AU2016216675A1 - Protease resistant mmutants of stromal cell derived factor-1 in the repair of tissue damage - Google Patents

Protease resistant mmutants of stromal cell derived factor-1 in the repair of tissue damage Download PDF

Info

Publication number
AU2016216675A1
AU2016216675A1 AU2016216675A AU2016216675A AU2016216675A1 AU 2016216675 A1 AU2016216675 A1 AU 2016216675A1 AU 2016216675 A AU2016216675 A AU 2016216675A AU 2016216675 A AU2016216675 A AU 2016216675A AU 2016216675 A1 AU2016216675 A1 AU 2016216675A1
Authority
AU
Australia
Prior art keywords
seq
sdf
msdf
peptide
peptides
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
AU2016216675A
Inventor
Richard Lee
Vincent Segers
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Brigham and Womens Hospital Inc
Original Assignee
Brigham and Womens Hospital Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from AU2013234365A external-priority patent/AU2013234365B2/en
Application filed by Brigham and Womens Hospital Inc filed Critical Brigham and Womens Hospital Inc
Priority to AU2016216675A priority Critical patent/AU2016216675A1/en
Publication of AU2016216675A1 publication Critical patent/AU2016216675A1/en
Abandoned legal-status Critical Current

Links

Landscapes

  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The present invention is directed stromal cell derived factor-1 peptides that have been mutated to make them resistant to digestion by the proteases dipeptidyl peptidase IV (DPPIV) and matrix metalloproteinase-2 (MMP-2) but which maintain the ability of native SDF-I to attract T cells. The mutants may be attached to membranes formed by self-assembling peptides and then implanted at sites of tissue damage to help promote repair.

