AU2015200096B2 - Isolation and identification of glycosaminoglycans - Google Patents
Isolation and identification of glycosaminoglycans Download PDFInfo
- Publication number
- AU2015200096B2 AU2015200096B2 AU2015200096A AU2015200096A AU2015200096B2 AU 2015200096 B2 AU2015200096 B2 AU 2015200096B2 AU 2015200096 A AU2015200096 A AU 2015200096A AU 2015200096 A AU2015200096 A AU 2015200096A AU 2015200096 B2 AU2015200096 B2 AU 2015200096B2
- Authority
- AU
- Australia
- Prior art keywords
- gag
- bmp2
- heparin
- peptide
- column
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 229920002683 Glycosaminoglycan Polymers 0.000 title claims abstract description 183
- 238000002955 isolation Methods 0.000 title abstract description 17
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 claims abstract description 137
- 230000027455 binding Effects 0.000 claims abstract description 137
- 229960002897 heparin Drugs 0.000 claims abstract description 134
- 229920000669 heparin Polymers 0.000 claims abstract description 132
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 54
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 51
- 229920002971 Heparan sulfate Polymers 0.000 claims description 214
- 210000004027 cell Anatomy 0.000 claims description 119
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 117
- 238000000034 method Methods 0.000 claims description 99
- 239000000203 mixture Substances 0.000 claims description 84
- 150000003839 salts Chemical class 0.000 claims description 46
- 238000004458 analytical method Methods 0.000 claims description 34
- 150000001413 amino acids Chemical class 0.000 claims description 31
- 230000014509 gene expression Effects 0.000 claims description 31
- 239000007787 solid Substances 0.000 claims description 26
- 230000004069 differentiation Effects 0.000 claims description 17
- 108090000856 Lyases Proteins 0.000 claims description 10
- 102000004317 Lyases Human genes 0.000 claims description 10
- 230000035755 proliferation Effects 0.000 claims description 9
- 150000003467 sulfuric acid derivatives Chemical class 0.000 claims description 9
- 230000024245 cell differentiation Effects 0.000 claims description 7
- 230000010261 cell growth Effects 0.000 claims description 7
- 230000002401 inhibitory effect Effects 0.000 claims description 7
- 238000000638 solvent extraction Methods 0.000 claims description 6
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical group OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 claims description 5
- 230000004936 stimulating effect Effects 0.000 claims description 4
- 210000004899 c-terminal region Anatomy 0.000 claims 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 230000012010 growth Effects 0.000 abstract description 10
- 238000011161 development Methods 0.000 abstract description 3
- 230000003993 interaction Effects 0.000 description 95
- 210000001519 tissue Anatomy 0.000 description 65
- 239000000872 buffer Substances 0.000 description 59
- 108010049931 Bone Morphogenetic Protein 2 Proteins 0.000 description 57
- 230000000694 effects Effects 0.000 description 56
- 239000000523 sample Substances 0.000 description 56
- 102100024506 Bone morphogenetic protein 2 Human genes 0.000 description 53
- 229920001184 polypeptide Polymers 0.000 description 53
- 102000004196 processed proteins & peptides Human genes 0.000 description 50
- 235000000346 sugar Nutrition 0.000 description 46
- 235000018102 proteins Nutrition 0.000 description 45
- 238000005670 sulfation reaction Methods 0.000 description 41
- 238000011282 treatment Methods 0.000 description 41
- 230000019635 sulfation Effects 0.000 description 34
- 210000000130 stem cell Anatomy 0.000 description 32
- 239000011159 matrix material Substances 0.000 description 27
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 26
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 24
- 102000004127 Cytokines Human genes 0.000 description 22
- 108090000695 Cytokines Proteins 0.000 description 22
- 125000000837 carbohydrate group Chemical group 0.000 description 22
- -1 dextran sulphates Chemical class 0.000 description 22
- 239000003446 ligand Substances 0.000 description 22
- 229920000045 Dermatan sulfate Polymers 0.000 description 21
- 239000008194 pharmaceutical composition Substances 0.000 description 20
- 241000894007 species Species 0.000 description 20
- 230000011664 signaling Effects 0.000 description 19
- IOVCWXUNBOPUCH-UHFFFAOYSA-N Nitrous acid Chemical compound ON=O IOVCWXUNBOPUCH-UHFFFAOYSA-N 0.000 description 18
- 238000005349 anion exchange Methods 0.000 description 18
- 230000006378 damage Effects 0.000 description 18
- 229940051593 dermatan sulfate Drugs 0.000 description 18
- AVJBPWGFOQAPRH-FWMKGIEWSA-L dermatan sulfate Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@H](OS([O-])(=O)=O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](C([O-])=O)O1 AVJBPWGFOQAPRH-FWMKGIEWSA-L 0.000 description 18
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 18
- 239000003814 drug Substances 0.000 description 18
- 208000027418 Wounds and injury Diseases 0.000 description 17
- 235000001014 amino acid Nutrition 0.000 description 17
- 210000000988 bone and bone Anatomy 0.000 description 17
- 201000010099 disease Diseases 0.000 description 17
- 238000010828 elution Methods 0.000 description 17
- 238000000338 in vitro Methods 0.000 description 17
- 208000014674 injury Diseases 0.000 description 17
- 239000000463 material Substances 0.000 description 17
- 230000003389 potentiating effect Effects 0.000 description 17
- 239000000243 solution Substances 0.000 description 17
- 108010090804 Streptavidin Proteins 0.000 description 16
- 230000015556 catabolic process Effects 0.000 description 16
- 150000001875 compounds Chemical class 0.000 description 16
- 238000006731 degradation reaction Methods 0.000 description 16
- 238000011033 desalting Methods 0.000 description 16
- 230000029087 digestion Effects 0.000 description 16
- 150000002016 disaccharides Chemical class 0.000 description 16
- 108010083213 heparitinsulfate lyase Proteins 0.000 description 16
- 210000002901 mesenchymal stem cell Anatomy 0.000 description 16
- 238000002360 preparation method Methods 0.000 description 16
- 230000008569 process Effects 0.000 description 16
- 229920001287 Chondroitin sulfate Polymers 0.000 description 15
- 108010022901 Heparin Lyase Proteins 0.000 description 15
- 108090000573 Osteocalcin Proteins 0.000 description 15
- 239000003102 growth factor Substances 0.000 description 15
- 102000004067 Osteocalcin Human genes 0.000 description 14
- 238000002835 absorbance Methods 0.000 description 14
- 210000000845 cartilage Anatomy 0.000 description 13
- 238000011068 loading method Methods 0.000 description 13
- 238000011069 regeneration method Methods 0.000 description 13
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 12
- 238000001727 in vivo Methods 0.000 description 12
- 108010043267 Sp7 Transcription Factor Proteins 0.000 description 11
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 11
- 102100032317 Transcription factor Sp7 Human genes 0.000 description 11
- 102000005962 receptors Human genes 0.000 description 11
- 108020003175 receptors Proteins 0.000 description 11
- 230000008929 regeneration Effects 0.000 description 11
- 230000008439 repair process Effects 0.000 description 11
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 10
