000 claims description 11
- 238000001727 in vivo Methods 0.000 claims description 10
- 210000002540 macrophage Anatomy 0.000 claims description 9
- 238000002360 preparation method Methods 0.000 claims description 9
- 230000029812 viral genome replication Effects 0.000 claims description 9
- 108700039887 Essential Genes Proteins 0.000 claims description 7
- 101150117356 UL94 gene Proteins 0.000 claims description 7
- 230000004048 modification Effects 0.000 claims description 7
- 238000012986 modification Methods 0.000 claims description 7
- 101150081727 UL32 gene Proteins 0.000 claims description 6
- 101150104684 UL44 gene Proteins 0.000 claims description 6
- 101150074007 UL99 gene Proteins 0.000 claims description 6
- 239000003937 drug carrier Substances 0.000 claims description 6
- 101150002378 gC gene Proteins 0.000 claims description 6
- 101150015940 gL gene Proteins 0.000 claims description 6
- 230000007480 spreading Effects 0.000 claims description 6
- 238000003892 spreading Methods 0.000 claims description 6
- 231100000221 frame shift mutation induction Toxicity 0.000 claims description 5
- 230000037433 frameshift Effects 0.000 claims description 5
- 230000010415 tropism Effects 0.000 claims description 5
- 101150046896 trm1 gene Proteins 0.000 claims description 4
- 108091074834 12 family Proteins 0.000 claims description 3
- 101710186352 Probable membrane antigen 3 Proteins 0.000 claims description 3
- 101710181078 Probable membrane antigen 75 Proteins 0.000 claims description 3
- 101710178472 Tegument protein Proteins 0.000 claims description 3
- 101150072074 UL28 gene Proteins 0.000 claims description 3
- 101150022492 UL83 gene Proteins 0.000 claims description 3
- 101150071882 US17 gene Proteins 0.000 claims description 3
- 101150044878 US18 gene Proteins 0.000 claims description 3
- 101150110932 US19 gene Proteins 0.000 claims description 3
- 101150049278 US20 gene Proteins 0.000 claims description 3
- 101150114976 US21 gene Proteins 0.000 claims description 3
- 101150044134 US28 gene Proteins 0.000 claims description 3
- 108020001507 fusion proteins Proteins 0.000 abstract description 44
- 102000037865 fusion proteins Human genes 0.000 abstract description 44
- 230000004044 response Effects 0.000 description 95
- 230000005867 T cell response Effects 0.000 description 85
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 83
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 83
- 238000011887 Necropsy Methods 0.000 description 80
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 76
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 74
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 74
- 239000000203 mixture Substances 0.000 description 74
- 210000004072 lung Anatomy 0.000 description 71
- 238000002255 vaccination Methods 0.000 description 68
- 238000000034 method Methods 0.000 description 66
- 201000010099 disease Diseases 0.000 description 64
- 210000001519 tissue Anatomy 0.000 description 58
- 208000015181 infectious disease Diseases 0.000 description 52
- 235000001014 amino acid Nutrition 0.000 description 50
- 229940024606 amino acid Drugs 0.000 description 46
- 150000001413 amino acids Chemical class 0.000 description 46
- 238000004458 analytical method Methods 0.000 description 46
- 102100040247 Tumor necrosis factor Human genes 0.000 description 45
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 42
- 206010018691 Granuloma Diseases 0.000 description 41
- 210000001165 lymph node Anatomy 0.000 description 41
- 238000011282 treatment Methods 0.000 description 39
- 108090000765 processed proteins & peptides Proteins 0.000 description 37
- 125000003275 alpha amino acid group Chemical group 0.000 description 35
- 235000018102 proteins Nutrition 0.000 description 34
- 102000004169 proteins and genes Human genes 0.000 description 34
- 210000001744 T-lymphocyte Anatomy 0.000 description 33
- 241000700605 Viruses Species 0.000 description 32
- 101100156500 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) vapB47 gene Proteins 0.000 description 31
- 230000001575 pathological effect Effects 0.000 description 31
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 30
- 101710088334 Diacylglycerol acyltransferase/mycolyltransferase Ag85B Proteins 0.000 description 30
- 241000282414 Homo sapiens Species 0.000 description 28
- 101710088335 Diacylglycerol acyltransferase/mycolyltransferase Ag85A Proteins 0.000 description 26
- 241001465754 Metazoa Species 0.000 description 26
- 208000019693 Lung disease Diseases 0.000 description 25
- 230000003834 intracellular effect Effects 0.000 description 24
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 24
- 102000004127 Cytokines Human genes 0.000 description 23
- 108090000695 Cytokines Proteins 0.000 description 23
- 238000002591 computed tomography Methods 0.000 description 23
- -1 ESAT6 Proteins 0.000 description 22
- 239000012634 fragment Substances 0.000 description 22
- 108010074328 Interferon-gamma Proteins 0.000 description 21
- 102000004196 processed proteins & peptides Human genes 0.000 description 21
- 102100037850 Interferon gamma Human genes 0.000 description 20
- 101150082158 UL128 gene Proteins 0.000 description 20
- 239000003795 chemical substances by application Substances 0.000 description 20
- 230000005847 immunogenicity Effects 0.000 description 20
- 230000002685 pulmonary effect Effects 0.000 description 20
- 230000003902 lesion Effects 0.000 description 19
- 210000005259 peripheral blood Anatomy 0.000 description 19
- 239000011886 peripheral blood Substances 0.000 description 19
- 230000002829 reductive effect Effects 0.000 description 19
- 210000002919 epithelial cell Anatomy 0.000 description 18
- 238000010186 staining Methods 0.000 description 17
- 210000004369 blood Anatomy 0.000 description 16
- 239000008280 blood Substances 0.000 description 16
- 238000011161 development Methods 0.000 description 16
- 230000018109 developmental process Effects 0.000 description 16
- 108091026890 Coding region Proteins 0.000 description 15
- 101710166488 6 kDa early secretory antigenic target Proteins 0.000 description 14
- 230000000295 complement effect Effects 0.000 description 14
- 230000008488 polyadenylation Effects 0.000 description 13
- 229920001184 polypeptide Polymers 0.000 description 13
- 238000012360 testing method Methods 0.000 description 13
- 241000894006 Bacteria Species 0.000 description 12
- 108020004414 DNA Proteins 0.000 description 12
- 102000003886 Glycoproteins Human genes 0.000 description 12
- 108090000288 Glycoproteins Proteins 0.000 description 12
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 12
- 210000002889 endothelial cell Anatomy 0.000 description 12
- 238000005259 measurement Methods 0.000 description 12
- 210000000952 spleen Anatomy 0.000 description 12
- 241000124008 Mammalia Species 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- 210000004185 liver Anatomy 0.000 description 11
- 239000000523 sample Substances 0.000 description 11
- 238000006467 substitution reaction Methods 0.000 description 11
- 241000282693 Cercopithecidae Species 0.000 description 10
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 10
- 101001057048 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) ESAT-6-like protein EsxB Proteins 0.000 description 10
- 101150096955 US6 gene Proteins 0.000 description 10
- 230000002238 attenuated effect Effects 0.000 description 10
- 230000001580 bacterial effect Effects 0.000 description 10
- 210000002950 fibroblast Anatomy 0.000 description 10
- 238000009472 formulation Methods 0.000 description 10
- 210000003734 kidney Anatomy 0.000 description 10
- 238000004519 manufacturing process Methods 0.000 description 10
- 238000001890 transfection Methods 0.000 description 10
- 239000002671 adjuvant Substances 0.000 description 9
- 239000000443 aerosol Substances 0.000 description 9
- 230000002068 genetic effect Effects 0.000 description 9
- 102000040430 polynucleotide Human genes 0.000 description 9
- 108091033319 polynucleotide Proteins 0.000 description 9
- 239000002157 polynucleotide Substances 0.000 description 9
- 230000001105 regulatory effect Effects 0.000 description 9
- 210000000115 thoracic cavity Anatomy 0.000 description 9
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 8
- 238000013459 approach Methods 0.000 description 8
- 238000004422 calculation algorithm Methods 0.000 description 8
- 230000005101 cell tropism Effects 0.000 description 8
- 230000002085 persistent effect Effects 0.000 description 8
- 239000013612 plasmid Substances 0.000 description 8
- 230000001681 protective effect Effects 0.000 description 8
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 7
- 108010002350 Interleukin-2 Proteins 0.000 description 7
- 101100395578 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) hrp1 gene Proteins 0.000 description 7
- 108010076504 Protein Sorting Signals Proteins 0.000 description 7
- 230000000875 corresponding effect Effects 0.000 description 7
- 230000004069 differentiation Effects 0.000 description 7
- 239000012636 effector Substances 0.000 description 7
- 238000009396 hybridization Methods 0.000 description 7
- 238000003780 insertion Methods 0.000 description 7
- 230000037431 insertion Effects 0.000 description 7
- 208000024191 minimally invasive lung adenocarcinoma Diseases 0.000 description 7
- 210000000056 organ Anatomy 0.000 description 7
- 230000001717 pathogenic effect Effects 0.000 description 7
- 239000000546 pharmaceutical excipient Substances 0.000 description 7
- 230000009467 reduction Effects 0.000 description 7
- 206010011831 Cytomegalovirus infection Diseases 0.000 description 6
- 239000004698 Polyethylene Substances 0.000 description 6
- 238000007792 addition Methods 0.000 description 6
- 230000000903 blocking effect Effects 0.000 description 6
- 230000008859 change Effects 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 6
- 239000003623 enhancer Substances 0.000 description 6
- 230000001976 improved effect Effects 0.000 description 6
- 239000002502 liposome Substances 0.000 description 6
- 230000000750 progressive effect Effects 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 108020004705 Codon Proteins 0.000 description 5
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 5
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 5
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 5
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 5
- 241000282560 Macaca mulatta Species 0.000 description 5
- 108010076039 Polyproteins Proteins 0.000 description 5
- 241000288906 Primates Species 0.000 description 5
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 5
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 5
- 102100022203 Tumor necrosis factor receptor superfamily member 25 Human genes 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 230000002596 correlated effect Effects 0.000 description 5
- 101150036876 cre gene Proteins 0.000 description 5
- 230000005750 disease progression Effects 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 101150079015 esxB gene Proteins 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 230000002163 immunogen Effects 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 230000001939 inductive effect Effects 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 210000003071 memory t lymphocyte Anatomy 0.000 description 5
- 108091079658 miR-142-1 stem-loop Proteins 0.000 description 5
- 108091071830 miR-142-2 stem-loop Proteins 0.000 description 5
- 239000002674 ointment Substances 0.000 description 5
- 244000052769 pathogen Species 0.000 description 5
- 230000002093 peripheral effect Effects 0.000 description 5
- 230000002265 prevention Effects 0.000 description 5
- 230000007420 reactivation Effects 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 239000000725 suspension Substances 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 4
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 4
- 241000282553 Macaca Species 0.000 description 4
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 4
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 4
- 108700019146 Transgenes Proteins 0.000 description 4
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 4
- 230000001154 acute effect Effects 0.000 description 4
- 238000010171 animal model Methods 0.000 description 4
- 230000001186 cumulative effect Effects 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 4
- 210000005161 hepatic lobe Anatomy 0.000 description 4
- 238000010231 histologic analysis Methods 0.000 description 4
- 230000001900 immune effect Effects 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 150000002632 lipids Chemical class 0.000 description 4
- 210000004698 lymphocyte Anatomy 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 210000005087 mononuclear cell Anatomy 0.000 description 4
- 210000002569 neuron Anatomy 0.000 description 4
- 210000000496 pancreas Anatomy 0.000 description 4
- 229920000447 polyanionic polymer Polymers 0.000 description 4
- 229920002643 polyglutamic acid Polymers 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 238000013268 sustained release Methods 0.000 description 4
- 239000012730 sustained-release form Substances 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 4
- 230000000699 topical effect Effects 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- 108020005345 3' Untranslated Regions Proteins 0.000 description 3
- 102100036301 C-C chemokine receptor type 7 Human genes 0.000 description 3
- 102100021933 C-C motif chemokine 25 Human genes 0.000 description 3
- 101710112540 C-C motif chemokine 25 Proteins 0.000 description 3
- 108091035707 Consensus sequence Proteins 0.000 description 3
- 108010051219 Cre recombinase Proteins 0.000 description 3
- 206010061818 Disease progression Diseases 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101000716065 Homo sapiens C-C chemokine receptor type 7 Proteins 0.000 description 3
- 101000679903 Homo sapiens Tumor necrosis factor receptor superfamily member 25 Proteins 0.000 description 3
- 101100195396 Human cytomegalovirus (strain Merlin) RL11 gene Proteins 0.000 description 3
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- 108010065805 Interleukin-12 Proteins 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- 125000000393 L-methionino group Chemical group [H]OC(=O)[C@@]([H])(N([H])[*])C([H])([H])C(SC([H])([H])[H])([H])[H] 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 241000218605 Macacine betaherpesvirus 3 Species 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 241000186359 Mycobacterium Species 0.000 description 3
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 3
- 206010028980 Neoplasm Diseases 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 238000010240 RT-PCR analysis Methods 0.000 description 3
- 241000700584 Simplexvirus Species 0.000 description 3
- 108091081024 Start codon Proteins 0.000 description 3
- 210000000662 T-lymphocyte subset Anatomy 0.000 description 3
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 3
- 102100040112 Tumor necrosis factor receptor superfamily member 10B Human genes 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 238000001793 Wilcoxon signed-rank test Methods 0.000 description 3
- 230000006229 amino acid addition Effects 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000002146 bilateral effect Effects 0.000 description 3
- 230000005540 biological transmission Effects 0.000 description 3
- 238000001574 biopsy Methods 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 210000000038 chest Anatomy 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 238000011109 contamination Methods 0.000 description 3
- BFMYDTVEBKDAKJ-UHFFFAOYSA-L disodium;(2',7'-dibromo-3',6'-dioxido-3-oxospiro[2-benzofuran-1,9'-xanthene]-4'-yl)mercury;hydrate Chemical compound O.[Na+].[Na+].O1C(=O)C2=CC=CC=C2C21C1=CC(Br)=C([O-])C([Hg])=C1OC1=C2C=C(Br)C([O-])=C1 BFMYDTVEBKDAKJ-UHFFFAOYSA-L 0.000 description 3
- 238000009826 distribution Methods 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 210000001163 endosome Anatomy 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000036039 immunity Effects 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 210000000265 leukocyte Anatomy 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 239000012669 liquid formulation Substances 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 108091056924 miR-124 stem-loop Proteins 0.000 description 3
- 210000000066 myeloid cell Anatomy 0.000 description 3
- 230000007935 neutral effect Effects 0.000 description 3
- 238000007481 next generation sequencing Methods 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- 230000007170 pathology Effects 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 208000008128 pulmonary tuberculosis Diseases 0.000 description 3
- 238000011002 quantification Methods 0.000 description 3
- 238000011084 recovery Methods 0.000 description 3
- 210000001525 retina Anatomy 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 238000007619 statistical method Methods 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 210000000779 thoracic wall Anatomy 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 2
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- 102100040149 Adenylyl-sulfate kinase Human genes 0.000 description 2
- 108010054404 Adenylyl-sulfate kinase Proteins 0.000 description 2
- 238000012935 Averaging Methods 0.000 description 2
- 102100021942 C-C motif chemokine 28 Human genes 0.000 description 2
- BHPQYMZQTOCNFJ-UHFFFAOYSA-N Calcium cation Chemical compound [Ca+2] BHPQYMZQTOCNFJ-UHFFFAOYSA-N 0.000 description 2
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 2
- 208000035473 Communicable disease Diseases 0.000 description 2
- 206010062343 Congenital infection Diseases 0.000 description 2
- 206010011224 Cough Diseases 0.000 description 2
- 208000000059 Dyspnea Diseases 0.000 description 2
- 206010013975 Dyspnoeas Diseases 0.000 description 2
- 238000011510 Elispot assay Methods 0.000 description 2
- 241000991587 Enterovirus C Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 101000897477 Homo sapiens C-C motif chemokine 28 Proteins 0.000 description 2
- 101000610604 Homo sapiens Tumor necrosis factor receptor superfamily member 10B Proteins 0.000 description 2
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 2
- 108010000521 Human Growth Hormone Proteins 0.000 description 2
- 102000002265 Human Growth Hormone Human genes 0.000 description 2
- 239000000854 Human Growth Hormone Substances 0.000 description 2
- 108090000467 Interferon-beta Proteins 0.000 description 2
- 102000003810 Interleukin-18 Human genes 0.000 description 2
- 108090000171 Interleukin-18 Proteins 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 102000004388 Interleukin-4 Human genes 0.000 description 2
- 108010002616 Interleukin-5 Proteins 0.000 description 2
- 102100039897 Interleukin-5 Human genes 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 102000043131 MHC class II family Human genes 0.000 description 2
- 108091054438 MHC class II family Proteins 0.000 description 2
- 241000186367 Mycobacterium avium Species 0.000 description 2
- 241000186365 Mycobacterium fortuitum Species 0.000 description 2
- 241000186363 Mycobacterium kansasii Species 0.000 description 2
- 241000186362 Mycobacterium leprae Species 0.000 description 2
- 101150098384 NEC2 gene Proteins 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 206010035600 Pleural fibrosis Diseases 0.000 description 2
- 206010035664 Pneumonia Diseases 0.000 description 2
- 108091030071 RNAI Proteins 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 208000035415 Reinfection Diseases 0.000 description 2
- 108020004459 Small interfering RNA Proteins 0.000 description 2
- FKNQFGJONOIPTF-UHFFFAOYSA-N Sodium cation Chemical compound [Na+] FKNQFGJONOIPTF-UHFFFAOYSA-N 0.000 description 2
- 108700012920 TNF Proteins 0.000 description 2
- 101150056647 TNFRSF4 gene Proteins 0.000 description 2
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 2
- 102100040403 Tumor necrosis factor receptor superfamily member 6 Human genes 0.000 description 2
- 101150087840 UL11 gene Proteins 0.000 description 2
- 101150085237 UL36 gene Proteins 0.000 description 2
- 101150033660 UL6 gene Proteins 0.000 description 2
- 101150095805 UL7 gene Proteins 0.000 description 2
- 101150026859 UL9 gene Proteins 0.000 description 2
- 108700005077 Viral Genes Proteins 0.000 description 2
- 108010067390 Viral Proteins Proteins 0.000 description 2
- 230000003187 abdominal effect Effects 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 208000036981 active tuberculosis Diseases 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 230000030741 antigen processing and presentation Effects 0.000 description 2
- 230000014102 antigen processing and presentation of exogenous peptide antigen via MHC class I Effects 0.000 description 2
- 230000036528 appetite Effects 0.000 description 2
- 235000019789 appetite Nutrition 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 239000007900 aqueous suspension Substances 0.000 description 2
- 239000008135 aqueous vehicle Substances 0.000 description 2
- 229960000190 bacillus calmette–guérin vaccine Drugs 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 108010006025 bovine growth hormone Proteins 0.000 description 2
- 210000000621 bronchi Anatomy 0.000 description 2
- 229910001424 calcium ion Inorganic materials 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 230000036755 cellular response Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 230000001332 colony forming effect Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- CVSVTCORWBXHQV-UHFFFAOYSA-N creatine Chemical compound NC(=[NH2+])N(C)CC([O-])=O CVSVTCORWBXHQV-UHFFFAOYSA-N 0.000 description 2
- 230000000120 cytopathologic effect Effects 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 230000002939 deleterious effect Effects 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 238000002224 dissection Methods 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- LZCLXQDLBQLTDK-UHFFFAOYSA-N ethyl 2-hydroxypropanoate Chemical compound CCOC(=O)C(C)O LZCLXQDLBQLTDK-UHFFFAOYSA-N 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 230000009368 gene silencing by RNA Effects 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 238000001036 glow-discharge mass spectrometry Methods 0.000 description 2
- 208000010758 granulomatous inflammation Diseases 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 210000003494 hepatocyte Anatomy 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 229920002674 hyaluronan Polymers 0.000 description 2
- 229960003160 hyaluronic acid Drugs 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 239000012216 imaging agent Substances 0.000 description 2
- 230000002519 immonomodulatory effect Effects 0.000 description 2
- 238000003119 immunoblot Methods 0.000 description 2
- 230000001024 immunotherapeutic effect Effects 0.000 description 2
- 230000001771 impaired effect Effects 0.000 description 2
- 239000007943 implant Substances 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 206010022000 influenza Diseases 0.000 description 2
- 108010028930 invariant chain Proteins 0.000 description 2
- DRAVOWXCEBXPTN-UHFFFAOYSA-N isoguanine Chemical compound NC1=NC(=O)NC2=C1NC=N2 DRAVOWXCEBXPTN-UHFFFAOYSA-N 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 238000012417 linear regression Methods 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 238000010234 longitudinal analysis Methods 0.000 description 2
- 239000006210 lotion Substances 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 229940071648 metered dose inhaler Drugs 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 2
- 230000000877 morphologic effect Effects 0.000 description 2
- 125000001446 muramyl group Chemical group N[C@@H](C=O)[C@@H](O[C@@H](C(=O)*)C)[C@H](O)[C@H](O)CO 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- JXTPJDDICSTXJX-UHFFFAOYSA-N n-Triacontane Natural products CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC JXTPJDDICSTXJX-UHFFFAOYSA-N 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- 230000017074 necrotic cell death Effects 0.000 description 2
- 238000010606 normalization Methods 0.000 description 2
- 238000006213 oxygenation reaction Methods 0.000 description 2
- VYNDHICBIRRPFP-UHFFFAOYSA-N pacific blue Chemical compound FC1=C(O)C(F)=C2OC(=O)C(C(=O)O)=CC2=C1 VYNDHICBIRRPFP-UHFFFAOYSA-N 0.000 description 2
- 230000001936 parietal effect Effects 0.000 description 2
- 230000008506 pathogenesis Effects 0.000 description 2
- 230000007918 pathogenicity Effects 0.000 description 2
- 230000002688 persistence Effects 0.000 description 2
- 210000004224 pleura Anatomy 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 150000004053 quinones Chemical class 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 229910001415 sodium ion Inorganic materials 0.000 description 2
- 230000003393 splenic effect Effects 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 229940032094 squalane Drugs 0.000 description 2
- 229940031439 squalene Drugs 0.000 description 2
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 230000000153 supplemental effect Effects 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 229940113082 thymine Drugs 0.000 description 2
- 210000003437 trachea Anatomy 0.000 description 2
- 208000027930 type IV hypersensitivity disease Diseases 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 229940035893 uracil Drugs 0.000 description 2
- 210000002700 urine Anatomy 0.000 description 2
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- SGKRLCUYIXIAHR-AKNGSSGZSA-N (4s,4ar,5s,5ar,6r,12ar)-4-(dimethylamino)-1,5,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1=CC=C2[C@H](C)[C@@H]([C@H](O)[C@@H]3[C@](C(O)=C(C(N)=O)C(=O)[C@H]3N(C)C)(O)C3=O)C3=C(O)C2=C1O SGKRLCUYIXIAHR-AKNGSSGZSA-N 0.000 description 1
- GHOKWGTUZJEAQD-ZETCQYMHSA-N (D)-(+)-Pantothenic acid Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-ZETCQYMHSA-N 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- 108091064702 1 family Proteins 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- FZWBNHMXJMCXLU-UHFFFAOYSA-N 2,3,4,5-tetrahydroxy-6-[3,4,5-trihydroxy-6-[[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]oxan-2-yl]oxyhexanal Chemical compound OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OCC(O)C(O)C(O)C(O)C=O)O1 FZWBNHMXJMCXLU-UHFFFAOYSA-N 0.000 description 1
- XQCZBXHVTFVIFE-UHFFFAOYSA-N 2-amino-4-hydroxypyrimidine Chemical compound NC1=NC=CC(O)=N1 XQCZBXHVTFVIFE-UHFFFAOYSA-N 0.000 description 1
- 101150090724 3 gene Proteins 0.000 description 1
- HIQIXEFWDLTDED-UHFFFAOYSA-N 4-hydroxy-1-piperidin-4-ylpyrrolidin-2-one Chemical compound O=C1CC(O)CN1C1CCNCC1 HIQIXEFWDLTDED-UHFFFAOYSA-N 0.000 description 1
- 108020003589 5' Untranslated Regions Proteins 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 241001479434 Agfa Species 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 102100030346 Antigen peptide transporter 1 Human genes 0.000 description 1
- 102100030343 Antigen peptide transporter 2 Human genes 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 208000034048 Asymptomatic disease Diseases 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 108091032955 Bacterial small RNA Proteins 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 102100023995 Beta-nerve growth factor Human genes 0.000 description 1
- 102100023109 Bile acyl-CoA synthetase Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 101001075376 Bos taurus Gamma-glutamyl hydrolase Proteins 0.000 description 1
- 208000023081 Buruli ulcer disease Diseases 0.000 description 1
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 1
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 1
- 102100021936 C-C motif chemokine 27 Human genes 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 108010084313 CD58 Antigens Proteins 0.000 description 1
- 101150072608 CVC1 gene Proteins 0.000 description 1
- 101150010802 CVC2 gene Proteins 0.000 description 1
- 101100289995 Caenorhabditis elegans mac-1 gene Proteins 0.000 description 1
- 101100348617 Candida albicans (strain SC5314 / ATCC MYA-2876) NIK1 gene Proteins 0.000 description 1
- 241000008374 Capirona Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 241000010804 Caulobacter vibrioides Species 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 108010083675 Chemokine CCL27 Proteins 0.000 description 1
- 101000709520 Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) Atypical response regulator protein ChxR Proteins 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 241000193468 Clostridium perfringens Species 0.000 description 1
- 108010065693 Clostridium perfringens theta-toxin Proteins 0.000 description 1
- 101710094648 Coat protein Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 206010010144 Completed suicide Diseases 0.000 description 1
- 206010010356 Congenital anomaly Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 108010037462 Cyclooxygenase 2 Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 101150026402 DBP gene Proteins 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 101150040913 DUT gene Proteins 0.000 description 1
- 206010012373 Depressed level of consciousness Diseases 0.000 description 1
- 101710088341 Dermatopontin Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010013453 Disseminated tuberculosis Diseases 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 108010024212 E-Selectin Proteins 0.000 description 1
- 102100023471 E-selectin Human genes 0.000 description 1
- 108010031111 EBV-encoded nuclear antigen 1 Proteins 0.000 description 1
- 101710130332 ETS domain-containing protein Elk-4 Proteins 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 206010015548 Euthanasia Diseases 0.000 description 1
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 1
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 1
- 101150065273 GN gene Proteins 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 208000000351 Gastrointestinal Tuberculosis Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108700023863 Gene Components Proteins 0.000 description 1
- 101150109586 Gk gene Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Polymers OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 101150064935 HELI gene Proteins 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 1
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 208000000616 Hemoptysis Diseases 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 101000899111 Homo sapiens Hemoglobin subunit beta Proteins 0.000 description 1
- 101000994375 Homo sapiens Integrin alpha-4 Proteins 0.000 description 1
- 101000991061 Homo sapiens MHC class I polypeptide-related sequence B Proteins 0.000 description 1
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 1
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 1
- 101000582320 Homo sapiens Neurogenic differentiation factor 6 Proteins 0.000 description 1
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101100100117 Homo sapiens TNFRSF10B gene Proteins 0.000 description 1
- 101000763579 Homo sapiens Toll-like receptor 1 Proteins 0.000 description 1
- 101001050288 Homo sapiens Transcription factor Jun Proteins 0.000 description 1
- 101000610609 Homo sapiens Tumor necrosis factor receptor superfamily member 10D Proteins 0.000 description 1
- 101000679921 Homo sapiens Tumor necrosis factor receptor superfamily member 21 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 1
- 101100048383 Human cytomegalovirus (strain AD169) UL60 gene Proteins 0.000 description 1
- 101100048384 Human cytomegalovirus (strain AD169) UL61 gene Proteins 0.000 description 1
- 101100155370 Human cytomegalovirus (strain AD169) UL90 gene Proteins 0.000 description 1
- 101900003124 Human cytomegalovirus Envelope protein UL128 Proteins 0.000 description 1
- 101900326344 Human cytomegalovirus Membrane protein UL148 Proteins 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 1
- 235000003332 Ilex aquifolium Nutrition 0.000 description 1
- 241000209027 Ilex aquifolium Species 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 102100032818 Integrin alpha-4 Human genes 0.000 description 1
- 102100022339 Integrin alpha-L Human genes 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 108010064600 Intercellular Adhesion Molecule-3 Proteins 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 101710148794 Intercellular adhesion molecule 2 Proteins 0.000 description 1
- 102100037872 Intercellular adhesion molecule 2 Human genes 0.000 description 1
- 102100037871 Intercellular adhesion molecule 3 Human genes 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108091029795 Intergenic region Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102100036342 Interleukin-1 receptor-associated kinase 1 Human genes 0.000 description 1
- 101710199015 Interleukin-1 receptor-associated kinase 1 Proteins 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 102000000704 Interleukin-7 Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 108020003285 Isocitrate lyase Proteins 0.000 description 1
- 108010055717 JNK Mitogen-Activated Protein Kinases Proteins 0.000 description 1
- 102000019145 JUN kinase activity proteins Human genes 0.000 description 1
- 101150069255 KLRC1 gene Proteins 0.000 description 1
- 101150074862 KLRC3 gene Proteins 0.000 description 1
- 101150018199 KLRC4 gene Proteins 0.000 description 1
- YQEZLKZALYSWHR-UHFFFAOYSA-N Ketamine Chemical compound C=1C=CC=C(Cl)C=1C1(NC)CCCCC1=O YQEZLKZALYSWHR-UHFFFAOYSA-N 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical compound CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- 108010092694 L-Selectin Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical compound OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Natural products CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- 102100033467 L-selectin Human genes 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 206010024229 Leprosy Diseases 0.000 description 1
- 206010024264 Lethargy Diseases 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 208000008771 Lymphadenopathy Diseases 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 101150047390 MCP gene Proteins 0.000 description 1
- 102100030301 MHC class I polypeptide-related sequence A Human genes 0.000 description 1
- 102100030300 MHC class I polypeptide-related sequence B Human genes 0.000 description 1
- 101100404845 Macaca mulatta NKG2A gene Proteins 0.000 description 1
- 241000701076 Macacine alphaherpesvirus 1 Species 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100028123 Macrophage colony-stimulating factor 1 Human genes 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 238000000585 Mann–Whitney U test Methods 0.000 description 1
- 108010023335 Member 2 Subfamily B ATP Binding Cassette Transporter Proteins 0.000 description 1
- 108010060408 Member 25 Tumor Necrosis Factor Receptors Proteins 0.000 description 1
- 208000036626 Mental retardation Diseases 0.000 description 1
- 101100038266 Methanothermobacter thermautotrophicus (strain Winter) rpo2N gene Proteins 0.000 description 1
- 108091028080 MiR-132 Proteins 0.000 description 1
- 108091033773 MiR-155 Proteins 0.000 description 1
- 108091062140 Mir-223 Proteins 0.000 description 1
- 241000187478 Mycobacterium chelonae Species 0.000 description 1
- 241001532526 Mycobacterium gallinarum Species 0.000 description 1
- 241001147828 Mycobacterium haemophilum Species 0.000 description 1
- 241000187492 Mycobacterium marinum Species 0.000 description 1
- 241000187490 Mycobacterium scrofulaceum Species 0.000 description 1
- 241001049988 Mycobacterium tuberculosis H37Ra Species 0.000 description 1
- 241001646725 Mycobacterium tuberculosis H37Rv Species 0.000 description 1
- 241000187917 Mycobacterium ulcerans Species 0.000 description 1
- 241000187644 Mycobacterium vaccae Species 0.000 description 1
- 241000187494 Mycobacterium xenopi Species 0.000 description 1
- 102000010168 Myeloid Differentiation Factor 88 Human genes 0.000 description 1
- 108010077432 Myeloid Differentiation Factor 88 Proteins 0.000 description 1
- 102000003505 Myosin Human genes 0.000 description 1
- 108060008487 Myosin Proteins 0.000 description 1
- FXHOOIRPVKKKFG-UHFFFAOYSA-N N,N-Dimethylacetamide Chemical compound CN(C)C(C)=O FXHOOIRPVKKKFG-UHFFFAOYSA-N 0.000 description 1
- 101150041636 NEC1 gene Proteins 0.000 description 1
- 102100022682 NKG2-A/NKG2-B type II integral membrane protein Human genes 0.000 description 1
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 1
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 1
- 102100022701 NKG2-E type II integral membrane protein Human genes 0.000 description 1
- 102100022700 NKG2-F type II integral membrane protein Human genes 0.000 description 1
- 108010025020 Nerve Growth Factor Proteins 0.000 description 1
- 102100030589 Neurogenic differentiation factor 6 Human genes 0.000 description 1
- 208000008457 Neurologic Manifestations Diseases 0.000 description 1
- 108091060545 Nonsense suppressor Proteins 0.000 description 1
- 108010061100 Nucleoproteins Proteins 0.000 description 1
- 241001452677 Ogataea methanolica Species 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 108010035766 P-Selectin Proteins 0.000 description 1
- 102100023472 P-selectin Human genes 0.000 description 1
- 102100032341 PCNA-interacting partner Human genes 0.000 description 1
- 101710196737 PCNA-interacting partner Proteins 0.000 description 1
- 101150044441 PECAM1 gene Proteins 0.000 description 1
- 101150034459 Parpbp gene Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 206010035588 Pleural adhesion Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102100038567 Properdin Human genes 0.000 description 1
- 102100038280 Prostaglandin G/H synthase 2 Human genes 0.000 description 1
- 102100028688 Putative glycosylation-dependent cell adhesion molecule 1 Human genes 0.000 description 1
- 108091078291 RL11 family Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101710138742 Receptor-type tyrosine-protein phosphatase H Proteins 0.000 description 1
- 206010038910 Retinitis Diseases 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 1
- 101100007329 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) COS1 gene Proteins 0.000 description 1
- 101100221606 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) COS7 gene Proteins 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 102400000830 Saposin-B Human genes 0.000 description 1
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 1
- 208000033712 Self injurious behaviour Diseases 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000713311 Simian immunodeficiency virus Species 0.000 description 1
- 241000256251 Spodoptera frugiperda Species 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 206010042566 Superinfection Diseases 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 238000011053 TCID50 method Methods 0.000 description 1
- 102000003714 TNF receptor-associated factor 6 Human genes 0.000 description 1
- 108090000009 TNF receptor-associated factor 6 Proteins 0.000 description 1
- 101150110861 TRM2 gene Proteins 0.000 description 1
- 101150048584 TRM3 gene Proteins 0.000 description 1
- 101150102071 TRX1 gene Proteins 0.000 description 1
- 101150037769 TRX2 gene Proteins 0.000 description 1
- 101800000849 Tachykinin-associated peptide 2 Proteins 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102100027010 Toll-like receptor 1 Human genes 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 102100023132 Transcription factor Jun Human genes 0.000 description 1
- 241000255985 Trichoplusia Species 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 102100040110 Tumor necrosis factor receptor superfamily member 10D Human genes 0.000 description 1
- 102100022205 Tumor necrosis factor receptor superfamily member 21 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 206010053613 Type IV hypersensitivity reaction Diseases 0.000 description 1
- 101150018081 UL102 gene Proteins 0.000 description 1
- 101150023740 UL104 gene Proteins 0.000 description 1
- 101150068544 UL122 gene Proteins 0.000 description 1
- 101150087430 UL34 gene Proteins 0.000 description 1
- 101150036065 UL37 gene Proteins 0.000 description 1
- 101150117989 UL46 gene Proteins 0.000 description 1
- 101150004685 UL48 gene Proteins 0.000 description 1
- 101150066971 UL49 gene Proteins 0.000 description 1
- 101150063032 UL51 gene Proteins 0.000 description 1
- 101150011902 UL52 gene Proteins 0.000 description 1
- 101150009795 UL54 gene Proteins 0.000 description 1
- 101150081415 UL55 gene Proteins 0.000 description 1
- 101150015312 UL56 gene Proteins 0.000 description 1
- 101150056567 UL70 gene Proteins 0.000 description 1
- 101150113240 UL71 gene Proteins 0.000 description 1
- 101150073487 UL76 gene Proteins 0.000 description 1
- 101150016730 UL79 gene Proteins 0.000 description 1
- 101150075622 UL80 gene Proteins 0.000 description 1
- 101150094182 UL84 gene Proteins 0.000 description 1
- 101150041688 UL87 gene Proteins 0.000 description 1
- 101150051392 UL91 gene Proteins 0.000 description 1
- 101150104254 UL92 gene Proteins 0.000 description 1
- 101150055346 UL95 gene Proteins 0.000 description 1
- 101150004042 UL96 gene Proteins 0.000 description 1
- 101150002298 UL98 gene Proteins 0.000 description 1
- 101150003185 US12 gene Proteins 0.000 description 1
- 101150065606 US13 gene Proteins 0.000 description 1
- 101150004205 US14 gene Proteins 0.000 description 1
- 101710153113 Unique short US2 glycoprotein Proteins 0.000 description 1
- 101710126011 Unique short US6 glycoprotein Proteins 0.000 description 1
- 108091023045 Untranslated Region Proteins 0.000 description 1
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 206010047139 Vasoconstriction Diseases 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 208000013228 adenopathy Diseases 0.000 description 1
- 230000000240 adjuvant effect Effects 0.000 description 1
- 230000001919 adrenal effect Effects 0.000 description 1
- 238000012382 advanced drug delivery Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 238000013103 analytical ultracentrifugation Methods 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 210000000709 aorta Anatomy 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- JPIYZTWMUGTEHX-UHFFFAOYSA-N auramine O free base Chemical compound C1=CC(N(C)C)=CC=C1C(=N)C1=CC=C(N(C)C)C=C1 JPIYZTWMUGTEHX-UHFFFAOYSA-N 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000008956 bacterial persistence Effects 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-FPRJBGLDSA-N beta-D-galactose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-FPRJBGLDSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 238000003766 bioinformatics method Methods 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 238000004820 blood count Methods 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 235000012206 bottled water Nutrition 0.000 description 1
- KQNZDYYTLMIZCT-KQPMLPITSA-N brefeldin A Chemical compound O[C@@H]1\C=C\C(=O)O[C@@H](C)CCC\C=C\[C@@H]2C[C@H](O)C[C@H]21 KQNZDYYTLMIZCT-KQPMLPITSA-N 0.000 description 1
- JUMGSHROWPPKFX-UHFFFAOYSA-N brefeldin-A Natural products CC1CCCC=CC2(C)CC(O)CC2(C)C(O)C=CC(=O)O1 JUMGSHROWPPKFX-UHFFFAOYSA-N 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 230000021523 carboxylation Effects 0.000 description 1
- 238000006473 carboxylation reaction Methods 0.000 description 1
- 201000004827 cardiac tuberculosis Diseases 0.000 description 1
- 235000010418 carrageenan Nutrition 0.000 description 1
- 239000000679 carrageenan Substances 0.000 description 1
- 229920001525 carrageenan Polymers 0.000 description 1
- 229940113118 carrageenan Drugs 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- 239000011651 chromium Substances 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229940028617 conventional vaccine Drugs 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 229960003624 creatine Drugs 0.000 description 1
- 239000006046 creatine Substances 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 208000020023 cytomegalovirus pneumonia Diseases 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 229960003722 doxycycline Drugs 0.000 description 1
- 239000003651 drinking water Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 230000005684 electric field Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 1
- 230000010502 episomal replication Effects 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229940116333 ethyl lactate Drugs 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000035611 feeding Effects 0.000 description 1
- 229940126864 fibroblast growth factor Drugs 0.000 description 1
- 239000012997 ficoll-paque Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 235000021022 fresh fruits Nutrition 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 101150029683 gB gene Proteins 0.000 description 1
- 101150055782 gH gene Proteins 0.000 description 1
- 101150040331 gM gene Proteins 0.000 description 1
- 229940044627 gamma-interferon Drugs 0.000 description 1
- 238000004868 gas analysis Methods 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000030279 gene silencing Effects 0.000 description 1
- 238000012252 genetic analysis Methods 0.000 description 1
- 230000000762 glandular Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 230000005182 global health Effects 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 230000033687 granuloma formation Effects 0.000 description 1
- 239000007902 hard capsule Substances 0.000 description 1
- 230000003862 health status Effects 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 230000002962 histologic effect Effects 0.000 description 1
- 230000003118 histopathologic effect Effects 0.000 description 1
- 230000005745 host immune response Effects 0.000 description 1
- 208000024697 human cytomegalovirus infection Diseases 0.000 description 1
- 235000020256 human milk Nutrition 0.000 description 1
- 210000004251 human milk Anatomy 0.000 description 1
- 244000052637 human pathogen Species 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 230000036571 hydration Effects 0.000 description 1
- 238000006703 hydration reaction Methods 0.000 description 1
- 230000009610 hypersensitivity Effects 0.000 description 1
- 230000002631 hypothermal effect Effects 0.000 description 1
- 230000001146 hypoxic effect Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000008629 immune suppression Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 208000000509 infertility Diseases 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 208000021267 infertility disease Diseases 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000010468 interferon response Effects 0.000 description 1
- 230000004073 interleukin-2 production Effects 0.000 description 1
- 238000011246 intracellular protein detection Methods 0.000 description 1
- 238000010212 intracellular staining Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- XQZXYNRDCRIARQ-LURJTMIESA-N iopamidol Chemical compound C[C@H](O)C(=O)NC1=C(I)C(C(=O)NC(CO)CO)=C(I)C(C(=O)NC(CO)CO)=C1I XQZXYNRDCRIARQ-LURJTMIESA-N 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 239000000644 isotonic solution Substances 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 229960003299 ketamine Drugs 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 238000011551 log transformation method Methods 0.000 description 1
- 150000004668 long chain fatty acids Chemical class 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 201000007227 lymph node tuberculosis Diseases 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 210000005015 mediastinal lymph node Anatomy 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 108091064282 miR-125 stem-loop Proteins 0.000 description 1
- 108091037066 miR-125-1 stem-loop Proteins 0.000 description 1
- 108091062107 miR-125-2 stem-loop Proteins 0.000 description 1
- 108091079767 miR-125-3 stem-loop Proteins 0.000 description 1
- 108091032320 miR-146 stem-loop Proteins 0.000 description 1
- 108091024530 miR-146a stem-loop Proteins 0.000 description 1
- 108091062762 miR-21 stem-loop Proteins 0.000 description 1
- 108091041631 miR-21-1 stem-loop Proteins 0.000 description 1
- 108091044442 miR-21-2 stem-loop Proteins 0.000 description 1
- 108091050734 miR-652 stem-loop Proteins 0.000 description 1
- 108091032902 miR-93 stem-loop Proteins 0.000 description 1
- 239000010445 mica Substances 0.000 description 1
- 229910052618 mica group Inorganic materials 0.000 description 1
- 239000003595 mist Substances 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- CQDGTJPVBWZJAZ-UHFFFAOYSA-N monoethyl carbonate Chemical compound CCOC(O)=O CQDGTJPVBWZJAZ-UHFFFAOYSA-N 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 208000027531 mycobacterial infectious disease Diseases 0.000 description 1
- DAZSWUUAFHBCGE-KRWDZBQOSA-N n-[(2s)-3-methyl-1-oxo-1-pyrrolidin-1-ylbutan-2-yl]-3-phenylpropanamide Chemical compound N([C@@H](C(C)C)C(=O)N1CCCC1)C(=O)CCC1=CC=CC=C1 DAZSWUUAFHBCGE-KRWDZBQOSA-N 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 229940053128 nerve growth factor Drugs 0.000 description 1
- 210000003061 neural cell Anatomy 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000007971 neurological deficit Effects 0.000 description 1
- 108091027963 non-coding RNA Proteins 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 238000002671 oral rehydration therapy Methods 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 210000002741 palatine tonsil Anatomy 0.000 description 1
- 229940014662 pantothenate Drugs 0.000 description 1
- 235000019161 pantothenic acid Nutrition 0.000 description 1
- 239000011713 pantothenic acid Substances 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 229960001412 pentobarbital Drugs 0.000 description 1
- WEXRUCMBJFQVBZ-UHFFFAOYSA-N pentobarbital Chemical compound CCCC(C)C1(CC)C(=O)NC(=O)NC1=O WEXRUCMBJFQVBZ-UHFFFAOYSA-N 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 229940021222 peritoneal dialysis isotonic solution Drugs 0.000 description 1
- 230000008823 permeabilization Effects 0.000 description 1
- 239000008250 pharmaceutical cream Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 230000009894 physiological stress Effects 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 229960001539 poliomyelitis vaccine Drugs 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229920001343 polytetrafluoroethylene Polymers 0.000 description 1
- 239000004810 polytetrafluoroethylene Substances 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 235000019422 polyvinyl alcohol Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 238000011240 pooled analysis Methods 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 238000012809 post-inoculation Methods 0.000 description 1
- 238000009021 pre-vaccination Methods 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 108020003519 protein disulfide isomerase Proteins 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 238000002106 pulse oximetry Methods 0.000 description 1
- 239000002510 pyrogen Substances 0.000 description 1
- 239000002096 quantum dot Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 210000005000 reproductive tract Anatomy 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 238000010206 sensitivity analysis Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 101150117326 sigA gene Proteins 0.000 description 1
- 201000003196 skeletal tuberculosis Diseases 0.000 description 1
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 1
- 210000004872 soft tissue Anatomy 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 108010012704 sulfated glycoprotein p50 Proteins 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 208000032922 susceptibility to mycobacterium tuberculosis Diseases 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 208000008203 tachypnea Diseases 0.000 description 1
- 206010043089 tachypnoea Diseases 0.000 description 1
- 229940052907 telazol Drugs 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 229960001005 tuberculin Drugs 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 210000001635 urinary tract Anatomy 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 230000006444 vascular growth Effects 0.000 description 1
- 230000025033 vasoconstriction Effects 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 238000009423 ventilation Methods 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 239000000304 virulence factor Substances 0.000 description 1
- 230000007923 virulence factor Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 230000003313 weakening effect Effects 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- UHVMMEOXYDMDKI-JKYCWFKZSA-L zinc;1-(5-cyanopyridin-2-yl)-3-[(1s,2s)-2-(6-fluoro-2-hydroxy-3-propanoylphenyl)cyclopropyl]urea;diacetate Chemical compound [Zn+2].CC([O-])=O.CC([O-])=O.CCC(=O)C1=CC=C(F)C([C@H]2[C@H](C2)NC(=O)NC=2N=CC(=CC=2)C#N)=C1O UHVMMEOXYDMDKI-JKYCWFKZSA-L 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/04—Mycobacterium, e.g. Mycobacterium tuberculosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
- A61P31/06—Antibacterial agents for tuberculosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/35—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5256—Virus expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16111—Cytomegalovirus, e.g. human herpesvirus 5
- C12N2710/16141—Use of virus, viral particle or viral elements as a vector
- C12N2710/16143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16111—Cytomegalovirus, e.g. human herpesvirus 5
- C12N2710/16151—Methods of production or purification of viral material
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16111—Cytomegalovirus, e.g. human herpesvirus 5
- C12N2710/16171—Demonstrated in vivo effect
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/20—Pseudochromosomes, minichrosomosomes
- C12N2800/204—Pseudochromosomes, minichrosomosomes of bacterial origin, e.g. BAC
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/30—Vector systems comprising sequences for excision in presence of a recombinase, e.g. loxP or FRT
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Communicable Diseases (AREA)
- Pulmonology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Mycology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Virology (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
The present disclosure provides cytomegalovirus vectors encoding fusion proteins comprising
Description
Recombinant Cytomegalovirus Vectors As Vaccines For Tuberculosis
Field
The present disclosure is directed, in part, to cytomegalovirus vectors encoding fusion proteins comprising Mycobacterium tuberculosis (Mtb) antigens, nucleic acid molecules encoding the same, cytomegalovirus vectors comprising nucleic acid molecules, compositions comprising the same, and methods of eliciting an immune response against tuberculosis.