Description

Pr©tt©a§© R©§5§ttanntt Munttannte ©f Stfrromal Csflfl ©erivedl Factor-1 inn ttDne Repair of Tissnne KDammag©
Cross Meffereme® ¢0 Relatted AppicaHnonns
The present application claims priority to, and the benefit of, United States provisional applications 60/929,353, filed on June 22, 2007, and 60/853,441, filed on October 23, 2006. The contents of these previous applications is hereby incorporated by reference in its entirety.
Field off tine Imvennitioini
The present invention is directed to stromal cell derived factor-1 (SDF-1) peptides that have been mutated in a manner that preserves their ability to attract cells but which makes them resistant to inactivation by proteases, particularly matrix metalloproteinase-2 (MMP-2) and/or dipeptidyl peptidase IV (DPPIV/CD26). When delivered to damaged tissue, these mutants promote tissue repair. The peptides should also be useful in the treatment of many conditions, including ulcers in the gastrointestinal tract or elsewhere, wounds resulting from accident, surgery or disease; and cardiac tissue damaged as the result of a myocardial infarction. The peptides should also be useful in treating diabetic patients to make them less susceptible to damage caused by wounds, ulcers or lesions. In an especially preferred embodiment, the mutated forms of SDF-1 are delivered to damaged tissue using a membrane formed by self-assembling peptides.
Backgroimimdl off nine Imveimilioini
Stromal cell derived factor-1 (SDF-1, or CXCL12) is a 68 amino acid member of the chemokine family which attracts resting T-lymphocytes, monocytes and CD34+ stem cells. It is commonly found in two different forms SDF-Ια and SDF-Ιβ which are the result of differential mRNA splicing (US 5,563,048). These forms are essentially the same except that SDF-1 β is extended by four amino acids (-Arg-Phe-Lys-Met) at the C terminus. Both forms of SDF-1 are initially made with a signal peptide, 21 amino acids in length, that is cleaved to make the active peptide (US 5,563,048). For the purposes of the present invention, it will be understood that the term "SDF-1" refers to the active form of the peptide, i.e., after cleavage of the signal peptide, and encompasses both SDF-Ια and SDF-Ιβ.
It has also been shown that the full length, 68 amino acid, SDF-1 sequence is not needed for activity. Peptides that have at least the first eight N-terminal residues of SDF-1 maintain the receptor binding and bioactivity of the full peptide, albeit at a reduced potency. For example, SDF-1, 1-8, 1-9, 1-9 dimer, and 1-17 induce intracellular calcium and chemotaxis in T lymphocytes and CEM cells and bind to CXC chemokine receptor 4 (CXCR4). However, native SDF-1 has half-maximal chemoattractant activity at 5 nM, whereas the 1-9 dimer requires 500 nM and is therefore 100-fold less potent The 1-17 and a 1-9 monomer analogs are 400- and 3600-fold, respectively, less potent than SDF-1. SDF-1 variants with C-terminal cyclization have been described that have a higher CXCR4 receptor binding affinity and cyclization of this type may, if desired, be used in connection with the peptides described herein. For the purposes of the present invention, the term SDF-1 will include forms of the peptide that have been truncated at the C terminal end but which maintain SDF-1 biological activity, i.e., which are chemotactic for T lymphocytes and CEM cells and which bind to CXC chemokine receptor 4 (CXCR4). At a minimum, these truncated forms include the first eight amino acids at the N-terminal aid of the peptide. SDF-1 plays a key-role in the homing of hematopoietic stem cells to bone marrow during embryonic development (Nagasawa, et al., Nature 382:635-638 (1996); Zou, et al., Nature 393:595-599 (1998)) and after stem cell transplantation (Lapidot, et al., Blood 706:1901-1910 (2005)). In addition to its role in stem cell homing, SDF-1 is also important in cardiogenesis and vasculogenesis. SDF-1 deficient mice die perinatally and have defects in cardiac ventricular septal formation, bone marrow hematopoiesis and organ-specific vasculogenesis (Nagasawa, et al., Nature 382:635-638 (1996); Zou, et al., Nature 393:595-599 (1998)). It has also been reported that abnormally low levels of SDF-1 are at least partially responsible for the impaired wound healing associated with diabetic patients and that impairment can be reversed by the administration of this cytokine at the site of tissue damage (Gallagher, et al., J. Clin. Invest. 777:1249-1259(2007)).
In the normal adult heart, SDF-1 is expressed constitutively, but expression is upregulated within days after myocardial infarction (Pillarisetti, et al., Inflammation 25:293-300 (2001)). Askari et al. increased SDF-1 expression 8 weeks after myocardial infarction by intramyocardial transplantation of stably transfected cardiac fibroblasts overexpressing SDF-1 in combination with G-CSF therapy (Lancet 362:697-703 (2003)). This was associated with higher numbers of bone marrow stem cells (c-Kit or CD34 positi ve) and endothelial cells in the heart and resulted in an increase of vascular density and an improvement of left ventricular function. These studies suggest that the insufficiency of the naturally-occurring myocardial repair process may be in part due to inadequate SDF-1 availability. Hence, die delivery of SDF-1 in a controlled manner after myocardial infarction may attract more progenitor cells and thereby promote tissue repair (Penn, et al., Int. J. Cardiol. 95(Suppl. 1):S23-S25 (2004)). Apart from this, the administration of SDF-1 may be used to improve the healing of wounds or ulcers in patients, especially those with diabetes.
One way that may be used for the sustained delivery of drugs at a site of tissue damage is through the use of biologically compatible membranes. Certain peptides are capable of self-assembly when incubated in the presence of a low concentration of monovalent metal cation (U.S. 5,670,483; U.S. 6,548,630). Assembly results in the formation of a gel-like membrane that is non-toxic, non-immunogenic and relatively stable to proteases. Once formed, membranes are stable in serum, aqueous solutions and cell culture medium. They can be made under sterile conditions, are capable of supporting the growth of cells and are slowly digested when implanted in an animal’s body. These characteristics make the membranes well suited as devices for the delivery of therapeutic agents (US 20060148703 and 20060088510).
Summary off ttDn® Imvemulnonn
The present invention is based, in part, on experiments that had as their hypothesis that the beneficial effect of stromal cell derived factor-1 (SDF-1) in the recovery of damaged cardiac tissue is limited by high concentrations of the protease matrix metalloproteinase-2 (MMP-2) present in such tissue. More specifically, it was proposed that the MMP-2 cleaves SDF-1 and thereby eliminates its ability to attract progenitor cells to the site of tissue damage.
In order to test this hypothesis, the inventors developed mutated forms of SDF-1 that retain their ability to attract T cells but which are resistant to MMP-2 digestion. The mSDF-1 peptides were attached to a specially designed membrane formed by selfassembling peptides and then tested in an animal model of cardiac damage. It was found that mSDF-1 attached to membranes and implanted into the myocardium of test animals improved cardiac recovery to a greater extent than either SDF-1 or mSDF-1 that was not attached to membranes.
In addition, the inventors found that truncated forms of SDF-1 maintain bioactivity and, as with the full length peptide, mutations in the fourth or fifth amino acids protect the peptide from protease digestion.
In its first aspect, the invention is directed to mutant forms of SDF-1 (mSDF-1) which are characterized by a change in the fourth and/or the fifth amino acid from the N-terminus of unmutated SDF-1 (KP VSJLS YEC PC RFFESH VARAN VKHLK ILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK (SEQ ID NO:52)). Thus, the fourth amino acid is changed to an amino acid other than S and/or the fifth amino acid is changed to an amino acid other than L. As discussed above, truncated forms of the full length SDF-1 peptide maintain biological activity provided that the first eight amino acids (highlighted in the sequence shown above) are present and these truncated forms may also be made protease resistant by mutating the fourth and/or fifth position. The invention includes these biologically active truncated mutants as well. Put another way, the invention includes peptides comprising the amino acid sequence of at least amino acids 1-8 of SEQ ID NO:52, which are optionally extended at the C terminus by all or any portion of the remaining sequence of SEQ ID NQ:52, shown as amino acids 9-68. In all cases, the peptide will have a sequence corresponding to that given in SEQ ID NO:52 except that there will be a proteinogenic amino acid other than S at position 4 and/or a proteinogenic amino other than L at position 5.