- 102000015775 Core Binding Factor Alpha 1 Subunit Human genes 0.000 description 10
- 108010024682 Core Binding Factor Alpha 1 Subunit Proteins 0.000 description 10
- 241001465754 Metazoa Species 0.000 description 10
- 238000001042 affinity chromatography Methods 0.000 description 10
- 230000015572 biosynthetic process Effects 0.000 description 10
- 229940094517 chondroitin 4-sulfate Drugs 0.000 description 10
- KXKPYJOVDUMHGS-OSRGNVMNSA-N chondroitin sulfate Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](OS(O)(=O)=O)[C@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](C(O)=O)O1 KXKPYJOVDUMHGS-OSRGNVMNSA-N 0.000 description 10
- 210000002808 connective tissue Anatomy 0.000 description 10
- 230000011164 ossification Effects 0.000 description 10
- 230000002188 osteogenic effect Effects 0.000 description 10
- 238000000926 separation method Methods 0.000 description 10
- 102000004190 Enzymes Human genes 0.000 description 9
- 108090000790 Enzymes Proteins 0.000 description 9
- 210000002744 extracellular matrix Anatomy 0.000 description 9
- 239000012634 fragment Substances 0.000 description 9
- 229920001542 oligosaccharide Polymers 0.000 description 9
- 150000002482 oligosaccharides Chemical class 0.000 description 9
- 230000004044 response Effects 0.000 description 9
- 150000004044 tetrasaccharides Chemical class 0.000 description 9
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 8
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 8
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 8
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 8
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 8
- IAJILQKETJEXLJ-UHFFFAOYSA-N Galacturonsaeure Natural products O=CC(O)C(O)C(O)C(O)C(O)=O IAJILQKETJEXLJ-UHFFFAOYSA-N 0.000 description 8
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 8
- 239000002671 adjuvant Substances 0.000 description 8
- 238000005571 anion exchange chromatography Methods 0.000 description 8
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 8
- 239000008103 glucose Substances 0.000 description 8
- 239000001963 growth medium Substances 0.000 description 8
- 239000012145 high-salt buffer Substances 0.000 description 8
- 210000003041 ligament Anatomy 0.000 description 8
- 239000000758 substrate Substances 0.000 description 8
- 210000002435 tendon Anatomy 0.000 description 8
- 238000005406 washing Methods 0.000 description 8
- MSWZFWKMSRAUBD-IVMDWMLBSA-N 2-amino-2-deoxy-D-glucopyranose Chemical compound N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-IVMDWMLBSA-N 0.000 description 7
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 7
- 102000005348 Neuraminidase Human genes 0.000 description 7
- 108010006232 Neuraminidase Proteins 0.000 description 7
- 108010059712 Pronase Proteins 0.000 description 7
- 239000002253 acid Substances 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 229940126864 fibroblast growth factor Drugs 0.000 description 7
- 229960002442 glucosamine Drugs 0.000 description 7
- 230000014759 maintenance of location Effects 0.000 description 7
- 230000001404 mediated effect Effects 0.000 description 7
- 210000003205 muscle Anatomy 0.000 description 7
- 230000002265 prevention Effects 0.000 description 7
- 238000003786 synthesis reaction Methods 0.000 description 7
- UMCMPZBLKLEWAF-BCTGSCMUSA-N 3-[(3-cholamidopropyl)dimethylammonio]propane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 UMCMPZBLKLEWAF-BCTGSCMUSA-N 0.000 description 6
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 6
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 6
- 108010007726 Bone Morphogenetic Proteins Proteins 0.000 description 6
- 102000007350 Bone Morphogenetic Proteins Human genes 0.000 description 6
- 101710132601 Capsid protein Proteins 0.000 description 6
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 6
- 102000030914 Fatty Acid-Binding Human genes 0.000 description 6
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 6
- 229930182816 L-glutamine Natural products 0.000 description 6
- AEMOLEFTQBMNLQ-WAXACMCWSA-N alpha-D-glucuronic acid Chemical compound O[C@H]1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-WAXACMCWSA-N 0.000 description 6
- 239000011324 bead Substances 0.000 description 6
- 229940112869 bone morphogenetic protein Drugs 0.000 description 6
- 239000004202 carbamide Substances 0.000 description 6
- 150000001720 carbohydrates Chemical class 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 238000000605 extraction Methods 0.000 description 6
- 108091022862 fatty acid binding Proteins 0.000 description 6
- 238000001914 filtration Methods 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 238000002513 implantation Methods 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 230000000717 retained effect Effects 0.000 description 6
- 150000008163 sugars Chemical class 0.000 description 6
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 5
- 101710154607 Azurocidin Proteins 0.000 description 5
- 241000283690 Bos taurus Species 0.000 description 5
- 102000003971 Fibroblast Growth Factor 1 Human genes 0.000 description 5
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- 235000011114 ammonium hydroxide Nutrition 0.000 description 5
- 238000013459 approach Methods 0.000 description 5
- 230000004071 biological effect Effects 0.000 description 5
- 229960002685 biotin Drugs 0.000 description 5
- 235000020958 biotin Nutrition 0.000 description 5
- 239000011616 biotin Substances 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 238000012512 characterization method Methods 0.000 description 5
- 239000003085 diluting agent Substances 0.000 description 5
- 238000004128 high performance liquid chromatography Methods 0.000 description 5
- 238000011534 incubation Methods 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 210000003098 myoblast Anatomy 0.000 description 5
- 239000002243 precursor Substances 0.000 description 5
- 238000003753 real-time PCR Methods 0.000 description 5
- 239000007858 starting material Substances 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 230000029663 wound healing Effects 0.000 description 5
- SQDAZGGFXASXDW-UHFFFAOYSA-N 5-bromo-2-(trifluoromethoxy)pyridine Chemical compound FC(F)(F)OC1=CC=C(Br)C=N1 SQDAZGGFXASXDW-UHFFFAOYSA-N 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 108091035707 Consensus sequence Proteins 0.000 description 4
- 102000003974 Fibroblast growth factor 2 Human genes 0.000 description 4
- 101000793686 Homo sapiens Azurocidin Proteins 0.000 description 4
- 101000711846 Homo sapiens Transcription factor SOX-9 Proteins 0.000 description 4
- 102000016611 Proteoglycans Human genes 0.000 description 4
- 108010067787 Proteoglycans Proteins 0.000 description 4
- 102100034204 Transcription factor SOX-9 Human genes 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- TZCXTZWJZNENPQ-UHFFFAOYSA-L barium sulfate Chemical compound [Ba+2].[O-]S([O-])(=O)=O TZCXTZWJZNENPQ-UHFFFAOYSA-L 0.000 description 4
- 235000014633 carbohydrates Nutrition 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 229940059329 chondroitin sulfate Drugs 0.000 description 4
- 238000004587 chromatography analysis Methods 0.000 description 4
- 230000006862 enzymatic digestion Effects 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 239000011521 glass Substances 0.000 description 4
- 102000043635 human AZU1 Human genes 0.000 description 4
- 238000012423 maintenance Methods 0.000 description 4