Background
Tuberculosis (TB) is a global health problem resulting in 8 million new cases and 2 million deaths each year. The emergence of multi-drug and totally-drug resistant strains of TB only makes this problem more severe. The life cycle of Mtb has 3 stages. In the acute phase following initial infection the bacteria replicate in the host and virulence factors are expressed, leading to the generation of an immune response by the host. As the immune response begins to control the infection, the Mtb enters a latent, asymptomatic state in which the bacteria become non-replicating and are encased in granulomas. The bacterium can persist in this latent state in infected individuals for many years, making diagnosis and treatment of disease difficult. In some cases, the bacteria are reactivated and begin replicating again, leading back to the disease state. Reactivation can occur for numerous reasons, including immune suppression caused by diseases such as HIV, treatments such as chemotherapy, or the weakening of the immune system due to aging. An estimated 2 billion people are latently infected with Mtb worldwide, and reactivation of latent Mtb accounts for most new cases of active TB disease. Reactivation is associated with inflammation, necrosis and cavitation of the lung, a process that results in draining of the lesions into the bronchus. Aerosols generated when individuals with bronchial lesions cough causes dissemination of the Mtb organism to uninfected, susceptible persons, and the transmission cycle is thus maintained.
The only currently available vaccine against TB, Mycobacterium bo vis (Bacille
Calmette-Guerin) (BCG), was first introduced in 1921. BCG has been widely utilized and while studies show that for some purposes BCG is effective (e.g. against disseminated TB in infants), it is known to be ineffective with respect to preventing the development, persistence and reactivation of latent TB in adults. There is an ongoing need to develop improved, more effective vaccines against TB.
Use of cytomegalovirus (CMV) vectors (e.g., Rhesus CMV (RhCMV) and human CMV (HCMV)) has particular advantages. First, CMV elicits an astoundingly high frequency (steady-
state) T cell response, at least an order of magnitude higher than that of most non-persistent virus (it is not uncommon for CMV-specific T cells to encompass >20% of the circulating memory repertoire), and the representation of CMV-specific T cells (as it relates to CMV-driven non- CMV antigens) is even higher in tissues such as the lung and liver. In addition, the above responses persist indefinitely. CMV is also capable of re-infecting already chronically infected individuals, even in the face of pre-existing immune responses, and such re-infection with recombinant CMVs is also capable of inducing new responses to distinct CMV-encoded foreign proteins. CMV also engenders pathogenicity only in very specific situations of immune deficiency, immaturity, or seronegative pregnant women (its potential for disease is among the best documented among potential human pathogens). Finally, CMV infection is ubiquitous in most of humanity.
While vaccines are often effective to immunize individuals prophylactically or therapeutically against pathogen infection or human diseases, there is a need for improved vaccines and vectors. There is also a need for compositions and methods that produce an enhanced immune response. Likewise, while some immunotherapeutics are useful to modulate immune response in a patient, there remains a need for improved immunotherapeutic compositions and methods.
Summary
The present disclosure provides recombinant RhCMV or HCMV vectors comprising a nucleic acid sequence encoding an expressible Mtb antigen selected from Ag85A-Ag85B- Rv3407, Rvl733-Rv2626c, RpfA-RpfC-RpfD, Ag85B-ESAT6, and Ag85A-ESAT6-Rv3407- Rv2626c-RpfA-RpfD.
The present disclosure also provides pharmaceutical compositions comprising the recombinant RhCMV or HCMV vaccine vectors described herein and a pharmaceutically acceptable carrier.
The present disclosure also provides methods for treatment or prevention of tuberculosis comprising administering to a subject in need thereof at least one recombinant RhCMV or HCMV vaccine vector described herein.
The present disclosure also provides methods for eliciting an immune response to a Mtb antigen comprising administering to a subject in need thereof at least one recombinant RhCMV or HCMV vaccine vector described herein.
The present disclosure also provides methods for eliciting a CD8+ or CD4+ T cell response to a Mtb antigen comprising administering to a subject in need thereof at least one recombinant RhCMV or HCMV vaccine vector described herein.
The present disclosure also provides Mtb antigens selected from Ag85B-ESAT6 and Ag85A-ESAT6-Rv3407-Rv2626c-RpfA-RpfD.
Brief Description Of The Drawings
Figure 1 shows immunogenicity of BCG and Rhesus CMV vectors containing various TB constructs; immune responses induced by vaccination were analyzed by intracellular cytokine staining throughout the vaccination period; shown is the percentage of memory cells expressing either IFNy or TNF; CD4+ T cells are shown in the upper panel and CD8+ T cells are shown in the lower panels.
Figure 2 (panels a, b, c, and d) shows ESAT-6-specific responses analyzed by intracellular cytokine staining throughout the vaccination period; shown above are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells (PBMCs; shown in panels a and b) and broncho ale volar lavage cells (BAL; shown in panels c and d); CD4+ T cells are shown in panels a and c, and CD8+ T cells are shown in panels b and d.
Figure 3 (panels a, b, c, and d) shows Rvl733 -specific responses analyzed by intracellular cytokine staining throughout the vaccination period; shown above are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells (PBMCs; shown in panels a and b) and broncho ale volar lavage cells (BAL; shown in panels c and d); CD4+ T cells are shown in panels a and c, and CD8+ T cells are shown in panels b and d.
Figure 4 (panels a, b, c, and d) shows RpfC-specific responses analyzed by intracellular cytokine staining throughout the vaccination period; shown above are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells (PBMCs; shown in panels a and b) and bronchoale volar lavage cells (BAL; shown in panels c and d); CD4+ T cells are shown in panels a and c, and CD8+ T cells are shown in panels b and d.
Figure 5 (panels a, b, c, and d) shows Ag85B -specific responses analyzed by intracellular cytokine staining throughout the vaccination period; shown above are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells (PBMCs; shown in panels a and b) and broncho ale volar
lavage cells (BAL; shown in panels c and d); CD4+ T cells are shown in panels a and c, and CD8+ T cells are shown in panels b and d.
Figure 6 (panels a and b) shows Ag85A-specific responses analyzed by intracellular cytokine staining throughout the vaccination period; shown above are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells; CD4+ T cells are shown in panel a and CD8+ T cells are shown in panel b.
Figure 7 (panels a and b) shows Rv3407-specific responses analyzed by intracellular cytokine staining throughout the vaccination period; shown above are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells; CD4+ T cells are shown in panel a and CD8+ T cells are shown in panel b.
Figure 8 (panels a and b) shows Rv2626-specific responses analyzed by intracellular cytokine staining throughout the vaccination period; shown above are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells; CD4+ T cells are shown in panel a and CD8+ T cells are shown in panel b.
Figure 9 (panels a and b) shows RpfD-specific responses analyzed by intracellular cytokine staining throughout the vaccination period; shown above are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells; CD4+ T cells are shown in panel a and CD8+ T cells are shown in panel b.
Figure 10 (panels a and b) shows RpfA-specific responses analyzed by intracellular cytokine staining throughout the vaccination period; shown above are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells; CD4+ T cells are shown in panel a and CD8+ T cells are shown in panel b.
Figure 11 (panels a and b) shows Ag85B -specific cells phenotyped by flow cytometry and classified as naive, Tcm (central memory), TrEM (transitional effector memory), or Tern (effector memory) T cells; CD4+ T cells are shown in panel a and CD8+ T cells are shown in panel b; analysis was performed in the plateau phase, at days 316/318 after BCG vaccination.
Figure 12 shows T cells stimulated with antigen in the presence of antibody to block MHC I (red) or MHC II (blue); CD8+ T cell responses induced by BCG are primarily inhibited by blocking MHC I; in contrast, responses induced by RhCMV 68-1 are primarily inhibited by blocking MHC II.
Figure 13 shows correlation between various pairings of efficacy criteria; also included in each analysis are slope (rs) and p value.
Figure 14 shows representative CT scans from NHP in the unvaccinated and
RhCMV/TB groups.
Figure 15 shows the volume of parenchymal disease present at the time points indicated (or, for data points shown with open symbols, at necropsy).
Figure 16 (panels a, b, and c) shows the necropsy score overall (panel a), in the lung alone (panel b) and in lung draining lymph nodes (panel c).
Figure 17 (panels a, b, c, and d) shows the bacterial burden (CFU/g tissue) present in random samples from the lung/trachea (light blue), draining lymph nodes (red), peripheral lymph nodes (dark blue), and extrapulmonary tissues (green); shown are representative NHP from each group, including unvaccinated (panel a), BCG (panel b), CMV (panel c), and BCG + CMV (panel d).
Figure 18 shows the number of Mtb culture-positive samples present in random biopsies from NHP; overall culture scores are broken out into lung and non-lung compartments.
Figure 19 (panels a and b) shows non-lung samples further broken out into lung draining lymph node samples (panel a) and non-lung associated samples (panel b); non-lung associated samples include liver, kidney, and spleen.
Figure 20 (panels a, b, c, d, e, and f) shows the bacterial burden in all lung-draining lymph nodes (panel a), as well as specific lung draining lymph nodes (panels b, c, and d); also included is the granuloma score for the carinal (panel e) and hilar (panel f) lymph nodes.
Figure 21 shows the T cell response against each antigen is shown at various time points throughout the vaccination phase.
Figure 22 shows a correlation between the CD4 T cell response against each antigen, shown at various time points throughout the vaccination phase, and the extent of extrapulmonary spread.
Figure 23 shows a correlation between the CD8 T cell response against each antigen, shown at various time points throughout the vaccination phase, and the extent of extrapulmonary spread.
Figure 24 (panels a, b, c, and d) shows infection by detection of de novo immune responses. PBMCs were stimulated with RhCMV lysate (panels a and b) or CFP peptides (panels c and d); responses were analyzed by intracellular cytokine staining; shown are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells; CD4+ (panels a and c) and CD8 (panels b and d) T cells responses are shown.
Figure 25 (panels a, b, c, d, e, and f) shows RhCMV-induced immune responses analyzed post-challenge; PBMCs were stimulated with ESAT6 (panels a and b), Ag85B (panels c and d), and Rvl733 (panels e and f); responses were analyzed by intracellular cytokine
staining; shown are the percentages of memory cells expressing either IFNy or TNF; CD4+ (panels a, c, and e) and CD8+ (panels b, d, and f) T cells responses.
Figure 26 (panels a, b, c, and d) show the total RhCMV-induced immune responses in various compartments analyzed post-necropsy (panels a and b) and de novo CFP10 responses induced by infection (panels c and d); shown above are the percentages of memory cells expressing either IFNy or TNF.
Figure 27 shows individual antigen-specific CD4+ T cell responses in various compartments analyzed post-necropsy; shown above are the percentages of memory cells expressing either IFNy or TNF.
Figure 28 shows individual antigen-specific CD4+ T cell responses in various lymph nodes analyzed post-necropsy; shown above are the percentages of memory cells expressing either IFNy or TNF.
Figure 29 shows the total RhCMV-induced immune responses in various compartments analyzed post-necropsy; panels c and d show de novo CFP10 responses induced by infection; shown above are the percentages of memory cells expressing either IFNy or TNF.
Figure 30 shows the individual antigen-specific CD8+ T cell responses in various compartments analyzed post-necropsy; shown above are the percentages of memory cells expressing either IFNy or TNF.
Figure 31 shows individual antigen-specific CD8+ T cell responses in various lymph nodes analyzed post-necropsy; shown above are the percentages of memory cells expressing either IFNy or TNF.
Figure 32 shows a correlate analysis comparing the splenic CD4+ T cell response with the number of culture-positive lymph nodes.
Figure 33 shows immune responses induced by vaccination analyzed by intracellular cytokine staining throughout the vaccination period; shown are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells; CD4+ T cells and CD8+ T cells are shown; the data points represent a summation of the antigens assayed, which are indicated below the panel.
Figure 34 shows immune responses induced by vaccination normalized between vectors by summing only those antigens present in each vector (antigens noted below the panel);
responses were analyzed by intracellular cytokine staining throughout the vaccination period; shown are the percentages of memory cells expressing either IFNy or TNF; included are responses from peripheral blood mononuclear cells; CD4+ T cells and CD8+ T cells are shown.
Figure 35 (panels a and b) shows immune responses induced by vaccination analyzed by intracellular cytokine staining throughout the vaccination period; shown are the percentages of memory cells expressing either IFNy or TNF; included are responses from BAL; CD4+ T cells are shown in panel a and CD8+ T cells are shown in panel b; the data points represent a summation of the antigens assayed, which are indicated below the panel.
Figure 36 shows peripheral blood CFPlO-specific T cell responses post-Mtb challenge.
Figure 37 shows clinical outcome data from longitudinal CT scans, which is used to quantify the volume of lung disease present post-challenge.
Figure 38 shows a necropsy score.
Figure 39 shows a culture score.
Figure 40 shows overall efficacy of Strain 68-1 RhCMV/TB vectors.
Figure 41 shows late disease resolution in a Strain 68-1 RhCMV/TB-6Ag single vector vaccination.
Figure 42 (panels a, b, c, d, e, and f) shows the immunogenicity of RhCMV/TB and BCG vaccines for Study 3.
Figure 43 (panels a, b, c, d, e, and f) shows the outcome of Mtb challenge for Study 3. Figure 44 (panels a, b, c, d, e, f, and g) shows the immunogenicity of RhCMV/TB vaccines for Study 4.
Figure 45 (panels a, b, c, d, e, f, g, and h) shows the outcome of Mtb challenge for Study 4 and overall.
Figure 46 (panels a, b, and c) shows RhCMV/TB vectors used in Study 3 and 4.
Figure 47 (panels a, b, and c) shows the development of de novo Mtb-specific CD8+ T cell responses after Mtb challenge.
Figure 48 shows pathologic scoring of TB disease at necropsy.
Figure 49 (panels a, b, c, d, and e) shows a summary of outcome statistics.
Figure 50 (panels a, b, c, and d) shows a comparison of different measures of TB infection outcome.
Figure 51 shows a summary of TB disease outcome at necropsy of Study 3.
Figure 52 shows MHC-restriction analysis of RhCMV/TB vector-elicited CD8+ T cell responses in Study 4.
Figure 53 (panels a and b) shows an analysis of non- vaccine-elicited, Mtb-specific CD4+ and CD8+ T cell responses at necropsy.
Figure 54 shows a summary of outcome at necropsy of Study 4.
Figure 55 (panels a, b, and c) shows immune correlates analysis of Studies 3 and 4.
Description Of Embodiments
The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting.
As used herein, the singular forms "a," "an" and "the" include plural referents unless the context clearly dictates otherwise.
For recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the numbers 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
As used herein, "adjuvant" means any molecule added to any composition described herein to enhance the immunogenicity of the Mtb antigens.
As used herein, "coding sequence" or "encoding nucleic acid" means the nucleic acids (RNA or DNA molecule) that comprise a nucleotide sequence which encodes an Mtb antigen. The coding sequence can further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered.
As used herein, "consensus" or "consensus sequence" means a polypeptide sequence based on analysis of an alignment of multiple subtypes of a particular Mtb antigen. Nucleic acid sequences that encode a consensus polypeptide sequence can be prepared. Vaccines comprising Mtb antigens that comprise consensus sequences and/or nucleic acid molecules that encode such antigens can be used to induce broad immunity against multiple subtypes or serotypes of a particular antigen. I some embodiments, the consensus sequence may be the most common sequence.
As used herein, "electroporation" means the use of a transmembrane electric field pulse to induce microscopic pathways (pores) in a bio-membrane; their presence allows biomolecules such as plasmids, oligonucleotides, siRNA, drugs, ions, and water to pass from one side of the cellular membrane to the other.
As used herein, "fragment" with respect to nucleic acid sequences, means a nucleic acid sequence or a portion thereof, that encodes a portion of an Mtb antigen capable of eliciting an immune response in a mammal that cross reacts with a full length wild type Mtb antigen. The fragments can be DNA fragments selected from at least one of the various nucleotide sequences that encode protein fragments set forth below. For example, polynucleotides may comprise at least about 15, 20, 30, 40, 50, 75, 100, 150, 200, 300, 400, 500 or 1000 or more contiguous nucleotides of one or more of the sequences disclosed herein as well as all intermediate lengths
there between. It will be readily understood that "intermediate lengths", in this context, means any length between the quoted values, such as 16, 17, 18, 19, etc.; 21, 22, 23, etc.; 30, 31, 32, etc.; 50, 51, 52, 53, etc.; 100, 101, 102, 103, etc.; 150, 151, 152, 153, etc.; including all integers through 200 to 500; 500 to 1,000, and the like.
As used herein, "fragment" or "immunogenic fragment" with respect to polypeptide sequences, means a portion of an MTB antigen capable of eliciting an immune response in a mammal that cross reacts with a full length wild type strain Mtb antigen. Fragments of consensus or wild type Mtb antigens can comprise at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 95% of a consensus or wild type Mtb antigen. In some embodiments, fragments of consensus proteins can comprise at least 20 amino acids or more, at least 30 amino acids or more, at least 40 amino acids or more, at least 50 amino acids or more, at least 60 amino acids or more, at least 70 amino acids or more, at least 80 amino acids or more, at least 90 amino acids or more, at least 100 amino acids or more, at least 110 amino acids or more, at least 120 amino acids or more, at least 130 amino acids or more, at least 140 amino acids or more, at least 150 amino acids or more, at least 160 amino acids or more, at least 170 amino acids or more, at least 180 amino acids or more of a consensus or wild type protein.
As used herein, "genetic construct" refers to the DNA or RNA molecules that comprise a nucleotide sequence which encodes an Mtb antigen. The coding sequence includes initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of the individual to whom the nucleic acid molecule is administered.
As used herein, "expressible form" refers to gene constructs that contain the necessary regulatory elements operable linked to a coding sequence that encodes an Mtb antigen such that when present in the cell of the individual, the coding sequence will be expressed.
As used herein, "homology" refers to a degree of complementarity for nucleic acid molecules. There can be partial homology or complete homology (i.e., identity). A partially complementary sequence that at least partially inhibits a completely complementary sequence from hybridizing to a target nucleic acid is referred to using the functional term "substantially homologous." When used in reference to a double- stranded nucleic acid sequence such as a cDNA or genomic clone, the term "substantially homologous" refers to a probe that can hybridize to a strand of the double- stranded nucleic acid sequence under conditions of low stringency. When used in reference to a single- stranded nucleic acid sequence, the term
"substantially homologous" refers to a probe that can hybridize to (i.e., is the complement of) the single- stranded nucleic acid template sequence under conditions of low stringency.
As used herein, "identical" or "identity" in the context of two or more nucleic acids or polypeptide sequences, means that the sequences have a specified percentage of residues that are the same over a specified region. The percentage can be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity. In cases where the two sequences are of different lengths or the alignment produces one or more staggered ends and the specified region of comparison includes only a single sequence, the residues of single sequence are included in the denominator but not the numerator of the calculation. When comparing DNA and RNA, thymine (T) and uracil (U) residues can be considered equivalent. Identity and/or homology can be performed manually or by using a computer sequence algorithm such as BLAST or BLAST 2.0.
As used herein, "immune response" means the activation of a host' s immune system, e.g., that of a mammal, in response to the introduction of an Mtb antigen. The immune response can be in the form of a cellular or humoral response, or both.
As used herein, "isolated" means that a polynucleotide is substantially away from other coding sequences, and that the nucleic acid segment does not contain large portions of unrelated coding DNA, such as large chromosomal fragments or other functional genes or polypeptide coding regions. Of course, this refers to the nucleic acid segment as originally isolated, and does not exclude genes or coding regions later added to the segment by the hand of man.
As used herein, "Mtb antigen" means an antigen from Mycobacterium tuberculosis, which may be an isolated antigen, or an antigen that forms part of a fusion protein with other antigen(s).
As used herein, "Mycobacteria" means a genus of aerobic intracellular bacterial organisms. Upon invasion of a host, these organisms survive within endosomal compartments of monocytes and macrophages. Human mycobacterial diseases include tuberculosis (caused by M. tuberculosis (Mtb)), Leprosy (caused by M. leprae), Bairnsdale ulcers (caused by M. ulcerans), and other infections that can be caused by M. marinum, M. kansasii, M. scrofulaceum, M.
szulgai, M. xenopi, M. fortuitum, M. haemophilum, M. chelonei, and M. intracelluare .
Mycobacterium strains that were previously considered to be nonpathogenic (such as M. avium) are also now known to be major killers of immunosuppressed AIDS patients. The major response
to mycobacteria involves cell mediated hypersensitivity (DTH) reactions with T cells and macrophages playing major roles in the intracellular killing and walling off (or containing) of the organism (granuloma formation). A major T cell response involves CD4+ lymphocytes that recognize mycobacterial heat shock proteins and immunodominant antigens.
As used herein, "nucleic acid" or "oligonucleotide" or "polynucleotide" means at least two nucleotides covalently linked together, which has been isolated free of total genomic DNA of a particular species. Included within these terms are nucleic acid segments and smaller fragments of such segments, and also recombinant CMV vectors. The depiction of a single strand also defines the sequence of the complementary strand. Thus, a nucleic acid also encompasses the complementary strand of a depicted single strand. Many variants of a nucleic acid can be used for the same purpose as a given nucleic acid. Thus, a nucleic acid also encompasses substantially identical nucleic acids and complements thereof. A single strand provides a probe that can hybridize to a target sequence under stringent hybridization conditions. Thus, a nucleic acid also encompasses a probe that hybridizes under stringent hybridization conditions. Nucleic acids can be single stranded or double stranded, or can contain portions of both double stranded and single stranded sequence. The nucleic acid can be DNA, both genomic and cDNA, RNA, or a hybrid, where the nucleic acid can contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine. Nucleic acids can be obtained by chemical synthesis methods or by recombinant methods. As will be understood by those skilled in the art, the nucleic acid molecules can include genomic sequences, extra- genomic and plasmid-encoded sequences and smaller engineered gene segments that express, or may be adapted to express, proteins, polypeptides, peptides and the like. Such segments may be naturally isolated, or modified synthetically by the hand of man.
As used herein, "operably linked" means that expression of a gene is under the control of a promoter with which it is spatially connected. A promoter can be positioned 5' (upstream) or 3' (downstream) of a gene under its control. The distance between the promoter and a gene can be approximately the same as the distance between that promoter and the gene it controls in the gene from which the promoter is derived. As is known in the art, variation in this distance can be accommodated without loss of promoter function.
As used herein, "promoter" means a synthetic or naturally-derived molecule which is capable of conferring, activating or enhancing expression of a nucleic acid in a cell. A promoter can comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same. A promoter
can also comprise distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription. A promoter can be derived from sources including viral, bacterial, fungal, plants, insects, and animals. A promoter can regulate the expression of a gene component constitutively, or differentially with respect to cell, the tissue or organ in which expression occurs or, with respect to the developmental stage at which expression occurs, or in response to external stimuli such as physiological stresses, pathogens, metal ions, or inducing agents.
As used herein, "signal peptide" and "leader sequence", used interchangeably, refer to an amino acid sequence that can be linked at the amino terminus of an Mtb antigenic protein set forth herein. Signal peptides/leader sequences typically direct localization of a protein. Signal peptides/leader sequences used herein can facilitate secretion of the protein from the cell in which it is produced or anchor it in the membrane. Signal peptides/leader sequences are often cleaved from the remainder of the protein, often referred to as the mature protein, upon secretion from the cell. Signal peptides/leader sequences are linked at the N terminus of the protein.
As used herein, "stringent hybridization conditions" means conditions under which a first nucleic acid sequence (e.g., probe) will hybridize to a second nucleic acid sequence (e.g., target), such as in a complex mixture of nucleic acids. Stringent conditions are sequence- dependent and will be different in different circumstances. Stringent conditions can be selected to be about 5 to 10°C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength pH. The Tm can be the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at Tm, 50% of the probes are occupied at equilibrium). Stringent conditions can be those in which the salt concentration is less than about 1.0 M sodium ion, such as about 0.01 to 1.0 M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., about 10 to 50 nucleotides) and at least about 60 °C for long probes (e.g., greater than about 50 nucleotides). Stringent conditions can also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal can be at least 2 to 10 times background hybridization. Exemplary stringent hybridization conditions include the following: 50% formamide, 5x SSC, and 1% SDS, incubating at 42°C, or, 5x SSC, 1% SDS, incubating at 65 °C, with wash in 0.2x SSC, and 0.1% SDS at 65 °C.
As used herein, "substantially complementary" means that a first sequence is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the complement of a second sequence over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540, or more nucleotides or amino acids, or that the two sequences hybridize under stringent hybridization conditions.
As used herein, "substantially identical" means that a first and second sequence are at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540 or more nucleotides or amino acids, or with respect to nucleic acids, if the first sequence is substantially complementary to the complement of the second sequence.
As used herein, "tuberculosis" means a disease that is generally caused by
Mycobacterium tuberculosis that usually infects the lungs. However, other "atypical" mycobacteria such as M. kansasii may produce a similar clinical and pathologic appearance of disease. Transmission of M. tuberculosis occurs by the airborne route in confined areas with poor ventilation. In more than 90% of cases, following infection with tuberculosis, the immune system prevents development of disease from M. tuberculosis, often called, active tuberculosis. However, not all of the M. tuberculosis is killed and, thus tiny, hard capsules are formed. "Primary tuberculosis" is seen as disease that develops following an initial infection, usually in children. The initial focus of infection is a small subpleural granuloma accompanied by granulomatous hilar lymph node infection. Together, these make up the Ghon complex. In nearly all cases, these granulomas resolve and there is no further spread of the infection.