For the purposes of the present invention, all peptide sequences are written from the N terminus (far left) to the C terminus (far right) and unless otherwise indicated, all amino acids are “proteinogenic” amino acids, i.e., they are the L-isomers of: alanine (A); arginine (R); asparagine (N); aspartic acid (D); cysteine (C); glutamic acid (E); glutamine (Q); glycine (G); histidine (H); isoleucine (I); leucine (L); lysine (K); methionine (M); phenylalanine (F); proline (P); serine (S); threonine (T); tryptophan (W); tyrosine (Ϋ); or valine (V). Mutant SDF-1 peptides may be abbreviated herein as “mSDF-1,” “mSDF” or SDF(NqN’) where N is the one letter designation of the amino acid originally present, q is its position from the N terminus of the peptide and Ν’ is the amino acid that has replaced N.
It will also be understood that, although SEQ ID NO:52 shows the intact lull length sequence of SDF-Ια, this sequence may be extended at the C terminus by up to four more amino acids, in particular with the sequence -R-F-K-M. Thus, the invention includes mutant forms of both SDF-Ια and SDF-Ιβ (see US 5,563,048). In some instances, peptides that have been mutated by the addition of amino acids at the N terminus are abbreviated as "Xp-R" where X is a proteinogenic amino acid, p is an integer and R is the peptide prior to extension. It will also be understood that, unless otherwise indicated, all pharmaceutically acceptable forms of peptides may be used, including all pharmaceutically acceptable salts.
The mSDF-1 peptides must maintain chemoattractant activity with a sensitivity (as determined by, e.g., the effective concentration needed to obtain 50% of maximal response in the assays of Jurkat T cell migration described herein) of at least 1/10 the sensitivity of unmutated SDF-1. In addition, the mSDF-1 peptides must be resistant to loss of this chemoattractant activity due to cleavage by matrix metalloproteinase-2 (MMP-2). Preferably the rate of inactivation of mSDF-1 is less than Vi (and more preferably, less than lA or 1/10) the rate of inactivation of SDF-1.
In one embodiment, the mSDF-1 peptide has the sequence: KPVXLSYRCPC RFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCID PKLKWIQEYLEKALNK (SEQ ID NO:53) where X is any of the 20 proteinogenic amino acids except S. The most preferred of these peptides is SDF(S4V) which has the sequence: KP V VLS YRCPCRFFESH VAR AN VKHLKILN TPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK (SEQ ID NO:54). SEQ ID 53 and 54 show the full sequence of SDF-1 peptides. However, it will be understood that truncated versions of the peptides will maintain activity as long as the first eight N-terminus amino acids are present. These are also part of the invention and may be made protease resistant by mutating the amino acids at positions 4 and/or 5.
In another embodiment, the mSDF-1 peptide has the sequence: KPVSXSYRC PCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVC IDPKLKWIQEYLEKALNK (SEQ ID NO:55) where X is any of the 20 proteinogenic1 amino acids except L, W or E. The most preferred of these peptides is SDF(L5P) which has the sequence: KPVSPS YRCPCRFFESH VARAN VKH LKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKAL N K (SEQ ID NO:56). Again, peptides that are truncated and which have at least the first eight amino acids of SEQ ID NO:55 or 56 are included in the invention. They may be extended at the C terminus by additional amino acids from the sequences shown above.
The longest mSDF-1 peptides presented above are 68 amino acids in length. However, unless otherwise indicated, it will also be understood that one additional proteinogenic amino acid may be added to the N terminus without substantially changing chemoattractant activity or MMP-2 resistance. Moreover, the addition of an amino acid at the N terminus represents a preferred embodiment since this will have the effect of making the peptide resistant to digestion by a second common peptidase, dipeptidyl peptidase IV (DPPIV/CD26, abbreviated herein as "DPPIV"). DPPIV is a 110-kD glycoprotein which is expressed in renal proximal tubules, in intestinal epithelial cells, liver, placenta and lung and which cleaves peptides that have a proline in the second position from the N terminus (Kikawa, et al, Biochim. Biophys. Acta 7757:45-51 (2005)). SDF-1 has a proline in the second position (as can be seen above in SEQ ID NO:52) and is therefore cleaved by DPPIV between this proline and the following valine (Narducci, et al., Blood 707:1108-1115 (2006); Christopherson, Exp. Hematol. 34:1060-1068 (2006)).
One way to eliminate the proteolytic effect of DPPIV would be to change the proline in position 2 of SDF-1 (see SEQ ID NO:52). However, this proline is essential for SDF-l's biological activity and therefore cannot be replaced and maintain a therapeutically effective peptide. However, activity can be maintained and a DPPIV resistant peptide made by adding one to four amino acids (or an organic group) to the N terminus of SEQ ID:52. For example, it has been experimentally found that resistance to DPPIV cleavage can be obtained by adding a serine to the N terminus of the peptide.
Thus, in another aspect, the invention is directed to the peptide XP-SDF-1, where X is preferably, any proteinogenic amino acid, p is an integer between 1 and 4, and SDF-1 is as shown in SEQ ID NO:52. In preferred embodiments, n=l. It will be understood that when p is greater than 1, each of the 2-4 added amino acids may independently be chosen from any of the proteinogenic amino acids described herein, i.e., any of these proteinogenic amino acids may be in the first position, any in the second position, etc. SDF-1 may also be made resistant to DPPIV by adding a "protease protective organic group" to the N-terminus. A "protease protective organic group" is defined herein as an organic group, other than a proteinogenic amino acid, that, when added to the N terminal amino acid of SDF-1, results in a modified peptide that maintains at least 10% (and preferably at least 50% or 80%) of the chemoattractant activity of unmodified SDF-1 (as determined by, e.g., assays of Juikat T cell migration described herein) and which, in addition, is inactivated by DPPIV at a rate of less than 50% (and more preferably, at a rate of less than 25% or 10%) the rate of inactivation of unmodified SDF-1. For example, X may be: R!-(CH2)d-, where d is an integer from 0-3, and R1 is selected from: hydrogen (with the caveat that when R1 is hydrogen, d must be at least 1); a branched or straight C1-C3 alkyl; a straight or branched C2-C3 alkenyl; a halogen, CF3; -CONR5R4; -COOR5; -COR5; -(CH2)qNR5R4; -(CH2)qSOR5; -(CH2)qS02R5, -(CH2)qSC>2NR5R4; and OR5, where R4 and R5 are each independently hydrogen or a straight or branched C1-C3 alkyl. In instances where an organic group is used for X, p should be 1. In addition, X may represent a proteinogenic amino acid as discussed above, so that 1-4 amino acids are added to SDF-1, and one or more of these added amino acids may be substituted with a protease protective organic group.
In the formula XP-SDF-1, SDF-1 may optionally include any of the mutations in positions 4 and/or 5 of SEQ ID NO:52 as described above. Thus, the invention encompasses peptides of the form Xp-mSDF-l, where X and p are as defined above and mSDF-1 is selected from: SEQ ID NO:53; SEQ ID NO:54; SEQ ID NO:55; and SEQ ID NO:56. These doubly mutated peptides will be resistant to both DPPIV and MMP-2.