- 210000000963 osteoblast Anatomy 0.000 description 4
- 239000002244 precipitate Substances 0.000 description 4
- 238000012545 processing Methods 0.000 description 4
- 229940002612 prodrug Drugs 0.000 description 4
- 239000000651 prodrug Substances 0.000 description 4
- 238000010839 reverse transcription Methods 0.000 description 4
- 238000004513 sizing Methods 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 230000017423 tissue regeneration Effects 0.000 description 4
- PIEPQKCYPFFYMG-UHFFFAOYSA-N tris acetate Chemical compound CC(O)=O.OCC(N)(CO)CO PIEPQKCYPFFYMG-UHFFFAOYSA-N 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 102000004411 Antithrombin III Human genes 0.000 description 3
- 108090000935 Antithrombin III Proteins 0.000 description 3
- 229920002567 Chondroitin Polymers 0.000 description 3
- 229920002307 Dextran Polymers 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 102100035290 Fibroblast growth factor 13 Human genes 0.000 description 3
- 102000008055 Heparan Sulfate Proteoglycans Human genes 0.000 description 3
- 102000003745 Hepatocyte Growth Factor Human genes 0.000 description 3
- 108090000100 Hepatocyte Growth Factor Proteins 0.000 description 3
- 229920000288 Keratan sulfate Polymers 0.000 description 3
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 3
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 3
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 3
- 102000004896 Sulfotransferases Human genes 0.000 description 3
- 108090001033 Sulfotransferases Proteins 0.000 description 3
- 108090000054 Syndecan-2 Proteins 0.000 description 3
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 3
- 229960000583 acetic acid Drugs 0.000 description 3
- 238000000184 acid digestion Methods 0.000 description 3
- 210000004504 adult stem cell Anatomy 0.000 description 3
- 229960005348 antithrombin iii Drugs 0.000 description 3
- 210000001185 bone marrow Anatomy 0.000 description 3
- 239000013622 capto Q Substances 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 230000004663 cell proliferation Effects 0.000 description 3
- DLGJWSVWTWEWBJ-HGGSSLSASA-N chondroitin Chemical compound CC(O)=N[C@@H]1[C@H](O)O[C@H](CO)[C@H](O)[C@@H]1OC1[C@H](O)[C@H](O)C=C(C(O)=O)O1 DLGJWSVWTWEWBJ-HGGSSLSASA-N 0.000 description 3
- 230000001276 controlling effect Effects 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 230000006866 deterioration Effects 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- 230000003828 downregulation Effects 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 238000012377 drug delivery Methods 0.000 description 3
- 238000004108 freeze drying Methods 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 239000012362 glacial acetic acid Substances 0.000 description 3
- 150000002337 glycosamines Chemical class 0.000 description 3
- 230000035876 healing Effects 0.000 description 3
- 108010037536 heparanase Proteins 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000011835 investigation Methods 0.000 description 3
- KXCLCNHUUKTANI-RBIYJLQWSA-N keratan Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@H](COS(O)(=O)=O)O[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@H](O[C@@H](O[C@H]3[C@H]([C@@H](COS(O)(=O)=O)O[C@@H](O)[C@@H]3O)O)[C@H](NC(C)=O)[C@H]2O)COS(O)(=O)=O)O[C@H](COS(O)(=O)=O)[C@@H]1O KXCLCNHUUKTANI-RBIYJLQWSA-N 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 125000005647 linker group Chemical group 0.000 description 3
- 230000007774 longterm Effects 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 238000010899 nucleation Methods 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 230000009818 osteogenic differentiation Effects 0.000 description 3
- 230000004819 osteoinduction Effects 0.000 description 3
- 238000007747 plating Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 230000001737 promoting effect Effects 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 229920006395 saturated elastomer Polymers 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 239000001632 sodium acetate Substances 0.000 description 3
- 235000017281 sodium acetate Nutrition 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 238000001228 spectrum Methods 0.000 description 3
- 238000003756 stirring Methods 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- OVXIMRGEBNSORH-UHFFFAOYSA-N 2-[[2-[2-[[2-[[1-[1-[5-amino-2-[[2-amino-3-(1h-indol-3-yl)propanoyl]amino]-5-oxopentanoyl]pyrrolidine-2-carbonyl]pyrrolidine-2-carbonyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]propanoylamino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-methylp Chemical compound CCC(C)C(C(O)=O)NC(=O)C(CCCN=C(N)N)NC(=O)C(C)NC(=O)C(CCCN=C(N)N)NC(=O)C1CCCN1C(=O)C1N(C(=O)C(CCC(N)=O)NC(=O)C(N)CC=2C3=CC=CC=C3NC=2)CCC1 OVXIMRGEBNSORH-UHFFFAOYSA-N 0.000 description 2
- HRPVXLWXLXDGHG-UHFFFAOYSA-N Acrylamide Chemical compound NC(=O)C=C HRPVXLWXLXDGHG-UHFFFAOYSA-N 0.000 description 2
- 102100036601 Aggrecan core protein Human genes 0.000 description 2
- 108010067219 Aggrecans Proteins 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 208000010392 Bone Fractures Diseases 0.000 description 2
- 102100024505 Bone morphogenetic protein 4 Human genes 0.000 description 2
- 102100034808 CCAAT/enhancer-binding protein alpha Human genes 0.000 description 2
- 101710168309 CCAAT/enhancer-binding protein alpha Proteins 0.000 description 2
- 102100031168 CCN family member 2 Human genes 0.000 description 2
- 102000012422 Collagen Type I Human genes 0.000 description 2
- 108010022452 Collagen Type I Proteins 0.000 description 2
- 108010039419 Connective Tissue Growth Factor Proteins 0.000 description 2
- 102100023593 Fibroblast growth factor receptor 1 Human genes 0.000 description 2
- 101710182386 Fibroblast growth factor receptor 1 Proteins 0.000 description 2
- 102100027842 Fibroblast growth factor receptor 3 Human genes 0.000 description 2
- 101710182396 Fibroblast growth factor receptor 3 Proteins 0.000 description 2
- 102100037362 Fibronectin Human genes 0.000 description 2
- 108010067306 Fibronectins Proteins 0.000 description 2
- 102000034615 Glial cell line-derived neurotrophic factor Human genes 0.000 description 2
- 108091010837 Glial cell line-derived neurotrophic factor Proteins 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 102100024025 Heparanase Human genes 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 108010028750 Integrin-Binding Sialoprotein Proteins 0.000 description 2
- 102000016921 Integrin-Binding Sialoprotein Human genes 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 102000007547 Laminin Human genes 0.000 description 2
- 108010085895 Laminin Proteins 0.000 description 2
- 102100025744 Mothers against decapentaplegic homolog 1 Human genes 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 2
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 2
- 108010069196 Neural Cell Adhesion Molecules Proteins 0.000 description 2
- 102100023616 Neural cell adhesion molecule L1-like protein Human genes 0.000 description 2
- 102000004264 Osteopontin Human genes 0.000 description 2
- 108010081689 Osteopontin Proteins 0.000 description 2
- 102000008108 Osteoprotegerin Human genes 0.000 description 2
- 108010035042 Osteoprotegerin Proteins 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 239000004698 Polyethylene Substances 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 239000012505 Superdex™ Substances 0.000 description 2