"Secondary tuberculosis" is seen mostly in adults as a reactivation of previous infection (or reinfection), particularly when health status declines. The granulomatous inflammation is much more florid and widespread. Typically, the upper lung lobes are most affected, and cavitation can occur. Dissemination of tuberculosis outside of the lungs can lead to the appearance of a number of uncommon findings with characteristic patterns that include skeletal tuberculosis, genital tract tuberculosis, urinary tract tuberculosis, central nervous system (CNS) tuberculosis,
gastrointestinal tuberculosis, adrenal tuberculosis, scrofula, and cardiac tuberculosis. "Latent" tuberculosis is an Mtb infection in an individual that can be detected by a diagnostic assay, such as, but not limited to a tuberculin skin test (TST) wherein the infection does not produce symptoms in that individual. "Active" tuberculosis is a symptomatic Mtb infection in a subject. Microscopically, the inflammation produced with TB infection is granulomatous, with epithelioid macrophages and Langhans giant cells along with lymphocytes, plasma cells, maybe a few polymorphonuclear cells, fibroblasts with collagen, and characteristic caseous necrosis in the center. The inflammatory response is mediated by a type IV hypersensitivity reaction, and
skin testing is based on this reaction. In some examples, tuberculosis can be diagnosed by a skin test, an acid fast stain, an auramine stain, or a combination thereof. The most common specimen screened is sputum, but the histologic stains can also be performed on tissues or other body fluids.
As used herein, "variant" with respect to a nucleic acid means: i) a portion or fragment of a referenced nucleotide sequence; ii) the complement of a referenced nucleotide sequence or portion thereof; iii) a nucleic acid that is substantially identical to a referenced nucleic acid or the complement thereof; or iv) a nucleic acid that hybridizes under stringent conditions to the referenced nucleic acid, complement thereof, or a sequences substantially identical thereto.
As used herein, "variant" with respect to a peptide or polypeptide means that it differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retains at least one biological activity. Variant can also mean a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity. A conservative substitution of an amino acid, i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. Amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties. The term "variant" also encompasses homologous genes of xenogeneic origin.
As used herein, "CMV vector" means a CMV nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell. A CMV vector may include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. A CMV vector may also include one or more selectable marker gene and other genetic elements known in the art.
The present disclosure provides recombinant RhCMV or HCMV vectors comprising a nucleic acid molecule encoding an expressible Mtb antigen selected from Ag85A-Ag85B- Rv3407, Rvl733-Rv2626c, RpfA-RpfC-RpfD, Ag85B-ESAT6, and Ag85A-ESAT6-Rv3407- Rv2626c-RpfA-RpfD. In some embodiments, the nucleic acid molecule encoding any particular Mtb antigen can be a mycobacterial sequence, a bacterial codon optimized sequence (such as an E. coli optimized sequence), or a mammalian optimized sequence (such as a human optimized sequence). Methods of codon optimization (whether for bacterial or mammalian) are well known to the skilled artisan.
In any of the embodiments of the nucleic acid molecules set forth herein, the individual Mtb nucleic acid sequences can be present in any order. For example, for a fusion protein comprising Ag85A, Ag85B, and Rv3407 antigens, the first (or N-terminal) nucleic acid molecule may encode Ag85A, Ag85B, or Rv3407; the second nucleic acid molecule may encode Ag85A, Ag85B, or Rv3407 (whichever one is not the first Mtb antigen); and the third nucleic acid molecule may encode Ag85A, Ag85B, or Rv3407 (whichever one is not the first or second Mtb antigen). Likewise for every nucleic acid molecule disclosed herein.
Additional coding or non-coding sequences may, but need not, be present within a polynucleotide of the present invention, and a polynucleotide may, but need not, be linked to other molecules and/or support materials.
Polynucleotides may comprise a native sequence (e.g., an endogenous sequence that encodes a CMV or TB protein or a portion thereof) or may comprise a variant, or a biological or antigenic functional equivalent of such a sequence.
A nucleotide sequence encoding Ag85A is shown in Table 1 as SEQ ID NO:l, and an amino acid sequence of Ag85A is shown in Table 1 as SEQ ID NO:2.
A nucleotide sequence encoding Ag85B is shown in Table 1 as SEQ ID NO:3, and an amino acid sequence of Ag85B is shown in Table 1 as SEQ ID NO:4.
A nucleotide sequence encoding Rv3407 is shown in Table 1 as SEQ ID NO:5, and an amino acid sequence of Rv3407 is shown in Table 1 as SEQ ID NO:6.
A nucleotide sequence encoding Rvl733 is shown in Table 1 as SEQ ID NO:7, and an amino acid sequence of Rvl733 is shown in Table 1 as SEQ ID NO:8.
A nucleotide sequence encoding Rv2626c is shown in Table 1 as SEQ ID NO:9, and an amino acid sequence of Rv2626c is shown in Table 1 as SEQ ID NO: 10.
A nucleotide sequence encoding RpfA is shown in Table 1 as SEQ ID NO: 11, and an amino acid sequence of RpfA is shown in Table 1 as SEQ ID NO: 12.
A nucleotide sequence encoding RpfC is shown in Table 1 as SEQ ID NO: 13, and an amino acid sequence of RpfC is shown in Table 1 as SEQ ID NO: 14.
A nucleotide sequence encoding RpfD is shown in Table 1 as SEQ ID NO: 15, and an amino acid sequence of RpfD is shown in Table 1 as SEQ ID NO: 16.
A nucleotide sequence encoding ESAT-6 is shown in Table 1 as SEQ ID NO: 17, and an amino acid sequence of ESAT-6 is shown in Table 1 as SEQ ID NO: 18.
Table 1
Construct nucleotide sequence
amino acid sequence
Ag85A atgcagcttgttgacagggttcgtggcgccgtcacgggtatgtcgcgtcgactcgtggtcggggccgtcggc gcggccctagtgtcgggtctggtcggcgccgtcggtggcacggcgaccgcgggggcattttcccggccgg gcttgccggtggagtacctgcaggtgccgtcgccgtcgatgggccgtgacatcaaggtccaattccaaagtg gtggtgccaactcgcccgccctgtacctgctcgacggcctgcgcgcgcaggacgacttcagcggctgggac atcaacaccccggcgttcgagtggtacgaccagtcgggcctgtcggtggtcatgccggtgggtggccagtca agcttctactccgactggtaccagcccgcctgcggcaaggccggttgccagacttacaagtgggagaccttc ctgaccagcgagctgccggggtggctgcaggccaacaggcacgtcaagcccaccggaagcgccgtcgtc ggtctttcgatggctgcttcttcggcgctgacgctggcgatctatcacccccagcagttcgtctacgcgggagc gatgtcgggcctgttggacccctcccaggcgatgggtcccaccctgatcggcctggcgatgggtgacgctg gcggctacaaggcctccgacatgtggggcccgaaggaggacccggcgtggcagcgcaacgacccgctgt tgaacgtcgggaagctgatcgccaacaacacccgcgtctgggtgtactgcggcaacggcaagccgtcggat ctgggtggcaacaacctgccggccaagttcctcgagggcttcgtgcggaccagcaacatcaagttccaagac gcctacaacgccggtggcggccacaacggcgtgttcgacttcccggacagcggtacgcacagctgggagt actggggcgcgcagctcaacgctatgaagcccgacctgcaacgggcactgggtgccacgcccaacaccgg gcccgcgccccagggcgcctag (SEQ ID N0:1)
MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAF
SRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDF
SGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQ
TYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYH
PQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKE
DPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFL
EGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAM
KPDLQRALGATPNTGPAPQGA (SEQ ID N0:2)
Ag85B atgacagacgtgagccgaaagattcgagcttggggacgccgattgatgatcggcacggcagcggctgtagt ccttccgggcctggtggggcttgccggcggagcggcaaccgcgggcgcgttctcccggccggggctgcc ggtcgagtacctgcaggtgccgtcgccgtcgatgggccgcgacatcaaggttcagttccagagcggtggga acaactcacctgcggtttatctgctcgacggcctgcgcgcccaagacgactacaacggctgggatatcaaca ccccggcgttcgagtggtactaccagtcgggactgtcgatagtcatgccggtcggcgggcagtccagcttcta cagcgactggtacagcccggcctgcggtaaggctggctgccagacttacaagtgggaaaccttcctgacca gcgagctgccgcaatggttgtccgccaacagggccgtgaagcccaccggcagcgctgcaatcggcttgtcg atggccggctcgtcggcaatgatcttggccgcctaccacccccagcagttcatctacgccggctcgctgtcgg ccctgctggacccctctcaggggatggggcctagcctgatcggcctcgcgatgggtgacgccggcggttac aaggccgcagacatgtggggtccctcgagtgacccggcatgggagcgcaacgaccctacgcagcagatcc ccaagctggtcgcaaacaacacccggctatgggtttattgcgggaacggcaccccgaacgagttgggcggt gccaacatacccgccgagttcttggagaacttcgttcgtagcagcaacctgaagttccaggatgcgtacaacg ccgcgggcgggcacaacgccgtgttcaacttcccgcccaacggcacgcacagctgggagtactggggcgc tcagctcaacgccatgaagggtgacctgcagagttcgttaggcgccggctga (SEQ ID N0:3)
MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGL
PVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWD
INTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWE
TFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIY
AGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWER
NDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSN
LKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSL
GAG (SEQ ID N0:4)
Rv3407 atgcgtgctaccgttgggcttgtggaggcaatcggaatccgagaactaagacagcacgcatcgcgatacctc gcccgggttgaagccggcgaggaacttggcgtcaccaacaaaggaagacttgtggcccgactcatcccggt gcaggccgcggagcgttctcgcgaagccctgattgaatcaggtgtcctgattccggctcgtcgtccacaaaac cttctcgacgtcaccgccgaaccggcgcgcggccgcaagcgcaccctgtccgatgttctcaacgaaatgcg
cgacgagcagtga (SEQ ID NO:5)
MRATVGLVEAIGIRELRQHASRYLARVEAGEELGVTNKGRLVARLIP VQAAERSREALIESGVLIPARRPQNLLDVTAEPARGRKRTLSDVLNE MRDEQ (SEQ ID NO:6)
Rvl733 atgatcgccacaacccgcgatcgtgaaggagccaccatgatcacgtttaggctgcgcttgccgtgccggacg atactgcgggtgttcagccgcaatccgctggtgcgtgggacggatcgactcgaggcggtcgtcatgctgctg gccgtcacggtctcgctgctgactatcccgttcgccgccgcggccggcaccgcagtccaggattcccgcagc cacgtctatgcccaccaggcccagacccgccatcccgcaaccgcgaccgtgatcgatcacgagggggtgat cgacagcaacacgaccgccacgtcagcgccgccgcgcacgaagatcaccgtgcctgcccgatgggtcgtg aacggaatagaacgcagcggtgaggtcaacgcgaagccgggaaccaaatccggtgaccgcgtcggcattt gggtcgacagtgccggtcagctggtcgatgaaccagctccgccggcccgtgccattgcggatgcggccctg gccgccttgggactctggttgagcgtcgccgcggttgcgggcgccctgctggcgctcactcgggcgattctg atccgcgttcgcaacgccagttggcaacacgacatcgacagcctgttctgcacgcagcggtga (SEQ ID
N0:7)
MIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTDRLEAVVMLL AVTVSLLTIPFAAAAGTAVQDSRSHVYAHQAQTRHPATATVIDHEGV IDSNTT ATS APPRTKIT VPARWVVNGIERS GE VNAKPGTKS GDRVGIW VDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVAGALLALTRAI LIRVRNASWQHDIDSLFCTQR (SEQ ID N0:8)
Rv2626c atgaccaccgcacgcgacatcatgaacgcaggtgtgacctgtgttggcgaacacgagacgctaaccgctgc cgctcaatacatgcgtgagcacgacatcggcgcgttgccgatctgcggggacgacgaccggctgcacggc atgctcaccgaccgcgacattgtgatcaaaggcctggctgcgggcctagacccgaataccgccacggctgg cgagttggcccgggacagcatctactacgtcgatgcgaacgcaagcatccaggagatgctcaacgtcatgga agaacatcaggtccgccgtgttccggtcatctcagagcaccgcttggtcggaatcgtcaccgaagccgacatc gcccgacacctgcccgagcacgccattgtgcagttcgtcaaggcaatctgctcgcccatggccctcgccagc tag (SEQ ID N0:9)
MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLH GMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNV MEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMAL AS (SEQ ID NO: 10)
RpfA atgagtggacgccaccgtaagcccaccacatccaacgtcagcgtcgccaagatcgcctttaccggcgcagta ctcggtggcggcggcatcgccatggccgctcaggcgaccgcggccaccgacggggaatgggatcaggtg gcccgctgcgagtcgggcggcaactggtcgatcaacaccggcaacggttacctcggtggcttgcagttcact caaagcacctgggccgcacatggtggcggcgagttcgccccgtcggctcagctggccagccgggagcag cagattgccgtcggtgagcgggtgctggccacccagggtcgcggcgcctggccggtgtgcggccgcgggt tatcgaacgcaacaccccgcgaagtgcttcccgcttcggcagcgatggacgctccgttggacgcggccgcg gtcaacggcgaaccagcaccgctggccccgccgcccgccgacccggcgccacccgtggaacttgccgct aacgacctgcccgcaccgctgggtgaacccctcccggcagctcccgccgacccggcaccacccgccgac ctggcaccacccgcgcccgccgacgtcgcgccacccgtggaacttgccgtaaacgacctgcccgcaccgc tgggtgaacccctcccggcagctcccgccgacccggcaccacccgccgacctggcaccacccgcgcccg ccgacctggcgccacccgcgcccgccgacctggcgccacccgcgcccgccgacctggcaccacccgtgg aacttgccgtaaacgacctgcccgcgccgctgggtgaacccctcccggcagctcccgccgaactggcgcca cccgccgatctggcacccgcgtccgccgacctggcgccacccgcgcccgccgacctggcgccacccgcg cccgccgaactggcgccacccgcgcccgccgacctggcaccacccgctgcggtgaacgagcaaaccgcg ccgggcgatcagcccgccacagctccaggcggcccggttggccttgccaccgatttggaactccccgagcc cgacccccaaccagctgacgcaccgccgcccggcgacgtcaccgaggcgcccgccgaaacgccccaagt ctcgaacatcgcctatacgaagaagctgtggcaggcgattcgggcccaggacgtctgcggcaacgatgcgc tggactcgctcgcacagccgtacgtcatcggctga (SEQ ID NO: 11)
MSGRHRKPTTSNVSVAKIAFTGAVLGGGGIAMAAQATAATDGEWD QVARCESGGNWSINTGNGYLGGLQFTQSTWAAHGGGEFAPSAQLAS
REQQIA VGER VLATQGRG AWP VCGRGLS N ATPRE VLPAS AAMD APL
DAAAVNGEPAPLAPPPADPAPPVELAANDLPAPLGEPLPAAPADPAPP
ADLAPPAPADVAPPVELAVNDLPAPLGEPLPAAPADPAPPADLAPPAP
ADLAPPAPADLAPPAPADLAPPVELAVNDLPAPLGEPLPAAPAELAPP
ADLAPASADLAPPAPADLAPPAPAELAPPAPADLAPPAAVNEQTAPG
DQPATAPGGPVGLATDLELPEPDPQPADAPPPGDVTEAPAETPQVSNI
AYTKKLWQAIRAQDVCGNDALDSLAQPYVIG (SEQ ID NO: 12)
RpfC gtgcatcctttgccggccgaccacggccggtcgcggtgcaatagacacccgatctcaccactctctctaatcg gtaacgcttcggccacttccggcgatatgtcgagcatgacaagaatcgccaagccgctcatcaagtccgccat ggccgcaggactcgtcacggcatccatgtcgctctccaccgccgttgcccacgccggtcccagcccgaact gggacgccgtcgcgcagtgcgaatccgggggcaactgggcggccaacaccggaaacggcaaatacggc ggactgcagttcaagccggccacctgggccgcattcggcggtgtcggcaacccagcagctgcctctcggga acaacaaatcgcagttgccaatcgggttctcgccgaacagggattggacgcgtggccgacgtgcggcgccg cctctggccttccgatcgcactgtggtcgaaacccgcgcagggcatcaagcaaatcatcaacgagatcatttg ggcaggcattcaggcaagtattccgcgctga (SEQ ID NO: 13)
VHPLP ADHGRS RCNRHPIS PLS LIGN AS ATS GDMS S MTRIAKPLIKS A MAAGLVTASMSLSTAVAHAGPSPNWDAVAQCESGGNWAANTGNG KYGGLQFKPATWAAFGGVGNPAAASREQQIAVANRVLAEQGLDAW PTCG AAS GLPIALWS KP AQGIKQIINEIIWAGIQAS IPR (SEQ ID NO: 14)
RpfD atgacaccgggtttgcttactactgcgggtgctggccgaccacgtgacaggtgcgccaggatcgtatgcacg gtgttcatcgaaaccgccgttgtcgcgaccatgtttgtcgcgttgttgggtctgtccaccatcagctcgaaagcc gacgacatcgattgggacgccatcgcgcaatgcgaatccggcggcaattgggcggccaacaccggtaacg ggttatacggtggtctgcagatcagccaggcgacgtgggattccaacggtggtgtcgggtcgccggcggcc gcgagtccccagcaacagatcgaggtcgcagacaacattatgaaaacccaaggcccgggtgcgtggccga aatgtagttcttgtagtcagggagacgcaccgctgggctcgctcacccacatcctgacgttcctcgcggccga gactggaggttgttcggggagcagggacgattga (SEQ ID NO: 15)
MTPGLLTTAGAGRPRDRCARIVCTVFIETAVVATMFVALLGLSTISSK ADDID WD AI AQCES GGNWA ANTGNGLYGGLQIS QATWDS NGG VGS PAAASPQQQIEVADNIMKTQGPGAWPKCSSCSQGDAPLGSLTHILTFL AAETGGCSGSRDD (SEQ ID NO:16)
ESAT-6 atgacagagcagcagtggaatttcgcgggtatcgaggccgcggcaagcgcaatccagggaaatgtcacgtc cattcattccctccttgacgaggggaagcagtccctgaccaagctcgcagcggcctggggcggtagcggttc ggaggcgtaccagggtgtccagcaaaaatgggacgccacggctaccgagctgaacaacgcgctgcagaa cctggcgcggacgatcagcgaagccggtcaggcaatggcttcgaccgaaggcaacgtcactgggatgttcg catag (SEQ ID NO:17)
MTEQQWNFAGIE A AAS AIQGN VTSIHS LLDEGKQS LTKLA A AWGGS GSEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVT GMFA (SEQ ID NO: 18)
All sequences shown in Table 1 are derived from HCMV.
In some embodiments, the fusion protein comprises Ag85A, Ag85B, and Rv3407 antigens. In some embodiments, the fusion protein comprises Rvl733 and Rv2626c antigens. In some embodiments, the fusion protein comprises RpfA, RpfC, and RpfD antigens. In some embodiments, the fusion protein comprises Ag85B and ESAT6 antigens. In some embodiments, the fusion protein comprises Ag85A, ESAT6, Rv3407, Rv2626c, RpfA, and RpfD antigens.
In any of the embodiments of fusion proteins set forth herein, the individual Mtb antigens can be present in any order. For example, for a fusion protein comprising Ag85A, Ag85B, and Rv3407 antigens, the first (or N-terminal) antigen may be Ag85A, Ag85B, or Rv3407; the second antigen may be Ag85A, Ag85B, or Rv3407 (whichever one is not the first Mtb antigen); and the third antigen may be Ag85A, Ag85B, or Rv3407 (whichever one is not the first or second Mtb antigen). Likewise for every fusion protein disclosed herein.
Individual Mtb antigens may be linked together in a C-terminus to N-terminus or N- terminus to C-terminus manner without any linker. Alternately, a linker may be present between any two Mtb antigens within any of the fusion proteins disclosed herein. In some embodiments, the linker is a segment of DNA optionally containing one or more restrictions sites, wherein the linker is inserted between nucleic acid molecules encoding two Mtb antigens of any of the fusion proteins disclosed herein.
In some embodiments, the fusion protein comprises Ag85A-Ag85B-Rv3407 (Construct A; see Table 2). The nucleotide sequence is SEQ ID NO: 19, and the corresponding amino acid sequence is SEQ ID NO:20.
In some embodiments, the fusion protein comprises Rvl733-Rv2626c (Construct B; see Table 2). The nucleotide sequence is SEQ ID NO:21, and the corresponding amino acid sequence is SEQ ID NO:22.
In some embodiments, the fusion protein comprises RpfA-RpfC-RpfD (Construct C; see Table 2). The nucleotide sequence is SEQ ID NO:23, and the corresponding amino acid sequence is SEQ ID NO:24.
In some embodiments, the fusion protein comprises Ag85B-ESAT6 (Construct D; see Table 2). The nucleotide sequence is SEQ ID NO:25, and the corresponding amino acid sequence is SEQ ID NO:26.
In some embodiments, the fusion protein comprises Ag85A-ESAT6-Rv3407-Rv2626c-
RpfA-RpfD (Construct E; see Table 2). The nucleotide sequence is SEQ ID NO:27 or SEQ ID NO:28, and the corresponding amino acid sequence is SEQ ID NO:29 or SEQ ID NO:30.
Table 2
Construct nucleotide sequence
amino acid sequence
atggcattttcccggccgggcttgccggtggagtacctgcaggtgccgtcgccgtcgatgggccgtgacatc aaggtccaattccaaagtggtggtgccaactcgcccgccctgtacctgctcgacggcctgcgcgcgcaggac gacttcagcggctgggacatcaacaccccggcgttcgagtggtacgaccagtcgggcctgtcggtggtcatg ccggtgggtggccagtcaagcttctactccgactggtaccagcccgcctgcggcaaggccggttgccagact tacaagtgggagaccttcctgaccagcgagctgccggggtggctgcaggccaacaggcacgtcaagccca ccggaagcgccgtcgtcggtctttcgatggctgcttcttcggcgctgacgctggcgatctatcacccccagca
gttcgtctacgcgggagcgatgtcgggcctgttggacccctcccaggcgatgggtcccaccctgatcggcct ggcgatgggtgacgctggcggctacaaggcctccgacatgtggggcccgaaggaggacccggcgtggca gcgcaacgacccgctgttgaacgtcgggaagctgatcgccaacaacacccgcgtctgggtgtactgcggca acggcaagccgtcggatctgggtggcaacaacctgccggccaagttcctcgagggcttcgtgcggaccagc aacatcaagttccaagacgcctacaacgccggtggcggccacaacggcgtgttcgacttcccggacagcgg tacgcacagctgggagtactggggcgcgcagctcaacgctatgaagcccgacctgcaacgggcactgggt gccacgcccaacaccgggcccgcgccccagggcgccatgttctcccggccggggctgccggtcgagtac ctgcaggtgccgtcgccgtcgatgggccgcgacatcaaggttcagttccagagcggtgggaacaactcacct gcggtttatctgctcgacggcctgcgcgcccaagacgactacaacggctgggatatcaacaccccggcgttc gagtggtactaccagtcgggactgtcgatagtcatgccggtcggcgggcagtccagcttctacagcgactgg tacagcccggcctgcggtaaggctggctgccagacttacaagtgggaaaccttcctgaccagcgagctgcc gcaatggttgtccgccaacagggccgtgaagcccaccggcagcgctgcaatcggcttgtcgatggccggct cgtcggcaatgatcttggccgcctaccacccccagcagttcatctacgccggctcgctgtcggccctgctgga cccctctcaggggatggggcctagcctgatcggcctcgcgatgggtgacgccggcggttacaaggccgca gacatgtggggtccctcgagtgacccggcatgggagcgcaacgaccctacgcagcagatccccaagctggt cgcaaacaacacccggctatgggtttattgcgggaacggcaccccgaacgagttgggcggtgccaacatac ccgccgagttcttggagaacttcgttcgtagcagcaacctgaagttccaggatgcgtacaacgccgcgggcg ggcacaacgccgtgttcaacttcccgcccaacggcacgcacagctgggagtactggggcgctcagctcaac gccatgaagggtgacctgcagagttcgttaggcgccggcatgcgtgctaccgttgggcttgtggaggcaatc ggaatccgagaactaagacagcacgcatcgcgatacctcgcccgggttgaagccggcgaggaacttggcgt caccaacaaaggaagacttgtggcccgactcatcccggtgcaggccgcggagcgttctcgcgaagccctga ttgaatcaggtgtcctgattccggctcgtcgtccacaaaaccttctcgacgtcaccgccgaaccggcgcgcgg ccgcaagcgcaccctgtccgatgttctcaacgaaatgcgcgacgagcagtga (SEQ ID NO: 19)
MAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQ
DDFS GWDINTP AFEWYDQS GLS V VMP VGGQS S FYSD WYQPACGKA
GCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLA
IYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWG
PKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPA
KFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLN
AMKPDLQRALGATPNTGPAPQGAFSRPGLPVEYLQVPSPSMGRDIKV
QFQS GGNNSPAVYLLDGLRAQDD YNGWDINTPAFEWYYQS GLSIVM
PVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVK
PTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLI
GLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLW
VYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVF
NFPPNGTHSWEYWGAQLNAMKGDLQSSLGAGAAARATVGLVEAIGI
RELRQHASRYLARVEAGEELGVTNKGRLVARLIPVQAAERSREALIE
SGVLIPARRPQNLLDVTAEPARGRKRTLSDVLNEMRDEQ (SEQ ID
NO:20)
atgaccaccgcacgcgacatcatgaacgcaggtgtgacctgtgttggcgaacacgagacgctaaccgctgc cgctcaatacatgcgtgagcacgacatcggcgcgttgccgatctgcggggacgacgaccggctgcacggc atgctcaccgaccgcgacattgtgatcaaaggcctggctgcgggcctagacccgaataccgccacggctgg cgagttggcccgggacagcatctactacgtcgatgcgaacgcaagcatccaggagatgctcaacgtcatgga agaacatcaggtccgccgtgttccggtcatctcagagcaccgcttggtcggaatcgtcaccgaagccgacatc gcccgacacctgcccgagcacgccattgtgcagttcgtcaaggcaatctgctcgcccatggccctcgccagc atgatcgccacaacccgcgatcgtgaaggagccaccatgatcacgtttaggctgcgcttgccgtgccggacg atactgcgggtgttcagccgcaatccgctggtgcgtgggacggatcgactcgaggcggtcgtcatgctgctg gccgtcacggtctcgctgctgactatcccgttcgccgccgcggccggcaccgcagtccaggattcccgcagc cacgtctatgcccaccaggcccagacccgccatcccgcaaccgcgaccgtgatcgatcacgagggggtgat cgacagcaacacgaccgccacgtcagcgccgccgcgcacgaagatcaccgtgcctgcccgatgggtcgtg
aacggaatagaacgcagcggtgaggtcaacgcgaagccgggaaccaaatccggtgaccgcgtcggcattt gggtcgacagtgccggtcagctggtcgatgaaccagctccgccggcccgtgccattgcggatgcggccctg gccgccttgggactctggttgagcgtcgccgcggttgcgggcgccctgctggcgctcactcgggcgattctg atccgcgttcgcaacgccagttggcaacacgacatcgacagcctgttctgcacgcagcggtga (SEQ ID N0:21)
MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLH
GMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNV
MEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMAL
ASMIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTDRLEAVVM
LLAVTVSLLTIPFAAAAGTAVQDSRSHVYAHQAQTRHPATATVIDHE
GVIDSNTTATSAPPRTKITVPARWVVNGIERSGEVNAKPGTKSGDRV
GIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVAGALLALT
RAILIRVRNASWQHDIDSLFCTQR (SEQ ID NO:22)
atggcgtcagggaggcatcggaaaccaactacaagcaatgtatctgttgccaagattgctttcaccggcgcag ttcttggaggtggcggaattgccatggctgcccaggcaacagccgctacagatggagagtgggatcaggtg gctcgatgtgagtctggtggcaactggtctatcaacactgggaacgggtatcttggcggcttgcaatttactcag agcacttgggctgcccacggagggggtgaatttgctcctagcgcgcagctggcctcccgcgagcagcagat cgctgtgggagagagggtgttggccacacagggaagaggtgcctggcctgtctgtggccgcggactcagta atgctacccctagggaggtgctgcccgcctcagccgctatggacgctccactggatgctgccgccgtgaatg gcgagccagctccgctggcacccccacctgcagaccccgctcccccagtcgagctggcggcaaacgacct gcccgcacctctcggagaaccacttcctgcagcgcctgccgatccagctccacctgctgatttggctcccccc gctcccgccgatgtagcccctccggtcgagttggctgtgaatgacctgccggcacctctgggcgagcccctc ccagccgctccggccgaccctgcccctcctgctgatctggcaccacccgctcctgccgacctcgccccaccc gccccagcagacctggctccaccagcgcctgcggatcttgccccgcctgttgagctggctgtcaacgatcttc ctgcgcctcttggagagcccctgcccgctgctccagccgaactcgcaccaccggcagatctggctcccgcct ctgccgatcttgcacctcccgcaccggcggacttggcacctccagcaccagcagaactggctccccctgcgc cggctgacctggcccctccagcagccgttaatgagcaaaccgcaccaggggaccagccggctacggcacc aggtggaccggtggggctggccaccgacctggagctgcctgagccggatccccaaccagctgatgctccc ccacctggcgacgtaactgaggccccagctgaaacgccccaggtcagtaacatcgcttacacaaagaaact gtggcaggcaattagggctcaggacgtgtgtgggaacgacgccctggacagcttggcccaaccgtacgtga tcggtatgcaccccctccccgctgatcatggtcgcagtcgctgtaaccgccaccccatttcacctctcagcctta ttgggaatgcgtctgctacaagtggcgacatgtctagtatgacaaggattgctaagcccctcatcaaaagtgcg atggctgccggtctggtaacagcatccatgagcttgtccaccgcagtggctcacgctgggccttccccgaac tgggatgccgtcgcccagtgcgagtcaggcggcaattgggccgcaaataccggtaacggtaagtatggagg actgcagtttaaacctgcaacttgggccgcctttggaggagtgggtaatcctgcagctgcttctagagaacagc agattgccgtggctaaccgcgttctcgcggagcagggtctggacgcctggccgacctgtggcgccgcatca ggtttgccgatcgcgttgtggtcaaagcccgcccagggaatcaagcagattatcaatgagatcatctgggccg gaatacaggcaagcatccctagaatgactcctgggcttctgacaaccgctggcgctgggaggcccagggat aggtgcgcccggatcgtttgtaccgtattcatagagaccgccgtggtcgcgacaatgttcgtggctctcttggg cttgagcaccattagctctaaggccgatgatatagattgggatgctattgctcaatgcgaatccggtgggaact gggccgctaataccggaaatgggctctacggcggactgcagatcagccaggctacatgggatagcaacgg aggagtcgggtcccctgccgctgcatccccgcaacagcaaatcgaggtggccgataacatcatgaaaaccc agggacccggagcctggcccaaatgtagctcatgtagccaaggagatgcgcccctcggttcactgacgcac atcctcaccttcctcgccgcggaaaccggagggtgctctggcagccgggacgactga (SEQ ID
NO:23)
MSGRHRKPTTSNVSVAKIAFTGAVLGGGGIAMAAQATAATDGEWD QVARCESGGNWSINTGNGYLGGLQFTQSTWAAHGGGEFAPSAQLAS REQQIA VGER VLATQGRGAWP VCGRGLS N ATPRE VLPAS AAMD APL DAAAVNGEPAPLAPPPADPAPPVELAANDLPAPLGEPLPAAPADPAPP ADLAPPAPADVAPPVELAVNDLPAPLGEPLPAAPADPAPPADLAPPAP
ADLAPPAPADLAPPAPADLAPPVELAVNDLPAPLGEPLPAAPAELAPP
ADLAPASADLAPPAPADLAPPAPAELAPPAPADLAPPAAVNEQTAPG
DQPATAPGGPVGLATDLELPEPDPQPADAPPPGDVTEAPAETPQVSNI
AYTKKLWQAIRAQDVCGNDALDSLAQPYVIGVHPLPADHGRSRCNR
HPIS PLS LIGN AS ATS GDMS S MTRIAKPLIKS AM AAGLVT ASMSLS T A
VAHAGPSPNWDAVAQCESGGNWAANTGNGKYGGLQFKPATWAAF
GG VGNP A AAS REQQI A VANR VLAEQGLD AWPTCG A AS GLPIALWS K
PAQGIKQIINEIIWAGIQASIPRMTPGLLTTAGAGRPRDRCARIVCTVFI
ETAVVATMFVALLGLSTISSKADDIDWDAIAQCESGGNWAANTGNG
LYGGLQISQATWDSNGGVGSPAAASPQQQIEVADNIMKTQGPGAWP
KCS S CS QGD APLGSLTHILTFLA AETGGCS GS RDD (SEQ ID NO:24)
D atgttctcccggccggggctgccggtcgagtacctgcaggtgccgtcgccgtcgatgggccgcgacatcaa ggttcagttccagagcggtgggaacaactcacctgcggtttatctgctcgacggcctgcgcgcccaagacga ctacaacggctgggatatcaacaccccggcgttcgagtggtactaccagtcgggactgtcgatagtcatgccg gtcggcgggcagtccagcttctacagcgactggtacagcccggcctgcggtaaggctggctgccagactta caagtgggaaaccttcctgaccagcgagctgccgcaatggttgtccgccaacagggccgtgaagcccaccg gcagcgctgcaatcggcttgtcgatggccggctcgtcggcaatgatcttggccgcctaccacccccagcagtt catctacgccggctcgctgtcggccctgctggacccctctcaggggatggggcctagcctgatcggcctcgc gatgggtgacgccggcggttacaaggccgcagacatgtggggtccctcgagtgacccggcatgggagcgc aacgaccctacgcagcagatccccaagctggtcgcaaacaacacccggctatgggtttattgcgggaacgg caccccgaacgagttgggcggtgccaacatacccgccgagttcttggagaacttcgttcgtagcagcaacct gaagttccaggatgcgtacaacgccgcgggcgggcacaacgccgtgttcaacttcccgcccaacggcacg cacagctgggagtactggggcgctcagctcaacgccatgaagggtgacctgcagagttcgttaggcgccgg catgacagagcagcagtggaatttcgcgggtatcgaggccgcggcaagcgcaatccagggaaatgtcacgt ccattcattccctccttgacgaggggaagcagtccctgaccaagctcgcagcggcctggggcggtagcggtt cggaggcgtaccagggtgtccagcaaaaatgggacgccacggctaccgagctgaacaacgcgctgcaga acctggcgcggacgatcagcgaagccggtcaggcaatggcttcgaccgaaggcaacgtcactgggatgttc gcatag (SEQ ID NO:25)
MFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQD D YNGWDINTPAFEWY YQS GLS I VMPVGGQS SFYS DW YS PACGKAGC QTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAY HPQQFIYAGSLS ALLDPS QGMGPSLIGLAMGD AGGYKAADMWGPS S DPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLE NFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMK GDLQS S LG AGMTEQQWNFAGIE A A AS AIQGN VTSIHS LLDEGKQS LT KLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISEAGQA MAS TEGN VTGMFA (SEQ ID NO:26)
E atggcgttcagcagacccggcctgcccgtggagtacctgcaggtgcccagccccagcatgggccgggaca tcaaagtgcagttccagagcggcggagccaacagccctgccctgtacctgctggacggcctgcgggcccag gacgacttcagcggctgggacatcaacacccccgccttcgagtggtacgaccagagcggcctgagcgtggt gatgcccgtgggcggccagagcagcttctacagcgactggtatcagcccgcctgcggcaaggccggctgc cagacctacaagtgggagaccttcctgaccagcgagctgcccggctggctgcaggccaaccggcacgtga agcccaccggcagcgccgtggtgggcctgagcatggccgccagcagcgccctgaccctggccatctacca cccccagcagttcgtgtacgccggagccatgagcggcctgctggaccccagccaggccatgggccccacc ctgatcggcctggccatgggcgacgccggaggctacaaggccagcgacatgtggggccccaaggaggac cccgcctggcagcggaacgaccccctgctgaacgtgggcaagctgatcgccaacaacacccgcgtgtggg tgtactgcggcaacggcaagcccagcgacctgggcggcaacaacctgcccgccaagttcctggagggcttc gtgcggaccagcaacatcaagttccaggacgcctacaacgccggaggcggccacaacggcgtgttcgactt ccccgacagcggcacccacagctgggagtactggggagcccagctgaacgccatgaagcccgacctgca gcgggccctgggcgccacccccaacaccggccctgccccccagggcgctaccgagcagcagtggaactt
cgccggcatcgaagctgccgcgagcgccatccaaggcaacgtgaccagcatccacagcctgctggacgag ggcaagcagagcctgaccaagctggctgctgcttggggcggatccggaagcgaagcctaccagggcgtgc agcagaagtgggacgccacagccaccgagctgaacaacgccctgcagaacctcgccagaaccatcagcg aggccggacaggctatggccagcacagagggcaatgtgaccggcatgttcgccagggccacagtgggcct ggtggaggccattggcatcagggagctgaggcagcacgccagcaggtacctggccagagtggaggctgg agaggagctgggcgtgaccaacaagggcaggctggtggccagactgatccccgtgcaggctgccgagag gagcagagaggccctgatcgagagcggcgtgctgatccctgccagaaggcctcagaacctgctggacgtg accgctgagcctgccagaggcaggaagaggaccctgagcgacgtgctgaacgagatgagggacgagcag acaacagccagggacatcatgaacgccggcgtgacctgcgtgggagagcatgaaaccctcaccgccgccg cccaatacatgagggagcacgacatcggcgccctgcccatctgtggagacgacgacaggctgcacggcat gctgaccgacagggacatcgtgatcaagggcctggctgccggcctcgatcctaacaccgctacagccggcg agctggccagagacagcatctactacgtggacgccaacgccagcatccaggagatgctcaacgtgatggag gagcaccaggtgagaagggtgcctgtgatcagcgagcacaggctggtgggcatcgtgaccgaggccgata tcgctaggcacctgcccgagcacgccatcgtgcagttcgtgaaggccatctgcagccccatggctctggcca gctcagggaggcatcggaaaccaactacaagcaatgtatctgttgccaagattgctttcaccggcgcagttctt ggaggtggcggaattgccatggctgcccaggcaacagccgctacagatggagagtgggatcaggtggctc gatgtgagtctggtggcaactggtctatcaacactgggaacgggtatcttggcggcttgcaatttactcagagc acttgggctgcccacggagggggtgaatttgctcctagcgcgcagctggcctcccgcgagcagcagatcgc tgtgggagagagggtgttggccacacagggaagaggtgcctggcctgtctgtggccgcggactcagtaatg ctacccctagggaggtgctgcccgcctcagccgctatggacgctccactggatgctgccgccgtgaatggcg agccagctccgctggcacccccacctgcagaccccgctcccccagtcgagctggcggcaaacgacctgcc cgcacctctcggagaaccacttcctgcagcgcctgccgatccagctccacctgctgatttggctccccccgct cccgccgatgtagcccctccggtcgagttggctgtgaatgacctgccggcacctctgggcgagcccctccca gccgctccggccgaccctgcccctcctgctgatctggcaccacccgctcctgccgacctcgccccacccgcc ccagcagacctggctccaccagcgcctgcggatcttgccccgcctgttgagctggctgtcaacgatcttcctg cgcctcttggagagcccctgcccgctgctccagccgaactcgcaccaccggcagatctggctcccgcctctg ccgatcttgcacctcccgcaccggcggacttggcacctccagcaccagcagaactggctccccctgcgccg gctgacctggcccctccagcagccgttaatgagcaaaccgcaccaggggaccagccggctacggcaccag gtggaccggtggggctggccaccgacctggagctgcctgagccggatccccaaccagctgatgctccccca cctggcgacgtaactgaggccccagctgaaacgccccaggtcagtaacatcgcttacacaaagaaactgtgg caggcaattagggctcaggacgtgtgtgggaacgacgccctggacagcttggcccaaccgtacgtgatcgg tacccccggactcctcaccacagctggagctggcaggcccagagacagatgcgccaggatcgtgtgcacc gtgttcatcgagaccgccgtggtggctaccatgttcgtggccctgctgggcctgagcaccatcagcagcaag gccgacgacatcgactgggacgccatcgcccagtgtgaatccggcggaaactgggccgccaataccggca atggcctgtacggcggcctgcagatcagccaggctacctgggactccaacggaggagtgggaagccctgc cgctgcttcccctcagcagcagatcgaggtggccgacaacatcatgaagacccaaggccctggcgcctggc ctaagtgttccagctgtagccagggcgatgctcctctgggcagcctgacccacatcctgacctttctcgccgcc gagacaggcggatgtagcggaagcagggacgac (SEQ ID NO:27) gctagcaccatggcgttcagcagacccggcctgcccgtggagtacctgcaggtgcccagccccagcatggg ccgggacatcaaagtgcagttccagagcggcggagccaacagccctgccctgtacctgctggacggcctgc gggcccaggacgacttcagcggctgggacatcaacacccccgccttcgagtggtacgaccagagcggcct gagcgtggtgatgcccgtgggcggccagagcagcttctacagcgactggtatcagcccgcctgcggcaag gccggctgccagacctacaagtgggagaccttcctgaccagcgagctgcccggctggctgcaggccaacc ggcacgtgaagcccaccggcagcgccgtggtgggcctgagcatggccgccagcagcgccctgaccctgg ccatctaccacccccagcagttcgtgtacgccggagccatgagcggcctgctggaccccagccaggccatg ggccccaccctgatcggcctggccatgggcgacgccggaggctacaaggccagcgacatgtggggcccc aaggaggaccccgcctggcagcggaacgaccccctgctgaacgtgggcaagctgatcgccaacaacacc cgcgtgtgggtgtactgcggcaacggcaagcccagcgacctgggcggcaacaacctgcccgccaagttcct ggagggcttcgtgcggaccagcaacatcaagttccaggacgcctacaacgccggaggcggccacaacgg