The invention also encompasses fusion proteins in which any of the above mSDF-1, Xp-SDF-1 or Xp-mSDF-l sequences are linked to self-assembling peptides capable of forming a biologically compatible membrane. Membranes with attached protease resistant SDF-1 can be implanted in a patient at a site of tissue damage, especially cardiac tissue damage, wounds (whether accidental, surgical or the result of disease) or ulcers and will maintain the SDF-1 biological activity at that site for a prolonged period of time. Fusion proteins are formed either by joining the C terminal end of a protease resistant SDF-1 peptide directly to the N terminal end of a self-assembling peptide or the two peptides can be joined by a linker sequence. Thus, the invention includes fusion proteins of the formula: A-(L)n-(R)q , where n is an integer from 0-3, q is an integer from 1-3, A is one of the protease resistant SDF-1 peptides (i.e., mSDF-1, Xp-SDF-1 or Xp-mSDF-1) described above, L is a linker sequence 3-9 amino acids long, and R is a self-assembling peptide selected from the group consisting of: AKAKAEAEAKAKAEAE, (SEQIDNO:l); AKAEAKAEAKAEAKAE, (SEQIDNO:2); EAKAEAKAEAKAEAKA, (SEQIDNO:3); KAEAKAEAKAEAKAEA, (SEQIDNO:4); AEAKAEAKAEAKAEAK, (SEQIDNO:5); ADADARARADADARAR, (SEQ ID NO:6); ARADARADARADARAD, (SEQIDNO:7); DARADARADARADARA, (SEQIDNO:8); RADARADARADARADA, (SEQIDNO:9); ADARADARADARADAR, (SEQ ID NO: 10); ARADAKAEARADAKAE, (SEQ ID NO: 11); AKAEARADAKAEARAD, (SEQ ID NO: 12); ARAKADAEARAKADAE, (SEQ ID NO: 13); AKARAEADAKARADAE, (SEQ ID NO: 14); AQAQAQAQAQAQAQAQ, (SEQ ID NO: 15); VQVQVQVQVQVQVQVQ, (SEQ ID NO: 16); YQYQYQYQYQYQYQYQ, (SEQ ID NO: 17); HQHQHQHQHQHQHQHQ, (SEQ ID NO: 18); ANANANANANANANAN, (SEQ ID NO: 19); VNVNVNVNVNVNVNVN, (SEQ ID NO:20); YNYNYNYNYNYNYNYN, (SEQ ID NO:21); HNHNHNHNHNHNHNHN, (SEQ ID NO:22); ANAQANAQANAQANAQ, (SEQ ID NO:23); AQANAQANAQANAQAN, (SEQ ID NO:24); VNVQVNVQVNVQVNVQ, (SEQ ID NO:25); VQVNVQVNVQVNVQVN, (SEQ ID NO:26); YNYQYNYQYNYQYNYQ, (SEQ ID NO:27); YQYNYQYNYQYNYQYN, (SEQ ID NO:28); HNHQHNHQHNHQHNHQ, (SEQ ID NO:29); HQHNHQHNHQHNHQHN, (SEQ ID NO:30); AKAQADAKAQADAKAQAD, (SEQ ID NO:31); VKVQVDVKVQVDVKVQVD, (SEQ ID NO:32); YKYQYDYKYQYDYKYQYD, (SEQ ID NO:33); HKHQHDHKHQHDHKHQHD, (SEQ ID NO:34); RARADADARARADADA, (SEQ ID NO:35); RADARGDARADARGDA, (SEQ ID NO:36); RAEARAEARAEARAEA, (SEQ ID NO:37); KADAKADAKADAKADA, (SEQ ID NO:38); AEAEAHAHAEAEAHAH, (SEQ ID NO:39); FEFEFKFKFEFEFKFK, (SEQ ID NO:40); LELELKLKLELELKLK, (SEQ ID N0:41); AEAEAKAKAEAEAKAK, (SEQ ID NO:42); AEAEAEAEAKAK, (SEQ ID NO:43); KAKAKAKAEAEAEAEA, (SEQ ID NO:44); AEAEAEAEAKAKAKAK, (SEQ ID NO:45); RARARARADADADADA, (SEQ ID NO:46); ADADADADARARARAR, (SEQ ID NO:47); DADADADARARARARA, (SEQ ID NO:48); HEHEHKHKHEHEHKHK, (SEQ ID NO:49); VEVEVEVEVEVEVEVEVEVE, (SEQ ID NO:50); and RFRFRFRFRFRFRFRFRFRF, (SEQ ID N0:51).
The most preferred self-assembling peptide is: RARADADARARADADA, (SEQ ID NO:35) with q=l; and preferred protease resistant SDF-1 peptides are SDF(S4V) and XP -SDF(S4V), especially where p=l. When joined together, the resulting fusion proteins are, for convenience, abbreviated as SDF(S4V)-RAD or XP-SDF(S4V)-RAD. Preferred linker sequences occur when n=l and L is GGGGGG (abbreviated as “6G,” SEQ ID NO:57); GIVGPL (SEQ ID NO:58) and PVGLIG (SEQ ID NO:59). The lattermost represents an MMP-2 cleavage site (“MCS”). GIVGPL (SEQ ID NO:58) represents a scrambled version of MCS and is abbreviated as “SCR.” Surprisingly, this sequence was also found to undergo MMP-2 cleavage, although at a slower rate than MCS. Preferred, fusion proteins containing linker sequences are: SDF(S4V)-6G-RAD; XP-SDF(S4V)-6G-RAD; SDF(S4V)-MCS-RAD; XP-SDF(S4V)-MCS-RAD; SDF(S4V>SCR-RAD; and XP-SDF(S4V)-SCR-RAD. Again, p is preferably 1.
In another aspect, the invention is directed to nucleic acids comprising a nucleotide sequence encoding any of the protease resistant peptides or fusion proteins described above, vectors in which these nucleic acids are operably linked to a promoter sequence and host cells transformed with the vectors. The term "operably linked" refers to genetic elements that are joined in a manner that enables them to carry out their normal functions. For example, a sequence encoding a peptide is operably linked to a promoter when its transcription is under the control of the promoter and the transcript produced is correctly translated into the peptide.
Preferred nucleic acids encoding protease resistant SDF-1 peptides and fusion proteins include: aagcccgtcgtcctgagctacagatgcccatgccgattcttcgaaagccatgttgccagagccaacgtcaagcatctcaa aattctcaacactccaaactgtgcccttcagattgtagcccggctgaagaacaacaacagacaagtgtgcattgacccga agctaaagtggattcaggagtacctggagaaagctttaaacaag (SEQ ID NO:60); aagcccgtcgtcctgagctacagatgcccatgccgattcttcgaaagccatgttgccagagccaacgtcaagcatctcaa aattctcaacactccaaactgtgcccttcagattgtagcccggctgaagaacaacaacagacaagtgtgcattgacccga agctaaagtggattcaggagtacctggagaaagctttaaacaagtgaggaatcgtgggacctctgcgtgcccgtgccga cgccgacgcccgtgcccgtgccgacgccgacgcc (SEQ ID NO:61); aagcccgtcgtcctgagctacagatgcccatgccgattcttcgaaagccatgttgccagagccaacgtcaagcatctcaa aattctcaacactccaaactgtgcccttcagattgtagcccggctgaagaacaacaacagacaagtgtgcattgacccga agctaaagtggattcaggagtacctggagaaagctttaaacaagcctgtgggactgatcggagtgcccgtgccgacgcc gacgcccgtgcccgtgccgacgccgacgcc (SEQ ID NO:62); and aagcccgtcgtcctgagctacagatgcccatgccgattcttcgaaagccatgttgccagagccaacgtcaagcatctcaa aattctcaacactccaaactgtgcccttcagattgtagcccggctgaagaacaacaacagacaagtgtgcattgacccga agctaaagtggattcaggagtacctggagaaagetttaaaeaagggaggcgggggaggtgggcgtgcccgtgccgae gccgacgcccgtgcccgtgccgacgccgacgcc (SEQ ID NO:63)
In another aspect, the invention is directed to a biologically compatible membrane formed from self-assembling peptides as described in published US applications 20060148703 and 20060088510 which have mSDF-1, Xp-SDF-1 or Xp-mSDF-1 peptides attached. The term “biologically compatible” indicates that the membranes are non-toxic and can be implanted in a patient without triggering an immune response. Between 0.1% and 10% (and preferably 0.5-5%) of the peptides that assemble into the membrane are bound to a mutant SDF-1. Binding may be either covalent or noncovalent. Noncovalent bonding occurs when protease resistant SDF-1 peptides are simply trapped in the membrane matrix and when protease resistant SDF-1 peptides are bound to self-assembling peptides in the membrane by biotin/avidin linkages. As used herein, the term “avidin” is intended to include streptavidin as well. The membranes may, optionally, have other therapeutic agents, e.g., PDGF or interleukin-8, attached as well.
The use of biotin and avidin for linking molecules is well known in the art and standard methodology can be used for attaching protease resistant SDF-1 peptides to selfassembling peptides either before or after membrane formation. Specific methodology for using biotin/avidin in connection with self-assembling membranes has been described in US 20060088510 and this methodology can be applied to forming membranes with attached cytokine. In order to prevent steric interference between the biotin/avidin groups and protease resistant peptides, a spacer may be included between the two. The spacer can take the form of 1-15 (preferably 1-10) fatty acids or 1-15 (preferably 1-10) amino acids and should separate the protease resistant SDF-1 peptide from the self-assembling peptide by at least an additional 12 angstroms and by no more than an additional 250 angstroms. Methodology for incorporating spacers of this type is well known in the art. In a preferred embodiment, about 1% of the self-assembling peptides used in membranes are attached to protease resistant SDF-1. It is also preferable that the self-assembling peptides making up membranes be homogeneous, i.e., that all of the peptides are identical.
As an alternative, protease resistant SDF-1 peptides may be joined to a selfassembling peptide that is part of the membrane by a peptide bond, i.e., the protease resistant SDF-1 may be part of a fusion protein in which it is joined to a self-assembling peptide either directly or via an intervening linker amino acid sequence. Any of the fusion proteins described above may be used, with SDF(S4V)-6G-RAD; XP-SDF(S4V)-6G-RAD; SDF(S4V)-MCS-RAD; XP-SDF(S4V)-MCS-RAD; SDF(S4V)-SCR-RAD and Xp-SDF(S4V)-SCR-RAD being particularly preferred. The membranes are made from the fusion proteins (or from the self-assembling peptides) by taking advantage of the fact that the self-assembling peptides described herein do not congregate together in water, but assemble into a membrane in the presence of a low concentration of monovalent metal cation. Thus, for example, fusion proteins may be made under conditions in which self-assembly does not occur and then exposed to conditions that promote membrane formation, e.g., low monovalent metal cation concentration. The end result is a matrix which can be implanted into a patient and which will maintain a high concentration of SDF-1 biological activity at the site of implantation. Alternatively, the fusion proteins can be incorporated into an injectable pharmaceutical composition at a concentration of monovalent cation that is too low to induce self-assembly and can then administered to a patient to induce membrane formation in vivo.
The mutated SDF-1 peptides are resistant to cleavage by MMP-2 and/or DPPIV but maintain at least a portion (at least 10% and preferably more than 25%, 50% or 80%) of the chemoattractant activity of native SDF-1. Thus, they are ideally suited for use at sites, such as damaged cardiac tissue, where MMP-2 (or DPPIV) is present at a high concentration. In addition, an MMP-2 cleavage site can, if desired, be placed in linker regions joining the SDF-1 peptides to the self-assembling peptides. This will allow for the protease resistant SDF-1 peptides to be released from an implanted membrane over time.