- 108010009583 Transforming Growth Factors Proteins 0.000 description 2
- 102000009618 Transforming Growth Factors Human genes 0.000 description 2
- 108090000631 Trypsin Proteins 0.000 description 2
- 102000004142 Trypsin Human genes 0.000 description 2
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 2
- 102100039037 Vascular endothelial growth factor A Human genes 0.000 description 2
- 108010031318 Vitronectin Proteins 0.000 description 2
- 102100035140 Vitronectin Human genes 0.000 description 2
- 239000000853 adhesive Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 230000003042 antagnostic effect Effects 0.000 description 2
- 210000002449 bone cell Anatomy 0.000 description 2
- 230000010478 bone regeneration Effects 0.000 description 2
- VSGNNIFQASZAOI-UHFFFAOYSA-L calcium acetate Chemical compound [Ca+2].CC([O-])=O.CC([O-])=O VSGNNIFQASZAOI-UHFFFAOYSA-L 0.000 description 2
- 239000001639 calcium acetate Substances 0.000 description 2
- 235000011092 calcium acetate Nutrition 0.000 description 2
- 229960005147 calcium acetate Drugs 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 210000001608 connective tissue cell Anatomy 0.000 description 2
- 239000000470 constituent Substances 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000001816 cooling Methods 0.000 description 2
- 238000012136 culture method Methods 0.000 description 2
- 238000003381 deacetylation reaction Methods 0.000 description 2
- 230000007547 defect Effects 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 210000001671 embryonic stem cell Anatomy 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- 108010006406 heparinase II Proteins 0.000 description 2
- 238000000703 high-speed centrifugation Methods 0.000 description 2
- 239000000710 homodimer Substances 0.000 description 2
- 229920002674 hyaluronan Polymers 0.000 description 2
- 229940099552 hyaluronan Drugs 0.000 description 2
- KIUKXJAPPMFGSW-MNSSHETKSA-N hyaluronan Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)C1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H](C(O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-MNSSHETKSA-N 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 210000001161 mammalian embryo Anatomy 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 239000003226 mitogen Substances 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 230000000921 morphogenic effect Effects 0.000 description 2
- 229950006780 n-acetylglucosamine Drugs 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 108700007229 noggin Proteins 0.000 description 2
- 102000045246 noggin Human genes 0.000 description 2
- XXUPLYBCNPLTIW-UHFFFAOYSA-N octadec-7-ynoic acid Chemical compound CCCCCCCCCCC#CCCCCCC(O)=O XXUPLYBCNPLTIW-UHFFFAOYSA-N 0.000 description 2
- 230000002138 osteoinductive effect Effects 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 238000000059 patterning Methods 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 229920001343 polytetrafluoroethylene Polymers 0.000 description 2
- 239000004810 polytetrafluoroethylene Substances 0.000 description 2
- 238000011533 pre-incubation Methods 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000017854 proteolysis Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 231100000241 scar Toxicity 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 238000007790 scraping Methods 0.000 description 2
- 238000001542 size-exclusion chromatography Methods 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 239000012279 sodium borohydride Substances 0.000 description 2
- 229910000033 sodium borohydride Inorganic materials 0.000 description 2
- 229910000029 sodium carbonate Inorganic materials 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 238000001179 sorption measurement Methods 0.000 description 2
- 125000006850 spacer group Chemical group 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 230000008467 tissue growth Effects 0.000 description 2
- 239000012588 trypsin Substances 0.000 description 2
- 230000003827 upregulation Effects 0.000 description 2
- 230000002792 vascular Effects 0.000 description 2
- UBWXUGDQUBIEIZ-UHFFFAOYSA-N (13-methyl-3-oxo-2,6,7,8,9,10,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-17-yl) 3-phenylpropanoate Chemical compound CC12CCC(C3CCC(=O)C=C3CC3)C3C1CCC2OC(=O)CCC1=CC=CC=C1 UBWXUGDQUBIEIZ-UHFFFAOYSA-N 0.000 description 1
- WCDDVEOXEIYWFB-VXORFPGASA-N (2s,3s,4r,5r,6r)-3-[(2s,3r,5s,6r)-3-acetamido-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4,5,6-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@@H]1C[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](C(O)=O)O[C@@H](O)[C@H](O)[C@H]1O WCDDVEOXEIYWFB-VXORFPGASA-N 0.000 description 1
- ZIIUUSVHCHPIQD-UHFFFAOYSA-N 2,4,6-trimethyl-N-[3-(trifluoromethyl)phenyl]benzenesulfonamide Chemical compound CC1=CC(C)=CC(C)=C1S(=O)(=O)NC1=CC=CC(C(F)(F)F)=C1 ZIIUUSVHCHPIQD-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- AEMOLEFTQBMNLQ-UHFFFAOYSA-N 3,4,5,6-tetrahydroxyoxane-2-carboxylic acid Chemical group OC1OC(C(O)=O)C(O)C(O)C1O AEMOLEFTQBMNLQ-UHFFFAOYSA-N 0.000 description 1
- 101150079978 AGRN gene Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 108010059616 Activins Proteins 0.000 description 1
- 102000005606 Activins Human genes 0.000 description 1
- 102100040026 Agrin Human genes 0.000 description 1
- 108700019743 Agrin Proteins 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 101710137189 Amyloid-beta A4 protein Proteins 0.000 description 1
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 1
- 101710151993 Amyloid-beta precursor protein Proteins 0.000 description 1
- 101710095342 Apolipoprotein B Proteins 0.000 description 1
- 102100040202 Apolipoprotein B-100 Human genes 0.000 description 1
- 102100029470 Apolipoprotein E Human genes 0.000 description 1
- 101710095339 Apolipoprotein E Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 102100036597 Basement membrane-specific heparan sulfate proteoglycan core protein Human genes 0.000 description 1
- 108010049955 Bone Morphogenetic Protein 4 Proteins 0.000 description 1
- 239000004135 Bone phosphate Substances 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 208000021479 Cardiovascular injury Diseases 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- ZEOWTGPWHLSLOG-UHFFFAOYSA-N Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F Chemical compound Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F ZEOWTGPWHLSLOG-UHFFFAOYSA-N 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 229920002101 Chitin Polymers 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 102100031162 Collagen alpha-1(XVIII) chain Human genes 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 229920000089 Cyclic olefin copolymer Polymers 0.000 description 1
- AEMOLEFTQBMNLQ-AQKNRBDQSA-N D-glucopyranuronic acid Chemical compound OC1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-AQKNRBDQSA-N 0.000 description 1
- 102000003915 DNA Topoisomerases Human genes 0.000 description 1
- 108090000323 DNA Topoisomerases Proteins 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000289659 Erinaceidae Species 0.000 description 1
- 108090000371 Esterases Proteins 0.000 description 1
- 101150021185 FGF gene Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108090000378 Fibroblast growth factor 3 Proteins 0.000 description 1
- 102100028043 Fibroblast growth factor 3 Human genes 0.000 description 1