cgtgttcgacttccccgacagcggcacccacagctgggagtactggggagcccagctgaacgccatgaagc ccgacctgcagcgggccctgggcgccacccccaacaccggccctgccccccagggcgctaccgagcagc agtggaacttcgccggcatcgaagctgccgcgagcgccatccaaggcaacgtgaccagcatccacagcctg ctggacgagggcaagcagagcctgaccaagctggctgctgcttggggcggatccggaagcgaagcctacc agggcgtgcagcagaagtgggacgccacagccaccgagctgaacaacgccctgcagaacctcgccagaa ccatcagcgaggccggacaggctatggccagcacagagggcaatgtgaccggcatgttcgccagggccac agtgggcctggtggaggccattggcatcagggagctgaggcagcacgccagcaggtacctggccagagtg gaggctggagaggagctgggcgtgaccaacaagggcaggctggtggccagactgatccccgtgcaggct gccgagaggagcagagaggccctgatcgagagcggcgtgctgatccctgccagaaggcctcagaacctgc tggacgtgaccgctgagcctgccagaggcaggaagaggaccctgagcgacgtgctgaacgagatgaggg acgagcagacaacagccagggacatcatgaacgccggcgtgacctgcgtgggagagcatgaaaccctcac cgccgccgcccaatacatgagggagcacgacatcggcgccctgcccatctgtggagacgacgacaggctg cacggcatgctgaccgacagggacatcgtgatcaagggcctggctgccggcctcgatcctaacaccgctac agccggcgagctggccagagacagcatctactacgtggacgccaacgccagcatccaggagatgctcaac gtgatggaggagcaccaggtgagaagggtgcctgtgatcagcgagcacaggctggtgggcatcgtgaccg aggccgatatcgctaggcacctgcccgagcacgccatcgtgcagttcgtgaaggccatctgcagccccatgg ctctggccagctcagggaggcatcggaaaccaactacaagcaatgtatctgttgccaagattgctttcaccgg cgcagttcttggaggtggcggaattgccatggctgcccaggcaacagccgctacagatggagagtgggatc aggtggctcgatgtgagtctggtggcaactggtctatcaacactgggaacgggtatcttggcggcttgcaattt actcagagcacttgggctgcccacggagggggtgaatttgctcctagcgcgcagctggcctcccgcgagca gcagatcgctgtgggagagagggtgttggccacacagggaagaggtgcctggcctgtctgtggccgcgga ctcagtaatgctacccctagggaggtgctgcccgcctcagccgctatggacgctccactggatgctgccgcc gtgaatggcgagccagctccgctggcacccccacctgcagaccccgctcccccagtcgagctggcggcaa acgacctgcccgcacctctcggagaaccacttcctgcagcgcctgccgatccagctccacctgctgatttggc tccccccgctcccgccgatgtagcccctccggtcgagttggctgtgaatgacctgccggcacctctgggcga gcccctcccagccgctccggccgaccctgcccctcctgctgatctggcaccacccgctcctgccgacctcgc cccacccgccccagcagacctggctccaccagcgcctgcggatcttgccccgcctgttgagctggctgtcaa cgatcttcctgcgcctcttggagagcccctgcccgctgctccagccgaactcgcaccaccggcagatctggct cccgcctctgccgatcttgcacctcccgcaccggcggacttggcacctccagcaccagcagaactggctccc cctgcgccggctgacctggcccctccagcagccgttaatgagcaaaccgcaccaggggaccagccggcta cggcaccaggtggaccggtggggctggccaccgacctggagctgcctgagccggatccccaaccagctga tgctcccccacctggcgacgtaactgaggccccagctgaaacgccccaggtcagtaacatcgcttacacaaa gaaactgtggcaggcaattagggctcaggacgtgtgtgggaacgacgccctggacagcttggcccaaccgt acgtgatcggtacccccggactcctcaccacagctggagctggcaggcccagagacagatgcgccaggat cgtgtgcaccgtgttcatcgagaccgccgtggtggctaccatgttcgtggccctgctgggcctgagcaccatc agcagcaaggccgacgacatcgactgggacgccatcgcccagtgtgaatccggcggaaactgggccgcc aataccggcaatggcctgtacggcggcctgcagatcagccaggctacctgggactccaacggaggagtgg gaagccctgccgctgcttcccctcagcagcagatcgaggtggccgacaacatcatgaagacccaaggccct ggcgcctggcctaagtgttccagctgtagccagggcgatgctcctctgggcagcctgacccacatcctgacct ttctcgccgccgagacaggcggatgtagcggaagcagggacgactacccctacgacgtgcccgactacgc cgattagtctaga (SEQ ID NO:28)
MAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQ
DDFS GWDINTP AFEWYDQS GLS V VMP VGGQS S FYSD WYQPACGKA
GCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLA
IYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWG
PKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPA
KFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLN
AMKPDLQRALGATPNTGPAPQGATEQQWNFAGIEAAASAIQGNVTSI
HSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ
NLARTIS E AGQAM AS TEGN VTGMFARAT VGL VE AIGIRELRQHAS RY
LAR VE AGEELG VTNKGRL V ARLIP VQ A AERS RE ALIES G VLIPARRPQ
NLLDVTAEPARGRKRTLSDVLNEMRDEQTTARDIMNAGVTCVGEHE
TLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPN
TATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGI
VTE ADIARHLPEHAI VQFVKAICSPM AL AS S GRHRKPTTS NVS VAKIA
FTGAVLGGGGIAMAAQATAATDGEWDQVARCESGGNWSINTGNGY
LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVGERVLATQGRGA
WPVCGRGLSNATPREVLPASAAMDAPLDAAAVNGEPAPLAPPPADP
APPVELAANDLPAPLGEPLPAAPADPAPPADLAPPAPADVAPPVELA
VNDLPAPLGEPLPAAPADPAPPADLAPPAPADLAPPAPADLAPPAPAD
LAPPVELAVNDLPAPLGEPLPAAPAELAPPADLAPASADLAPPAPADL
APPAPAELAPPAPADLAPPAAVNEQTAPGDQPATAPGGPVGLATDLE
LPEPDPQPADAPPPGDVTEAPAETPQVSNIAYTKKLWQAIRAQDVCG
NDALDSLAQPYVIGTPGLLTTAGAGRPRDRCARIVCTVFIETAVVAT
MFVALLGLSTIS S KADDIDWD AIAQCES GGNWA ANTGNGLYGGLQIS
QATWDSNGGVGSPAAASPQQQIEVADNIMKTQGPGAWPKCSSCSQG
D APLGS LTHILTFL A AETGGCS GS RDD (SEQ ID NO:29)
MAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQ
DDFS GWDINTP AFEWYDQS GLS V VMP VGGQS S FYSD WYQPACGKA
GCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLA
IYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWG
PKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPA
KFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLN
AMKPDLQRALGATPNTGPAPQGATEQQWNFAGIEAAASAIQGNVTSI
HSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ
NLARTIS E AGQAM AS TEGN VTGMFARAT VGL VE AIGIRELRQHAS RY
LARVE AGEELG VTNKGRL V ARLIP VQ A AERS RE ALIES G VLIPARRPQ
NLLDVTAEPARGRKRTLSDVLNEMRDEQTTARDIMNAGVTCVGEHE
TLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPN
TATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGI
VTE ADIARHLPEHAI VQFVKAICSPM ALAS S GRHRKPTTS NVS VAKIA
FTGAVLGGGGIAMAAQATAATDGEWDQVARCESGGNWSINTGNGY
LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVGERVLATQGRGA
WPVCGRGLSNATPREVLPASAAMDAPLDAAAVNGEPAPLAPPPADP
APPVELAANDLPAPLGEPLPAAPADPAPPADLAPPAPADVAPPVELA
VNDLPAPLGEPLPAAPADPAPPADLAPPAPADLAPPAPADLAPPAPAD
LAPPVELAVNDLPAPLGEPLPAAPAELAPPADLAPASADLAPPAPADL
APPAPAELAPPAPADLAPPAAVNEQTAPGDQPATAPGGPVGLATDLE
LPEPDPQPADAPPPGDVTEAPAETPQVSNIAYTKKLWQAIRAQDVCG
NDALDSLAQPYVIGTPGLLTTAGAGRPRDRCARIVCTVFIETAVVAT
MFVALLGLSTISSKADDIDWDAIAQCESGGNWAANTGNGLYGGLQIS
QATWDSNGGVGSPAAASPQQQIEVADNIMKTQGPGAWPKCSSCSQG
D APLGS LTHILTFL A AETGGCS GS RDD YP YD VPD Y AD (SEQ ID
NO:30)
Any Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can have an amino acid sequence that is 100%, or from 70% to 99.9%, identical to the particular amino acid sequence listed in Tables 1 and 2. The amino acid sequence of any
individual Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can be at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the particular amino acid sequence listed in Tables 1 and 2. Identity or similarity with respect to an amino acid or nucleotide sequence is defined herein as the percentage of amino acid residues (or nucleotide residues as the case may be) in the particular Mtb antigen that are identical (i.e., same residue) with the amino acid or nucleotide sequence for the Mtb antigen shown in Tables 1 and 2, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Percent sequence identity can be determined by, for example, the Gap program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer
Group, University Research Park, Madison WI), using default settings, which uses the algorithm of Smith and Waterman (Adv. Appl. Math., 1981, 2, 482-489). Any amino acid number calculated as a % identity can be rounded up or down, as the case may be, to the closest whole number.
Optimal alignment of sequences for comparison can also be conducted using the
Megalign program in the Lasergene suite of bioinformatics software (DNASTAR, Inc., Madison, Wis.), using default parameters. This program embodies several alignment schemes described in the following references: Dayhoff, M. O. (1978) A model of evolutionary change in proteins— Matrices for detecting distant relationships. In Dayhoff, M. O. (ed.) Atlas of Protein Sequence and Structure, National Biomedical Research Foundation, Washington D.C. Vol. 5, Suppl. 3, pp. 345-358; Hein J. (1990) Unified Approach to Alignment and Phylogenes pp. 626-645 Methods in Enzymology vol. 183, Academic Press, Inc., San Diego, Calif.; Higgins, D. G. and Sharp, P. M. (1989) CABIOS 5:151-153; Myers, E. W. and Muller W. (1988) CABIOS 4:11-17;
Robinson, E. D. (1971) Comb. Theor 11 :105; Santou, N. Nes, M. (1987) Mol. Biol. Evol. 4:406- 425; Sneath, P. H. A. and Sokal, R. R. (1973) Numerical Taxonomy - the Principles and Practice of Numerical Taxonomy, Freeman Press, San Francisco, Calif.; Wilbur, W. J. and Lipman, D. J. (1983) Proc. Natl. Acad., Sci. USA 80:726-730.
Alternately, optimal alignment of sequences for comparison may be conducted by the local identity algorithm of Smith and Waterman (1981) Add. APL. Math 2:482, by the identity alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity methods of Pearson and Lipman (1988) Proc. Natl. Acad. Sci. USA 85: 2444, by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, Wis.), or by inspection.
Suitable examples of algorithms for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1977) Nucl. Acids Res. 25:3389-3402 and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. BLAST and BLAST 2.0 can be used, for example with the parameters described herein, to determine percent sequence identity for the polynucleotides and polypeptides of the invention. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. In one illustrative example, cumulative scores can be calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix can be used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative- scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments, (B) of 50, expectation (E) of 10, M=5, N=-4 and a comparison of both strands.
In some embodiments, the "percentage of sequence identity" is determined by comparing two optimally aligned sequences over a window of comparison of at least 20 positions, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less, usually 5 to 15 percent, or 10 to 12 percent, as compared to the reference sequences (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid bases or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the reference sequence (i.e., the window size) and multiplying the results by 100 to yield the percentage of sequence identity.
Any Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can be fragments of the particular amino acid sequence listed in Table 1. The amino acid sequence of any individual Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can be missing consecutive amino acids constituting at least 20%, at least 15%, at least 10%, at least 5%, at least 4%, at least 3%, at least 2%, or at least 1%, of the particular amino acid sequence listed in Table 1. The omitted consecutive amino acids may be
from the C-terminus or N-terminus portion of the antigen. Alternately, the omitted consecutive amino acids may be from the internal portion of the antigen, thus retaining at least its C-terminus and N-terminus amino acids of the antigen.
Any Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can have one or more amino acid additions, deletions, or substitutions compared to the particular amino acid sequence listed in Table 1. Any individual Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can have at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or at least twelve amino acid additions, deletions, or substitutions compared to the particular amino acid sequence listed in Table 1. The amino acid additions, deletions, or substitutions can take place at any amino acid position within the Mtb antigen.
Where a particular Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, comprises at least one or more substitutions, the substituted amino acid(s) can each be, independently, any naturally occurring amino acid or any non-naturally occurring amino acid. Thus, a particular Mtb antigen may comprise one or more amino acid substitutions that are naturally occurring amino acids and/or one or more amino acid
substitutions that are non-naturally occurring amino acids. Individual amino acid substitutions are selected from any one of the following: 1) the set of amino acids with nonpolar sidechains, for example, Ala, Cys, He, Leu, Met, Phe, Pro, Val; 2) the set of amino acids with negatively charged side chains, for example, Asp, Glu; 3) the set of amino acids with positively charged sidechains, for example, Arg, His, Lys; and 4) the set of amino acids with uncharged polar sidechains, for example, Asn, Cys, Gin, Gly, His, Met, Phe, Ser, Thr, Trp, Tyr, to which are added Cys, Gly, Met and Phe. Substitutions of a member of one class with another member of the same class are contemplated herein. Naturally occurring amino acids include, for example, alanine (Ala), arginine (Arg), asparagine (Asn), aspartic acid (Asp), cysteine (Cys), glutamine (Gin), glutamic acid (Glu), glycine (Gly), histidine (His), isoleucine (He), leucine (Leu), lysine (Lys), methionine (Met), phenylalanine (Phe), proline (Pro), serine (Ser), threonine (Thr), tryptophan (Trp), tyrosine (Tyr), and valine (Val). Non-naturally occurring amino acids include, for example, norleucine, ornithine, norvaline, homoserine, and other amino acid residue analogues such as those described in Ellman et al., Meth. Enzym., 1991, 202, 301-336. To generate such non-naturally occurring amino acid residues, the procedures of Noren et al., Science, 1989, 244, 182 and Ellman et al., supra, can be used. Briefly, these procedures involve chemically activating a suppressor tRNA with a non-naturally occurring amino acid residue followed by in vitro transcription and translation of the RNA.
The Mtb antigens, including any Mtb antigen within any of the fusion proteins described herein, which are modified as described herein retain their ability to elicit an immune response against Mycobacterium tuberculosis. That is, modification of a particular Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, will still allow the resultant Mtb antigen, or fusion protein comprising the same, to elicit an immune response against Mycobacterium tuberculosis.
The present disclosure also provides nucleic acid molecules encoding any of the fusion proteins described herein that comprise at least three Mycobacterium tuberculosis (Mtb) antigens. The nucleic acid molecules described herein and in Tables 1 and 2 are representative. The specific sequences recited in Table 1 are simply one example of a nucleic acid molecule that can encode a particular Mtb antigen within a fusion protein. One skilled in the art having knowledge of the genetic code can routinely prepare and design a plethora of nucleic acid molecules encoding the same Mtb antigen. The length and nucleotide content of any particular nucleic acid molecule is dictated by the desired amino acid sequence of the encoded Mtb antigen. The nucleic acid molecule sequences shown in Tables 1 and 2 are DNA, although RNA nucleic acid molecules are also contemplated.
In some embodiments, the CMV vaccines are attenuated CMV vaccines which are unable or impaired in their ability to replicate or assemble in cells and tissues associated with CMV transmission and disease. In addition, the present disclosure includes embodiments that relate to the unique ability of RhCMV to re-infect sero-positive Rhesus Macaques (or HCMV to re-infect sero-positive humans) in spite of the presence of a significant anti-RhCMV immune response (or anti-HCMV immune response). This inherent property of CMV vectors can be attributed to the extensive repertoire of immune evasion genes encoded by this virus (Hansen, S. G., Powers, C. J., Richards, R., Ventura, A. B., Ford, J. C, Siess, D., Axthelm, M. K., Nelson, J. A., Jarvis, M. A., Picker, L. J., et al. 2010. Evasion of CD8+ T cells is critical for superinfection by cytomegalovirus. Science 328: 102-106).
Some embodiments address issues of virus shedding and pathogenesis and relate to two potentially complementary approaches to generate a safe and effective vaccines using the CMV vectors. One approach focuses on development of CMV vectors that are either completely or conditionally spread defective or severely restricted in their replication, but that remain capable of inducing a protective immune response against a heterologous antigen. The second approach focuses on the generation of replication competent CMV vectors that are unable to infect cells, such as epithelial cells, which are a major cell type, along with fibroblasts, in the lung associated
with CMV pneumonia. Some embodiments may relate to additional safety features into these vectors, including a block in replication in neural and myeloid cells.
In some embodiments, the HCMV and RhCMV recombinant vectors encode heterologous antigens that may elicit and maintain high level cellular and/or humoral immune responses specific for the encoded antigen.
Further provided are recombinant RhCMV or HCMV vectors including a deletion in one or more RhCMV or HCMV genes that are important for replication. In some embodiments, at least one essential or augmenting gene is UL82, UL94, UL32, UL99, UL115 or UL44, or a homolog thereof. In some embodiments, the recombinant RhCMV or HCMV vectors further include a heterologous antigen, such as a pathogen-specific antigen or a tumor antigen.
For a human CMV (HCMV)/TB vaccine to be safe for all potential subjects in a general population, including individuals with unsuspected immune compromise, the CMV vaccine vector needs to be attenuated without losing the ability to induce protective immunity. CMV can replicate in a wide variety of cells and tissues in the host, including: neurons in the central nervous system (CNS), epithelial cells, hepatocytes, lung and kidney. Myeloid and endothelial cells are considered persistent sites for CMV in the host. During overt CMV disease in immunocompromised individuals, direct infection resulting in destruction of epithelial and endothelial cells in the lung, liver and retina is responsible for disease in these target organs. During congenital infection, direct CMV infection of neuronal cells is believed to account for the associated hearing deficits and mental retardation. Embodiments of the invention relate to modulating the ability of CMV to replicate in these critical cell types in order to increase vector safety without compromising vaccine efficacy, said attenuated viruses and their use as vaccines.
Some embodiments relate to HCMV as a vector for inducing protective immunity to TB, which is based on the highly innovative hypothesis that a high frequency, effector memory- biased T cell response has distinct advantages over conventional vaccine generated memory, combined with the recognition that HCMV provides just such a response. This characteristic of HCMV is unique to this virus, even when compared to other persistent viruses such as herpes simplex virus (HSV) and Epstein-Barr virus (Asanuma, H., Sharp, M., Maecker, H. T., Maino, V. C, and Arvin, A. M. 2000. Frequencies of memory T cells specific for varicella-zoster virus, herpes simplex virus, and cytomegalovirus by intracellular detection of cytokine expression. J Infect Dis 181:859-866; Harari, A., Vallelian, F., Meylan, P. R., and Pantaleo, G. 2005.
Functional heterogeneity of memory CD4+ T cell responses in different conditions of antigen exposure and persistence. J Immunol 174:1037-1045; Harari, A., Enders, F. B., Cellerai, C, Bart, P. A., and Pantaleo, G. 2009. Distinct profiles of cytotoxic granules in memory CD8+ T
cells correlate with function, differentiation stage, and antigen exposure. J Virol 83:2862-2871 ; Sylwester, A. W., Mitchell, B. L., Edgar, J. B., Taormina, C, Pelte, C, Ruchti, F., Sleath, P. R., Grabstein, K. H., Hosken, N. A., Kern, F., et al. 2005. Broadly targeted human cytomegalovirus- specific CD4+ and CD8+ T cells dominate the memory compartments of exposed subjects. J Exp Med 202:673-685).
While the HCMV vaccine may be considered safe, concerns still remain regarding both pathogenicity as well as the ability of the virus to spread to unvaccinated sero-negative individuals. The ability to rationally design an HCMV vaccine that is less pathogenic and not shed into the environment is now available with the advent of technological breakthroughs to clone and genetically manipulate CMV. With a long-term goal of generating a CMV vaccine vector encoding TB antigens that is safe and unable to spread to other individuals. Embodiments of this invention relate to the rational design and use of the latest reverse genetic techniques to generate a CMV-based vector that has a restricted tropism for cells involved in shedding as well as an altered ability to replicate in tissues associated with both adult and immunosuppressed populations.
In some embodiments, the recombinant RhCMV or HCMV vaccine vector is a tropism- restricted vector. In some embodiments, the tropism-restrictive vector lacks genes required for optimal growth in certain cell types or contains targets for tissue-specific micro-RNAs in genes essential for viral replication or wherein the tropism-restrictive vector has an epithelial, central nervous system (CNS), or macrophage deficient tropism, or a combination thereof.
Some embodiments relate to alteration of the cell-tropism of the CMV vector so as to prevent infection of specific cell types involved in potential tissue damage and/or shedding into urine or secretions. CMV is capable of infecting a wide variety of cells in the host, including: epithelial cells in gut, kidney, lung and retina, neuronal cells in the CNS, hepatocytes, as well as endothelial cells and myeloid lineage cells that are considered persistent sites of the virus (Dankner, W. M., McCutchan, J. A., Richman, D. D., Hirata, K., and Spector, S. A. 1990.
Localization of human cytomegalovirus in peripheral blood leukocytes by in situ hybridization. J Infect Dis 161:31-36; Einhorn, L., and Ost, A. 1984. Cytomegalovirus infection of human blood cells. J Infect Dis 149:207-214; Gnann, J. W., Jr., Ahlmen, J., Svalander, C, Olding, L., Oldstone, M. B., and Nelson, J. A. 1988. Inflammatory cells in transplanted kidneys are infected by human cytomegalovirus. Am J Pathol 132:239-248; Howell, C. L., Miller, M. J., and Martin, W. J. 1979. Comparison of rates of virus isolation from leukocyte populations separated from blood by conventional and Ficoll-Paque/Macrodex methods. J Clin Microbiol 10:533-537; Myerson, D., Hackman, R. C, Nelson, J. A., Ward, D. C, and McDougall, J. K. 1984.
Widespread presence of histologically occult cytomegalovirus. Hum Pathol 15:430-439; Schrier, R. D., Nelson, J. A., and Oldstone, M. B. 1985. Detection of human cytomegalovirus in peripheral blood lymphocytes in a natural infection. Science 230:1048-1051 ; Sinzger, C, Grefte, A., Plachter, B., Gouw, A. S., The, T. H., and Jahn, G. 1995. Fibroblasts, epithelial cells, endothelial cells and smooth muscle cells are major targets of human cytomegalovirus infection in lung and gastrointestinal tissues. J Gen Virol 76:741-750).
HCMV encodes >200 genes and several of the genes that are dispensable for basic virus replication have been identified as tropism determinants that enable the virus to enter and replicate in macrophages, endothelial cells, and epithelial cells. One locus of HCMV genes, UL128-131A, has been shown to be essential for entry into endothelial and epithelial cells
(Gerna, G., Percivalle, E., Lilleri, D., Lozza, L., Fornara, C, Hahn, G., Baldanti, F., and Revello, M. G. 2005. Dendritic-cell infection by human cytomegalovirus is restricted to strains carrying functional UL131-128 genes and mediates efficient viral antigen presentation to CD8+ T cells. J Gen Virol 86:275-284; Hahn, G., Revello, M. G., Patrone, M., Percivalle, E., Campanini, G., Sarasini, A., Wagner, M., Gallina, A., Milanesi, G., Koszinowski, U., et al. 2004. Human cytomegalovirus UL131-128 genes are indispensable for virus growth in endothelial cells and virus transfer to leukocytes. J Virol 78:10023-10033; Wang, D., and Shenk, T. 2005. Human cytomegalovirus UL131 open reading frame is required for epithelial cell tropism. J Virol 79:10330-10338; Wang, D., and Shenk, T. 2005. Human cytomegalovirus virion protein complex required for epithelial and endothelial cell tropism. Proc Natl Acad Sci USA
102:18153-18158; Ryckman, B. J., Rainish, B. L., Chase, M. C, Borton, J. A., Nelson, J. A., Jarvis, M. A., and Johnson, D. C. 2008. Characterization of the human cytomegalovirus gH/gL/ULl 28-131 complex that mediates entry into epithelial and endothelial cells. J Virol 82:60-70; Ryckman, B. J., Jarvis, M. A., Drummond, D. D., Nelson, J. A., and Johnson, D. C. 2006. Human cytomegalovirus entry into epithelial and endothelial cells depends on genes UL128 to UL150 and occurs by endocytosis and low-pH fusion. J Virol 80:710-722.).
The RhCMV homologues for HCMV UL128 and 130 are inactivated in the RhCMV strain 68-1. Efficient replication of rhesus cytomegalovirus variants in multiple rhesus and human cell types. Proc Natl Acad Sci USA 105:19950-19955. Interestingly, RhCMV 68-1 still grows in epithelial and endothelial cells (albeit at a reduced rate compared to low passage
RhCMV virus with intact UL128/130) (Lilja, A. E., Chang, W. L., Barry, P. A., Becerra, S. P., and Shenk, T. E. 2008. Functional genetic analysis of rhesus cytomegalovirus: Rh-1 is an epithelial cell tropism factor. J Virol 82:2170-2181; Rue, C. A., Jarvis, M. A., Knoche, A. J., Meyers, H. L., DeFilippis, V. R., Hansen, S. G., Wagner, M., Fruh, K., Anders, D. G., Wong, S.
W., et al. 2004. A cyclooxygenase-2 homologue encoded by rhesus cytomegalovirus is a determinant for endothelial cell tropism. Journal of Virology 78:12529-12536). Mutational analysis of RhCMV 68-1 has identified 4 other RhCMV genes (RhOl (HCMV TLR1), Rhl59 (HCMV UL148), Rhl60 (UL132) and Rh203 (HCMVUS22)) that are also required for epithelial cell tropism (Lilja et al., J Virol, 2008, 82, 2170-2181). Some embodiments relate to the mutation of the remainder of these epithelial cell tropism genes to highly reduce, if not abrogate, the ability of CMV to infect epithelial cells, thereby preventing its ability to be shed into urine or glandular secretions (i.e., saliva and breast milk), yet likely not compromise the ability of a CMV vector to induce a protective immune response to TB.
Moreover, since CMV infection of epithelial cells in the lung and retina results in pneumonia and retinitis, respectively, elimination of all the CMV epithelial cell tropism genes may significantly reduce the resultant vector' s pathogenic potential. Aspects of the invention relate to this highly targeted and innovative approach that will significantly enhance both the safety of the RhCMV/HCMV vector for use as a TB vaccine, as well as prevent shedding and the potential spread of the vaccine vector into the unvaccinated population.
Further embodiments relate to exploiting the tissue-specific expression of cellular microRNAs (miRNAs) to attenuate the virus in tissues associated with disease in adult and congenital infection. Endogenous microRNA can be broadly exploited to regulate transgene expression according to tissue, lineage and differentiation state. (Barnes et al., Cell Host Microbe, 2008, 4, 239-248; Lee et al., Clin. Cancer Res., 2009, 15, 5126-5135; Perez et al., Nat. Biotechnol., 2009, 27, 572-576).
Tissue specific expression of miRNAs has been exploited to generate an attenuated polio vaccine through the introduction of multiple miRNA target sequences of miR-124 that is specifically expressed in the CNS into the 3'UTR of the poliovirus genome (Barnes et al., supra). Addition of the miR-124 target sequences to the poliovirus genome was observed to significantly attenuate virus infection in mice. Similarly, multiple target sequences of miR-93 that is ubiquitously expressed in all mammalian but not avian tissues were added to the nucleoprotein gene of influenza resulting in a species-restricted influenza mutant that was able to grow in chicken eggs but not in mice (Perez et al., supra).
Some embodiments relate to this attenuation approach being effective for larger viruses, such as murine CMV (MCMV). Unlike the small RNA viruses, CMV encodes over 200 genes of which approximately 50% are essential and necessary for replication or encode structural proteins of the virus. One of these essential MCMV genes is the immediate early (IE) 3 gene (the mouse correlate of IE2 in HCMV or RhCMV) that encodes a transcriptional regulatory protein
necessary for subsequent activation of early and late genes in the virus. Deletion of this gene completely blocks viral replication in cells and mouse tissues (Angulo et al., J. Virol., 2000, 74, 11129-11136). It is described herein that introduction of target sequences of tissue-specific miRNAs into the 3'UTR of this gene would attenuate viral replication in these cells.
In further embodiments, the CMV vector may comprise one or more microRNA recognition elements (MREs). A mature microRNA (interchangeably termed an miRNA or miR) is typically an 18-25 nucleotide non-coding RNA that regulates expression of an mRNA operably linked to an MRE with specificity for the miRNA. An MRE can be any sequence that base pairs with and interacts with the miRNA somewhere on the mRNA transcript. Often, the MRE is present in the 3' untranslated region (UTR) of the mRNA, but it can also be present in the coding sequence or in the 5'-UTR. MRE's are not necessarily perfect complements to miRNAs, usually having only a few bases of complementarity to the miRNA and often containing one or more mismatches within those bases of complementarity. An MRE, therefore, can be any sequence capable of being bound by an miRNA sufficiently that the translation of a gene to which the MRE is operably linked (such as a CMV gene that is essential or augmenting for growth in vivo) is repressed by an miRNA silencing mechanism such as the RISC.
In some examples, a microRNA recognition element (MRE) is operably linked to a CMV gene that is essential or augmenting for growth in vivo. In other examples, the MRE silences expression in the presence of a miRNA that is expressed in cells of the myeloid lineage. Such miRNA include, but are not limited to, miR-142-3p, miR-223, miR-27a, miR-652, miR- 155, miR146a, miR-132, miR-21, or miR-125 (Brown et al., Nat. Biotechnol., 2007, 25, 1457- 1467). Myeloid lineage cells have been shown to represent a reservoir of latent virus, and are thought to harbor and disseminate virus throughout the host (Jarvis and Nelson, Front Biosci., 2002, 7, dl575-1582).
Further studies with MCMV (Snyder et al., , C. M., Allan, J. E., Bonnett, E. L., Doom,
C. M., and Hill, A. B. Cross-presentation of a spread-defective MCMV is sufficient to prime the majority of virus-specific CD8+ T cells. PLoS One 5 :e9681) indicate that cross-priming is the primary mechanism by which CMV-encoded proteins prime the immune response, replication in myeloid dendritic cells may have a surprisingly minimal impact on CMV immunogenicity.
Bacterial artificial chromosome (BAC)-based technology is used to generate a recombinant MCMV virus that contained four repeated target sequences (four 21mers) with exact complementarity to the cellular miRNA, miR-142-3p, within the 3'UTR of the essential viral gene IE3 (IE3-142). To confirm the extent to which miR-142-3p expression could repress IE3-142 replication, virus growth assays are performed in the macrophage cell line, IC-21. RT-
PCR analysis confirmed that IC-21 cells express high levels of miR-142-3p making the cell line suitable to test the effectiveness of the strategy. Preliminary experiments confirmed the utility of the approach for cell-type specific attenuation of CMV. Although IE3-142 replicated to wild type levels in fibroblasts, growth was completely blocked in IC-21 macrophage cells. A control virus, IE3-015, which contains only vector sequence within the IE3 insertion site, replicates to wild-type levels in IC-21 cells. RT-PCR analysis indicates that IE3 expression was completely abrogated following infection of IC-21 cells, but not following infection of fibroblast cells (lacking miR-142-3p expression) indicating that disruption of IE3 expression is not due to insertion of the target sequence.
Some embodiments relate to strategy to attenuate CMV based on the showing that viruses can be attenuated for tissue-specific growth by using miRNA target sequences and the attenuation of MCMV in myeloid cells through the targeting of cell specific miRNAs to essential viral genes. Since the CNS is a major target for CMV pathogenesis in both congenital and adult disease, HCMV/TB vaccines are generated that contain target sequences of highly conserved miRNAs specifically expressed by neurons fused to essential CMV genes to prevent replication in the CNS. Target sequences of the myeloid miRNA miR-124 to prevent replication and dissemination of the CMV vector in this cell type are also used. Together, these attenuated viruses will provide a further level of safety that will enable the use of this vaccine in all human target populations.