The compositions described above should be useful in the treatment of any disease or condition characterized by high concentrations of MMP-2 and/or DPPIV where attraction of stem cells might induce regeneration or healing. This would include the treatment of inflammatory and ischemic diseases such as stroke, limb ischemia; wound healing: and diabetic ulcers. In an especially preferred embodiment, the invention is directed to a method of treating damaged cardiac tissue, for example subsequent to a heart attack, by injecting or implanting any of the biologically compatible peptide membranes or fusion proteins described above at or near the site of damage. Preferably, membranes will be injected or implanted directly into the damaged tissue, e.g., myocardium, of a patient. The membranes should be large enough to prevent the protease resistant SDF-1 from being washed away by bodily fluids and a sufficient amount of mSDF-1 should be present to promote the migration of T cells to the site of injury. Guidance with regard to these parameters is provided by the experiments described herein.
Description of tine Innvenntioii
The present invention is based upon the concept that the recovery of damaged tissue, e.g., damaged cardiac tissue, is promoted by exposing the tissue to SDF-1 that has been mutated to make it resistant to MMP-2 and/or DPPIV cleavage and which is delivered by means of a membrane formed by spontaneously assembling peptides. The self-assembling peptides have been described in US 5,670,483 and 6,548,630 (hereby incorporated by reference in their entirety). Methods of attaching factors to membranes and the use of the membranes in delivering therapeutic agents to cardiac tissue have also been described (see published US applications 20060148703 and 20060088510, hereby incorporated by reference in their entirety). The same procedures for making and using membranes may be applied to the present invention.
Description of Self-Assembling Peptides
The peptides used for self-assembly should be at least 12 residues in length and contain alternating hydrophobic and hydrophilic amino acids. Peptides longer than about 200 amino acids tend to present problems with respect to solubility and membrane stability and should therefore be avoided. Ideally, peptides should be about 12-24 amino acids in length.
The self-assembling peptides must be complementary. This means that the amino acids on one peptide must be capable of forming ionic bonds or hydrogen bonds with the amino acids on another peptide. Ionic bonds would form between acidic and basic amino acid side chains. The hydrophilic basic amino acids include Lys, Arg, His, and Om. The hydrophilic acidic amino acids are Glu and Asp. Ionic bonds would form between an acidic residue on one peptide and a basic residue on another. Amino acids that form hydrogen bonds are Asn and Gin. Hydrophobic amino acids that may be incorporated into peptides include Ala, Val, lie, Met, Phe, Tyr, Trp, Ser, Thr, and Gly.
Self-assembling peptides must also be “structurally compatible.” This means that they must maintain an essentially constant distance between one another when they bind. Interpeptide distance can be calculated for each ionized or hydrogen bonding pair by taking the sum of the number of unbranched atoms on the side-chains of each amino acid in the pair. For example, lysine has five and glutamic acid has four unbranched atoms on their side chains. An interaction between these two residues on different peptides would result in an interpeptide distance of nine atoms. In a peptide containing only repeating units of EAK, all of the ion pairs would involve lysine and glutamate and therefore a constant interpeptide distance would be maintained. Thus, these peptides would be structurally complementary. Peptides in which the variation in interpeptide distance varies by more than one atom (about 3-4 angstroms) will not form gels properly. For example, if two bound peptides have ion pairs with a nine-atom spacing and other ion pairs with a seven-atom spacing, the requirement of structural complementarity would not have been met. A full discussion of complementarity and structural compatibility may be found in U.S. 5,670,483 and 6,548,630.
It should also be recognized that membranes may be formed from either a homogeneous mixture of peptides or a heterogeneous mixture of peptides. The term “homogeneous” in this context means peptides that are identical with one another. “Heterogeneous” indicates peptides that bind to one another but which are structurally different. Regardless of whether homogenous or heterogeneous peptides are used, die requirements with respect to the arrangement of amino acids, length, complementarity, and structural compatibility apply. In addition, it should be recognized that the carboxyl and amino groups of the terminal residues of peptides can either be protected or not protected using standard groups.
Makine of Peptides
The self-assembling and protease resistant SDF-1 peptides of the present invention can be made by solid-phase peptide synthesis using standard N-tert-butyoxycarbonyl (t-Boc) chemistry and cycles using n-methylpyrolidone chemistry. Once peptides have been synthesized, they can be purified using procedures such as high pressure liquid chromatography on reverse-phase columns. Purity may also be assessed by HPLC and the presence of a correct composition can be determined by amino acid analysis. A purification procedure suitable for mSDF-1 peptides is described in the Examples section.
Fusion proteins may either be chemically synthesized or made using recombinant DNA techniques. The full sequences of these proteins are described herein and examples are provided of DNA sequences that can be used in producing them.
Bindins of SDF-1 to Self-Assembling Peptides
Several strategies may be used for attaching protease resistant SDF-1 to selfassembling peptides. One strategy is non-covalent binding which has previously been shown to be effective in delivering PDGF-BB, a growth factor, to tissues (Hsieh, et al, J. Clin. Invest. 776:237-248 (2006)). A second attachment strategy is the biotin-sandwich method (Davis, et al., Proc. Nat'l Acad. Sci. USA 703:8155-8160 (2006)) in which a protease resistant SDF-1 is biotinylated and bound to biotinylated peptides using tetravalent streptavidin as a linker. To accomplish this, the protease resistant SDF-1 may be coupled to the 15 amino acid sequence of an acceptor peptide for biotinylation (referred as AP; Chen, et al., Nat. Methods 2:99-104 (2005)). Because the active site of SDF-1 is situated near the amino terminus, fusion proteins should be made by incorporating the extra sequences at the C-terminus. The acceptor peptide sequence allows site-specific biotinylation by the E. coli enzyme biotin ligase (BirA; Chen, et al., Nat. Methods 2:99-104 (2005)). Many commercial kits are available for biotinylating proteins. However, many of these kits biotinylate lysine residues in a nonspecific manner, and this may reduce mSDF-1 activity as it has been shown that the N-terminal lysine of SDF-1 is crucial for receptor binding and activity (Crump, et al„ EMBO J. 76:6996-7007 (1997)). Biotinylated self-assembling peptides are made by MIT Biopolymers laboratory and when mixed in a 1 to 100 ratio with native self-assembling peptides, self-assembly of nanofibers should not be disturbed (Davis, et al., Proc. Nat'l Acad. Sci. USA 703:8155-8160(2006)). A third targeting strategy is direct incorporation of protease resistant SDF-1 peptides into self-assembling nanofibers by construction of a fusion protein of mutated SDF-1 with a self-assembling peptide. For example an mSDF-1 may be coupled to the 16 amino acid sequence of SEQ ID NO:35. This “RAD” portion of the fusion protein will incorporate into the nanofiber scaffold while assembling.
Formation of Membranes
The self-assembling peptides and fusion proteins described herein will not form membranes in water, but will assemble in the presence of a low concentration of monovalent metal cation. The order of effectiveness of these cations is Li+>Na+>K+>Cs+ (U.S. 6,548,630). A concentration of monovalent cation of 5 mM should be sufficient for peptides to assemble and concentrations as high as 5 M should still be effective. The anion associated with the monovalent cation is not critical to the invention and can be acetate, chloride, sulfate, phosphate, etc.