- 102100028072 Fibroblast growth factor 4 Human genes 0.000 description 1
- 108090000381 Fibroblast growth factor 4 Proteins 0.000 description 1
- 108090000380 Fibroblast growth factor 5 Proteins 0.000 description 1
- 102100028073 Fibroblast growth factor 5 Human genes 0.000 description 1
- 108090000382 Fibroblast growth factor 6 Proteins 0.000 description 1
- 102100028075 Fibroblast growth factor 6 Human genes 0.000 description 1
- 102100028071 Fibroblast growth factor 7 Human genes 0.000 description 1
- 108090000385 Fibroblast growth factor 7 Proteins 0.000 description 1
- 108090000368 Fibroblast growth factor 8 Proteins 0.000 description 1
- 102100037680 Fibroblast growth factor 8 Human genes 0.000 description 1
- 102100037665 Fibroblast growth factor 9 Human genes 0.000 description 1
- 108090000367 Fibroblast growth factor 9 Proteins 0.000 description 1
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 description 1
- 101710182389 Fibroblast growth factor receptor 2 Proteins 0.000 description 1
- 102000016970 Follistatin Human genes 0.000 description 1
- 108010014612 Follistatin Proteins 0.000 description 1
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000010956 Glypican Human genes 0.000 description 1
- 108050001154 Glypican Proteins 0.000 description 1
- 108060003393 Granulin Proteins 0.000 description 1
- 102100038367 Gremlin-1 Human genes 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 102000004032 Heparin Cofactor II Human genes 0.000 description 1
- 108090000481 Heparin Cofactor II Proteins 0.000 description 1
- 102400001369 Heparin-binding EGF-like growth factor Human genes 0.000 description 1
- 101800001649 Heparin-binding EGF-like growth factor Proteins 0.000 description 1
- 102000019267 Hepatic lipases Human genes 0.000 description 1
- 108050006747 Hepatic lipases Proteins 0.000 description 1
- 101000864318 Homo sapiens Binder of sperm protein homolog 1 Proteins 0.000 description 1
- 101000762379 Homo sapiens Bone morphogenetic protein 4 Proteins 0.000 description 1
- 101001032872 Homo sapiens Gremlin-1 Proteins 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 102000011782 Keratins Human genes 0.000 description 1
- 108010076876 Keratins Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- AEMOLEFTQBMNLQ-HNFCZKTMSA-N L-idopyranuronic acid Chemical compound OC1O[C@@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-HNFCZKTMSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 239000004367 Lipase Substances 0.000 description 1
- 108010013563 Lipoprotein Lipase Proteins 0.000 description 1
- 102100022119 Lipoprotein lipase Human genes 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 102100030610 Mothers against decapentaplegic homolog 5 Human genes 0.000 description 1
- 101710143113 Mothers against decapentaplegic homolog 5 Proteins 0.000 description 1
- 208000006670 Multiple fractures Diseases 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 125000003047 N-acetyl group Chemical group 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- 108050000637 N-cadherin Proteins 0.000 description 1
- PRDZVHCOEWJPOB-IVMDWMLBSA-N N-sulfo-D-glucosamine Chemical compound OC[C@H]1OC(O)[C@H](NS(O)(=O)=O)[C@@H](O)[C@@H]1O PRDZVHCOEWJPOB-IVMDWMLBSA-N 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 238000010222 PCR analysis Methods 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 102000015439 Phospholipases Human genes 0.000 description 1
- 108010064785 Phospholipases Proteins 0.000 description 1
- 102000004211 Platelet factor 4 Human genes 0.000 description 1
- 108090000778 Platelet factor 4 Proteins 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102000007324 Protease Nexins Human genes 0.000 description 1
- 108010007544 Protease Nexins Proteins 0.000 description 1
- 241000508269 Psidium Species 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 230000010799 Receptor Interactions Effects 0.000 description 1
- 101700032040 SMAD1 Proteins 0.000 description 1
- 102100034201 Sclerostin Human genes 0.000 description 1
- 108050006698 Sclerostin Proteins 0.000 description 1
- 101100043638 Solanum tuberosum SS3 gene Proteins 0.000 description 1
- 102000005262 Sulfatase Human genes 0.000 description 1
- OUUQCZGPVNCOIJ-UHFFFAOYSA-M Superoxide Chemical compound [O-][O] OUUQCZGPVNCOIJ-UHFFFAOYSA-M 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 102000019361 Syndecan Human genes 0.000 description 1
- 108050006774 Syndecan Proteins 0.000 description 1
- 229920006362 Teflon® Polymers 0.000 description 1
- 102000007000 Tenascin Human genes 0.000 description 1
- 108010008125 Tenascin Proteins 0.000 description 1
- 108060008245 Thrombospondin Proteins 0.000 description 1
- 102000002938 Thrombospondin Human genes 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- KZWHEHSUEBTKJM-SLPGGIOYSA-N [(2r,3r,4s,5r)-3,4,5,6-tetrahydroxy-1-oxohexan-2-yl]sulfamic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](C=O)NS(O)(=O)=O KZWHEHSUEBTKJM-SLPGGIOYSA-N 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000001133 acceleration Effects 0.000 description 1
- 125000000218 acetic acid group Chemical group C(C)(=O)* 0.000 description 1
- 238000010306 acid treatment Methods 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000000488 activin Substances 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000001070 adhesive effect Effects 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 230000001270 agonistic effect Effects 0.000 description 1
- IAJILQKETJEXLJ-QTBDOELSSA-N aldehydo-D-glucuronic acid Chemical compound O=C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C(O)=O IAJILQKETJEXLJ-QTBDOELSSA-N 0.000 description 1
- RGCKGOZRHPZPFP-UHFFFAOYSA-N alizarin Chemical compound C1=CC=C2C(=O)C3=C(O)C(O)=CC=C3C(=O)C2=C1 RGCKGOZRHPZPFP-UHFFFAOYSA-N 0.000 description 1
- 125000005210 alkyl ammonium group Chemical group 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 239000000908 ammonium hydroxide Substances 0.000 description 1
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 230000003305 autocrine Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- MSWZFWKMSRAUBD-QZABAPFNSA-N beta-D-glucosamine Chemical compound N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-QZABAPFNSA-N 0.000 description 1
- DHCLVCXQIBBOPH-UHFFFAOYSA-N beta-glycerol phosphate Natural products OCC(CO)OP(O)(O)=O DHCLVCXQIBBOPH-UHFFFAOYSA-N 0.000 description 1
- GHRQXJHBXKYCLZ-UHFFFAOYSA-L beta-glycerolphosphate Chemical compound [Na+].[Na+].CC(CO)OOP([O-])([O-])=O GHRQXJHBXKYCLZ-UHFFFAOYSA-L 0.000 description 1
- 239000005312 bioglass Substances 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000033558 biomineral tissue development Effects 0.000 description 1
- 230000002305 biomodulatory effect Effects 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 238000011095 buffer preparation Methods 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 125000002843 carboxylic acid group Chemical group 0.000 description 1
- 230000022159 cartilage development Effects 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- DIUIQJFZKRAGBZ-UHFFFAOYSA-N chetoseminudin A Natural products O=C1C(SSS2)(CO)N(C)C(=O)C32CC2(N4C5=CC=CC=C5C(CC56C(N(C)C(CO)(SS5)C(=O)N6C)=O)=C4)C4=CC=CC=C4NC2N31 DIUIQJFZKRAGBZ-UHFFFAOYSA-N 0.000 description 1
- 210000001612 chondrocyte Anatomy 0.000 description 1
- 229940107200 chondroitin sulfates Drugs 0.000 description 1
- 108010008846 chordin Proteins 0.000 description 1