Also disclosed herein are recombinant CMV vectors, such as RhCMV and HCMV vectors, having a deletion in one or more genes that are essential for or augment CMV replication, dissemination or spreading. Thus, these vectors are referred to as "replication- deficient" CMV vectors. As used herein, "replication-deficient" encompasses CMV vectors that are unable to undergo any replication in a host cell, or have a significantly reduced ability to undergo viral replication. In some examples, the replication-deficient CMV vectors are able to replicate, but are unable to disseminate since they are incapable of infection neighboring cells. In some examples, the replication-deficient CMV vectors are able to replicate, but are unable to spread since they are not released from infected hosts.
CMV essential and augmenting genes are well known in the art (see, for example, Dunn et al., Proc. Natl. Acad. Sci. USA, 2003, 100, 14223-14228; and Dong et al., Proc. Natl. Acad. Sci. USA, 2003, 100, 12396-12401), and are described herein. In some embodiments, the recombinant RhCMV or HCMV vector includes a deletion in one gene that is essential for or augments virus replication, dissemination or spreading. In other embodiments, the recombinant RhCMV or HCMV vector includes a deletion in multiple (such as, but not limited to, two, three
or four) genes essential for or augmenting CMV replication, dissemination or spreading. The deletion need not be a deletion of the entire open reading frame of the gene, but includes any deletion that eliminates expression of functional protein.
In some embodiments, the recombinant RhCMV or HCMV vaccine vector comprises a deletion in a RhCMV or HCMV gene that is essential for replication within a host, dissemination within a host, or spreading from host to host. In some embodiments, the essential gene is UL82 (encoding pp71), UL94 (encoding the UL94 protein), UL32 (encoding ppl50), UL99 (encoding pp28), UL115 (encoding gL) and UL44 (encoding p52), or a homolog thereof.
Replication-deficient RhCMV and HCMV vectors disclosed herein can include a nucleic acid sequence encoding a heterologous antigen, such as a pathogen-specific antigen. As disclosed for other recombinant RhCMV and HCMV vectors described herein, replication- deficient RhCMV and HCMV vectors can be used to elicit an immune response in a subject against the encoded heterologous antigen.
A recombinant RhCMV vector having a deletion in gene UL82 (which encodes the pp 1 protein) is severely impaired in its ability to grow in vitro and to spread in vivo, but still elicits a robust T cell immune response against CMV (U.S. Patent No. 9,249,427). Thus, it is contemplated herein to use such a replication-deficient vector as a vaccine against CMV itself.
In some embodiments, the recombinant RhCMV or HCMV vaccine vector has a deletion in a gene region non-essential for growth in vivo. In some embodiments, the gene region is selected from the group consisting of the RLl 1 family, the pp65 family, the US 12 family, and the US28 family. In some embodiments, the RhCMV gene region is selected from the group consisting of Rhl3-Rh29, Rhl l l-Rhl l2, Rhl91-Rh202, and Rh214-Rh220. In some embodiments, the RhCMV gene region is selected from the group consisting of Rhl3.1, Rhl9, Rh20, Rh23, Rh24, Rhl l2, Rhl90, Rhl92, Rhl96, Rhl98, Rhl99, Rh200, Rh201, Rh202, and Rh220. In some embodiments, the HCMV gene region is selected from the group consisting of RL11, UL6, UL7, UL9, UL11, UL83 (pp65), US12, US13, US 14, US17, US18, US19, US20, US21, and UL28.
In some embodiments, the recombinant RhCMV or HCMV vector comprises a deletion in a RhCMV or HCMV gene that is essential for or augments replication. CMV essential genes and augmenting have been well described in the art (see, for example, Dunn et al., supra; and Dong et al., supra). Essential CMV genes include, but are not limited to, UL32, UL34, UL37, UL44, UL46, UL48, UL48.5, UL49, UL50, UL51, UL52, UL53, UL54, UL55, UL56, UL57, UL60, UL61 , UL70, UL71, UL73, UL75, UL76, UL77, UL79, UL80, UL82, UL84, UL85, UL86, UL87, UL89, UL90, UL91, UL92, UL93, UL94, UL95, UL96, UL98, UL99, UL100,
UL102, UL104, UL105, UL115 and UL122. In some embodiments, the CMV essential or augmenting gene is UL82, UL94, UL32, UL99, UL115 or UL44, or a homolog thereof (i.e., the homologous gene in RhCMV). Other essential or augmenting genes are known in the art and are described herein. In particular examples, the essential gene is UL82, or a homolog thereof. In some embodiments, the recombinant RhCMV and HCMV vectors do not include a heterologous antigen. In other embodiments, the recombinant RhCMV or HCMV vector having a deletion in an essential or augmenting gene includes a nucleic acid sequence encoding a heterologous antigen, such as a pathogen-specific antigen or a tumor antigen. Compositions comprising recombinant RhCMV or HCMV vectors and a pharmaceutically acceptable carrier also are provided. Such vectors and compositions can be used, for example, in a method of treating a subject with an infectious disease, or at risk of becoming infected with an infectious disease. CMV vectors having a deletion of at least one important gene are generally attenuated and thus can be used as vaccines for the treatment or prevention of CMV (in which case, the recombinant vector does not encode a heterologous antigen).
In some embodiments, the recombinant RhCMV or HCMV vectors comprise a suicide or safety means to prevent further replication of the virus. For example, the recombinant CMV vectors can include LoxP sites flanking an essential gene or region of the RhCMV or HCMV genome (essential CMV genes are listed above and are known in the art), as well as the coding sequence for Cre-recombinase. Cre-recombinase is generally under the control of an inducible promoter to regulate expression of Cre, thereby controlling removal of the essential gene and inhibition of viral replication. In particular examples, Cre is a Tet-regulated Cre and expression of Cre is controlled by the presence of Dox.
The present disclosure also relates to a method of a CMV vector capable of repeatedly infecting an organism which may comprise (a) constructing a vector containing and over- expressing at least one cytomegalovirus (CMV) glycoprotein, wherein the glycoprotein is US2, US 3, US 6 or USl 1, and (b) administering the vector repeatedly into the animal or human. Where superinfectivity is desired, any CMV vector, may express one or more of the HCMV
glycoproteins US2, US3, US 6 and USll (or the RhCMV homologues Rhl82, Rhl84, Rhl85, Rhl89).
In some embodiments, the recombinant RhCMV or HCMV vaccine vector further comprises a second nucleic acid sequence encoding US2, US3, or US6, or a homolog thereof, wherein the vector does not encode a functional USl l. In some embodiments, the second nucleic acid sequence encodes US2, US3, and US6. In some embodiments, the nucleic acid encoding a US 11 open reading frame is deleted. In some embodiments, the recombinant RhCMV or HCMV
vaccine vector further comprises a third nucleic acid sequence encoding US11, and wherein the nucleic acid sequence encoding US 11 comprises a point mutation, a frameshift mutation, and/or a deletion of one or more nucleotides of the nucleic acid sequence encoding US 11.
In some embodiments, the glycoproteins within the US2 to US 11 region of RhCMV or HCMV are deleted from the vector. In some embodiments, the recombinant RhCMV or HCMV vaccine vector lacks the transactivator pp71. In some embodiments, the recombinant RhCMV or HCMV vaccine vector lacks the tegument protein pp65.
In some embodiments, the recombinant RhCMV or HCMV vaccine vector further comprises a nucleic acid sequence that encodes UL128 or an ortholog thereof, and another nucleic acid sequence that encodes UL131 or an ortholog thereof, wherein the vector does not express an active UL130 protein.
In some embodiments, the recombinant RhCMV or HCMV vaccine vector further comprises a nucleic acid sequence that encodes UL130 or an ortholog thereof, and another nucleic acid sequence that encodes UL131 or an ortholog thereof, wherein the vector does not express an active UL128 protein.
In some embodiments, the recombinant RhCMV or HCMV vaccine vector comprises a mutation in UL128 or UL130 selected from a point mutation, a frameshift mutation, and a deletion of all or less than all of UL128 or UL130.
In some embodiments, the recombinant RhCMV or HCMV vaccine vector further comprises an antisense sequence or an RNAi sequence that inhibits the expression of UL128 or UL130 or both.
In some embodiments, the recombinant RhCMV or HCMV vaccine vector comprises a deletion or modification of US2, US3, US4, US5, US6, US11, or UL97, or a homolog thereof.
In some embodiments, the recombinant RhCMV or HCMV vaccine vector comprises a deletion of Rhl58-166 or a homolog thereof.
In some embodiments where repeated infection of a CMV vector is desired, the CMV vector may express one or more of the glycoproteins US2, US3, US6 and US 11. In a particularly advantageous embodiment, the vector expresses glycoproteins US2, US3, US6 and US 11. More advantageously, the vector contains and expresses all of the glycoproteins within the US2 to US 11 region of CMV. In an advantageous embodiment, the one or more of the glycoproteins US2, US3, US6 and US 11 may include, but not limited to, the glycoproteins of U.S. Pat. Nos. 7,892,564; 7,749,745; 7,364,893; 6,953,661 ; 6,913,751; 6,740,324; 6,613,892; 6,410,033; 6,140,114; 6,103,531 ; 6,033,671; 5,908,780; 5,906,935; 5,874,279; 5,853,733; 5,846,806;
5,843,458; 5,837,532; 5,804,372; 5,753,476; 5,741,696; 5,731,188; 5,720,957; 5,676,952;
5,599,544; 5,593,873 and 5,334,498.
Disclosed herein are human or animal CMV vectors comprising a nucleic acid sequence that encodes a heterologous protein antigen and a nucleic acid sequence that encodes an active UL131 protein. In one example, the CMV vector comprises a nucleic acid sequence that expresses an active UL128 protein but does not express an active UL130 protein. In another example, the CMV vector encodes an active UL130 protein but does not express an active UL128 protein.
In some examples, the CMV vector does not express an active UL128 or UL130 protein due to the presence of a deleterious mutation in the nucleic acid sequence encoding UL128 or UL130 or their orthologous genes in animal CMVs. The mutation may be any deleterious mutation that results in a lack of expression of active UL128 or UL130 protein. Such mutations can include point mutations, frameshift mutations, deletions of less than all of the sequence that encodes the protein (truncation mutations), or deletions of all of the nucleic acid sequence that encodes the protein, or any other mutations.
In further examples, the CMV vector does not express an active UL128 or UL130 protein due to the presence of a nucleic acid sequence in the vector that comprises an antisense or RNAi sequence (siRNA or miRNA) that inhibits the expression of the UL128 or UL130 protein.
Also disclosed herein are methods of generating CD8+ T cell responses to heterologous antigens in a subject. The methods involve administering an effective amount of a CMV vector to the subject. The CMV vector is characterized by having a nucleic acid sequence that encodes a heterologous antigen and a nucleic acid sequence that encodes an active UL131 protein. The CMV vector is further characterized by not encoding an active UL128 protein or an active UL130 protein or neither an active UL128 or active UL130 protein. The CD8+ T cell response is further characterized by having at least 10% of the CD8+ T cells directed against epitopes presented by MHC class II. In further examples, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, or more than 60% of the CD8+ T cells are directed against epitopes presented by MHC class II.
In further examples, the methods involve administering an effective amount of a second
CMV vector, the second CMV vector comprising a nucleic acid sequence that encodes a heterologous antigen to the subject. This second vector can be any CMV vector, including a CMV vector with an active UL128 and an active UL130 protein. The second CMV vector may comprise additional deletions known in the art to provide different immune responses such as a
US 11 deletion or any other deletion. The second heterologous antigen can be any heterologous antigen, including a heterologous antigen identical to the heterologous antigen in the first CMV vector. The second CMV vector can be administered at any time relative to the administration of the first CMV vector including before, concurrently with, or after the administration of the first CMV vector. This includes administration of the second vector any number of months, days, hours, minutes or seconds before or after the first vector. In preferred embodiments of the present invention viral vectors are used. Advantageously, the vector is a CMV vector, lacking at least the glycoprotein UL128 or a CMV vector lacking at least the glycoprotein UL130. Each CMV vector also expresses the glycoprotein UL131.
Suitable dosages of the CMV vectors in the immunogenic compositions can be readily determined by those of skill in the art. For example, the dosage of the CMV vectors can vary depending on the route of administration and the size of the subject. Suitable doses can be determined by those of skill in the art, for example by measuring the immune response of a subject, such as a laboratory animal, using conventional immunological techniques, and adjusting the dosages as appropriate. Such techniques for measuring the immune response of the subject include but are not limited to, chromium release assays, tetramer binding assays, IFN- . gamma. ELISPOT assays, IL-2 ELISPOT assays, intracellular cytokine assays, and other immunological detection assays, e.g., as detailed in the text "Antibodies: A Laboratory Manual" by Ed Harlow and David Lane.
In some embodiments, the recombinant RhCMV vaccine vector is Rh68-1 or Rh68-1.2.
During in vitro culture on fibroblasts, the Rh68-1 CMV vector lost the ability to express gene products from the Rhl3, Rh60, Rhl57.5, and Rhl57.6 open reading frames. The HCMV orthologs of these genes are RL11, UL36, UL128, and UL130, respectively. The Rh68-1.2 vector had expression of Rh60, Rhl57.5, and Rhl57.6 restored through recombinant DNA techniques (Lilja and Shenk, Proc. Natl. Acad. Sci. USA, 2008, 105, 19950-19955). The Rh68-1 CMV vector, but not the Rh68-1.2 CMV vector, primes surprisingly high number of CD8+ T cells restricted by MHC-E.
In some embodiments, the CMV vectors can comprise regulatory elements for gene expression of the coding sequences of the nucleic acid. The regulatory elements can be a promoter, an enhancer an initiation codon, a stop codon, a polyadenylation signal, additional restriction enzyme sites, multiple cloning sites, or other coding segments, and the like. In some embodiments, the CMV vector can comprise heterologous nucleic acid encoding an Mtb antigen and can further comprise an initiation codon, which is upstream of the antigen coding sequence,
and a stop codon, which is downstream of the antigen coding sequence. The initiation and termination codon are in frame with the antigen coding sequence.
In some embodiments, expression of the Mtb antigen is driven by an antigen-coding sequence in operable association with a promoter selected from the group consisting of a constitutive CMV promoter, an immediate early CMV promoter, an early CMV promoter, and a late CMV promoter. In some embodiments, the promoter is selected from the group consisting of
EF1 -alpha, UL82, MIE, pp65, and gH.
The CMV vector can also comprise a polyadenylation signal, which can be downstream of the antigen coding sequence. The polyadenylation signal can be a SV40 polyadenylation signal, LTR polyadenylation signal, CMV polyadeylation signal, bovine growth hormone (bGH) polyadenylation signal, human growth hormone (hGH) polyadenylation signal, or human β- globin polyadenylation signal. The SV40 polyadenylation signal can be a polyadenylation signal from a pCEP4 vector (Invitrogen, San Diego, CA).
The CMV vector can also comprise an enhancer. In some embodiments, the enhancer can be necessary for DNA expression. The enhancer can be human actin, human myosin, human hemoglobin, human muscle creatine or a viral enhancer such as one from CMV, RSV or EBV.
Polynucleotide function enhances are described in U.S. Patent Nos. 5,593,972, 5,962,428, and
WO94/016737, the contents of each are incorporated herein by reference.
The CMV vector can also comprise a mammalian origin of replication to maintain the vector extrachromosomally and produce multiple copies of the vector in a cell. The CMV vector can comprise the Epstein Barr virus origin of replication and nuclear antigen EBNA-1 coding region, which can produce high copy episomal replication without integration. The CMV vector can contain certain elements of the pVAXl or a pVaxl variant. The variant pVaxl plasmid is a
2998 basepair variant of the backbone vector plasmid pVAXl (Invitrogen, Carlsbad CA). The CMV promoter is located at bases 137-724. The T7 promoter/priming site is at bases 664-683.
Multiple cloning sites are at bases 696-811. Bovine GH polyadenylation signal is at bases 829-
1053. The Kanamycin resistance gene is at bases 1226-2020. The pUC origin is at bases 2320-
2993.
The CMV vector can also comprise a regulatory sequence, which can be well suited for gene expression in a mammalian or human cell into which the vector is administered. The consensus coding sequence can comprise a codon, which can allow more efficient transcription of the coding sequence in the host cell.
The present disclosure also provides host cells comprising any of the nucleic acid molecules or CMV vectors disclosed herein. The host cells can be used, for example, to express
the Mtb antigens, or fragments of thereof. The Mtb antigens, or fragments thereof, can also be expressed in cells in vivo. The host cell that is transformed (for example, transfected) to produce the Mtb antigens, or fragments of thereof can be an immortalised mammalian cell line, such as those of lymphoid origin (for example, a myeloma, hybridoma, trioma or quadroma cell line). The host cell can also include normal lymphoid cells, such as B-cells, that have been
immortalized by transformation with a virus (for example, the Epstein-Barr virus).
In some embodiments, the host cells include, but are not limited to: bacterial cells, such as E. coli, Caulobacter crescentus, Streptomyces species, and Salmonella typhimurium; yeast cells, such as Saccharomyces cerevisiae, Schizosaccharomyces pombe, Pichia pastoris, Pichia methanolica; insect cell lines, such as those from Spodoptera frugiperda (for example, Sf9 and Sf21 cell lines, and expresSF™ cells (Protein Sciences Corp., Meriden, CT, USA)), Drosophila S2 cells, and Trichoplusia in High Five® Cells (Invitrogen, Carlsbad, CA, USA); and mammalian cells, such as COS1 and COS7 cells, Chinese hamster ovary (CHO) cells, NSO myeloma cells, NIH 3T3 cells, 293 cells, Procell92S, perC6, HEPG2 cells, HeLa cells, L cells, HeLa, MDCK, HEK293, WI38, murine ES cell lines (for example, from strains 129/SV, C57/BL6, DBA-1 , 129/SVJ), K562, Jurkat cells, and BW5147. Other useful mammalian cell lines are well known and readily available from the American Type Culture Collection
("ATCC") (Manassas, VA, USA) and the National Institute of General Medical Sciences (NIGMS) Human Genetic Cell Repository at the Coriell Cell Repositories (Camden, NJ, USA). In some embodiments, the cell is a recombinant BCG. These cell types are only representative and are not meant to be an exhaustive list.
Among other considerations, some of which are described above, a host cell strain may be chosen for its ability to process the expressed Mtb antigens, or fragment thereof, in the desired fashion. Post-translational modifications of the polypeptide include, but are not limited to, glycosylation, acetylation, carboxylation, phosphorylation, lipidation, and acylation, and it is an aspect of the present disclosure to provide Mtb antigens thereof with one or more of these post-translational modifications.
In some embodiments, the recombinant BCG has been genetically engineered to express a functional endosomalytic protein that is bioactive at pH values near neutrality (e.g. about pH 6- 8 or about 6.5 to 7.5). The endosomalytic protein is active within Mycobacteria-containing endosomes, which typically have an internal pH near neutrality. The activity of the
endosomalytic protein produced by the rBCG results in disruption of the endosome, permitting the rBCG to escape from the endosome and into the cytoplasm of the cell.
In some embodiments, the endosomalytic protein that is introduced into the rBCG by genetic
engineering is Perfringolysin O (PfoA) from Clostridium perfringens or a mutant thereof, such as PfoAci37Q, as described in WO 2007/058663, which is incorporated herein by reference in its entirety.
In some embodiments, the Mycobacteria are attenuated, as exemplified by
BCG. However, those of skill in the art will recognize that other attenuated and nonattenuated Mycobacteria exist which would also be suitable for use herein. Examples of additional types of Mycobacteria include, but are not limited to, M. tuberculosis strain CDC1551 , M. tuberculosis strain Beijing, M. tuberculosis strain H37Ra (ATCC#:25177), M. tuberculosis strain H37Rv (ATCC#:25618), M. bo vis (ATCC#:19211 and 27291), M. fortuitum (ATCC#:15073), M.
smegmatis (ATCC#:12051 and 12549), M. intracellular (ATCC#:35772 and 13209), M.
kansasii (ATCC#:21982 and 35775) M. avium (ATCC#:19421 and 25291), M. gallinarum (ATCC#:19711), M. vaccae (ATCC#: 15483 and 23024), M. leprae (ATCC#:), M. marinarum (ATCC#:11566 and 11567), and microtti
(ATCC#:11152).
Examples of attenuated Mycobacterium strains include, but are not restricted
To, M. tuberculosis pantothenate auxotroph strain, M. tuberculosis rpoV mutant strain, M.
tuberculosis leucine auxotroph strain, BCG Danish strain (ATCC # 35733), BCG Japanese strain (ATCC # 35737), BCG Chicago strain (ATCC # 27289), BCG Copenhagen strain (ATCC #: 27290), BCG Pasteur strain (ATCC #: 35734), BCG Glaxo strain (ATCC #: 35741), BCG Connaught strain (ATCC # 35745), BCG Montreal (ATCC # 35746), BCG1331 strain, BCG Tokyo strain, BCG Moreau strain, BCG-Pasteur Aeras, and BCG Moscow strain.
The present disclosure also provides pharmaceutical compositions comprising any one or more of the recombinant RhCMV or HCMV vaccine vectors described herein and a pharmaceutically acceptable carrier.
In some embodiments, the Mtb antigen, or fragment thereof, is labeled with a detectable marker. Detectable markers include, but are not limited to, radioactive isotopes (such as P32 and S35), enzymes (such as horseradish peroxidase, chloramphenicol acetyltransferase (CAT), β- galactosidase (β-gal), and the like), fluorochromes, chromophores, colloidal gold, dyes, and biotin. The labeled Mtb antigens, or fragments thereof, can be used to carry out diagnostic procedures in a variety of cell or tissue types. For imaging procedures, in vitro or in vivo, the Mtb antigens can be labeled with additional agents, such as NMR contrasting agents, X-ray contrasting agents, or quantum dots. Methods for attaching a detectable agent to polypeptides are known in the art. The Mtb antigens can also be attached to an insoluble support (such as a bead, a glass or plastic slide, or the like).
In some embodiments, the Mtb antigens, or fragment thereof, can be conjugated to a therapeutic agent including, but not limited to, radioisotopes (such as i nIn or 90Y), toxins (such as tetanus toxoid or ricin), toxoids, and chemotherapeutic agents.
In some embodiments, the Mtb antigens, or fragments thereof, can be conjugated to an imaging agent. Imaging agents include, for example, a labeling moiety (such as biotin, fluorescent moieties, radioactive moieties, histidine tag or other peptide tags) for easy isolation or detection.
The present disclosure also provides compositions comprising any one or more of the fusion proteins, Mtb antigens, nucleic acid molecules encoding Mtb antigens, including fusion proteins thereof, cells, and/or CMV vectors and a pharmaceutically acceptable carrier useful in, for example, vaccines.
In some embodiments, liquid formulations of a pharmaceutical composition for oral administration prepared in water or other aqueous vehicles can contain various suspending agents such as methylcellulose, alginates, tragacanth, pectin, kelgin, carrageenan, acacia, polyvinylpyrrolidone, and polyvinyl alcohol. Liquid formulations of pharmaceutical compositions can also include solutions, emulsions, syrups and elixirs containing, together with the active compound(s), wetting agents, sweeteners, and coloring and flavoring agents. Various liquid and powder formulations of the pharmaceutical compositions can be prepared by conventional methods for inhalation into the lungs of the mammal to be treated.
In some embodiments, liquid formulations of a pharmaceutical composition for injection can comprise various carriers such as vegetable oils, dimethylacetamide,
dimethylformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, polyols such as, for example, glycerol, propylene glycol, liquid polyethylene glycol, and the like. In some embodiments, the composition includes a citrate/sucrose/tween carrier. For intravenous injections, water soluble versions of the compositions can be administered by the drip method, whereby a pharmaceutical formulation containing the antifungal agent and a physiologically acceptable excipient is infused. Physiologically acceptable excipients can include, for example, 5% dextrose, 0.9% saline, Ringer's solution or other suitable excipients. A suitable insoluble form of the composition can be prepared and administered as a suspension in an aqueous base or a pharmaceutically acceptable oil base, such as an ester of a long chain fatty acid such as, for example, ethyl oleate.
The compositions can be, for example, injectable solutions, aqueous suspensions or solutions, non-aqueous suspensions or solutions, solid and liquid oral formulations, salves, gels, ointments, intradermal patches, creams, aerosols, lotions, tablets, capsules, sustained release
formulations, and the like. In some embodiments, for topical applications, the pharmaceutical compositions can be formulated in a suitable ointment. In some embodiments, a topical semisolid ointment formulation typically comprises a concentration of the active ingredient from about 1 to 20%, or from 5 to 10%, in a carrier, such as a pharmaceutical cream base. Some examples of formulations of a composition for topical use include, but are not limited to, drops, tinctures, lotions, creams, solutions, and ointments containing the active ingredient and various supports and vehicles.
Typically, compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared. The preparation also can be emulsified or encapsulated in liposomes or microp articles such as polylactide, polyglycolide, or copolymer for enhanced adjuvant effect (see Langer, Science, 1990, 249, 1527 and Hanes, Advanced Drug Delivery Reviews, 1997, 28, 97). A sterile injectable preparation such as, for example, a sterile injectable aqueous or oleaginous suspension can also be prepared. This suspension may be formulated according to techniques known in the art using suitable dispersing, wetting, and suspending agents. In some embodiments, the pharmaceutical composition can be delivered in a
microencapsulation device so as to reduce or prevent a host immune response against the protein.
A suitable dose is an amount of a compound that, when administered as described above, is capable of promoting an anti-TB immune response, and is preferably at least 10-50% above the basal (i.e., untreated) level. Such response can be monitored, for example, by measuring the anti-T cell responses in a patient. Such vaccines should also be capable of causing an immune response that leads to an improved clinical outcome (e.g., more frequent remissions, complete or partial or longer disease-free survival) in vaccinated patients as compared to non- vaccinated patients. In general, for pharmaceutical compositions and vaccines comprising one or more polypeptides, the amount of each polypeptide sought in a dose ranges from about 25 meg to 5 mg per kg of host. Suitable dose sizes will vary with the size of the patient, but will typically range from about 0.1 mL to about 5 mL.
In general, an appropriate dosage and treatment regimen provides the active
compound(s) in an amount sufficient to provide therapeutic and/or prophylactic benefit. Such a response can be monitored by establishing an improved clinical outcome (e.g. more frequent remissions, complete or partial, or longer disease-free survival) in treated patients as compared to non-treated patients. Increases in preexisting immune responses to a TB protein may correlate with an improved clinical outcome. Such immune responses may generally be evaluated using
standard proliferation, cytotoxicity or cytokine assays, which may be performed using samples obtained from a patient before and after treatment.
In some embodiments, the compositions comprise about 1 nanogram to about 10 mg of nucleic acid. In some embodiments, the compositions comprise: 1) at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 nanograms, or at least 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95,100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 305, 310, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, 400, 405, 410, 415, 420, 425, 430, 435, 440, 445, 450, 455, 460, 465, 470, 475, 480, 485, 490, 495, 500, 605, 610, 615, 620, 625, 630, 635, 640, 645, 650, 655, 660, 665, 670, 675, 680, 685, 690, 695, 700, 705, 710, 715, 720, 725, 730, 735, 740, 745, 750, 755, 760, 765, 770, 775, 780, 785, 790, 795, 800, 805, 810, 815, 820, 825, 830, 835, 840, 845, 850, 855, 860, 865, 870, 875, 880, 885, 890, 895. 900, 905, 910, 915, 920, 925, 930, 935, 940, 945, 950, 955, 960, 965, 970, 975, 980, 985, 990, 995 or 1000 micrograms, or at least 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5 or 10 mg or more; and 2) up to and including 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 nanograms, or up to and including 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95,100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 305, 310, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, 400, 405, 410, 415, 420, 425, 430, 435, 440, 445, 450, 455, 460, 465, 470, 475, 480, 485, 490, 495, 500, 605, 610, 615, 620, 625, 630, 635, 640, 645, 650, 655, 660, 665, 670, 675, 680, 685, 690, 695, 700, 705, 710, 715, 720, 725, 730, 735, 740, 745, 750, 755, 760, 765, 770, 775, 780, 785, 790, 795, 800, 805, 810, 815, 820, 825, 830, 835, 840, 845, 850, 855, 860, 865, 870, 875, 880, 885, 890, 895. 900, 905, 910, 915, 920, 925, 930, 935, 940, 945, 950, 955, 960, 965, 970, 975, 980, 985, 990, 995, or 1000 micrograms, or up to and including 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5 or 10 mg.
In some embodiments, the compositions comprise about 5 nanograms to about 10 mg of nucleic acid molecule. In some embodiments, the compositions comprise about 25 nanograms to about 5 mg of nucleic acid molecule. In some embodiments, the compositions contain about 50 nanograms to about 1 mg of nucleic acid molecule. In some embodiments, the compositions contain about 0.1 to about 500 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 1 to about 350 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 5 to about 250 micrograms of nucleic acid
molecule. In some embodiments, the compositions contain about 10 to about 200 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 15 to about 150 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 20 to about 100 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 25 to about 75 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 30 to about 50 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 35 to about 40 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 100 to about 200 micrograms of nucleic acid molecule. In some embodiments, the compositions comprise about 10 to about 100 micrograms of nucleic acid molecule. In some embodiments, the compositions comprise about 20 to about 80 micrograms of nucleic acid molecule. In some embodiments, the compositions comprise about 25 to about 60 micrograms of nucleic acid molecule. In some embodiments, the compositions comprise about 30 nanograms to about 50 micrograms of nucleic acid molecule. In some embodiments, the compositions comprise about 35 nanograms to about 45 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 0.1 to about 500 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 1 to about 350 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 25 to about 250 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 100 to about 200 micrograms of nucleic acid molecule.
The compositions can be formulated according to the mode of administration to be used. In cases where compositions are injectable pharmaceutical compositions, they are sterile, pyrogen free and particulate free. An isotonic formulation can be used. Generally, additives for isotonicity can include sodium chloride, dextrose, mannitol, sorbitol and lactose. In some cases, isotonic solutions such as phosphate buffered saline are suitable. Stabilizers include gelatin and albumin. In some embodiments, a vasoconstriction agent is added to the formulation.
The compositions can further comprise a pharmaceutically acceptable excipient. The pharmaceutically acceptable excipient can be functional molecules as vehicles, adjuvants, carriers, or diluents. The pharmaceutically acceptable excipient can be a transfection facilitating agent, which can include surface active agents, such as immune-stimulating complexes
(ISCOMS), Freund's incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs, vesicles such as squalene and squalane, hyaluronic acid, lipids, liposomes, calcium ions, viral proteins, polyanions, polycations, or nanop articles, or other known transfection facilitating agents.
The transfection facilitating agent is a polyanion, polycation, including poly-L-glutamate (LGS), or lipid. The transfection facilitating agent is poly-L-glutamate, and more suitably, the poly-L- glutamate is present in the composition at a concentration less than 6 mg/ml. The transfection facilitating agent can also include surface active agents such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs and vesicles such as squalene and squalane, and hyaluronic acid can also be used administered in conjunction with the genetic construct. In some
embodiments, the plasmid compositions can also include a transfection facilitating agent such as lipids, liposomes, including lecithin liposomes or other liposomes known in the art, as a DNA- liposome mixture (see for example W09324640), calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents. In some embodiments, the transfection facilitating agent is a polyanion, polycation, including poly-L- glutamate (LGS), or lipid. Concentration of the transfection agent in the composition is less than 4 mg/ml, less than 2 mg/ml, less than 1 mg/ml, less than 0.750 mg/ml, less than 0.500 mg/ml, less than 0.250 mg/ml, less than 0.100 mg/ml, less than 0.050 mg/ml, or less than 0.010 mg/ml.
The pharmaceutically acceptable excipient may be an adjuvant. The adjuvant may be other genes that are expressed in alternative plasmid or are delivered as proteins in combination with the plasmid above. The adjuvant may be selected from the group consisting of: a- interferon(IFN-a), β-interferon (IFN-β), γ-interferon, platelet derived growth factor (PDGF), TNFa, TNF , GM-CSF, epidermal growth factor (EGF), cutaneous T cell- attracting chemokine (CTACK), epithelial thymus-expressed chemokine (TECK), mucosae-associated epithelial chemokine (MEC), IL-12, IL-15, MHC, CD80,CD86 including IL-15 having the signal sequence deleted and optionally including the signal peptide from IgE. The adjuvant may be IL-12, IL-15, IL-28, CTACK, TECK, platelet derived growth factor (PDGF), TNFa, ΤΝΡβ, GM-CSF, epidermal growth factor (EGF), IL-1, IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, IL-18, or a combination thereof.
Other genes which may be useful adjuvants include those encoding: MCP-1, MIP-la, MIP-lp, IL-8, L-selectin, P-selectin, E-selectin, CD34, GlyCAM-1, MadCAM-1, LFA-1, VLA- 1, Mac-1, pl50.95, PECAM, ICAM-1, ICAM-2, ICAM-3, CD2, LFA-3, M-CSF, G-CSF, IL-4, mutant forms of IL-18, CD40, CD40L, vascular growth factor, fibroblast growth factor, IL-7, nerve growth factor, vascular endothelial growth factor, Fas, TNF receptor, Fit, Apo-1, p55, WSL-1, DR3, TRAMP, Apo-3, AIR, LARD, NGRF, DR4, DR5, KILLER, TRAIL-R2, TRICK2, DR6, Caspase ICE, Fos, c-jun, Sp-1, Ap-1, Ap-2, p38, p65Rel, MyD88, IRAK, TRAF6, IkB, Inactive NIK, SAP K, SAP-1, JNK, interferon response genes, NFkB, Bax, TRAIL, TRAILrec,
TRAILrecDRC5, TRAIL- R3, TRAIL-R4, RANK, RANK LIGAND, Ox40, Ox40 LIGAND, NKG2D, MICA, MICB, NKG2A, NKG2B, NKG2C, NKG2E, NKG2F, TAP1, TAP2 and functional fragments thereof.
The plasmid compositions can further comprise a genetic vaccine facilitator agent as described in U.S. Serial No. 021,579 filed April 1, 1994, which is fully incorporated by reference.
The present disclosure also provides kits comprising any of the Mtb antigens, fragments thereof, fusion proteins, nucleic acid molecules, CMV vectors, or cells, described herein. The kit can include, for example, container(s), package(s) or dispenser(s) along with labels and instructions for administration or use.
Vaccine CMV vectors and pharmaceutical compositions may be presented in unit-dose or multi-dose containers, such as sealed ampoules or vials. Such containers can be hermetically sealed to preserve sterility of the formulation until use. In general, formulations may be stored as suspensions, solutions or emulsions in oily or aqueous vehicles. Alternatively, a vaccine or pharmaceutical composition may be stored in a freeze-dried condition requiring only the addition of a sterile liquid carrier immediately prior to use.
The present disclosure also provides methods for treatment or prevention of tuberculosis comprising administering to a subject in need thereof at least one recombinant RhCMV or HCMV vaccine vector as described herein. In some embodiments, the methods further comprise re- administering to the subject at least one recombinant RhCMV or HCMV vaccine vector described herein. In some embodiments, the recombinant RhCMV or HCMV vaccine vector of the re-administration is different than the recombinant RhCMV or HCMV vaccine vector of the initial administration.
The present disclosure also provides methods for eliciting an immune response to a Mtb antigen comprising administering to a subject in need thereof at least one recombinant RhCMV or HCMV vaccine vector as described herein.
The present disclosure also provides methods for eliciting a CD8+ or CD4+ T cell response to a Mtb antigen comprising administering to a subject in need thereof at least one recombinant RhCMV or HCMV vaccine vector as described herein.
In some embodiments, the recombinant RhCMV or HCMV vaccine vector is administered to the subject intravenously, intramuscularly, intraperitoneally, intranasally, or orally. In some embodiments, the subject is a human.
In some embodiments, any of the Mtb antigens, constructs, vectors, or cells described herein, or compositions comprising the same, can be administered to a mammal as an aerosol. In
some embodiments, the aerosol inocula comprises saline. Conventional aerosol delivery devices include, but are not limited to, a pressurized metered dose inhaler (pMDI) and a dry power inhaler (DPI), both of which deliver a dry powder formulation, and nebulizers such as the PARI eFlow device, which delivers an aqueous dose as a fine mist. In some embodiments, the aerosol delivery device is a Pari eFlow portable electronic aerosol delivery platform attached to a delivery mask. In some embodiments, the average particle size is from about 1 μιη to about 10 μιη, from about 1 μιη to about 5 μιη, from about 3 μιη to about 5 μιη, from about 4 μιη to about 5 μιη, or from about 3.9 μιη to about 4.9 μιη. In some embodiments, the aerosol is in a volume from about 0.1 ml to about 5 ml, from about 0.1 ml to about 2 ml, from about 0.1 ml to about 1.5 ml, from about 0.5 ml to about 1.5 ml, from about 0.5 ml to about 1.2 ml, from about 0.7 ml to about 1.2 ml, or about 1 ml.
Effective doses of the compositions of the present disclosure, for the treatment of a condition vary depending upon many different factors, including means of administration, target site, physiological state of the subject, whether the subject is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. Usually, the subject is a human but non-human mammals including transgenic mammals can also be treated.