The initial concentration of self-assembling peptide will influence the final size and thickness of membranes formed. In general, the higher the peptide concentration, the higher the extent of membrane formation. Formation can take place at peptide concentrations as low as 0.5 mM or 1 mg/ml. However, membranes are preferably formed at higher initial peptide concentrations, e.g., 10 mg/ml, to promote better handling characteristics. Overall, it is generally better to form membranes by adding peptides to a salt solution rather than adding salt to a peptide solution.
The formation of membranes is relatively unaffected by pH or by temperature. Nevertheless, pH should be maintained below 12 and temperatures should generally be in the range of 4-90°C. Divalent metal cations at concentrations equal to or above 100 mM result in improper membrane formation and should be avoided. Similarly, a concentration of sodium dodecyl sulfate of 0.1% or higher should be avoided.
Membrane formation may be observed by simple visual inspection and this can be aided, if desired, with stains such as Congo Red. The integrity of membranes can also be observed microscopically, with or without stain.
Pharmaceutical Compositions and Dosages
Membranes with attached protease resistant SDF-1 peptides or fusion proteins may be incorporated into a pharmaceutical composition containing a carrier such as saline, water, Ringer’s solution and other agents or excipients. The dosage form will generally be designed for implantation or injection, particularly into cardiac tissue but topical treatments will also be useful, e.g., in the treatment of wounds. All dosage forms may be prepared using methods that are standard in die art (see e.g., Remington’s Pharmaceutical Sciences. 16th ed. A. Oslo, ed., Easton, PA (1980)).
It is expected that the skilled practitioner will adjust dosages on a case by case basis using methods well established in clinical medicine. The optimal dosage will be determined by methods known in the art and will be influenced by factors such as the age of the patient, disease state and other clinically relevant factors. IEsampfles
Example 1: Biological Effects and Protease Resistance of SDF-1 Mutants SDF-1 Purification and Expression
The DNA sequence of mature SDF-1 a may be cloned from human cDNA into pET-Sumo vector and an extra N-terminal serine residue may be incorporated to facilitate cleavage by Sumo protease (yielding an SDF-1 form of 69 AA). Fusion proteins may be made by incorporating RAD or AP sequences in reverse primers. Sumo-SDF-1 fusion proteins are expressed in Rosetta DE3 E coli and grown to an optical density of 1.5 (600nm) at 37°C. Cells are induced with 0.25mM isopropyl β-D-thiogalactoside for 4h and harvested by centrifugation. As described below, SDF-1 a may be purified by a 3-step procedure; all steps being performed at 21°C.
Cells from a 4-L growth were lysed in 300ml lysis buffer (6M Guanidine, 20mM phosphate (pH 7.8), 500mM NaCl) and homogenized. Debris is collected by centrifugation at 3000g. The first purification step consisted of capture of the poly-histidine tag present in the SUMO-SDF-Ια fusion protein with Nickel-NTA. Nickel-NTA resin was washed with wash buffer (8M Urea, 500mM NaCl, 20mM phosphate (pH 6.2)) and the bound protein was eluted at pH 4. Further purification and oxidative refolding were performed on a Cation Exchange HPLC column. The sample was adjusted to binding buffer (8M Urea, 30mM 2-mercaptoethanol, ImM EDTA, 50mM Tris pH8) and loaded on the HPLC column. Refolding of Sumo-SDF-1 was performed on the column with a 2h run of refolding buffer (50mM Tris pH8, 75mM NaCl, O.lmM reduced Glutathione and O.lmM oxidized
Glutathione). Sumo-SDF-1 was eluted with a step gradient (0.5 to 1M NaCl) and concentrated. The SUMO-SDF-1 fusion protein was cleaved by Sumo Protease 1 (1U/ 50pg protein) in 50mM Tris pH 8.0, 500mM NaCl. The sample was adjusted to 0.1% trifluoroacetic acid (TFA) and loaded on a Cl8 Reversed Phase HPLC column for the final purification step. The column was subjected to a linear gradient from 30 to 40% acetonitrile in 0.1% TFA. The fractions containing SDF-1 were lyophilized and resuspended. Activity of purified SDF-1 was tested by migration of Jurkat T-lymphocyte cell line.
Modification of SDF-1 Constructs SDF-1 fusion constructs were modified by insertional mutagenesis with one of three sequences: one sequence is susceptible to MMP-2 cleavage (MMP cleavage site or MCS), another sequence contains the same amino acids but in a random order (scrambled sequence, or SCR), and the third sequence contains 6 glycines as a linker.
Mutations of the MMP Cleavage Sites in Chemokines SDF-1 is cleaved by MMP-2 in its active site at the N-terminus, leaving an N-terminal tetrapeptide and inactive SDF-1 (5-68). Specific mutagenesis of 4 different amino acids was performed in order to render SDF-1 resistant to MMP-2 cleavage, based on substrate sequences of MMP-2 described by Netzel-Amett et al (Biochemistry 32:6427-6432 (1993)). The four different constructs were expressed and purified as described for SDF-1. Of the 4 different mutations, SDF-1(L5W) and SDF-1(L5E) showed minimal activity on T-cell migration. In contrast, SDF-1(S4V) and SDF-1(L5P) showed bioactivity comparable to native SDF-1. Because SDF-1(L5P) was more difficult to purify, SDF-1(S4V) was selected for further experiments.
Effect of Mutations on Protease Susceptibility and Chemoattractant Activity
The mutated forms of SDF-1 were examined in an assay of migration of Jurkat T cells at a concentration of 100 nM. This assay indicated that both SDF-1(S4V) and SDF-1(L5P) retained most of the activity of unmutated SDF-1 in promoting T cell migration. This activity was greatly reduced in SDF-1 (L5W) mutants and SDF-1(L5E) mutants.
The susceptibility of the peptides to cleavage by MMP-2 was determined by incubating the mutants with the enzyme for one hour and then examining the incubation product by SDS-PAGE. This revealed that, unlike SDF-1, the mutants did not undergo a positional shift indicative of cleavage. MMP-2 incubation was also found to reduce the chemoattractant activity of SDF-1 but not SDF-1 (S4V) as shown by a Jurkat T-cell migration assay. These results suggest that the S4V variant of SDF-1 retains chemokine bioactivity but is resistant to activation by MMP-2.
In vivo Data A blinded and randomized study was performed to evaluate the effect of different SDF-1 forms on cardiac function after myocardial infarction in rats. Ejection fraction was measured with a Millar catheter system for measurement of intraventricular pressures and ventricular volumes. Both SDF-1 (S4V)-6G-RAD and SDF-1 (S4V)-MCS-RAD significantly increased cardiac function 4 weeks after myocardial infarction in rats compared to MI only group. This indicates that both MMP-2 resistance (SDF-1 (S4V)) and attachment to membranes are necessary for successful cardiac repair therapy.
Example 2: Experiments with Truncated Forms of SDF-1 3 truncated forms of SDF-1 were synthesized commercially; all include die first 17 amino acids of native SDF-1. Two variants of SDF-1 17AA were designed to be more resistant to MMP-2, based on our prior work with the entire SDF-1 protein: SDF-1 17AA: KPVSLSYRCPCRFFESH (SEQ ID 64) SDF-1 (S4V) 17AA: KPWLSYRCPCRFFESH (SEQ ID 65) SDF-1 (L5P) 17AA: KPVSPSYRCPCRFFESH (SEQ ID 66)
Migration experiments were performed with the Jurkat T-lymphocyte cell line. Truncated SDF-1 17AA was 500 times less potent than native SDF-1 but maximal migration induced was similar to native SDF-1. Therefore, if 500 times higher concentrations were used compared to full-length protein, the same migratory response of T-lymphocytes should be observed. The mutated SDF-1 (S4V) 17AA and SDF-1 (L5P) 17AA were three times less potent than SDF-1 17AA without mutation. This is a similar shift to that seen between native SDF-1 and SDF-1 (S4V).
Cleavage experiments of the peptides with MMP-2 were performed: 2 nmole of SDF-1 17AA, SDF-1 (S4V) 17AA, and SDF-1(L5P) 17AA were incubated with MMP-2 for lh at RT. Proteins were run on an SDS-PAGE showing cleavage of SDF-1 17AA, but not of SDF-1(S4V) 17AA or SDF-1 (L5P) 17AA. Thus, these truncated proteins may be useful therapeutically, as they are still bioactive and also MMP-2 resistant.
All references cited herein are fully incorporated by reference. Having now fully described the invention, it will be understood by those of skill in the art that the invention may be practiced within a wide and equivalent range of conditions, parameters and the like, without affecting the spirit or scope of the invention or any embodiment thereof.