- 102000006533 chordin Human genes 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 230000002301 combined effect Effects 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 230000006854 communication Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000001010 compromised effect Effects 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 239000005289 controlled pore glass Substances 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 150000001925 cycloalkenes Chemical class 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000006196 deacetylation Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 230000008846 dynamic interplay Effects 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000007515 enzymatic degradation Effects 0.000 description 1
- 238000006345 epimerization reaction Methods 0.000 description 1
- 238000010931 ester hydrolysis Methods 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000002270 exclusion chromatography Methods 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000013265 extended release Methods 0.000 description 1
- 239000011536 extraction buffer Substances 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 239000003517 fume Substances 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 229940097042 glucuronate Drugs 0.000 description 1
- 229940097043 glucuronic acid Drugs 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 210000002288 golgi apparatus Anatomy 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 102000022382 heparin binding proteins Human genes 0.000 description 1
- 108091012216 heparin binding proteins Proteins 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 229940014041 hyaluronate Drugs 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 210000004347 intestinal mucosa Anatomy 0.000 description 1
- 230000004068 intracellular signaling Effects 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- AEMOLEFTQBMNLQ-CLQWQSTFSA-N l-iduronic acid Chemical compound O[C@H]1O[C@H](C(O)=O)[C@H](O)[C@@H](O)[C@@H]1O AEMOLEFTQBMNLQ-CLQWQSTFSA-N 0.000 description 1
- 235000019421 lipase Nutrition 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 239000003055 low molecular weight heparin Substances 0.000 description 1
- 229940127215 low-molecular weight heparin Drugs 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000012092 media component Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000002297 mitogenic effect Effects 0.000 description 1
- 230000004001 molecular interaction Effects 0.000 description 1
- 238000000302 molecular modelling Methods 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- 210000000107 myocyte Anatomy 0.000 description 1
- 230000004070 myogenic differentiation Effects 0.000 description 1
- 230000001114 myogenic effect Effects 0.000 description 1
- DIOQZVSQGTUSAI-UHFFFAOYSA-N n-butylhexane Natural products CCCCCCCCCC DIOQZVSQGTUSAI-UHFFFAOYSA-N 0.000 description 1
- 230000010807 negative regulation of binding Effects 0.000 description 1
- 230000017095 negative regulation of cell growth Effects 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 210000001178 neural stem cell Anatomy 0.000 description 1
- 210000000461 neuroepithelial cell Anatomy 0.000 description 1
- GQPLMRYTRLFLPF-UHFFFAOYSA-N nitrous oxide Inorganic materials [O-][N+]#N GQPLMRYTRLFLPF-UHFFFAOYSA-N 0.000 description 1
- 238000000655 nuclear magnetic resonance spectrum Methods 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 210000004663 osteoprogenitor cell Anatomy 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 230000003076 paracrine Effects 0.000 description 1
- LCCNCVORNKJIRZ-UHFFFAOYSA-N parathion Chemical compound CCOP(=S)(OCC)OC1=CC=C([N+]([O-])=O)C=C1 LCCNCVORNKJIRZ-UHFFFAOYSA-N 0.000 description 1
- 108010049224 perlecan Proteins 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 239000005020 polyethylene terephthalate Substances 0.000 description 1
- 229920000139 polyethylene terephthalate Polymers 0.000 description 1
- 229920000193 polymethacrylate Polymers 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920000915 polyvinyl chloride Polymers 0.000 description 1
- 239000004800 polyvinyl chloride Substances 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 159000000001 potassium salts Chemical class 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000000135 prohibitive effect Effects 0.000 description 1
- 230000007026 protein scission Effects 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 210000004708 ribosome subunit Anatomy 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- 239000003001 serine protease inhibitor Substances 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 230000003019 stabilising effect Effects 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 230000003068 static effect Effects 0.000 description 1
- 230000003335 steric effect Effects 0.000 description 1
- 238000002305 strong-anion-exchange chromatography Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 108060007951 sulfatase Proteins 0.000 description 1
- 229910021653 sulphate ion Inorganic materials 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000009469 supplementation Effects 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- ABZLKHKQJHEPAX-UHFFFAOYSA-N tetramethylrhodamine Chemical compound C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=CC=C1C([O-])=O ABZLKHKQJHEPAX-UHFFFAOYSA-N 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 230000009772 tissue formation Effects 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 210000003954 umbilical cord Anatomy 0.000 description 1
- 108010047303 von Willebrand Factor Proteins 0.000 description 1
- 102100036537 von Willebrand factor Human genes 0.000 description 1
- 229960001134 von willebrand factor Drugs 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Landscapes
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Abstract The isolation and identification of glycosaminoglycans capable of binding to proteins having a heparin-binding domain is disclosed, as well as the use of the glycosaminoglycans isolated in the growth and/or development of tissue. 6103564_1 (GHMatters) P86576.AU.1 LEOWNR
Description
1 2015200096 09 Jan 2015
Isolation and Identification of Glycosaminoglycans
The entire disclosure in the complete specification of our Australian Patent Application No. 2009290755 is by this cross-reference incorporated into the present specification.
Field of the Invention
The present invention relates to the isolation and identification of glycosaminoglycans capable of binding to proteins having a heparin-binding domain, as well as to the use of the glycosaminoglycans isolated in the growth and/or development of tissue.
Background to the Invention
Glycosaminoglycans (GAGs) are complex carbohydrate macromolecules responsible for performing and regulating a vast number of essential cellular functions. GAGs have been implicated in the modulation or mediation of many signalling systems in concert with the many hundreds of known heparin-binding growth and adhesive factors. It is contemplated that the association of growth factors with GAGs modulates their various activities with a diverse range of actions, such as lengthening their half-lives by protecting them from proteolytic degradation, modulating localisation of these cytokines at the cell surface, mediating molecular interactions and stabilising ligand-receptor complexes.