In some embodiments, the compositions can be administered to a subject by injection intravenously, subcutaneously, intraperitoneally, intramuscularly, intramedullarily,
intraventricularly, intraepidurally, intraarterially, intravascularly, intraarticularly, intrasynovially, intrasternally, intrathecally, intrahepatically, intraspinally, intratumorly, intracranially, enteral, intrapulmonary, transmucosal, intrauterine, sublingual, or locally at sites of inflammation or tumor growth by using standard methods. Alternately, the compositions can be administered to a subject by routes including oral, nasal, ophthalmic, rectal, or topical. The most typical route of administration is intravascular, subcutaneous, or intramuscular, although other routes can be effective. In some embodiments, compositions are administered as a sustained release composition or device, such as a Medipad™ device. The composition can also be administered via the respiratory tract, for example, using a dry powder inhalation device, nebulizer, or a metered dose inhaler. The composition can also be administered by traditional syringes, needleless injection devices, "microprojectile bombardment gone guns," or other physical methods such as electroporation ("EP"), "hydrodynamic method", or ultrasound.
In some embodiments, the pharmaceutical compositions may be delivered by intranasal sprays, inhalation, and/or other aerosol delivery vehicles. Methods for delivering genes, nucleic acids, and peptide compositions directly to the lungs via nasal aerosol sprays has been described e.g., in U.S. Pat. No. 5,756,353 and U.S. Pat. No. 5,804,212 (each specifically incorporated
herein by reference in its entirety). Likewise, the delivery of drugs using intranasal microparticle resins (Takenaga et al., 1998) and lysophosphatidyl-glycerol compounds (U.S. Pat. No.
5,725,871, specifically incorporated herein by reference in its entirety) are also well-known in the pharmaceutical arts. Likewise, transmucosal drug delivery in the form of a
polytetrafluoroethylene support matrix is described in U.S. Pat. No. 5,780,045 (specifically incorporated herein by reference in its entirety).
In some embodiments, the composition can be administered to a subject by sustained release administration, by such means as depot injections of erodible implants directly applied during surgery or by implantation of an infusion pump or a biocompatible sustained release implant into the subject. Alternately, the composition can be administered to a subject by injectable depot routes of administration, such as by using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods, or by applying to the skin of the subject a transdermal patch containing the composition, and leaving the patch in contact with the subject's skin, generally for 1 to 5 hours per patch.
The present disclosure also provides methods of eliciting an immune response against
Mycobacterium tuberculosis in a mammal comprising administering to the mammal an immunologically sufficient amount of one or more CMV vectors comprising one or more of the Mtb fusion proteins described herein.
The fusion proteins and compositions described herein can be used to treat or prevent tuberculosis. In some embodiments, the method comprises administering to a human a therapeutically- or prophylactically-effective amount of any of the CMV vectors or compositions described herein such that the tuberculosis infection is diminished or prevented. In some embodiments, the subject being treated will have been previously diagnosed as having tuberculosis. Such subjects will, thus, have been diagnosed as being in need of such treatment. Alternately, the treatment may be intended to prevent a tuberculosis infection in a subject that does not yet have tuberculosis or to a subject that is travelling to an area where tuberculosis is prevalent.
Treatment of a subject suffering from tuberculosis can be monitored using standard methods. Some methods entail determining a baseline value, for example, of an antibody level or profile in a subject, before administering a dosage of agent, and comparing this with a value for the profile or level after treatment. A significant increase such as, for example, greater than the typical margin of experimental error in repeat measurements of the same sample, expressed as one standard deviation from the mean of such measurements in value of the level or profile signals a positive treatment outcome (i.e., that administration of the agent has achieved a desired
response). If the value for immune response does not change significantly, or decreases, a negative treatment outcome is indicated.
In other embodiments, a control value such as a mean and standard deviation, of level or profile is determined for a control population. Typically the individuals in the control population have not received prior treatment. Measured values of the level or profile in a subject after administering a therapeutic agent are then compared with the control value. A significant increase relative to the control value, such as greater than one standard deviation from the mean, signals a positive or sufficient treatment outcome. A lack of significant increase or a decrease signals a negative or insufficient treatment outcome. Administration of the therapeutic is generally continued while the level is increasing relative to the control value. As before, attainment of a plateau relative to control values is an indicator that the administration of treatment can be discontinued or reduced in dosage and/or frequency.
In other embodiments, a control value of the level or profile, such as a mean and standard deviation, is determined from a control population of individuals who have undergone treatment with a therapeutic agent and whose levels or profiles have plateaued in response to treatment. Measured values of levels or profiles in a subject are compared with the control value. If the measured level in a subject is not significantly different, such as by more than one standard deviation, from the control value, treatment can be discontinued. If the level in a subject is significantly below the control value, continued administration of agent is warranted. If the level in the subject persists below the control value, then a change in treatment may be indicated.
In other embodiments, a subject who is not presently receiving treatment but has undergone a previous course of treatment is monitored for antibody levels or profiles to determine whether a resumption of treatment is required. The measured level or profile in the subject can be compared with a value previously achieved in the subject after a previous course of treatment. A significant decrease relative to the previous measurement, such as greater than a typical margin of error in repeat measurements of the same sample, is an indication that treatment can be resumed. Alternately, the value measured in a subject can be compared with a control value (mean plus standard deviation) determined in a population of subjects after undergoing a course of treatment. Alternately, the measured value in a subject can be compared with a control value in populations of prophylactically treated subjects who remain free of symptoms of disease, or populations of therapeutically treated subjects who show amelioration of disease characteristics. In all of these cases, a significant decrease relative to the control level, such as more than a standard deviation, is an indicator that treatment should be resumed in a subject.
In some methods, a baseline measurement of antibody to a given antigen in the subject is made before administration, a second measurement is made soon thereafter to determine the peak antibody level, and one or more further measurements are made at intervals to monitor decay of antibody levels. When the level of antibody has declined to baseline or a predetermined percentage of the peak less baseline, such as 50%, 25% or 10%, administration of a further dosage of antigen is administered. In some embodiments, peak or subsequent measured levels less background are compared with reference levels previously determined to constitute a beneficial prophylactic or therapeutic treatment regime in other subjects. If the measured antibody level is significantly less than a reference level, such as less than the mean minus one standard deviation of the reference value in population of subjects benefiting from treatment, administration of an additional dosage of antigen is indicated.
Immunization schedules (or regimens) are well known for animals (including humans) and can be readily determined for the particular subject and immunogenic composition. Hence, the immunogens can be administered one or more times to the subject. Preferably, there is a set time interval between separate administrations of the immunogenic composition. While this interval varies for every subject, typically it ranges from 10 days to several weeks, and is often 2, 4, 6 or 8 weeks. For humans, the interval is typically from 2 to 6 weeks. In a particularly advantageous embodiment of the present invention, the interval is longer, advantageously about 10 weeks, 12 weeks, 14 weeks, 16 weeks, 18 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 28 weeks, 30 weeks, 32 weeks, 34 weeks, 36 weeks, 38 weeks, 40 weeks, 42 weeks, 44 weeks, 46 weeks, 48 weeks, 50 weeks, 52 weeks, 54 weeks, 56 weeks, 58 weeks, 60 weeks, 62 weeks, 64 weeks, 66 weeks, 68 weeks or 70 weeks.
In some embodiments, the subject(s) that can be treated by the above-described methods is an animal, such as a mammal, including, but are not limited to, humans, non-human primates, rodents (including rats, mice, hamsters and guinea pigs) cow, horse, sheep, goat, pig, dog and cat. In most instances, the mammal is a human.
The present disclosure also provides CMV/TB vectors as described herein for use in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection.
The present disclosure also provides CMV/TB vectors as described herein for use in treating or preventing a Mycobacterium tuberculosis infection.
The present disclosure also provides uses of CMV/TB vectors as described herein in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection.
The present disclosure also provides uses of CMV/TB vectors as described herein in treating or preventing a Mycobacterium tuberculosis infection.
The present disclosure also provides any of the CMV/TB vectors as described herein, or any of the compositions described herein, or any of the cells described herein, or any of the methods described herein, or any of the uses described herein, substantially as described with reference to the accompanying examples and/or figures.
The following representative embodiments are presented:
Embodiment 1. A recombinant RhCM V or HCMV vector comprising a nucleic acid sequence encoding an expressible Mtb antigen selected from Ag85A-Ag85B-Rv3407, Rvl733- Rv2626c, RpfA-RpfC-RpfD, Ag85B-ESAT6, and Ag85A-ESAT6-Rv3407-Rv2626c-RpfA- RpfD.
Embodiment 2. The recombinant RhCMV or HCMV vaccine vector of embodiment 1 , wherein expression of the Mtb antigen is driven by an antigen-coding sequence in operable association with a promoter selected from the group consisting of a constitutive CMV promoter, an immediate early CMV promoter, an early CMV promoter, and a late CMV promoter.
Embodiment 3. The recombinant RhCMV or HCMV vaccine vector of embodiment 2, wherein the promoter is selected from the group consisting of EFl-alpha, UL82, MIE, pp65, and gH.
Embodiment 4. The recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 3, comprising a deletion or modification of US2, US3, US4, US5, US6, USll, or UL97, or a homolog thereof.
Embodiment 5. The recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 4, comprising a deletion of Rhl58-166 or a homolog thereof.
Embodiment 6. The recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 5, wherein the RhCMV or HCMV vaccine vector is a tropism-restricted vector.
Embodiment 7. The recombinant RhCMV or HCMV vaccine vector of embodiment 6, wherein the tropism-restrictive vector lacks genes required for optimal growth in certain cell types or contains targets for tissue-specific micro-RNAs in genes essential for viral replication or wherein the tropism-restrictive vector has an epithelial, central nervous system (CNS), or macrophage deficient tropism, or a combination thereof.
Embodiment 8. The recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 7, wherein the RhCMV or HCMV vaccine vector has a deletion in a gene region non-essential for growth in vivo.
Embodiment 9. The recombinant RhCMV or HCMV vaccine vector of embodiment 8, wherein the gene region is selected from the group consisting of the RL11 family, the pp65 family, the US 12 family, and the US28 family.
Embodiment 10. The recombinant RhCMV vaccine vector of embodiment 9, wherein the RhCMV gene region is selected from the group consisting of Rhl 3-Rh29, Rhl 11-Rhl 12, Rhl91-Rh202, and Rh214-Rh220, or wherein the RhCMV gene region is selected from the group consisting of Rhl3.1, Rhl9, Rh20, Rh23, Rh24, Rhll2, Rhl90, Rhl92, Rhl96, Rhl98, Rhl99, Rh200, Rh201, Rh202, and Rh220.
Embodiment 11. The recombinant HCMV vaccine vector of embodiment 9, wherein the HCMV gene region is selected from the group consisting of RL11 , UL6, UL7, UL9, UL11, UL83 (pp65), US12, US13, US14, US17, US18, US19, US20, US21, and UL28.
Embodiment 12. The recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 11, wherein the vector comprises a deletion in a RhCMV or HCMV gene that is essential for replication within a host, dissemination within a host, or spreading from host to host.
Embodiment 13. The recombinant RhCMV or HCMV vaccine vector of embodiment 12, wherein the essential gene is UL94, UL32, UL99, UL115, or UL44, or a homolog thereof.
Embodiment 14. The recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 13, wherein the vector comprises a deletion in gene UL82/pp71 or a homolog thereof.
Embodiment 15. The recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 14, wherein the vector further comprises a second nucleic acid sequence encoding US2, US3, or US6, or a homolog thereof, wherein the vector does not encode a functional US 11.
Embodiment 16. The recombinant RhCMV or HCMV vaccine vector of embodiment
15, wherein the second nucleic acid sequence encodes US2, US3, and US6.
Embodiment 17. The recombinant RhCMV or HCMV vaccine vector of embodiment 15 or embodiment 16, wherein the nucleic acid encoding a US 11 open reading frame is deleted.
Embodiment 18. The recombinant RhCMV or HCMV vaccine vector of any one of embodiment s 15 to 17, further comprising a third nucleic acid sequence encoding US11, and wherein the nucleic acid sequence encoding US 11 comprises a point mutation, a frameshift mutation, and/or a deletion of one or more nucleotides of the nucleic acid sequence encoding US11.
Embodiment 19. The recombinant RhCMV or HCMV vaccine vector of embodiment 18, wherein the vector lacks the tegument protein pp65.
Embodiment 20. The recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 19, wherein the vector does not express an active UL130 protein.
Embodiment 21. The recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 20, wherein the RhCMV vaccine vector is Rh68-1 or Rh68-1.2.
Embodiment 22. The recombinant RhCMV or HCMV vaccine vector of embodiment 1 further comprising a microRNA recognition element (MRE) operably linked to a CMV gene that is essential or augmenting for CMV growth, and wherein the MRE silences expression in the presence of a microRNA that is expressed by a cell of myeloid lineage.
Embodiment 23. A pharmaceutical composition comprising the recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 22, and a pharmaceutically acceptable carrier.
Embodiment 24. A method for treatment or prevention of tuberculosis comprising administering to a subject in need thereof at least one recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 22.
Embodiment 25. The method of embodiment 24, further comprising re- administering to the subject at least one recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 22.
Embodiment 26. The method of embodiment 25, wherein the recombinant RhCMV or
HCMV vaccine vector of the re-administration is different than the recombinant RhCMV or HCMV vaccine vector of the initial administration.
Embodiment 27. A method for eliciting an immune response to a Mtb antigen comprising administering to a subject in need thereof at least one recombinant RhCMV or HCMV vaccine vector of any one of embodiments 1 to 22.
Embodiment 28. A method for eliciting a CD8+ or CD4+ T cell response to a Mtb antigen comprising administering to a subject in need thereof at least one recombinant RhCMV or HCMV vaccine vector of embodiment 20.
Embodiment 29. The method of any one of embodiments 24 to 28 wherein the recombinant RhCMV or HCMV vaccine vector is administered to the subject intravenously, intramuscularly, intraperitoneally, intranasally, or orally.
Embodiment 30. The method of any one of embodiments 24 to 29 wherein the vector is an HCMV vector and the subject is a human.
Embodiment 31. A Mtb antigen selected from Ag85B-ESAT6 and Ag85A-ESAT6- Rv3407-Rv2626c-RpfA-RpfD.
Embodiment 32. The Mtb antigen of embodiment 31 which is Ag85A-ESAT6-Rv3407- Rv2626c-RpfA-RpfD.
In order that the subject matter disclosed herein may be more efficiently understood, examples are provided below. It should be understood that these examples are for illustrative purposes only and are not to be construed as limiting the claimed subject matter in any manner. Throughout these examples, molecular cloning reactions, and other standard recombinant DNA techniques, were carried out according to methods described in Maniatis et al., Molecular
Cloning - A Laboratory Manual, 2nd ed., Cold Spring Harbor Press (1989), using commercially available reagents, except where otherwise noted.
Examples
Example 1 : CMV/TB Vectors
Particular aspects provide recombinant HCMV/TB vectors that can be growth- modulated in vivo (e.g., by oral administration of the antibiotic doxycycline). Heterologous antigen expression may be under the control of promoters of different kinetic classes with respect to the CMV infection cycle (e.g., EFla—constitutive; MIE— immediate early; pp65- early; gH-late).
In particular embodiments, HCMV/TB vectors lack immune modulatory genes (e.g., Rhl58-166 and Rhl82-189) to enhance vector immunogenicity, safety and heterologous gene carrying capacity of the vector. For example, HCMV encodes at least four different gene products, gpUS2, gpUS3, gpUS6 and gpUSl l that interfere with antigen presentation by MHC I. All four HCMV MHC evasion molecules are encoded in the unique short region of HCMV and belong to the related US6 gene family. Additional HCMV immunomodulators include, but are not limited to UL118, UL119, UL36, UL:37, ULl l la, UL146, UL147, etc. Likewise, RhCMV contains analogous immune modulatory genes, that can be deleted or modified to enhance vector immunogenicity, safety and heterologous gene carrying capacity of the inventive vaccine vectors.
In additional embodiments, HCMV/TB are further optimized for anti-TB
immunogenicity by insertion of multiple antigen genes, such as those disclosed herein.
Alternatively, several vectors, each having a single inserted antigen may be used for coadministration.
In additional embodiments, HCMV/TB vectors contain LoxP sites strategically placed in the CMV genome to flank an essential region of the viral genome, in combination with a tetracycline (Tet) -regulated Cre recombinase.
Construction and Characterization of the RhCMV BAC.
The development of BAC technology to clone large segments of genomic DNA coupled with sophisticated λ phage-based mutagenesis systems has revolutionized the field of herpes virology enabling genetic approaches to analyze the virus. Applicants have used this system, for example, to construct an RhCMV BAC(RhCMV BAC-Cre) containing the complete RhCMV strain 68-1 genome. The RhCMV BAC-Cre was derived from an infectious, pathogenic RhCMV 68-1/EGFP recombinant virus. RhCMV BAC-Cre contains a BAC cassette inserted at a single LoxP site within the Rhl81 (US l)/Rhl82 (US2) intergenic region of RhCMVvLoxP. Insertion of the BAC cassette at this site results in the generation of LoxP sequences flanking the cassette. As the BAC cassette contains a Cre gene that is expressed in eukaryotic cells, transfection of this "self-excising" RhCMV BAC-Cre into fibroblasts results in efficient excision of the BAC cassette, reconstituting virus (designated RhCMVvLoxP). Characterization of the growth of the BAC-reconstituted virus (RhCMVvLoxP) in vitro and in vivo demonstrates that the various genetic manipulations did not alter the WT properties of the virus. The genomic structure of RhCMVvLoxP is identical to that of WT RhCMV except for the residual LoxP site. The presence of the LoxP sequence does not alter the expression profiles of neighboring Rhl81 (US 1) and Rhl 82 (US 2) or distal (IE2) genes. RhCMVvLoxP replicates with WT kinetics both in tissue culture and in RhCMV seronegative immunocompetent RMs (n=2). Analysis of tissues from one animal terminated at 6 months post- inoculation demonstrated the presence of both RhCMV DNA and IE1 -expressing cells in the spleen, consistent with the persistent gene expression observed in previous studies with WT virus. Both RMs developed vigorous anti- RhCMV antibody titers comparable to those observed in naturally infected animals. Taken together, these observations demonstrate that RhCMVvLoxP is phenotypically WT and is suitable to construct site-specific alterations for the development of vaccine vectors.
Example 2: Non-Human Primate Study #1
This challenge included four treatment groups: 1) naive non-human primates (NHPs)
(e.g., Rhesus Macaques) (i.e., unvaccinated controls) (n=8); 2) NHPs vaccinated with BCG alone (n=7); 3) NHPs vaccinated with a cocktail of CMV/TB vectors alone (n=7); and 4) NHPs vaccinated with BCG and a cocktail of CMV/TB vectors. The naive NHPs were CMV- seropositive. The NHPs vaccinated with BCG were vaccinated with 0.1 ml intradermally with
Statens Serum Institute (SSI) BCG vaccine. The NHPs vaccinated with a cocktail of CMV/TB vectors were vaccinated with four Rh68-1 vectors (encoding fusion proteins comprised of Ag85A-Ag85B-Rv3407, Rvl733-Rv2626, RpfA-RpfC-RpfD, and Ag85B-ESAT6). The NHPs vaccinated with BCG and a cocktail of CMV/TB vectors were primed with the SSI BCG and boosted with the same cocktail of the four Rh68-1 vectors as above. The NHPs who received the CMV/TB vectors received 5xl06 PFU (plaque forming unit) of CMV/TB vector cocktails subcutaneously at weeks 6 and 21. The two BCG groups were given BCG at Week 0. At Weeks 6 and 21, the two CMV/TB vectors groups were immunized with the cocktail of RhCMV/TB vectors. NHP were challenged with Mycobacterium tuberculosis at Week 49. Endpoints included longitudinal CT scanning, gross pathology and bacterial burden.
Three of the four vectors used in this study encode classical, latency and resuscitation antigen cassettes (encoding fusion proteins comprised of Ag85A-Ag85B-Rv3407, Rvl733- Rv2626, and RpfA-RpfC-RpfD, respectively). NHP received 5E6 pfu/RhCMV vector, delivered subcutaneously. Also included was a Rh68-1 vector encoding a fusion protein comprised of Ag85AB and ESAT6.
Immunogenicity of these vectors was evaluated using intracellular cytokine staining. Figure 1 shows CD4+ and CD8+ T cell responses. PBMCs were assayed for each of the 9 antigens.
Figures 2A, 2B, 2C, and 2D show ESAT-6-specific responses following vaccination. Figures 3A, 3B, 3C, and 3D show Rvl733-specific responses following vaccination. Figures 4A, 4B, 4C, and 4D show RpfC-specific responses following vaccination. Figures 5A, 5B, 5C, and 5D show Ag85B-specific responses following vaccination. Figures 6A and 6B show Ag85A- specific responses following vaccination. Figures 7A and 7B show Rv3407 -specific responses following vaccination. Figures 8A and 8B show Rv2626-specific responses following vaccination. Figures 9A and 9B show RpfD-specific responses following vaccination. Figures 10A and 10B show RpfA-specific responses following vaccination.
Figure 11 shows the phenotypic differentiation of BCG- and RhCMV-induced T cells in blood.
Figure 12 shows that these Rh68-1 vectors, as expected, induce CD8 T cells that are primarily restricted by MHC II.
The RhCMV vectors were highly immunogenic, showing robust responses in both peripheral blood mononuclear cells (PBMCs) as well as broncho alveolar lavage (BAL).
Vaccination with Rh68-1 also significantly reduced disease progression as compared to naive controls.
Efficacy was evaluated by several means, including CT scan analysis (volume of lung involvement), necropsy score (size, number and distribution of gross lesions; lung, lung-draining lymph nodes, and total (which includes distant dissemination)), and necropsy Mycobacterium tuberculosis cultures (40 lung samples by sterology (30 right; 10 left); 9 lymph nodes (6 lung draining and 3 non-mediastinal); and 9 extra-pulmonary tissues (5 liver, 2 kidney, spleen, and pancreas)).
For pulmonary necropsy scoring, individual lobes were scored on 5 mm sections. The following scores were given for granuloma prevalence: no visible lesions = 1 ; 1 -3 lesions =2; 4-10 lesions = 3; 11-15 lesions = 4; 16-20 lesions = 5; > 20 lesions = 6; and Miliary <50% of lobe = 7. The following scores were given for largest granuloma size: none visible = 1; <l-2 mm = 2; 3-4 mm = 3; 5-10 mm = 4; 11-20 mm =5; > 20 mm = 6; confluent or miliary lesions involving <50% of lobe = 7; and confluent or miliary lesions involving > 50% of lobe = 8. The following scores were given for additional scoring criteria (1 = absent; 2 = present): parietal pleural adhesions associated with granulomatous disease, parietal pleural thickening associated with granulomatous disease; granulomatous disease with cavitation, and granulomatous disease involving parietal pleura, diaphragm or body wall.
For thoracic lymph node necropsy scoring, the following scores were given for size: nodes visible but not enlarged (< 5 mm) = 0; nodes visibly enlarged (< 5-10 mm) (unilateral) = 1 ; nodes visibly enlarged (< 5-10 mm) (bilateral) = 2; and nodes visibly enlarged (> 1 cm) (unilateral/bilateral) = 3. The following scores were given for granuloma prevalence:
no granulomas visible on capsular or cut surface = 0; focal or multifocal, circumscribed, non- coalescing granulomas < 2mm = 1 ; coalescing solid or caseous granulomas occupying < 50% of node = 2; coalescing solid or caseous granulomas occupying > 50% of node = 3; and complete granulomatous nodal effacement = 4. The following scores were given for additional scoring criteria (absent = 1 ; present = 2): other thoracic lymph nodes.
For liver and spleen necropsy scoring, the following scores were given for prevalence: no visible granulomas = 0; 1-3 visible granulomas = 1 ; 4-10 visible granulomas = 2; > 10 visible granulomas = 3 ; and miliary pattern = 4. The following scores were given for granuloma size: none present = 0; < l -2mm = 1 ; 3-4 mm = 2; and > 4 mm = 3.
For miscellaneous organs and tissue, the following scores were given for prevalence: no visible granulomas = 0; 1-3 visible granulomas = 1; 4-10 visible granulomas = 2; > 10 visible granulomas = 3 ; and miliary pattern = 4. The following scores were given for granuloma size: none present = 0; < l -2mm = 1 ; 3-4 mm = 2; and > 4 mm = 3.
Figure 13 shows the correlation of various efficacy criteria (i.e., necropsy < 16 weeks for cause, and > 16 weeks randomized) for a bi-weekly and pre- necropsy CT Scan (lung disease only). The necropsy score accounted for the size, number and distribution of gross lesions in the lung, lung draining lymph nodes, and distal sites. In particular, 40 lung samples (30 right; 10 left), 9 lymph nodes (6 lung draining and 3 non-mediastinal), and 9 extra-pulmonary tissue (5 liver, 2 kidney, spleen, and pancreas) were analyzed by sterology. Figure 14 shows CT Scans at 14 weeks post-infection. Figure 15 shows the quantification of pulmonary disease by CT scan. Figure 16 shows the gross pathology scores. These scores reflect the number of granulomas present, the size of the granulomas, and any complex pathologies (pleural thickening, pneumonia, etc). Included are overall scores (which include lung, lung draining lymph nodes, liver and spleen), as well as separated scores for the lung and lung draining lymph nodes. Figures 17 and 18 show the extent of disease and dissemination. RhCMV/TB vector vaccination alone achieved 73% efficacy against overall disease spread, which was statistically superior to both unvaccinated and BCG vaccination alone. Monkeys primed with BCG 6 weeks before
RhCMV/TB vaccination were still significantly protected against overall disease spread, but protection was less than that observed in the RhCMV/TB vaccination alone. Figure 19 shows the extent of disease and dissemination in non-lung samples. Figure 20 shows the extent of disease and dissemination in lymph nodes.
Figure 21 shows comparative T cell response analysis. Figure 22 shows correlation of CD4 T cell responses with extrapulmonary spread. Figure 23 shows correlation of CD8 T cell responses with extrapulmonary spread. In summary, the strongest correlate is between peak ESAT6-specific CD4+ T cell responses in blood after first CMV vector vaccination (correlation weakens but is still significant after exclusion of BCG group). Blood response correlates are strongest for extent of extrapulmonary disease (vs. extent of lung disease). The "best" blood CD4+ responses are: ESAT6, RpfA, RpfD, Rv2626, Rv3407. The "best" blood CD8+ responses: same as CD4 + Ag 85 A and 85 B. Few BAL responses correlate with outcome.
Figure 24 shows confirmation of infection by immune analysis, whereby CFP10, an Mtb antigen not included in the RhCMV constructs, was used to confirm infection by detection of de novo immune responses. Figure 25 shows post-challenge immune responses in PBMCs.
Figures 26 and 27 show CD4 T cell responses post-necropsy. Figure 28 shows antigen-specific CD4 T cell responses in lymph nodes analyzed post-necropsy. Figures 29 and 30 show CD8 T cell responses post-necropsy. Figure 31 shows antigen- specific CD8 T cell responses in lymph nodes analyzed post-necropsy. Overall, TB infection-elicited CFPlO-specific CD4+ and CD8+ T cell responses are similar between all RM groups. CMV vectors maintain
higher frequencies of TB insert-specific CD4+ T cells responses in PBMC, BM, spleen and lung for all inserts except ESAT6. This difference is less apparent in LN samples, except for RpfA and RpfD (although in certain LNs, RpfC, 85 A, Rv2623, and
Rv3407 Ag responses are also highest in the CMV vector vaccinated group). TB insert specific CD8+ T cell responses are more variable (and tend to be higher in unvaccinated RM), but responses to RpfA, RpfD, 85 A, Rv2626 and Rv3407 still tend to be higher in CMV
vector-vaccinated animals in most tissues.
Figure 32 shows post-necropsy correlation between splenic CD4 T cell responses and lymph node culture. A correlation of CD4+ responses to non-lung disease was observed for Ag85A, RpfA, RpfD, Rv2626, and Rv3407 (moderate to strong), as well as for Ag85B and RpfC (although weaker). A correlation of CD8+ responses to lung disease was observed for RpfA and RpfD (moderate), as well as for ESAT6 (although weaker). A correlation of CD8+ responses to non-lung disease was observed for Ag85A, RpfA, and RpfD (strong), as well as for Rv2626, Rv3407, and Ag85B (moderate). Peak ESAT6-specific responses (particularly CD4+) during vaccination correlated with reduced extra-pulmonary disease after challenge, but not at necropsy (as TB infection eventually induced high frequency ESAT6 -specific responses in all animals).
In general, CMV vectors elicit and maintain higher TB insert-specific CD4+ and CD8+ T cell responses than BCG. These responses are associated with significant protection against both pulmonary and extra-pulmonary disease progression. BCG was associated with, at best, a trend towards modest pulmonary protection, but extra-pulmonary disease was no different than that of unvaccinated controls. Indeed, the administration of BCG prior to CMV vector vaccination partially abrogated CMV vector-mediated protection, in particular for
extra-pulmonary spread. T cell responses to some, but not all, TB inserts were lower in some tissues in the animals receiving both BCG and CMV vectors compared to those receiving CMV vectors alone, but it remains to be determined whether this or another mechanism (e.g., BCG elicited responses promoting bacterial spread) account for the reduced protection associated the BCG "prime." Correlates of protection were stronger for extra-pulmonary disease than pulmonary disease and point to RpfA, RpfD, Ag85A, Rv2626 and Rv3407 (and
possibly ESAT6) being the most effective vaccine inserts.
In summary, RhCMV/TB vector-vaccinated RM show significantly reduced disease
(both pulmonary and extra-pulmonary) by all criteria. RhCMV/TB vectors elicited and maintained higher (and qualitatively different) TB insert-specific CD4+ and CD8+ T cell responses than BCG. RhCMV/TB vector vaccination provided significant protection against both
pulmonary and extra-pulmonary disease progression (73% overall). BCG was associated with a trend towards modest pulmonary protection compared to unvaccinated controls, but
extra-pulmonary disease was no different than that of unvaccinated controls. The combination of BCG and RhCMV/TB vectors is less effective than RhCMV/TB vector vaccination alone with the BCG component reducing both pulmonary and extra-pulmonary protection. RhCMV/TB vector-vaccinated RM may manifest a marked enhanced early response to infection in carinal LNs. The outcome (extra-pulmonary spread) predominantly correlated with CD4+ T cell responses to Ag85A, Rpf-A/C/D, Rv3407, Rv2626, and ESAT6. Example 3: Non-Human Primate Study #2
The second study was designed to confirm and extend previous findings of CMV- induced protection against Mycobacterium tuberculosis in rhesus macaques. In the original study, significant protection was induced by a cocktail of CMV vectors (strain 68-1), encoding a total of 9 antigens.
The second NHP study consisted of four vaccine groups: 1) Strain 68-1 RhCMV/TB-
9Ag vector set (n=9); 2) Strain 68-1.2 RhCMV/TB -9 Ag vector set (n=9); 3) Strain 68-1 RhCMV/TB-6Ag single vector (n=9); and 4) unvaccinated. Group 1) consisted of Macaques vaccinated with a cocktail of four Rh68-1 vectors (encoding fusion proteins comprised of Ag85A-Ag85B-Rv3407, Rvl733-Rv2626, RpfA-RpfC-RpfD, and Ag85B-ESAT6). Group 2) consisted of Macaques vaccinated with a cocktail of four Rh68-1.2 vectors (encoding fusion proteins comprised of Ag85A-Ag85B-Rv3407, Rvl733-Rv2626, RpfA-RpfC-RpfD, and Ag85B-ESAT6). Group 3) consisted of Macaques vaccinated with a single Rh68-1 vector (encoding a fusion protein comprised of Ag85 A-ESAT6-Rv3407-Rv2626c-RpfA-RpfD).
At weeks 0 and 14, NHP in Groups 1) -3) were vaccinated with the RhCMV/TB vectors described above. NHP were challenged with Mycobacterium tuberculosis (Erdman El 1-10 mTB at 10 CFU given intrabronchially) at week 55. There was not BAL post-challenge. The outcomes analyzed were the same as those described above in Example 2.
The 4 Rh68-1 vectors used in the first study were used again here (see above for information on construction). Three of the four Rh68-1.2 vectors used in this study encode classical, latency and resuscitation antigen cassettes (encoding fusion proteins comprised of Ag85A-Ag85B-Rv3407, Rvl733-Rv2626, and RpfA-RpfC-RpfD, respectively). The Rh68-1 vector encoding a six-antigen fusion protein (comprising antigens Ag85A, ESAT6, Rv3407, Rv2626, RpfA and RpfD) and Rh68-1.2 vector encoding Ag85B and ESAT6 were also used.
Immunogenicity of these vectors was evaluated using intracellular cytokine staining. Figure 33 shows PBMC immune responses following vaccination with RhCMV vectors; all vaccines showed robust immunogenicity. Figure 34 shows comparing immunogenicity induced by each RhCMV vector; all vaccines showed equivalent immunogenicity to common inserts. Figure 35 shows BAL immune responses following vaccination with RhCMV vectors. In addition, for Strain 68-1 RhCMV/TB vectors (UL128/UL130-deleted), all CD8+ T cell responses were MHC-II- and MHC-E-restricted, whereas for Strain 68-1.2 RhCMV/TB vectors (UL128/UL130-intact), all CD8+ T cell responses were MHC-Ia-restricted (data not shown).
Figure 36 shows Peripheral blood CFPlO-specific T cell responses post-Mtb challenge. All monkeys showed de novo responses to Mtb post challenge. Figure 37 shows clinical outcome data from longitudinal CT scans, which is used to quantify the volume of lung disease present post-challenge. There is clear evidence of protection in each of the vaccinated groups. Figures 38 and 39 show a necropsy score and culture, respectively. Figure 40 shows overall efficacy of Strain 68-1 RhCMV/TB vectors. Figure 41 shows late disease resolution in a Strain 68-1 RhCMV/TB-6Ag single vector vaccination. Figure 42 shows, at necropsy, the monkey manifested a pathologic extent of a disease score of 10 with only a single Mtb culture. The data suggests that Strain 68-1 RhCMV vector-elicited T cell responses may not only be able to prevent development of TB lesions, but may also be capable of mediating their regression.
In summary, low dose (10 bacteria) Erdman El 1-10 strain mTB challenge resulted in considerably less aggressive disease than previous studies using a >25 bacteria challenge dose, but all unvaccinated controls still showed both pulmonary and draining LN disease. Strain 68-1 RhCMV/TB vector vaccination, either the 9 Ag vector set, or the single 6 Ag insert vector, provided striking protection against both pulmonary and extra-pulmonary
disease after low dose mTB challenge: 1) 10 of 18 NHPs (56%) with no pathologic evidence of infection (7 of which were also completely culture negative) vs. 0% of unvaccinated controls; and 2) 12 of 18 NHPs (67%) with less disease (as measured by both Path Score and Culture) than the unvaccinated control with the least extent of disease progression; and 3) efficacy of the Strain 68-1 RhCMV/TB-6Ag single vector > Strain 68-1 RhCMV/TB-9Ag vector set. Strain 68- 1.2 RhCMV/TB-9Ag vaccination resulted in significant overall protection.
In addition, Strain 68-1 RhCMV/TB vector vaccination protects highly TB susceptible rhesus macaques from progressive pulmonary and extra-pulmonary TB disease after both high and low dose intrabronchial Erdman strain mTB challenge. In the high dose challenge model, BCG was not significantly protective and the combination of BCG and Strain 68-1 RhCMV/TB vector vaccination was less protective than Strain 68-1 RhCMV/TB vector vaccination alone.
Current data suggest vector-elicited CD4+ T cell responses are the primary protective correlate. To date, the single 6 Ag (polyprotein) expressing RhCMV vector provides the best overall protection, but it remains possible that different or additional TB Ag inserts would increase efficacy.
Example 4: General Methodology for Studies #3 and #4
Rhesus macaques:
Sixty- five purpose-bred, pedigreed, male RM (Macaca mulatto) of Indian genetic background were used in studies 3 and 4. At assignment, these RM were specific-pathogen free (SPF) as defined by being free of Macacine herpesvirus 1, D-type simian retrovirus, simian T- lymphotrophic virus type 1, simian immunodeficiency virus, and Mtb. All RM used in this study were housed at the Oregon National Primate Center (ONPRC) in Animal Biosafety level (ABSL)-2 (vaccine phase) and ABSL-3 rooms (challenge phase) with autonomously controlled temperature, humidity, and lighting. RM were single cage housed due to the infectious nature of the study and had visual, auditory and olfactory contact with other animals. Because the RM were single cage housed, an enhanced enrichment plan was designed and overseen by nonhuman primate behavior specialists. RM were fed commercially prepared primate chow twice daily and received supplemental fresh fruit or vegetables daily. Fresh, potable water was provided via automatic water systems. All RM were observed twice daily to assess appetite, attitude, activity level, hydration status and evidence of disease (tachypnea, dyspnea, coughing). Physical exams including body weight and complete blood counts were performed at all protocol time points. RM care and all experimental protocols and procedures were approved by the ONPRC. The ONPRC is a Category I facility. The Laboratory Animal Care and Use Program at the ONPRC is fully accredited by the American Association for Accreditation of Laboratory Animal Care (AAALAC), and has an approved Assurance (#A3304-01) for the care and use of animals on file with the NIH Office for Protection from Research Risks. The IACUC adheres to national guidelines established in the Animal Welfare Act (7 U.S.C. Sections 2131-2159) and the Guide for the Care and Use of Laboratory Animals (8th Edition) as mandated by the U.S. Public Health Service Policy.