Claims (20)

  1. What is Claimed is:
    1. An isolated mutant stromal cell derived factor-1 comprising a peptide having a formula selected from the group consisting of: Xp-SDF-1, mSDF-1 and Xp-mSDF-1, wherein: a) X is a proteinogenic amino acid or a protease protective organic group; b) p is an integer between 1 and 4; c) SDF-1 is a peptide comprising the amino acid sequence of at least amino acids 1-8 of SEQ ID NO:52 and which is optionally extended at the C terminus by all, or any portion, of the remaining sequence of SEQ ID NO:52, shown as amino acids 9-68; d) Xp-SDF-1 has chemoattractant activity for T cells and is inactivated by dipeptidyl peptidase IV (DPPIV) at a rate that is less than one half of the rate at which SDF-1 is inactivated; e) mSDF-1 is a form of SDF-1 comprising a mutation in the fourth and/or the fifth amino acid from the N terminus of SDF-1; f) mSDF-1 has chemoattractant activity for T cells and is inactivated by matrix metalloproteinase-2 (MMP-2) at a rate that is less than one half of the rate at which SDF-1 is inactivated. g) Xp-mSDF-1 has chemoattractant activity for T cells, is inactivated by DPPIV at a rate that is less than one half of the rate at which SDF-1 is inactivated and is inactivated by MMP-2 at a rate that is less than one half of the rate at which SDF-1 is inactivated.
  2. 2. The isolated mutant stromal cell derived factor-1 of claim 1, comprising either mSDF-1 or Xp-mSDF-1, wherein said mSDF-1: a) comprises the amino acid sequence of SEQ ID NO:53; b) maintains chemoattractant activity for T cells with a sensitivity of at least 1/10 that of SDF-1; and c) is inactivated by matrix metalloproteinase-2 (MMP-2) at a rate that is less than one fourth of the rate of inactivation of SDF-1.
  3. 3. The isolated mutant stromal cell derived factor-1 of claim 2, wherein said mSDF-1 is SDF(S4V), characterized by the amino acid sequence of SEQ ID NO:54.
  4. 4. The isolated mutant stromal cell derived factor-1 of claim 1, comprising the formula of either mSDF-1 or Xp-mSDF-1 wherein said mSDF-1: a) comprises the amino acid sequence of SEQ ID NO:55; b) maintains chemoattractant activity for T cells with a sensitivity of at least 1/10 that of SDF-1; and c) is inactivated by matrix metalloproteinase-2 (MMP-2) at a rate that is less than one fourth of the rate of inactivation of SDF-1.
  5. 5. The isolated mutant stromal cell derived factor-1 of claim 4, Wherein said mSDF-1 is SDF(L5P), characterized by the amino acid sequence of SEQ ID NO:56.
  6. 6. A fusion protein comprising the formula: A-(L)n-(R)q , wherein: A is the isolated mutant stromal cell derived factor-1 of claim 1, n is an integer from 0-3; q is an integer from 1-3; L is a linker sequence of 3-9 amino acids, and R is a self-assembling peptide selected from the group consisting of: AKAKAEAEAKAKAEAE, (SEQ ID NO: 1); AKAEAKAEAKAEAKAE, (SEQIDNO:2); EAKAEAKAEAKAEAKA, (SEQIDNO:3); KAEAKAEAKAEAKAEA, (SEQIDNO:4); AEAKAEAKAEAKAEAK, (SEQIDNO:5); ADADARARADADARAR, (SEQ ID NO:6); ARADARADARADARAD, (SEQIDNO:7); DARADARADARADARA, (SEQIDNO:8); RADARADARADARADA, (SEQIDNO:9); ADARADARADARADAR, (SEQ IDNO:10); ARADAKAEARADAKAE, (SEQ ID NO: 11); AKAEARADAKAEARAD, (SEQ ID NO: 12); ARAKADAEARAKADAE, (SEQ IDNO:13); AKARAEADAKARADAE, (SEQ ID NO: 14); AQAQAQAQAQAQAQAQ, (SEQ ID NO:15); VQVQVQVQVQVQVQVQ, (SEQ ID NO: 16); YQYQYQYQYQYQYQYQ, (SEQ ID NO: 17); HQHQHQHQHQHQHQHQ, (SEQ ID NO: 18); ANANANANANANANAN, (SEQ ID NO: 19); VNVNVNVNVNVNVNVN, (SEQ ID NO:20); YNYNYNYNYNYNYNYN, (SEQ IDNO:21); HNHNHNHNHNHNHNHN, (SEQ ID NO:22); ANAQANAQANAQANAQ, (SEQ ID NO:23); AQANAQANAQANAQAN, (SEQ ID NO:24); VNVQVNVQVNVQVNVQ, (SEQ ID NO:25); VQVNVQVNVQVNYQVN, (SEQ ID NO:26); YNYQYNYQYNYQYNYQ, (SEQ ID NO:27); YQYNYQYNYQYNYQYN, (SEQ ID NO:28); HNHQHNHQHNHQHNHQ, (SEQ ID NO:29); HQHNHQHNHQHNHQHN, (SEQ ID NO:30); AKAQADAKAQADAKAQAD, (SEQ ID NO:31); VKVQVDVKVQVDVKVQVD, (SEQ ID NO:32); YKYQYDYKYQYDYKYQYD, (SEQ ID NO:33); HKHQHDHKHQHDHKHQHD, (SEQ ID NO:34); RARADADARARADADA, (SEQ ED NO:35); RADARGDARADARGDA, (SEQ ID NO:36); RAEARAEARAEARAEA, (SEQ ID NO:37); KADAKADAKADAKADA, (SEQ ID NO:38); AEAEAHAHAEAEAHAH, (SEQ IDNO:39); FEFEFKFKFEFEFKFK, (SEQ ID NO:40); LELELKLKLELELKLK, (SEQ ID NO:41); AEAEAKAKAEAEAKAK, (SEQ ID NO:42); AEAEAEAEAKAK, (SEQ ID NO:43); KAKAKAKAEAEAEAEA, (SEQ ID NO:44); AEAEAEAEAKAKAKAK, (SEQ ID NO:45); RARARARADADADADA, (SEQ ID NO:46); ADADADADARARARAR, (SEQ ID NO:47); DADADADARARARARA, (SEQ ID NO:48); HEHEHKHKHEHEHKHK, (SEQ ID NO:49); VEVEVEVEVEVEVEVEVEVE, (SEQ ID NO:50); and RFRFRFRFRFRFRFRFRFRF, (SEQ ID NO:51).
  7. 7. The fusion protein of claim 6, wherein A is either mSDF-1 or Xp-mSDF-1; and comprises the amino acid sequence of any one of SEQ ID NO:53 - SEQ ID NO:56.
  8. 8. The fusion protein of claim 7, wherein n=l and L is selected from the group consisting of: GGGGGG (SEQ ID NO:57); GIVGPL (SEQ ID NO:58) and PVGLIG (SEQ ID NO:59).
  9. 9. The fusion protein of claim 8, wherein A is the mSDF-1 peptide of SEQ ID NO:54.
  10. 10. The fusion protein of claim 9, wherein q=l and R is RARADADARARADADA, (SEQ ID NO:35).
  11. 11. A nucleic acid comprising a nucleotide sequence encoding the isolated mutant stromal cell derived factor-1 of claim 1 or the fusion protein of claim 6.
  12. 12. The nucleic acid of claim 11, wherein said nucleic acid comprises a nucleotide sequence selected from the group consisting of: SEQ ID NOs:60-63.
  13. 13. A biologically compatible peptide membrane comprising one or more selfassembling peptides having an amino acid sequence selected from the group consisting of SEQ ID NO:l-SEQ ID NO:51 and wherein: 0.1-10% of said selfassembling peptides are bound to the isolated mutant stromal cell derived factor-1 of claim 1.
  14. 14. The biologically compatible peptide membrane of claim 13, wherein said isolated mutant stromal cell derived factor-1 is bound to a self-assembling peptide in said membrane by a biotin/avidin linkage.
  15. 15. The biologically compatible peptide membrane of claim 13, wherein there is a spacer separating said isolated mutant stromal cell derived factor-1 from said one or more self-assembling peptides by at least 14 angstroms and no more than 250 angstroms.
  16. 16. The biologically compatible peptide membrane of claim 13, wherein said mSDF-1 peptide is covalently bound to a self-assembling peptide in said membrane by a peptide bond.
  17. 17. A method of treating a patient to aid the repair of damaged tissue, comprising: administering locally to said damaged tissue, the mutant stromal cell derived factor-1 of claim 1.
  18. 18. The method of claim 17, wherein said mutant stromal cell derived factor-1 is attached to a biologically compatible membrane or is attached to a self-assembling peptide that forms a biologically compatible membrane after administration locally to said damaged tissue.
  19. 19. The method of claim 17, wherein said patient is treated for a disease or condition selected from the group consisting of: stroke; limb ischemia; tissue damage due to trauma; and diabetic ulcers.
  20. 20. The method of claim 17, wherein said patient is treated for damage to cardiac tissue and said method comprises injecting or implanting said biologically compatible peptide membrane into the myocardium of said patient.
AU2016216675A 2006-10-23 2016-08-18 Protease resistant mmutants of stromal cell derived factor-1 in the repair of tissue damage Abandoned AU2016216675A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
AU2016216675A AU2016216675A1 (en) 2006-10-23 2016-08-18 Protease resistant mmutants of stromal cell derived factor-1 in the repair of tissue damage