There are an ever increasing number of identified heparin-binding growth factors, 25 adding to the hundreds already known, most of which were purified by heparin affinity chromatography. They include the extensive fibroblast growth factor (FGF) family, the PDGFs and the pleiotropins through to the TGF-β superfamily of cytokines. This latter family of factors encompasses the osteo-inductive bone morphogenetic protein (BMP) subfamily, so named for their ability to induce ectopic bone formation. 30
The nature and effect of the interaction of GAGs and growth factors remains unclear. Although the interaction between FGF2 and particular saccharide sequences found within heparin has been shown to be of high affinity, it remains generally unclear whether the association between other growth factors and heparans involves a high 35 affinity or specific binding interaction between an amino acid sequence epitope on the
6103564_1 (GHMatters) P86576.AU.1 LECWNR 2 protein growth factor and a saccharide sequence embedded in the GAG, or whether the association is mediated by lower affinity, non-specific interactions between the GAG and protein growth factor.
If interactions between GAGs and proteins resident in, or secreted into, the extracellular matrix are specific, the binding partners need to be identified in order to unravel the interactions and understand how these interactions may be used or modulated to provide new treatments. A major question that arises is, therefore, whether there are saccharide sequences embedded in the chains of GAG molecules that match primary amino acid sequences within the polypeptide backbone of growth factors so controlling their association, and so bioactivity, with absolute, or at least relative, specificity.
It is to be understood that, if any prior art publication is referred to herein, such reference does not constitute an admission that the publication forms a part of the common general knowledge in the art, in Australia or any other country.
Summary of the Invention
We have devised a method to answer this question which involves enriching for glycosaminoglycan molecules that exhibit binding to particular polypeptides having a heparin-binding domain. Isolated GAG mixtures and/or molecules can then be identified and tested for their ability to modulate the growth and differentiation of cells and tissue expressing a protein containing the heparin-binding domain. For the first time, this enables the controlled analysis of the effect of particular GAG saccharide sequences on the growth and differentiation of cells and tissue, both in vitro and in vivo. A first aspect provides a method of isolating heparan sulphate capable of specific and high affinity binding to a protein having a heparin-binding domain, the method comprising: (i) providing a solid support having peptide molecules adhered to the support, wherein the peptide molecules comprise the heparin-binding domain and optionally one or more additional amino acids at one or each of the N- and C- terminal ends wherein the number of such additional amino acids is 1-20; (ii) contacting the peptide molecules with a glycosaminoglycan mixture enriched for heparan sulphate such that peptide-heparan sulphate complexes form; 8580231 _1 (GHMatters) P86576.AU.1 ©-Jan-17 3 (iii) partitioning peptide-heparan sulphate complexes from the remainder of the mixture which does not bind the heparin-binding domain, or does not specifically bind the heparin-binding domain; (iv) dissociating heparan sulphate from the peptide-heparan sulphate complexes; and (v) collecting the dissociated heparan sulphate, wherein the dissociated heparan sulfate is enriched for molecules that are capable of specific and high affinity binding to the heparin binding domain. A second aspect provides a method of identifying heparan sulphate capable of stimulating or inhibiting growth and/or differentiation of cells and/or tissues, the method comprising: (i) providing a solid support having peptide molecules adhered to the support, wherein the peptide molecules comprise a heparin-binding domain and optionally one or more additional amino acids at one or each of the N- and C- terminal ends wherein the number of such additional amino acids is 1-20; (ii) contacting the peptide molecules with a glycosaminoglycan mixture enriched for heparan sulphate such that peptide-heparan sulphate complexes form; (iii) partitioning peptide-heparan sulphate complexes from the mixture remainder which does not bind the heparin-binding domain, or does not specifically bind the heparinbinding domain; (iv) dissociating heparan sulphate from the polypeptide-heparan sulphate complexes; (v) collecting the dissociated heparan sulphate, wherein the dissociated heparan sulfate is enriched for molecules that are capable of specific and high affinity binding to the heparin binding domain; (vi) adding the collected heparan sulphate to cells or tissues in which a protein comprising the heparin-binding domain amino acid sequence is present; and (vii) measuring one or more of: proliferation of the cells, differentiation of the cells, expression of one or more protein markers.
Also disclosed is a method of isolating glycosaminoglycans capable of binding to proteins having heparin/heparan-binding domains, the method comprising: (i) providing a solid support having polypeptide molecules adhered to the support, wherein the polypeptide comprises a heparin-binding domain; (ii) contacting the polypeptide molecules with a mixture comprising glycosaminoglycans such that polypeptide-glycosaminoglycan complexes are allowed to form; 8580231J (GHMatters) P86576.AU.1 9-Jan-17 4 (iii) partitioning polypeptide-glycosaminoglycan complexes from the remainder of the mixture; (iv) dissociating glycosaminoglycans from the polypeptide-glycosaminoglycan complexes; (v) collecting the dissociated glycosaminoglycans.
Also disclosed are isolated glycosaminoglycans identified by their ability to modulate the growth or differentiation of cells or tissues. A method of identifying glycosaminoglycans capable of stimulating or inhibiting the growth and/or differentiation of cells and/or tissues is disclosed, the method comprising: (i) providing a solid support having polypeptide molecules adhered to the support, wherein the polypeptide comprises a heparin-binding domain; (ii) contacting the polypeptide molecules with a mixture comprising glycosaminoglycans such that polypeptide-glycosaminoglycan complexes are allowed to form; (iii) partitioning polypeptide-glycosaminoglycan complexes from the remainder of the mixture; (iv) dissociating glycosaminoglycans from the polypeptide-glycosaminoglycan complexes; (v) collecting the dissociated glycosaminoglycans; (vi) adding the collected glycosaminoglycans to cells or tissues in which a protein containing the amino acid sequence of the heparin-binding domain is present; (vii) measuring one or more of: proliferation of the cells, differentiation of the cells, expression of one or more protein markers.
In embodiments of the present invention the mixture comprising GAGs may contain synthetic glycosaminoglycans. However, in preferred embodiments GAGs obtained from cells or tissues are used. For example, the mixture may contain extracellular matrix wherein the extracellular matrix material is obtained by scraping live tissue in situ (i.e. directly from the tissue in the body of the human or animal from which it is obtained) or by scraping tissue (live or dead) that has been extracted from the body of the human or animal. Alternatively, the extracellular matrix material may be obtained from cells grown in culture. The extracellular matrix material may be obtained from connective tissue or connective tissue cells, e.g. bone, cartilage, muscle, fat, ligament or tendon. 8580231 _1 (GHMatters) P86576.AU.1 9-Jan-17 5
The GAG component may be extracted from a tissue or cell sample or extract by a series of routine separation steps (e.g. anion exchange chromatography), well known to those of skill in the art. GAG mixtures may contain a mixture of different types of glycosaminoglycan, which may include dextran sulphates, chondroitin sulphates and heparan sulphates. In preferred embodiments the GAG mixture contacted with the solid support has been enriched for one of these types of glycosaminoglycan, most preferably for heparan sulphate. A heparan sulphate-, chondroitin sulphate- or dextran sulphate-enriched GAG fraction may be obtained by performing column chromatography on the GAG mixture, e.g. weak, medium or strong anion exchange chromatography, as well as strong high pressure liquid chromatography (SAX-HPLC), with selection of the appropriate fraction.
The collected GAGs may be subjected to further analysis in order to identify the GAG, e.g. determine GAG composition or sequence, or determine structural characteristics of the GAG. GAG structure is typically highly complex, and, taking account of currently available analytical techniques, exact determinations of GAG sequence structure are not possible in most cases.