Animal Procedures:
RM were sedated with ketamine HC1 or Telazol® for intradermal and subcutaneous vaccine administration, venipuncture, broncho alveolar lavage, lymph node biopsy, intrabronchial Mtb inoculation and computed tomography (CT) procedures. Mtb Erdman KOI was diluted in saline, lightly sonicated and bacteria were delivered to a segmental bronchus in the right caudal
lung lobe using a bronchoscope. The RM in Studies 3 and 4 received 25 and 10 colony forming units (CFU), respectively, in a volume of 2 ml. Pre- and post-challenge axial CT scans (2.5 mm slices) were obtained using a multi-section CT scanner using helical technique, collimation 3 mm and pitch 1.5 (CereTom, Neurologica Corp., Danvers, MA) and reconstructed as 1.25 mm slices to improve detection sensitivity. Nonionic iodinated contrast (Isovue 370, 1-2 ml/kg, Bracco Diagnostics, Princeton NJ) was administered IV at a rate of 1-2 ml/s. CT scans were obtained with 120 kVp and 200 niA. All animals were imaged pre-challenge, at two- week intervals for the duration of the studies and immediately prior to necropsy. Scans were interpreted by a veterinarian who was blinded to the identity of the subject. Lesion area in sequential scans was determined from transverse slices through entire lung fields using the IMPAX 6.5.5.3020 software area tool (AGFA HealthCare N.V., Mortsel, Belgium) and lesion volume determined by multiplying area by 1.25. One RM developed extensive bilateral miliary disease with estimated lesion volume >200,000 mm3 and no further attempts to estimate lesion volume were made in this animal.
Necropsy:
The humane criteria for removing RM with end- stage TB from the studies are as follows: 1) marked lethargy, 2) severe dyspnea at rest and/or failure to maintain adequate oxygenation (85%) based on pulse oximetry or blood gas analysis, 3) hemoptysis, 4) weight loss (>15% in 2 weeks; >25% over any time course in an adult animal), 5) hypothermia <96°F with supplemental heating, 6) persistent anemia (<20% for 2 weeks), 7) dehydration unresponsive to oral rehydration therapy for 3 days, 8) non-responsiveness to therapy for spontaneous diseases conditions, 9) poor appetite, requiring more than 3 orogastric tube feedings in 7 days, 10) obtundation, 11) neurologic deficits, and 12) persistent self-injurious behavior unresponsive to a change in location or enrichment. RM that manifested one or more of these end-stage criteria were immediately necropsied. RM that remained clinically well after post- infection week 16 were randomized and scheduled for euthanasia and necropsy at the rate of two per week. There were 3 exceptions to this general rule of necropsy initiated by end-stage disease criteria or randomization (designated as "other"). One non-end-stage RM (Dl) in Study 3 was euthanized on the same day as an end-stage RM because the IACUC does not permit housing a single RM alone in a room. Two additional RM (Nl, N3) in Study 3 were euthanized because of failure to maintain adequate oxygenation following a bronchoalveolar lavage procedure that was not attributable to end-stage Mtb disease. To avoid this issue in Study 4, BALs were not performed after challenge in this study.
At the humane or scheduled endpoint RM were euthanized with sodium pentobarbital overdose (>50 mg/kg) and exsanguinated via the distal aorta. The necropsy procedure included complete gross pathologic evaluation of abdominal organs and tissues and the brain prior to entering the thoracic cavity to avoid contamination. Macroscopic granulomas in liver, spleen, kidney and the brain were counted, measured and photographed in serial 5 mm tissue slices whereas granulomas occurring in extra thoracic lymph nodes, the gastrointestinal tract and soft tissues were collected, measured and photographed with minimum sectioning and given a numeric point value score using a semi-quantitative grading system (see, Figure 48). Granulomas (≤10) occurring in these tissues were bisected and one half collected in pre-weighed sterile media tubes for mycobacterial culture (see below) and the remaining half immersed in 10% neutral- buffered formalin for histologic analysis. Representative granulomas were selected for mycobacterial culture and histology from tissues with >10 granulomas. Single small granulomas (<1 mm) were utilized entirely for bacteriology. Representative samples of all abdominal organs and tissues and the brain were collected and then fixed in 10% neutral-buffered formalin for histologic analysis. Additional samples from these tissues were collected for mononuclear isolation and for mycobacterial culture. The pleura and thoracic wall were examined on entering the thoracic cavity and macroscopic granulomas and adhesions were collected, counted, measured, photographed, scored as described (see, Figure 48) and sampled for quantitative bacteriology and histology. The thoracic viscera were removed en bloc, and then transferred to a sterile cutting board for examination and dissection. Extreme care was taken to avoid mycobacterial contamination of thoracic tissues by spillage of granuloma contents during dissection, and this was accomplished in all but 1 RM in which gross spillage of granuloma contents was observed upon opening the thoracic cavity. The heart was removed and examined and pulmonary and mediastinal lymph nodes and individual lung lobes were dissected free, weighed and photographed. Lymph nodes were divided into samples for mycobacterial culture, histopathology, and mononuclear cell isolation (with mycobacterial culture prioritized if tissue was limiting). Macroscopic granulomas in individual lung lobes were counted, measured, photographed and scored in serial 5 mm tissue slices. Samples for mycobacterial culture and histology from the right and left lung slices were harvested using a nonbiased stereologic sampling method. Individual 6 mm lung tissue cores (30 from the right lung and 10 from the left lung) were bisected and one-half collected in pre-weighed sterile media tubes for bacteriology and the remaining half immersed in 10% neutral-buffered formalin for histologic analysis.
Additionally, representative samples of all lung lobes and the heart were collected and immersed in 10% neutral-buffered formalin. Tissues for histologic analysis were routinely processed and
embedded in paraffin. Sections (6 mm) were stained with hematoxylin and eosin. Selected tissues were stained by the Ziehl-Neelsen method for acid-fast bacteria.
Vaccines:
The 68-1 and 68-1.2 RhCMV/TB vectors were constructed by bacterial artificial chromosome (BAC) recombineering and were reconstituted and amplified into vector preparations as previously described (Hansen et al., Nature, 2011, 473, 523-527; Hansen et al., Nature, 2013, 502, 100-104; Hansen et al., Science, 2013, 340, 1237874; and Hansen et al., Nat. Med., 2009, 15, 293-299). The Mtb Ags to be included in these vectors were selected by a bioinformatics selection criteria starting with the scoring of 4000 Mtb open reading frames by 11 criteria (Zvi et al., BMC Med. Genomics, 2008, 1, 18). Those criteria included immunogenicity, vaccine efficacy, expression in granulomas, secretion, and role in hypoxic survival. The top candidates were then further screened by a deeper bioinformatics analysis of predicted T cell epitopes and curated to include antigens that are active during different stages of TB infection. In addition, all antigens had been shown to be at least partially protective in a mouse challenge model. The final choice of 9 Mtb proteins for the vaccine inserts included 3 representative proteins from so-called acute phase (85A, 85B, ESAT6), latency (Rvl733c, Rv3407, Rv2626c) and resuscitation (Rpf A, Rpf C and RpfD) class of Mtb Ags. These 9 Ags were expressed in 4 different RhCMV/TB vectors (to be used in combination) for both the 68-1 and 68-1.2 backbones, as follows: 1) Ag85A/Ag85B/Rv3407 (GenBank #KY611401), 2) Rvl733/Rv26226 (GenBank #KY611402), 3) RpfA/RpfC/RpfD (GenBank #KY611403), and 4) Ag85B/ESAT-6 (GenBank #KY611404). The GenBank Accession #s correspond the to the sequences as they are found in the final vectors. Polyprotein #s 1-3 were inserted into the nonessential Rh211 open reading frame under the control of murine CMV IE promotor. Polyprotein #4 was inserted in the same region of the RhCMV genome but under the control of the EFla promotor (see, Figure 46, panel a). For the single 6 Ag-expressing, 68-1 RhCMV/TB vector, a single polyprotein insert consisting of 2 Ags from each of 3 classes described above (acute: ESAT-6, Ag85 A; latency: Rv3407, Rv2626; resuscitation: RpfA, RpfD; GenBank #KY611405) was used to replace the nonessential Rhl07 gene, placing its expression under the control of the endogenous Rhl07 promoter (see, Figure 46, panels a and b). All BACs were analyzed by restriction digestion to confirm genomic integrity and were further examined by next generation sequencing (NGS) on an Illumina MiSeq sequencer to ensure the absence of any unintended mutations in the transgene. To reconstitute the vaccine vectors, the BACs were electroporated into telomerized or primary rhesus fibroblasts and kept in culture until full cytopathic effect was achieved. At this point, transgene expression was confirmed by immunoblot of infected cell lysates and vaccine
stocks were generated by the OHSU Molecular Virology Support Core (MVSC). Overall genomic integrity and transgene expression of the final vaccine stocks were confirmed by immunoblots, NGS, and pilot immunogenicity studies in RM. In addition, expression of the ORFs neighboring the TB Ag insertion site was confirmed by RT-PCR. RhCMV/TB vector stocks were titered using primary rhesus fibroblasts in a TCID50 assay. Study 3 and 4 RM were vaccinated by subcutaneous administration of 5 x 106 pfu of each of the designated RhCMV/TB vectors. For the RM receiving the 4 vector set, each vector was administered in a separate limb (right arm, left arm, right leg, left leg). RM were given the test vaccines twice, with the second dose (homologous boost) administered 15 weeks (Study 1) or 14 weeks (Study 2) after the first dose. The BCG vaccine (Danish strain 1331; Batch #111005A) was obtained from the Statens Serum Institute (Copenhagen, Denmark) and was reconstituted per the manufacturer's instructions (Diluent Batch #386587B). RM were BCG-vaccinated by the intradermal administration of 100 μΐ of vaccine containing 5.5 x 105 CFUs into the mid-back.
Immunologic assays:
Mtb-specific CD4+ and CD8+ T cell responses were measured in blood, BAL and tissues by flow cytometric ICS, as previously described (Hansen et al., Science, 2013, 340, 1237874; Hansen et al., Science, 2016, 351, 714-720; and Hansen et al., Nat. Med., 2009, 15, 293-299). Briefly, mononuclear cell preparations from blood, BAL or tissue were incubated at 37°C in a humidified 5% CO2 atmosphere with overlapping, consecutive 15-mer peptide mixes (11 amino acid overlap) comprising these proteins, or individual 15-mer peptides from these proteins, and the co-stimulatory molecules CD28 and CD49d (BD Biosciences) for 1 hour, followed by addition of brefeldin A (Sigma- Aldrich) for an additional 8 hours. Co-stimulation without antigenic peptides served as a background control. As previously described (Hansen et al., Science, 2016, 351, 714-720), the MHC restriction (MHC-Ia, MHC-E, MHC-II) of a peptide- specific response was determined by pre-incubating isolated mononuclear cells for 1 hour at room temperature (prior to adding peptides and incubating per the standard ICS assay) with the following blockers: 1) the pan anti-MHC-I mAb W6/32 (10 mg/ml), 2) the MHC-II-blocking CLIP peptide (MHC-II-associated invariant chain, amino acids 89-100; 20 μΜ), and 3) the MHC-E-blocking VL9 peptide (VMAPRTLLL; SEQ ID NO:31 ; 20 μΜ). Blocking reagents were not washed, but remain throughout the assay. Following incubation, stimulated cells were fixed, permeabilized and stained as previously described (Hansen et al., Science, 2013, 340, 1237874; Hansen et al., Science, 2016, 351, 714-720; and Hansen et al., Nat. Med., 2009, 15, 293-299) using combinations of the following fluorochrome-conjugated mAbs: SP34-2 (CD3; Pacific Blue, Alexa700), L200 (CD4; AmCyan, BV510), SK-1 (CD8a; PerCP-Cy5.5), MAB 11
(TNF-α; FITC, PE), B27 (IFN-γ; APC), FN50 (CD69; PE, PE-TexasRed), B56 (Ki-67; FITC), and in polycytokine analyses, JES6-5H4 (IL-2; PE, PE Cy-7). To determine the cell surface phenotype of Mtb-specific CD8+ T cells, mononuclear cells were stimulated as described above, except that the CD28 co-stimulatory mAb was used as a fluorochrome conjugate to allow CD28 expression levels to be later assessed by flow cytometry, and in these experiments, cells were surface- stained after incubation for lineage markers CD3, CD4, CD8, CD95 and CCR7 (see below for mAb clones) prior to fixation/permeabilization and then intracellular staining for response markers (CD69, IFN-γ, TNF-a). Data was collected on an LSR-II (BD Biosciences). Analysis was performed using FlowJo software (Tree Star). In all analyses, gating on the lymphocyte population was followed by the separation of the CD3+ T cell subset and progressive gating on CD4+ and CD8+ T cell subsets. Antigen-responding cells in both CD4+ and CD8+ T cell populations were determined by their intracellular expression of CD69 and one or more cytokines (either or both of the IFN-γ and TNF; + IL-2 in polycytokine analyses). After subtracting background, the raw response frequencies were memory corrected, as previously described (Hansen et al., Nature, 2011, 473, 523-527 and Hansen et al., Nat. Med., 2009, 15, 293-299) using combinations of the following fluorochrome-conjugated mAbs to define the memory vs. naive subsets SP34-2 (CD3; Alexa700, PerCP-Cy5.5), L200 (CD4; AmCyan), SK-1 (CD8a; APC, PerCP-cy-5.5), MAB 11 (TNF-a; FITC), B27 (IFN-γ; APC), FN50 (CD69; PE), CD28.2 (CD28; PE-TexasRed), DX2 (CD95 ; PE), 15053 (CCR7; Pacific Blue), and B56 (Ki-67; FITC). For memory phenotype and polycytokine analysis of Mtb Ag-specific T cells, all cells expressing CD69 plus one or more cytokines were first Boolean gated, and then this overall Ag- responding population was subdivided into the subsets of interest on the basis of surface phenotype or cytokine production pattern.
Mycobacterial Culture:
Tissues routinely collected at necropsy for Mtb burden analysis in both Study 3 and 4 included: 30 stereologic punches from right lung lobes, 10 punches from left lung lobes, trachea, left hilar LN, right hilar LN, left carinal LN, right carinal LN, paratracheal LN, mediastinal LN, axillary LN, inguinal LN, mesenteric LN, spleen, pancreas, left medial lobe of liver, right medial lobe of liver, left lateral lobe of liver, right lateral lobe of liver, liver caudate, left kidney, and right kidney. In Study 4, retropharyngeal LN, tonsil, submandibular LN, and iliosacral LN were also collected and cultured. In one RM in Study 4, mycobacterial culture analysis was not reported due to gross contamination of thoracic tissues with granuloma contents. Tissues were collected in HBSS and were then homogenized in an IKA grinder tube with a IKA Ultra- Turrax Tube Drive homogenizer. The tissue homogenate was then filtered over a 70 μιη wire screen to
remove debris and 200 μΐ of this material was plated neat and in serial dilutions (1/10, 1/100) on 7H11 agar plates (Remel). All plates were incubated at 37°C and M. tuberculosis growth was enumerated 28 and 42 days later. Bacterial burden was calculated in CFU per gram of tissue. A tissue was considered Mtb+ if any colonies with the correct morphologic features were identified. Selected cultures were analyzed by the Ziehl-Neelsen method for acid-fast bacteria to confirm colony morphologic features.
Data preparation for statistical analysis:
Three outcome measures were evaluated for evidence of a difference across treatment arms within each study: CT scan area-under the curve from challenge to day 112 post-challenge, pathologic score at necropsy, and Mtb culture at necropsy. The equivalence of the three Study 4 vaccine groups by these outcome measures (see, Figure 49) justified a pooled analysis. An outcome measure that combines necropsy score and culture results into a single value that can be evaluated across both efficacy studies was evaluated. Associations between these outcomes and Mtb-specific T cell responses measured by ICS were assessed.
Area under the log CT scan-determined pulmonary disease volume curve: The AUC of the log-transformed CT scan-determined pulmonary disease volume measurements from time 0 (set to 0) to day 112 was computed. Missing values for monkeys taken to necropsy before the full series of scheduled CT scan time points were imputed. The AUC of this augmented data was computed. The imputation procedure that was employed used linear regression to estimate missing values from previous time points. As a sensitivity analysis, the missing values were imputed using a more conservative rule (replacing missing values with the largest non-missing value at the same time point among monkeys receiving the same treatment, excluding for further conservatism one high- valued outlier unvaccinated RM); the resulting AUCs were highly insensitive to this procedure (Pearson correlation over 0.99 for both studies).
Necropsy score data: The non-negative count valued necropsy scores are amenable to
Poisson modeling. Model evaluations supported inclusion of the additional parameter for overdispersion in the negative binomial model. In TB Study 4, the estimated extra parameter was zero, so this model was equivalent to a simple Poisson model. For this Poisson model, a sandwich-based estimates of variance-covariance matrices was employed as an alternative method to account for overdispersion, using the vcovHC function in the sandwich package (Zeileis, J. Stat. Software, 2004, 11, 1-17 and Zeileis, J. Stat. Software, 2006, 16, 1-16) in R.
Necropsy culture data: Necropsy culture inputs were quantitative measures of culture growth with multiple replicates per tissue. These data were treated as binary indicators of a culture being positive versus negative (zero), and the total number of positive cultures was
evaluated. Model evaluations of necropsy culture outcome data favored the more expressive negative binomial models over Poisson models, and did not support using the ZIP model. One animal in TB Study 4 (Rh30072) was missing necropsy culture data but did have necropsy score data; the analyses of the culture data therefore excluded this RM, but as described below, the missing value for use in computing the combined scaled outcome measure was imputed.
Combined scaled outcome measure: As shown in Figure 50, a strong correlation between the necropsy score and necropsy culture outcome measures within each study was observed, although the scales were different: necropsy cultures are about one third as large as necropsy scores, across both studies. The intermediate, study- specific combined scaled outcome measure was created to gain measurement precision by averaging these two very similar outcome measures. To ensure that each receives equal weight in the combined measure, and to maintain discreteness in support of Poisson analysis of the statistic, the inputs were scaled by multiplying the necropsy culture values by 3 and then adding these to the necropsy scores. For Study 4, one RM (13) had a missing necropsy culture value. For this animal, the combined scaled outcome measure was computed using an imputed necropsy culture value, which was obtained by multiplying the observed necropsy score value by the estimated coefficient from a simple linear regression model relating the two values. This monkey's necropsy score value was 29, its imputed necropsy culture value was 8, and its combined scaled outcome measure value was 53. A negative binomial regression model of these study- specific combined measures versus treatment and study was employed, and used the estimated coefficient on study (0.3796) to further scale the TB Study 3 combined scaled outcome values. Therefore, the combined scaled outcome variable for TB Study 3 RM is the study- specific value multiplied by 0.3796 and then rounded to maintain the discreteness of the final variable for Poisson analysis.
End of vaccine phase T cell response data: Longitudinal flow cytometric ICS measures of CD4+ and CD8+ immune responses targeting the 9 individual genes in the RhCMV vaccines, and CFP10 was evaluated. The primary summary of these data was a measure of the immune response at the end of vaccine phase. These pre-challenge baseline immunogenicity values are geometric means of three independent measurements over the time periods shown in Figures 42 (panel a) and Figure 44 (panel a). Totals over 6 or 9 antigens were computed prior to log- transformation and normalization. Normalization shifts and scales these values to have mean zero, standard deviation 1 so that units have the interpretation of z-scores measuring the number of standard deviations an immune measurement (on the log scale) is from the overall (study- specific) mean of that measurement.
Statistical analysis:
All statistical analyses were conducted in R40.
Efficacy: Non-parametric tests were employed for primary comparisons and parametric models were used for estimating confidence intervals of treatment effects. For comparisons of outcome measures across pairs of groups, we used two-sided Wilcoxon tests. Boxplots show unadjusted p-values of only the pairwise comparisons that are significant at the 0.05 level. Holm adjustment was employed for the specified primary non-parametric comparisons: between unvaccinated and vaccinated TB Study 3 groups, and separately between BCG-only and other vaccinated groups. For TB Study ,4 similarly applied Holm-adjustment within groups of comparisons between unvaccinated and vaccinated TB Study 4 groups individually, and between the original 68-1 9Ag vector and the two modifications (68-1 6Ag, and 68-1.2 9Ag). Boxplots show unadjusted p-values; Holm-adjusted p-values are shown in Figure 51. Vaccine efficacy is reported as 100%-W, where W is 100 times the estimated rate (or confidence limit) of the Poisson or negative binomial model representing a count- valued outcome measure (necropsy score, necropsy culture, or the combined scaled outcome measure) among a vaccine group, as a fraction of the rate for Unvaccinated RM. For analysis of correlations across outcome variables, Spearman' s rank-transformed correlation statistic (r) and test were used. For Spearman' s test, p- values were computed via the asymptotic t approximation using the contest method in R.
Immunogenicity and correlates analysis: For comparisons of immunogenicity across vaccine-receiving treatment groups at pre-challenge baseline, Kruskal-Wallis (KW) tests were employed. The boxplots indicate significance of pairwise Wilcoxon tests if both KW and
Wilcoxon tests had unadjusted p-values < 0.05. Due to the missing of blood immunology data from week 41 of RM U6 (Study 3 ; BCG-only group), for Figure 42 (panel d), n = 6 for the BCG group; and for Figure 42 (panel c), the data point for the data point for this RM used only 2, rather than 3, time points for averaging. For analysis of immune response correlations with the combined scaled outcome measure (defined above) among RM receiving RhCMV and no BCG, Spearman' s statistic and test was computed, and the scatterplots also show the curve of the best- fitting negative binomial model. The low correlations (see, Figure 55) were confirmed through sensitivity analyses that also found in each study separately and in each outcome measure, so the lack of significance is not an artifact of these analysis choices. Extensive non-parametric analyses as well as parametric analyses employing negative binomial models to estimate single- parameter and multi-parameter associations between this combined scaled measure and pre- challenge immune responses to RhCMV immunogens revealed no statistically supported immune correlates of that outcome, or of other related outcomes.
Example 5: Studies #3 and #4
To initially test the hypothesis that TEM responses elicited by RhCMV/TB vectors would manifest a higher efficacy than BCG, 3 groups of RM (n=7 each; all naturally RhCMV- infected at study assignment) were vaccinated with: 1) RhCMV/TB vectors alone (a set of 4 RhCMV vectors based on the 68-1 strain that together express 9 different Mtb proteins: ESAT-6, Ag85A, Ag85B, Rv3407, Rvl733, Rv2626, Rpf A, Rpf C, Rpf D; see, Figure 46, panel a), 2) BCG alone, and 3) BCG followed by RhCMV/TB, according to the protocol outlined in Figure 42, panel a. As expected, RhCMV/TB vectors elicited and maintained high frequency CD4+ and CD8+ T cell responses in blood to all 9 Mtb inserts, as measured by overlapping 15-mer peptide mix- induced expression of intracellular TNF and/or IFN-γ by flow cytometric intracellular cytokine (ICS) analysis, and in plateau phase, these responses were predominantly effector differentiated, manifesting either a fully differentiated TEM phenotype (CD8+) or a mixed transitional and fully differentiated TEM phenotype (CD4+) (see, Figure 42, panels b-d). About half of the RhCMV/TB-elicited, Mtb Ag-specific CD4+ and CD8+ T cells responding in the ICS assays produced both TNF and IFN-γ (with or without IL-2) with the remainder predominantly producing TNF alone (see, Figure 42, panel e). BCG elicited circulating CD4+ and CD8+ T cell responses to 8 of the 9 insert Ags (all except ESAT-6, which is not expressed by BCG22). These responses predominantly manifested a central memory phenotype for the CD4+ T cells and a fully differentiated TEM phenotype for the CD8+ T cells. However, in peripheral blood, the overall magnitude of the BCG-elicited T cell responses to these Ags was considerably less (5-10- fold) than in RhCMV/TB-vaccinated RM, and the majority of these T cells produced either TNF or IL-2 alone (CD4+) or TNF or IFN-γ alone (CD8+), but not both TNF and IFN-γ (see, Figure 42, panels b-e). Indeed, the BCG-induced CD4+ and CD8+ T cell response to these Ags was not large enough to measurably change the plateau-phase magnitude, phenotype and function of the TB Ag-specific responses in the RM that received both BCG and RhCMV/TB relative to the RM that received RhCMV/TB vaccination alone (see, Figure 42, panels b-e). Differences in response magnitude between BCG- and RhCMV/TB-vaccinated RM were less apparent in
broncho alveolar lavage (BAL) fluid, with the responses in the latter group only marginally higher than in the former group (see, Figure 42, panel f).
Referring to Figure 42, the immunogenicity of RhCMV/TB and BCG vaccines in Study
3 is shown. Panel a is a schematic of the vaccination and challenge protocol and RM groups of Study 3. Panel b shows a longitudinal analysis of the overall CD4+ and CD8+ T cell response to the 9 Mtb insert proteins after vaccination with the designated vaccines. The background- subtracted frequencies of cells responding with TNF and/or IFN-γ production by flow cytometric
ICS assay to peptide mixes comprising each of the Mtb proteins within the memory CD4+ or CD8+ T cell subset were summed with the figure showing the mean (+ SEM) of these overall (summed) responses at each time point. Panel c shows boxplots comparing the individual Mtb protein (each of the 9 Mtb inserts plus the non-insert CFP-10)-specific and overall (summed) Mtb-specific CD4+ and CD8+ T cell response frequencies (defined by TNF and/or IFN-γ production) in peripheral blood between the vaccine groups at the end of the vaccine phase (each data point is the mean of response frequencies in 3 separate samples from weeks 44-49; { indicates no response detected). Penal d shows boxplots comparing the memory differentiation of the vaccine-elicited CD4+ and CD8+ memory T cells in peripheral blood responding to Ag85A with TNF and/or IFN-γ production at the end of vaccine phase (week 47). Memory differentiation state was based on CD28 vs. CCR7 expression, delineating central memory (TCM), transitional effector memory (TTREM), and effector memory (TEM), as designated. Penal e shows boxplots comparing the frequency of vaccine-elicited CD4+ and CD8+ memory T cells in peripheral blood responding to Ag85A with TNF, IFN-γ and IL-2 production, alone and in all combinations at the end of vaccine phase (week 49). Panel f shows boxplots comparing the individual Mtb protein-specific and overall (summed) Mtb-specific CD4+ and CD8+ T cell response frequencies (defined by TNF and/or IFN-γ production) in broncho alveolar lavage (BAL) fluid between the vaccine groups at the end of the vaccine phase (weeks 46-47; { indicates no response detected). In panels c-f, the Kruskal-Wallis (KW) test was used to determine the significance of differences between vaccine groups with the Wilcoxon rank sum test used to perform pair- wise analysis if KW p values were <0.05; brackets indicate pair- wise comparisons with Wilcoxon p values <0.05.
Referring to Figure 46, a description of RhCMV/TB vectors is shown. Panel a is a diagram showing the insertion sites for TB Ag cassettes in either the RhCMV 68-1 and 68-1.2 BAC backbones. The top 4 constructs use exogenous promoters (either MCMV IE or EFla) to drive insert expression, whereas the bottom construct (68-1 RhCMV/TB-6Ag) replaces the Rhl07 open reading frame with the 6 Ag insert, and relies upon the endogenous Rhl07 promoter to regulate insert expression. Panel b shows a RT-PCR analysis of the 68-1 RhCMV/TB-6Ag vector confirming deletion of Rhl07, concomitant expression of the 6 Ag TB insert and unchanged expression of both IE1 and the adjacent Rhl08 open reading frame. In this experiment, telomerized rhesus fibroblasts (TRF) were infected with the vector at a multiplicity of infection (MOI) of 3 and RNA was harvested and cDNA generated at 48 hours post-infection. RT-PCR was performed using primers specific for internal regions of the indicated genes to demonstrate deletion of Rhl07 and expression of the 6Ag insert as well as surrounding open
reading frames. Panel c shows a Western Blot analysis of the HA-tagged 6 Ag insert expression (arrow) by the 68-1 RhCMV/TB-6Ag vector. TRFs were infected with RhCMV 68-1 or the 68-1 RhCMV/TB-6Ag vector (RhCMV 68-1 ARhl07-TB6Ag) at an MOI = 3, harvested at full cytopathic effect, and subjected to western blotting directed at the HA tag. HeLa cells transfected with a plasmid expressing the 6 Ag insert (pOri-TB6Ag) are shown as a control.
Fifty weeks after initial vaccination, the 3 groups of vaccinated RM and a control group of unvaccinated RM (n=8; also naturally CMV+) were challenged by intrabronchial instillation of 25 colony- forming units (CFUs) of Erdman strain Mtb bacteria into the right lower lobe. The effectiveness of challenge was confirmed by de novo development of CD4+ and CD8+ T cell responses to the CFP-10 Ag in all RM (see, Figure 43, panel a, and Figure 47, panel a; the Mtb- expressed CFP-10 Ag was not included in the RhCMV/TB vectors, and, like ESAT-6, is not expressed by BCG22). The development of pulmonary disease after challenge was monitored every two weeks by CT scan assessment of lesional volume, but primary outcome was determined by pathologic examination (pathologic score; see, Figure 48) and by extensive mycobacterial culture of lung (sampled using stereology), as well as lung-draining and other chest lymph nodes (LNs), peripheral LNs and selected organs (spleen, liver, kidney, pancreas) at necropsy (see Methods), with necropsy performed either at clinical endpoint, or after 20 weeks post-infection (pi), by randomization (see, Figure 42, panel a). Pulmonary disease developed rapidly in unvaccinated control RM with progression to severe (> 10,000 mm3) lung parenchymal disease by CT scan in 7/8 RM by day 56pi and all RM by day 98pi (see, Figure 43, panel b). In both RM groups that received BCG, the development of pulmonary disease was more variable, but 5 of 7 RM in each group developed severe disease by day 98pi. In contrast, 5 of 7 of the RM vaccinated with RhCMV/TB vectors alone developed only mild pulmonary disease (<3,000 mm3, n=4) or no disease (n=l), and the overall area-under-the-curve (AUC) of pulmonary lesion volume of this group during the first 16 weeks pi was significantly reduced from the
unvaccinated control group (see, Figure 43, panel c, and Figure 49, panel a).
Referring to Figure 43, the outcome of Mtb challenge (Study 3) is shown. Panel a shows the development of peripheral blood CD4+ T cell responses to the peptide mixes comprising the non- vaccine insert Mtb protein CFP-10 in all Study 3 RM after Mtb challenge by flow cytometric ICS analysis (response defined by TNF and/or IFN-γ production after background subtraction in memory subset; CFP-10-specific CD8+ T cell responses shown in Figure 47, panel a). Panel b shows CT quantification of disease volume in the pulmonary parenchyma after Mtb challenge (presence or absence of draining LN enlargement indicated by closed vs. open symbols). Panel c shows boxplots comparing the AUC of CT-determined pulmonary lesional
volume (day 0-112) of the 4 RM groups. Panels d-e show boxplots comparing the extent of TB at necropsy measured by Mtb recovery with mycobacterial culture and by pathologic disease score in lung parenchyma (panel d), all non-lung parenchymal tissues (panel e) and all tissues (panel f). In panels c-f, unadjusted Wilcoxon p values <0.05 are shown (see, Figure 49, panel a).
Referring to Figure 47, the development of de novo Mtb-specific CD8+ T cell responses after Mtb challenge is shown. Panels a and b show the development of peripheral blood CD8+ T cell responses to the peptide mixes comprising the non- vaccine insert Mtb protein CFP-10 in Study 3 (panel a) and Study 4 (panel b) RM after Mtb challenge by flow cytometric ICS analysis (response defined by TNF and/or IFN-γ production after background subtraction in memory subset). Corresponding CFP-10-specific CD4+ T cell responses are shown in Figure 43, panel a and Figure 45, panel a. All Mtb-challenged RM, including vaccinated RM that did not manifest post-challenge disease, showed multiple post-challenge samples with above-threshold CFP-10- specific CD4+ and CD8+ T cell responses, indicating a de novo response to challenge. Panel c shows the development of peripheral blood CD8+ T cell responses to the peptide mixes comprising the Ag85B, Rvl733 and Rpf proteins in Study 4, group 3 RM, who received the
RhCMV/TB-6Ag vaccine lacking these insert Ags (corresponding CD4+ T cell responses shown in Figure 45, panel b). Again, de novo post-challenge induction of responses to these 3 Mtb proteins was observed in all group 3 RM.
Referring to Figure 48, the pathologic scoring of TB disease at necropsy is shown. The tables show the criteria and scoring system used to quantify the pathologic extent of TB disease at necropsy in Study 3 and 4 RM. Note that every RM receives a separate score for 7 lung lobes, chest wall, each separate lymph node group (both chest and non-chest), liver, spleen, and each other involved organ, with the sum of these scores being the overall Pathologic Score. The sum of the scores for the 7 lung lobes is the Lung Pathologic Score, with the sum of all other scores (including chest wall and lymph nodes) being the Non-Lung Pathologic Score. The sum of all scores (Lung and Non-Lung) is the Overall Pathologic Score.
Referring to Figure 49, a summary of outcome statistics is shown. Panels a and b show Study 3 analysis. Panels c and d show Study 4 analysis. Panel e shows the combined analysis.
The CT-determined lesional AUC through week 16 pi closely correlated with pulmonary parenchymal disease at necropsy as measured by both pathologic scoring and mycobacteria culture (see, Figure 50, panel a), and as such, the extent of lung disease at necropsy was significantly reduced in the RhCMV/TB vector group compared to unvaccinated controls by both these measures (see, Figure 43, panel d, and Figure 49, panel a). No significant pulmonary disease reduction was observed in the BCG-only vaccinated cohort by either necropsy measure,
and the BCG+RhCMV/TB vaccine regimen resulted in only a modest reduction in mycobacterial burden. TB is typically not restricted to pulmonary parenchyma in RM given this dose of Erdman strain Mtb and necropsy analysis revealed extensive extra-pulmonary disease in the unvaccinated RM, including both lung-associated lymph node involvement and extra-thoracic spread (see, Figure 51). The extent of disease as measured by pathologic score was closely correlated with the extent of disease measured by mycobacterial culture (see, Figure 50, panel b), and by both criteria, extra-pulmonary disease was dramatically reduced in the RhCMV/TB- vaccinated cohort, resulting in a significant reduction in the overall extent of disease in this cohort relative to unvaccinated RM (see, Figure 43, panels e and f; Figure 49, panel a; and Figure 51). By Poisson modeling, the overall extent of disease was reduced in the RhCMV/TB- vaccinated group by 68.7% by mycobacterial culture (P<0.0001) and 67.3% by pathologic score (P<0.0001) relative to unvaccinated controls (see, Figure 49, panel b). In contrast, the extent of extra-pulmonary and overall disease in BCG-only- vaccinated RM was not significantly different from unvaccinated RM by either criteria, and in keeping with this, the extent of extra-pulmonary and overall disease in the RM given the RhCMV/TB vaccine alone was also significantly reduced from the BCG-only- vaccinated RM. Using the same Poisson modeling, RhCMV/TB vaccination reduced overall disease relative to BCG vaccination by 57.7% (P=0.0007) and 51.4% (P=0.01) for mycobacterial culture and pathologic score, respectively (see, Figure 49, panel b). Pre- vaccination of RM with BCG 6 weeks prior to initial RhCMV/TB vaccination appeared to substantially reduce the extra-pulmonary, as well as pulmonary, efficacy of
RhCMV/TB vaccination alone, as the BCG+RhCMV/TB-vaccinated group showed only a very modest reduction in mycobacterial recovery in all sites relative to unvaccinated controls (see, Figure 43, panels d-f; Figure 49, panel a; and Figure 51).
Referring to Figure 50, a comparison of different measures of TB infection outcome is shown. Panels a and b show the correlation of pulmonary parenchymal disease as measured by CT scan-determined disease volume (AUC through day 112) post-infection vs. Mtb culture of lung samples (panel a) and lung pathologic score (panel b) at necropsy of Study 3 RM. Panel c shows the correlation of overall Mtb culture vs. overall pathologic score at necropsy of Study 3 RM. Panels c and d show the same analysis for Study 4 RM. Spearman correlation coefficients (r) and associated p values are shown in each plot.
Referring to Figure 51, a summary of TB disease outcome at necropsy of Study 3 is shown. The lung, non-lung, and overall extent of Mtb disease by mycobacterial culture (# positive cultures; left y axis) and pathologic scoring (right y-axis; see Figure 48) is shown for each individual Study 3 RM.