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US60/853,441 2006-10-23
US60/929,353 2007-06-22
US11/976,032 2007-10-19
AU2013234365A AU2013234365B2 (en) 2006-10-23 2013-09-26 Protease resistant mutants of stromal cell derived factor-1 in the repair of tissue damage
AU2016216675A AU2016216675A1 (en) 2006-10-23 2016-08-18 Protease resistant mmutants of stromal cell derived factor-1 in the repair of tissue damage

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
AU2013234365A Division AU2013234365B2 (en) 2006-10-23 2013-09-26 Protease resistant mutants of stromal cell derived factor-1 in the repair of tissue damage

Publications (1)

Publication Number Publication Date
AU2016216675A1 true AU2016216675A1 (en) 2016-09-08

Family

ID=56851799

Family Applications (1)

Application Number Title Priority Date Filing Date
AU2016216675A Abandoned AU2016216675A1 (en) 2006-10-23 2016-08-18 Protease resistant mmutants of stromal cell derived factor-1 in the repair of tissue damage

Country Status (1)

Country Link
AU (1) AU2016216675A1 (en)

Similar Documents

Publication Publication Date Title
US10774124B2 (en) Protease resistant mutants of stromal cell derived factor-1 in the repair of tissue damage
CA2739615C (en) Fgf21 mutants comprising polyethylene glycol and uses thereof
CA2862745A1 (en) Growth differentiation factor 15 (gdf-15) polypeptides
JP2005530484A5 (en)
US10456451B2 (en) Protease-resistant mutants of stromal cell derived factor-1 in the repair of tissue damage
CA2094045A1 (en) Heparin binding mitogen with egf homology
RU2426745C2 (en) Recombinant chimeric protein of neutrophil and girugen inhibition factor and pharmaceutical composition containing it
JPH06228199A (en) Peptide binding body capable of passing through blood brain barrier
SK287523B6 (en) Use of a CC chemokine mutant, pharmaceutical composition containing the chemokine mutant, truncated and mutated human RANTES and method for producing the same
CN1980952A (en) Multimerised HIV fusion inhibitors
AU2013234365B2 (en) Protease resistant mutants of stromal cell derived factor-1 in the repair of tissue damage
AU2016216675A1 (en) Protease resistant mmutants of stromal cell derived factor-1 in the repair of tissue damage
WO2005095443A1 (en) Drug delivery system using peptide modification
KR101651330B1 (en) Methods of TAT-A20 fusion protein with good cell penetration and use thereof
KR20230120134A (en) Polypeptides and their uses
JPWO2005077971A1 (en) Novel peptide having heparin-binding ability designed from heparin-binding site of vascular endothelial growth factor (VEGF) -like protein derived from snake venom and use thereof
EA041758B1 (en) FGF21 MUTANTS AND THEIR APPLICATIONS

Legal Events

Date Code Title Description
MK5 Application lapsed section 142(2)(e) - patent request and compl. specification not accepted