To confirm and further characterize RhCMV/TB efficacy, a second, larger Mtb challenge study (n=9 RM per group; all RhCMV+ at assignment) was performed using a lower dose of Erdman strain and in which we compared the same 68-1 RhCMV/TB-9 Ag vaccine used in Study 3 (group 1) with an analogous RhCMV/TB-9 Ag) vaccine based on the 68-1.2 vector backbone (in which repaired expression of Rhl57.5 and Rhl57.4 results in distinct CD8+ T cell epitope targeting; group 2), and a single 68-1 RhCMV/TB-6 Ag vector expressing a 6-Ag Mtb polyprotein (Ag85A; ESAT-6; Rv3407; Rv2626; Rpf A; Rpf D) (group 3) (see, Fig. 44, panel a; Figure 46). 68-1 RhCMV vectors elicit unconventional CD8+ T cell responses that are restricted by MHC-II and MHC-E, whereas the CD8+ T cell responses elicited by 68-1.2 RhCMV vectors are conventionally MHC-Ia restricted; thus, the group 1 vs. group 2 comparison allows determination of the contribution of unconventionally restricted CD8+ T cells to RhCMV/TB efficacy. In the group 1 vs. group 3 comparison, whether the efficacy observed with the 4 RhCMV/TB vector set encoding 9 Mtb Ags (3 each in the acute phase, latency and resuscitation Ag types) can be recapitulated by a single RhCMV/TB vector expressing 6 Mtb Ags (2 each from these Ag types) which is more appropriate for clinical translation was determined. The magnitude of the overall Mtb-specific and individual Mtb insert- specific CD4+ and CD8+ T cell responses elicited by the 68-1 and 68-1.2 RhCMV/TB-9 Ag vectors were comparable in blood throughout the vaccination phase, and in BAL and lymph node at the end of vaccination phase, as was the memory differentiation and functional phenotype of the Mtb-specific response in blood (see, Figure 44, panels b-g). However, the CD8+ T cells elicited by the 68-1 RhCMV/TB vaccine were unconventionally (MHC-II and MHC-E) restricted, whereas those elicited by 68- 1.2 RhCMV/TB vaccine were conventionally (MHC-Ia) restricted (see, Figure 52). The observed immune responses against the 6 Ags common to both 68-1 RhCMV/TB-6 Ag and RhCMV/TB-9 Ag vaccines are similar between groups 1 and 3 with respect to magnitude, phenotype and (unconventional) MHC restriction, except for slightly different levels of CD8+ T cell responses in LN (see, Figure 44, panels b-g; Figure 52).
Referring to Figure 3, the immunogenicity of RhCMV/TB vaccines (Study 4) is shown. Panel a shows a schematic of the vaccination and challenge protocol and RM groups of Study 4. Panel b shows a longitudinal analysis of the overall CD4+ and CD8+ T cell response to the 9 Mtb Ags after vaccination with the designated vaccines, as described in Figure 42, panel b. Panel c shows boxplots comparing the individual Mtb protein (each of the 9 Mtb inserts plus the non- insert CFP-10)-specific and overall (summed) Mtb-specific CD4+ and CD8+ T cell response frequencies (defined by TNF and/or IFN-γ production) in peripheral blood between the vaccine groups at the end of the vaccine phase (each data point is the mean of response frequencies in 3
separate samples from weeks 49-55; { indicates no response detected). Panel d shows boxplots comparing the memory differentiation (see, Figure 42, panel d) of the vaccine-elicited CD4+ and CD8+ memory T cells in peripheral blood responding to Ag85A with TNF and/or IFN-γ production at the end of vaccine phase (weeks 51-52). Panel e shows boxplots comparing the frequency of vaccine-elicited CD4+ and CD8+ memory T cells in peripheral blood responding to Ag85A with TNF, IFN-γ and/or IL-2, alone and in all combinations at the end of vaccine phase (weeks 49-50). Panels f and g show boxplots comparing the individual Mtb protein (the 9 Mtb inserts plus the non-insert CFP-10)-specific and overall (summed) Mtb-specific CD4+ and CD8+ T cell response frequencies (defined by TNF and/or IFN-γ production) in BAL (panel f) and in peripheral LN (panel g) between the vaccine groups at the end of vaccine phase (weeks 46-47; { indicates no response detected). In panels c-g, statistics performed as described in Figure 42 with brackets indicating pair- wise comparisons with Wilcoxon p values <0.05.
Referring to Figure 52, the MHC-restriction analysis of RhCMV/TB vector-elicited CD8+ T cell responses in Study 4 is shown. RhCMV/TB vaccine-elicited CD8+ T cells were epitope- mapped in representative group 1, 2 and 3 RM from Study 4 using flow cytometric ICS to detect recognition of each consecutive, overlapping 15-mer gag peptide comprising the indicated TB proteins. Peptides resulting in specific CD8+ T cell responses are indicated by a box, with the color of the box designating MHC restriction as determined by blocking with the anti-pan-MHC-I mAb W6/32, the MHC-E blocking peptide VL9 and the MHC-II blocking peptide CLIP. The epitope restriction profiles of the strain 68-1 RhCMV/Ag85B/ESAT-6- and RhCMV/Rpf A/Rpf C/Rpf D-elicited CD8+ responses to Rpf A, Ag85B, and ESAT-6 are produced here for comparison with 68-1.2 versions of these vectors and for Rpf A and ESAT-6, with the 68-1 RhCMV/TB - 6 Ag vector.
After a 56 week vaccination period, all 27 vaccinated RM in groups 1-3 and 9
RhCMV+ unvaccinated control RM (group 4) were intrabronchially challenged with 10 CFUs of Erdman strain Mtb bacteria - the reduction in dose relative to Study 3 intended to slow TB progression in Study 4 RM to more closely resemble the course of human Mtb infection. In addition, post-challenge BAL was not performed in this experiment to prevent procedure-related mortality or enhancement of bacteria spread within the lung. All RM developed de novo CFP-10- specific T cell responses in blood following challenge, and the RhCMV/TB-6 Ag-vaccinated RM (group 3) also developed de novo T cell responses in blood to the Ag85B, Rpf C, and Rvl733 Ags, which were not included in their vaccine (see, Figure 45, panels a and b; Figure 47, panels b and c). All 9 unvaccinated (group 4) RM developed TB lesions on CT scans by day 28pi, but, as anticipated, the disease progression in this study was slower than in Study 3 (see, Figure 45,
panel c), and only 2 unvaccinated (group 4) control RM developed endpoint TB disease over the course of observation (see, Figure 44, panel a). Remarkably, 13 of the 27 vaccinated RM (5 each in group 1 and group 3 ; 3 in group 2) did not develop any radiologic signs of pulmonary TB (including no hilar adenopathy) at any time point through to random elective necropsy at >16weeks pi, and the average CT-determined lesional AUC in lung parenchyma of the overall cohort of vaccinated RM was significantly reduced from the unvaccinated group (see, Figure 45, panels c and d; Figure 49, panel c). At necropsy, none of the 13 CT-negative RM from vaccine groups 1-3 manifested any macroscopic granulomatous disease, and 10 of these 13 were culture negative in all tissues (the remaining 3 were Mtb-i- in lung-draining lymph nodes; see, Figure 50, panels c and d; Figure 54). Despite the development of CD4+ and CD8+ T cell responses to Mtb proteins not in their vaccine in lung, lung-draining and peripheral lymph nodes, and spleen (see, Figure 53), histopathologic examination of lung and lung-draining lymph node sections in these 13 TB disease- free RM showed no granulomatous inflammation. The overall extent of disease by mycobacterial culture and pathologic score was strongly correlated in this experiment (see, Figure 50, panel d), and was significantly reduced in the overall (pooled groups 1-3)
RhCMV/TB vaccinated group compared to the unvaccinated control group, with no significant difference in efficacy between individual groups 1-3, and similar protection in both lung and non-lung tissues (see, Figure 45, panels e-g; Figure 49, panel c; Figure 54). For the pooled vaccinated group, the overall reduction in disease extent relative to the unvaccinated control group was 74.5% by mycobacterial culture (P=0.0024) and 61.4% by pathologic score
(P=0.0011) using Poisson modeling (see, Figure 51). The finding of efficacy with 68-1.2 RhCMV/TB vaccination indicates that efficacy is not dependent on unconventional MHC-II and MHC-E-restricted CD8+ T cells, indicating that protection can be mediated by either conventional or unconventional CD8+ T cells, or is independent of CD8+ T cells altogether.
Referring to Figure 45, the outcome of Mtb challenge (Study 4 and Overall) is shown.
Panels a and b show the development of peripheral blood CD4+ T cell responses to the peptide mixes comprising the non- vaccine insert Mtb protein CFP-10 in all Study 4 RM (panel a), and comprising the Ag85B, Rvl733 and Rpf proteins in group 3 RM only (panel b; RM vaccinated with the single 68-1 RhCMV/TB-6Ag vector lacking these 3 inserts) after Mtb challenge by flow cytometric ICS analysis, as described in Figure 43, panel a (peripheral blood CD8+ T cell responses and tissue CD4+ and CD8+ T cell responses to these same Ags are shown in Figure 47, panels b and c and Figure 53, respectively). Panel c shows CT quantification of disease volume in the pulmonary parenchyma after Mtb challenge (presence or absence of draining LN enlargement indicated by closed vs. open symbols). Panel d shows boxplots comparing the AUC
of CT-determined pulmonary lesional volume (day 0-112) of the unvaccinated RM vs. all RhCMV/TB-vaccinated RM vs. RM in each individual RhCMV/TB vaccine group. Panels e-g show boxplots comparing the extent of TB at necropsy measured by Mtb recovery with mycobacterial culture and by pathologic disease score in lung parenchyma (panel e), all non-lung parenchymal tissues (panel f) and all tissues (panel g) in the same RM groups. Panel h shows a boxplot comparing the outcome of Mtb challenge in all unvaccinated RM vs. all RhCMV/TB- only vaccinated RM across both Studies 3 and 4 using a scaled outcome measure that combines both mycobacterial culture and pathologic score data. In panels d-h, unadjusted Wilcoxon p values <0.05 are shown (see, Figure 49, panel c).
Referring to Figure 53, an analysis of non- vaccine-elicited, Mtb-specific CD4+ and
CD8+ T cell responses at necropsy (response to Mtb challenge) is shown. Panel a shows flow cytometric ICS analysis demonstrating peripheral blood and tissue CD4+ and CD8+ T cell responses to the peptide mixes comprising the non-vaccine insert Mtb protein CFP10 in the 1 Study 3 RM and the 13 Study 4 RM (5, 3, and 5 from Groups 1, 2 and 3, respectively) without pathologic evidence of TB disease at necropsy (see, Figures 50 and 54; response defined by TNF and/or IFN-γ production after background subtraction in memory subset). Panel b shows a similar analysis of T cell responses to peptide mixes comprising the Ag85B, Rvl733 and Rpf proteins in the 5 Study 4, group 3 RM (vaccinated with the RhCMV/TB-6 Ag vaccine lacking these inserts) who failed to manifest TB disease after challenge. These data confirm that these protected monkeys were sufficiently exposed to Mtb infection after challenge to develop a robust systemic response to TB proteins that were not present in their vaccine.
Referring to Figure 54, a summary of outcome at necropsy of Study 4 is shown. The lung, non-lung, and overall extent of Mtb disease by mycobacterial culture (# positive cultures; left y axis) and pathologic scoring (right y-axis; see, Figure 48) are shown for each individual Study 4 RM.
It is remarkable that despite the fact that the average extent of TB progression in the unvaccinated control monkeys in Studies 3 and 4 was quite different, the reduction in disease with RhCMV/TB vaccination was similar in both studies. Indeed, using a normalized, combination outcome parameter based on both mycobacterial culture and pathologic score, it was estimated that across both studies the extent of disease in the RhCMV/TB-vaccinated RM was reduced 68% relative to unvaccinated controls (P=0.0019) (see, Figure 45, panel h; Figure 51). In contrast to the "all or none" efficacy of the RhCMV/SIV vaccine against rapidly progressive SIV infection, the protection afforded by RhCMV/TB against the more slowly progressive Mtb infection appears to be graded, including RM with apparent sterilizing
protection, RM with no macroscopic disease but with very focal bacterial persistence, and a higher fraction of RM with reduced progression compared to unvaccinated controls (see, Figures 50 and 54). However, there are also vaccinated RM that developed progressive and ultimately fatal TB disease similar to the unvaccinated controls. This outcome heterogeneity was not predicted by the RhCMV/TB-elicited, TNF/IFN-y-defined, CD4+ or CD8+ T cell response magnitudes in blood, BAL or LN prior to challenge (see, Figure 55). The observation that BCG vaccination 6 weeks prior to RhCMV/TB vaccination reduces efficacy almost 1 year later supports the concept that mycobacteria-induced immune responses do include an anti-protective component.
Referring to Figure 55, immune correlates analysis of Studies 3 and 4 are shown. Panels a and b show the relationship between the end-of- vaccine phase overall TB-specific CD4+ and CD8+ T cell responses in peripheral blood (panel a) and BAL (panel b) to the same scaled outcome measure that combines both mycobacterial culture and pathologic score data at necropsy used in Figure 45, panel h is shown for all Study 3 and 4 RM that received a
RhCMV/TB vaccine only. The T cell responses reflect the sum of responses to the ESAT-6, Ag85 A, Ag85B, Rv3407, Rvl733, Rv2626, Rpf A, Rpf C, Rpf D Ags and are presented in units of z-score (number of standard deviations that a monkey's normalized total immune response at end of vaccine phase is above the average of the monkeys in that study. Panel c shows the same analysis for overall Mtb-specific CD4+ and CD8+ T cell responses in peripheral lymph node in RhCMV/TB-vaccinated Study 4 RM (lymph node biopsy was not performed in Study 3).
Spearman correlation coefficients (r) and associated P values are shown in each plot, with the best-fitting negative binomial curve overlayed. Similar results (lack of significant correlation) were observed for total AUC CD4+ or CD8+ T cell responses for the entire vaccine phase in peripheral blood, and for peripheral blood, BAL, and lymph node responses to only the 6 Ags common to all RhCMV/TB-vaccinated RM, or to any individual Mtb Ag prior to challenge.
These studies show that a parenterally administered RhCMV-based vaccine is able to elicit and maintain over the course of at least a year effector responses that can control Mtb at the early stages of infection, and that the protection afforded by this vaccine can be complete, if not sterilizing. To our knowledge, this is the first report of complete prevention of TB in the RM model. Given TEM responses to natural, persistent CMV infection are maintained for life, the protection afforded by this vector platform is likely to be very durable, probably lifelong. The RhCMV/TB vaccine is efficacious against aggressive TB in RM and provides treatment of a human CMV/TB vaccine that would be effective in preventing pulmonary TB in adolescents and adults, and thereby contribute to ending the global TB epidemic.
Over both Studies 3 and 4, RhCMV/TB vaccination reduced the extent of disease at necropsy, as measured by both pathologic score and frequency of mycobacterial culture-positive tissues, by 68% compared to unvaccinated controls (P=0.0019). There was no significant difference in efficacy between cohorts vaccinated with 68-1 vs. 68-1.2 RhCMV vector backbones (which differ in CD8+ T cell epitope recognition) or with 68-1 RhCMV vectors expressing 9 vs. 6 Mtb proteins. In contrast, BCG was not significantly efficacious in this challenge model, and administration of BCG 6 weeks prior to RhCMV/TB vaccination reduced the efficacy of the latter vaccine. Across both studies, 14 of the 34 RhCMV/TB-vaccinated RM (41%) showed no granulomatous disease at necropsy (vs. 0 of 17 unvaccinated controls;
P=0.0018), despite immunologic evidence of initial infection after challenge, and 10 of these were mycobacterial culture-negative in all tissues. Thus, the RhCMV/TB vaccine is superior to BCG in the RM model, and is the first vaccine demonstrated to completely prevent progressive TB in primates.
Various modifications of the described subject matter, in addition to those described herein, will be apparent to those skilled in the art from the foregoing description. Such modifications are also intended to fall within the scope of the appended claims. Each reference (including, but not limited to, journal articles, U.S. and non-U.S. patents, patent application publications, international patent application publications, gene bank accession numbers, and the like) cited in the present application is incorporated herein by reference in its entirety.
Claims (29)
1. A Mtb antigen selected from Ag85B-ESAT6 and Ag85A-ESAT6-Rv3407-Rv2626c- RpfA-RpfD.
2. The Mtb antigen of claim 1 which is Ag85 A-ESAT6-Rv3407-Rv2626c-RpfA-RpfD.
3. A recombinant RhCMV or HCMV vector comprising a nucleic acid sequence encoding an expressible Mtb antigen selected from Ag85A-Ag85B-Rv3407, Rvl733-Rv2626c, RpfA- RpfC-RpfD, Ag85B-ESAT6, and Ag85A-ESAT6-Rv3407-Rv2626c-RpfA-RpfD.
4. The recombinant RhCMV or HCMV vaccine vector of claim 3, wherein expression of the Mtb antigen is driven by an antigen-coding sequence in operable association with a promoter selected from the group consisting of a constitutive CMV promoter, an immediate early CMV promoter, an early CMV promoter, and a late CMV promoter.
5. The recombinant RhCMV or HCMV vaccine vector of claim 4, wherein the promoter is selected from the group consisting of EFl-alpha, UL82, MIE, pp65, and gH.
6. The recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 5, comprising a deletion or modification of US2, US3, US4, US5, US6, US11, or UL97, or a homolog thereof.
7. The recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 6, comprising a deletion of Rhl58-166 or a homolog thereof.
8. The recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 7, wherein the RhCMV or HCMV vaccine vector is a tropism-restricted vector.
9. The recombinant RhCMV or HCMV vaccine vector of claim 8, wherein the tropism- restrictive vector lacks genes required for optimal growth in certain cell types or contains targets for tissue-specific micro-RNAs in genes essential for viral replication or wherein the tropism- restrictive vector has an epithelial, central nervous system (CNS), or macrophage deficient tropism, or a combination thereof.
10. The recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 9, wherein the RhCMV or HCMV vaccine vector has a deletion in a gene region non-essential for growth in vivo.
11. The recombinant RhCMV or HCMV vaccine vector of claim 10, wherein the gene region is selected from the group consisting of the RLl l family, the pp65 family, the US 12 family, and the US28 family.
12. The recombinant RhCMV vaccine vector of claim 11, wherein the RhCMV gene region is selected from the group consisting of Rhl3-Rh29, Rhl l l-Rhl l2, Rhl91-Rh202, and Rh214- Rh220, or wherein the RhCMV gene region is selected from the group consisting of Rhl3.1, Rhl9, Rh20, Rh23, Rh24, Rhl l2, Rhl90, Rhl92, Rhl96, Rhl98, Rhl99, Rh200, Rh201, Rh202, and Rh220.
13. The recombinant HCMV vaccine vector of claim 11, wherein the HCMV gene region is selected from the group consisting of RLl l, UL6, UL7, UL9, ULl l, UL83 (pp65), US 12, US 13, US 14, US17, US18, US19, US20, US21 , and UL28.
14. The recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 13, wherein the vector comprises a deletion in a RhCMV or HCMV gene that is essential for replication within a host, dissemination within a host, or spreading from host to host.
15. The recombinant RhCMV or HCMV vaccine vector of claim 14, wherein the essential gene is UL94, UL32, UL99, UL115, or UL44, or a homolog thereof.
16. The recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 15, wherein the vector comprises a deletion in gene UL82/pp71 or a homolog thereof.
17. The recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 16, wherein the vector further comprises a second nucleic acid sequence encoding US2, US3, or
US6, or a homolog thereof, wherein the vector does not encode a functional US11.
18. The recombinant RhCMV or HCMV vaccine vector of claim 17, wherein the second nucleic acid sequence encodes US2, US3, and US6.
19. The recombinant RhCMV or HCMV vaccine vector of claim 17 or claim 18, wherein the nucleic acid encoding a US11 open reading frame is deleted.
20. The recombinant RhCMV or HCMV vaccine vector of any one of claims 17 to 19, further comprising a third nucleic acid sequence encoding US 11 , and wherein the nucleic acid sequence encoding US 11 comprises a point mutation, a frameshift mutation, and/or a deletion of one or more nucleotides of the nucleic acid sequence encoding US 11.
21. The recombinant RhCMV or HCMV vaccine vector of claim 20, wherein the vector lacks the tegument protein pp65.
22. The recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 21, wherein the vector does not express an active UL130 protein.
23. The recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 22, wherein the RhCMV vaccine vector is Rh68-1 or Rh68-1.2.
24. The recombinant RhCMV or HCMV vaccine vector of claim 3 further comprising a microRNA recognition element (MRE) operably linked to a CMV gene that is essential or augmenting for CMV growth, and wherein the MRE silences expression in the presence of a microRNA that is expressed by a cell of myeloid lineage.
25. A pharmaceutical composition comprising the recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 24, or the Mtb antigen or claim 1 or claim 2, and a
pharmaceutically acceptable carrier.
26. A recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 24 for use in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection or for eliciting an immune response to a Mtb antigen.
27. A recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 24 for use in treating or preventing a Mycobacterium tuberculosis infection or for eliciting an immune response to a Mtb antigen.
28. Use of a recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 24 the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection or for eliciting an immune response to a Mtb antigen.
29. Use of a recombinant RhCMV or HCMV vaccine vector of any one of claims 3 to 24 for treating or preventing a Mycobacterium tuberculosis infection or for eliciting an immune response to a Mtb antigen.
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201662353432P | 2016-06-22 | 2016-06-22 | |
US62/353,432 | 2016-06-22 | ||
US201762478099P | 2017-03-29 | 2017-03-29 | |
US62/478,099 | 2017-03-29 | ||
PCT/US2017/038439 WO2017223146A1 (en) | 2016-06-22 | 2017-06-21 | Recombinant cytomegalovirus vectors as vaccines for tuberculosis |
Publications (2)
Publication Number | Publication Date |
---|---|
AU2017280065A1 AU2017280065A1 (en) | 2019-02-07 |
AU2017280065B2 true AU2017280065B2 (en) | 2021-07-01 |
Family
ID=60783577
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2017280065A Active AU2017280065B2 (en) | 2016-06-22 | 2017-06-21 | Recombinant cytomegalovirus vectors as vaccines for tuberculosis |
Country Status (7)
Country | Link |
---|---|
US (3) | US11091775B2 (en) |
EP (1) | EP3474889A4 (en) |
CN (1) | CN109843321A (en) |
AU (1) | AU2017280065B2 (en) |
CA (1) | CA3028827A1 (en) |
WO (1) | WO2017223146A1 (en) |
ZA (1) | ZA201900043B (en) |
Families Citing this family (15)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ES2788198T3 (en) | 2010-05-14 | 2020-10-20 | Univ Oregon Health & Science | Recombinant hCMV and hCMV vectors encoding a heterologous antigen isolated from hepatitis B virus and uses thereof |
LT2691530T (en) | 2011-06-10 | 2018-08-10 | Oregon Health & Science University | Cmv glycoproteins and recombinant vectors |
US10357555B2 (en) * | 2012-07-10 | 2019-07-23 | Transgene Sa | Mycobacterial antigen vaccine |
AU2015289560B2 (en) | 2014-07-16 | 2018-09-27 | Oregon Health & Science University | Human cytomegalovirus comprising exogenous antigens |
EP3256595A4 (en) | 2015-02-10 | 2018-09-26 | Oregon Health & Science University | Methods and compositions useful in generating non canonical cd8+ t cell responses |
CN116926128A (en) | 2015-11-20 | 2023-10-24 | 俄勒冈健康与科学大学 | CMV vectors comprising microRNA recognition elements |
BR112019007982A2 (en) | 2016-10-18 | 2019-07-02 | Univ Oregon Health & Science | cytomegalovirus vectors eliciting t cells restricted by histocompatibility complex molecules and major |
CN111655281A (en) * | 2018-01-26 | 2020-09-11 | 加利福尼亚大学董事会 | Intranasal delivery of vaccines containing cyclodipeptide adjuvants for tuberculosis |
EP3762025A4 (en) * | 2018-03-09 | 2021-12-01 | The Regents of the University of California | Cmv vectors and uses thereof |
AU2019260805A1 (en) * | 2018-04-26 | 2020-11-26 | Children's National Medical Center | Mycobacterial antigen compositions and methods of use |
JP2022536122A (en) * | 2019-06-07 | 2022-08-12 | オレゴン ヘルス アンド サイエンス ユニバーシティ | Tumor-associated antigen-specific T cell response |
MX2022002154A (en) * | 2019-08-20 | 2022-03-17 | Univ Oregon Health & Science | Modulation of t cell responses by ul18 of human cytomegalovirus. |
WO2023034801A1 (en) | 2021-08-31 | 2023-03-09 | Vir Biotechnology, Inc. | Recombinant hcmv vectors and uses thereof |
TW202328167A (en) * | 2021-08-31 | 2023-07-16 | 美商維爾生物科技股份有限公司 | Tuberculosis vaccines |
CN114272364B (en) * | 2021-12-22 | 2024-06-18 | 中国人民解放军总医院第八医学中心 | Mycobacterium tuberculosis tandem DNA vaccine W541 and preparation method and application thereof |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20110117133A1 (en) * | 2007-11-27 | 2011-05-19 | Avigdor Shafferman | Novel Recombinant BCG Tuberculosis Vaccine Designed to Elicit Immune Responses to Mycobacterium Tuberculosis in all Physiological Stages of Infection and Disease |
US20140377300A1 (en) * | 2013-06-25 | 2014-12-25 | Aeras Global Tb Vaccine Foundation | Tuberculosis Compositions And Methods Of Using The Same |
WO2017218867A1 (en) * | 2016-06-16 | 2017-12-21 | Aeras | Tuberculosis compositions and methods of treating or preventing tuberculosis |
Family Cites Families (36)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5593873A (en) | 1986-01-27 | 1997-01-14 | Syntro Corporation | Recombinant infectious bovine rhinotracheitis virus |
US5731188A (en) | 1986-11-20 | 1998-03-24 | Syntro Corporation | Recombinant equine herpesviruses |
US6410033B1 (en) | 1987-07-27 | 2002-06-25 | Syntro Corporation | Recombinant infectious bovine rhinotracheitis virus |
GB8918616D0 (en) | 1989-08-15 | 1989-09-27 | Univ Glasgow | Herpes simplex virus type 1 mutant |
US5874279A (en) | 1991-07-18 | 1999-02-23 | Syntro Corporation | Recombinant infectious bovine rhinotracheitis virus |
US6913751B2 (en) | 1992-06-12 | 2005-07-05 | Schering-Plough Veterinary Corporation | Recombinant avian herpesvirus useful in vaccine production |
US5853733A (en) | 1993-02-26 | 1998-12-29 | Syntro Corporation | Recombinant herpesvirus of turkeys and uses thereof |
US5741696A (en) | 1992-08-07 | 1998-04-21 | Syntro Corporation | Recombinant equine herpesviruses |
US5334498A (en) | 1992-08-18 | 1994-08-02 | Arch Development Corporation | Herpes simplex virus 1 UL13 gene product: methods and compositions |
AU675702B2 (en) | 1993-01-26 | 1997-02-13 | Leslie R. Coney | Compositions and methods for delivery of genetic material |
US5593972A (en) | 1993-01-26 | 1997-01-14 | The Wistar Institute | Genetic immunization |
US6875856B2 (en) | 1993-09-24 | 2005-04-05 | Syntro Corporation | Recombinant infectious laryngotracheitis virus and uses thereof |
FR2719056B1 (en) | 1994-04-20 | 1996-09-06 | Rhone Merieux | Herpesvirus transformed to express gD in vitro. |
US5846806A (en) | 1994-07-29 | 1998-12-08 | American Cyanamid Company | Identification of a human cytomegalovirus gene region involved in down-regulation of MHC class I heavy chain expression |
GB9415319D0 (en) | 1994-07-29 | 1994-09-21 | Medical Res Council | HSV viral vector |
US5736524A (en) * | 1994-11-14 | 1998-04-07 | Merck & Co.,. Inc. | Polynucleotide tuberculosis vaccine |
US5962428A (en) | 1995-03-30 | 1999-10-05 | Apollon, Inc. | Compositions and methods for delivery of genetic material |
FR2747046B1 (en) | 1996-04-05 | 1998-06-19 | Univ Paris Curie | NEW PLASMOVIRUS VACCINES |
WO1998004285A1 (en) | 1996-07-31 | 1998-02-05 | Ortho Pharmaceutical Corporation | Identification of human cytomegalovirus genes involved in down-regulation of mhc class i heavy chain expression |
US6103531A (en) | 1998-02-13 | 2000-08-15 | Ohio State Research Foundation | Methods of disrupting interferon signal transduction pathways |
AUPQ171999A0 (en) | 1999-07-20 | 1999-08-12 | University Of Sydney, The | Neurotropic virus transport |
EP1364037A4 (en) | 2001-02-02 | 2005-08-03 | Chemocentryx Inc | Methods and compositions useful for stimulating an immune response |
WO2002076216A1 (en) | 2001-03-27 | 2002-10-03 | Medigene, Inc. | Viral vectors and their use in therapeutic methods |
CA2589204C (en) | 2004-12-01 | 2013-10-29 | Aeras Global Tb Vaccine Foundation | Recombinant bcg strains with enhanced ability to escape the endosome |
US20090304750A1 (en) * | 2005-12-15 | 2009-12-10 | David Hone | Novel prime-boost combinations of attenuated mycobacterium |
DK2136836T3 (en) | 2007-04-04 | 2017-04-10 | Infectious Disease Res Inst | Immunogenic compositions with mycobacterium tuberculosis polypeptides and fusions thereof |
ES2788198T3 (en) * | 2010-05-14 | 2020-10-20 | Univ Oregon Health & Science | Recombinant hCMV and hCMV vectors encoding a heterologous antigen isolated from hepatitis B virus and uses thereof |
LT2691530T (en) * | 2011-06-10 | 2018-08-10 | Oregon Health & Science University | Cmv glycoproteins and recombinant vectors |
US10703784B2 (en) | 2011-09-30 | 2020-07-07 | La Jolla Institute For Allergy And Immunology | Antigens and epitopes derived from Mycobacterium tuberculosis |
US10357555B2 (en) | 2012-07-10 | 2019-07-23 | Transgene Sa | Mycobacterial antigen vaccine |
EP2912056B1 (en) | 2012-10-23 | 2020-02-12 | Statens Serum Institut | M. tuberculosis vaccines |
US20160228528A1 (en) | 2013-01-28 | 2016-08-11 | Janssen Sciences Ireland Uc | A single or multistage mycobacterium avium subsp. paratuberculosis subunit vaccine |
US9809801B2 (en) * | 2013-03-15 | 2017-11-07 | Université De Genève | Anti-mycobacterial vaccines |
EP3092000A1 (en) * | 2014-01-09 | 2016-11-16 | Transgene SA | Fusion of heterooligomeric mycobacterial antigens |
BR112016023778A2 (en) | 2014-04-24 | 2017-10-17 | Statens Seruminstitut | antigen fusion or cocktail protein, use of an antigen fusion or cocktail protein, vaccine, and method for immunizing an animal, including a human, against tuberculosis caused by virulent mycobacteria |
CN116926128A (en) * | 2015-11-20 | 2023-10-24 | 俄勒冈健康与科学大学 | CMV vectors comprising microRNA recognition elements |
-
2017
- 2017-06-21 WO PCT/US2017/038439 patent/WO2017223146A1/en unknown
- 2017-06-21 EP EP17816104.8A patent/EP3474889A4/en active Pending
- 2017-06-21 CN CN201780050396.2A patent/CN109843321A/en active Pending
- 2017-06-21 US US15/628,921 patent/US11091775B2/en active Active
- 2017-06-21 AU AU2017280065A patent/AU2017280065B2/en active Active
- 2017-06-21 CA CA3028827A patent/CA3028827A1/en active Pending
-
2019
- 2019-01-03 ZA ZA2019/00043A patent/ZA201900043B/en unknown
-
2021
- 2021-07-01 US US17/365,509 patent/US11834669B2/en active Active
-
2023
- 2023-10-27 US US18/496,076 patent/US20240150789A1/en active Pending
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20110117133A1 (en) * | 2007-11-27 | 2011-05-19 | Avigdor Shafferman | Novel Recombinant BCG Tuberculosis Vaccine Designed to Elicit Immune Responses to Mycobacterium Tuberculosis in all Physiological Stages of Infection and Disease |
US20140377300A1 (en) * | 2013-06-25 | 2014-12-25 | Aeras Global Tb Vaccine Foundation | Tuberculosis Compositions And Methods Of Using The Same |
WO2017218867A1 (en) * | 2016-06-16 | 2017-12-21 | Aeras | Tuberculosis compositions and methods of treating or preventing tuberculosis |
Non-Patent Citations (2)
Title |
---|
HANSEN, S.G. et al., 'Broadly targeted CD8+ T cell responses restricted by major histocompatibility complex E', Science, 2016, vol. 351, no. 6274, pages 714-720 * |
LANGERMANS J A M ET AL, VACCINE, ELSEVIER, AMSTERDAM, NL, vol. 23, no. 21, ISSN 0264-410X, (2005-04-15), pages 2740 - 2750, (2005-04-15) * |
Also Published As
Publication number | Publication date |
---|---|
US20210403951A1 (en) | 2021-12-30 |
ZA201900043B (en) | 2022-04-28 |
AU2017280065A1 (en) | 2019-02-07 |
WO2017223146A1 (en) | 2017-12-28 |
US11834669B2 (en) | 2023-12-05 |
US20180016599A1 (en) | 2018-01-18 |
US20240150789A1 (en) | 2024-05-09 |
EP3474889A1 (en) | 2019-05-01 |
CN109843321A (en) | 2019-06-04 |
EP3474889A4 (en) | 2020-04-29 |
US11091775B2 (en) | 2021-08-17 |
CA3028827A1 (en) | 2017-12-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11834669B2 (en) | Recombinant cytomegalovirus vectors as vaccines for tuberculosis | |
JP6816031B2 (en) | Methods and compositions useful for generating non-standard CD8 + T cell responses | |
Sung et al. | Update on the current status of cytomegalovirus vaccines | |
Karrer et al. | Expansion of protective CD8+ T-cell responses driven by recombinant cytomegaloviruses | |
US11684668B2 (en) | Replication-defective adenoviruses comprising nucleic acids encoding SARS-CoV-2 s glycoprotein and modified N protein comprising an endosomal targeting sequence | |
AU2019250180A1 (en) | CMV glycoproteins and recombinant vectors | |
US20130156808A1 (en) | Vaccine comprising beta-herpesvirus | |
JP2009529576A (en) | Vaccines against viruses that cause persistent or latent infections | |
EP4056687A1 (en) | F-genotype mumps virus attenuated strain and construction method therefor and application thereof | |
WO2008121329A2 (en) | Turkey herpesvirus vectored recombinant containing avian influenza genes | |
JP6117781B2 (en) | Cross-protective arenavirus vaccines and methods for their use | |
US11925685B2 (en) | DNA antibody constructs encoding anti-ZIKV envelope antibodies | |
JP2016501023A (en) | Conditionally replicating viral vectors | |
US20220016234A1 (en) | Anti covid-19 therapies using nucleocapsid and spike proteins | |
JP2022504624A (en) | Epstein-Barr virus-like particles with enlarged antigenic spectrum | |
Choi et al. | Guinea pig cytomegalovirus protective T cell antigen GP83 is a functional pp65 homolog for innate immune evasion and pentamer-dependent virus tropism | |
AU2022339765A1 (en) | Recombinant hcmv vectors and uses thereof | |
US20220257748A1 (en) | Hepatitis b virus-specific t cell responses | |
CN112426523A (en) | Pig vaccine containing antiviral composition and application | |
Fazel et al. | Efficacy and tolerability of an mRNA vaccine expressing gB and pp38 antigens of Marek’s disease virus in chickens | |
US20240075129A1 (en) | Anti COVID-19 Therapies targeting nucleocapsid and spike proteins | |
Antony | Immunobiological Correlates of SIV Vaccine Vectors and Macaque Tropism | |
KR20240049802A (en) | tuberculosis vaccine | |
Russell | Construction of a Simian Immunodeficiency Virus Vaccine from Cynomolgus Macaque Cytomegalovirus | |
WO2013126469A1 (en) | Chimeric dna vaccine compositions and methods of use |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PC1 | Assignment before grant (sect. 113) |
Owner name: OREGON HEALTH AND SCIENCE UNIVERSITY Free format text: FORMER APPLICANT(S): OREGON HEALTH AND SCIENCE UNIVERSITY; AERAS Owner name: INTERNATIONAL AIDS VACCINE INITIATIVE, INC. Free format text: FORMER APPLICANT(S): OREGON HEALTH AND SCIENCE UNIVERSITY; AERAS |
|
FGA | Letters patent sealed or granted (standard patent) |