However, the collected GAG molecules may be subjected to partial or complete saccharide digestion (e.g. chemically by nitrous acid or enzymatically with lyases such as heparinase III) to yield saccharide fragments that are both characteristic and diagnostic of the GAG. In particular, digestion to yield disaccharides (or tetrasaccharides) may be used to measure the percentage of each disaccharide obtained which will provide a characteristic disaccharide “fingerprint” of the GAG.
The pattern of sulphation of the GAG can also be determined and used to determine GAG structure. For example, for heparan sulphate the pattern of sulphation at amino sugars and at the C2, C3 and C6 positions may be used to characterise the heparan sulphate.
Disaccharide analysis, tetrasaccharide analysis and analysis of suphation can be used in conjunction with other analytical techniques such as HPLC, mass spectrometry and NMR which can each provide unique spectra for the GAG. In combination, these techniques may provide a definitive structural characterisation of the GAG. A high affinity binding interaction between the GAG and heparin-binding domain indicates 8580231.1 (GHMatters) P86576.AU.1 9-Jan-17 6 that the GAG will contain a specific saccharide sequence that contributes to the high affinity binding interaction. A further step may comprise determination of the complete or partial saccharide sequence of the GAG, or the key portion of the GAG, involved in the binding interaction.
In one embodiment, GAG-polypeptide complexes may be subjected to treatment with an agent that lyses glycosaminoglycan chains, e.g. a lyase. Lyase treatment may cleave portions of the bound GAG that are not taking part in the binding interaction with the polypeptide. Portions of the GAG that are taking part in the binding interaction with the polypeptide may be protected from lyase action. After removal of the lyase, e.g. following a washing step, the GAG molecule that remains bound to the polypeptide represents the specific binding partner (“GAG ligand”) of the polypeptide. Owing to the lower complexity of shorter GAG molecules, following dissociation and collection of the GAG ligand, a higher degree of structural characterisation of the GAG ligand can be expected. For example, the combination of any of the saccharide sequence (i.e. the primary (linear) sequence of monosaccharides contained in the GAG ligand), sulphation pattern, disaccharide and/or tetrasaccharide digestion analysis, NMR spectra, mass spectrometry spectra and HPLC spectra may provide a high level of structural characterisation of the GAG ligand.
Also disclosed is a GAG having high binding affinity for BMP2. More preferably the GAG is a heparan sulphate (HS). The HS was isolated from a GAG mixture obtained from the extracellular matrix of osteoblasts by following the methodology of the present invention in which a polypeptide comprising the heparin-binding domain of BMP2 (SEQ ID NO:1) was attached to a solid support and GAG-polypeptide complexes were allowed to form. Dissociation of the GAG component from the GAG-polypeptide complexes led to isolation of a unique HS herein called “HS/BMP2”.
Also disclosed is HS/BMP2. HS/BMP2 may be provided in isolated or purified form. Also disclosed is culture media comprising HS/BMP2.
Also disclosed is a pharmaceutical composition or medicament comprising HS/BMP2 is provided, optionally in combination with a pharmaceutically acceptable carrier, adjuvant or diluent. In some embodiments pharmaceutical compositions or medicaments may further comprise BMP2 protein. Pharmaceutical compositions or medicaments comprising HS/BMP2 are provided for use in the prevention or treatment of injury or disease. The use of HS/BMP2 in the manufacture of a medicament for the prevention or treatment of injury or 8580231.1 (GHMatters) P86576.AU.1 9-Jan-17 7 disease is also provided.
Also disclosed is a method of preventing or treating injury or disease in a patient in need of treatment thereof, the method comprising administering an effective amount of HS/BMP2 to the patient. The administered HS/BMP2 may be formulated in a suitable pharmaceutical composition or medicament and may further comprise a pharmaceutically acceptable carrier, adjuvant or diluent. Optionally, the pharmaceutical composition or medicament may also comprise BMP2 protein.
Also disclosed is a method of promoting or inhibiting osteogenesis (the formation of bone cells and/or bone tissue) comprising administering HS/BMP2 to bone precursor cells or bone stem cells.
Also disclosed is a method of promoting or inhibiting the formation of cartilage tissue (chondrogenesis), comprising administering HS/BMP2 to cartilage precursor cells or cartilage stem cells.
The methods of stimulating or inhibiting osteogenesis or formation of cartilage tissue may be conducted in vitro by contacting bone or cartilage precursor or stem cells with HS/BMP2, optionally in the presence of exogenously added BMP2 protein. The precursor cells or stem cells may be mesenchymal stem cells. Where tissue formation is promoted, the tissue formed may be collected and used for implantation into a human or animal patient.
Also disclosed is connective tissue wherein the connective tissue is obtained by in vitro culture of mesenchymal stem cells in the presence of HS/BMP2 (i.e. exogenous HS/BMP2), and optionally in the presence of BMP2 (i.e. exogenous BMP2). The connective tissue may be bone, cartilage, muscle, fat, ligament or tendon.
The prevention or treatment of disease using HS/BMP2 may involve the repair, regeneration or replacement of tissue, particularly connective tissue such as bone, cartilage, muscle, fat, ligament or tendon.
In patients having a deterioration of one of these tissues, administration of HS/BMP2 to the site of deterioration may be used to stimulate the growth, proliferation and/or differentiation of tissue at that site. For example, stimulation of mesenchymal stem cells present at, or near to, the site of administration may lead, preferably when BMP2 is also present at the 8580231 _1 (GHMatters) P86576.AU.1 ©-Jan-17 7a site, to the proliferation and differentiation of the mesenchymal stem cells into the appropriate connective tissue, thereby providing for replacement/regeneration of the damaged tissue and treatment of the injury.
Alternatively, connective tissue obtained from in vitro culture of mesenchymal stem cells in contact with HS/BMP2 may be collected and implanted at the site of injury or disease to replace damaged or deteriorated tissue. The damaged or deteriorated tissue may optionally first be excised from the site of injury or disease.
Also disclosed is a pharmaceutical composition containing stem cells, preferably mesenchymal stem cells, and HS/BMP2. Administration, e.g. injection, of the composition at the site of injury, disease or deterioration provides for the regeneration of tissue at the site.
Accordingly, HS/BMP2 is useful in wound healing in vivo, including tissue repair, regeneration and/or replacement (e.g. healing of scar tissue or a broken bone) effected by direct application of HS/BMP2, optionally in combination with BMP2 and/or stem cells, to the patient requiring treatment. HS/BMP2 is also useful in the in vitro generation of tissue suitable for implantation into a patient in need of tissue repair, regeneration and/or replacement.
Description of Preferred Embodiments
In the claims which follow and in the description of the invention, except where the context requires otherwise due to express language or necessary implication, the word “comprise” or variations such as “comprises” or “comprising” is used in an inclusive sense, i.e. to specify the presence of the stated features but not to preclude the presence or addition of further features in various embodiments of the invention.
The present invention relates to GAGs, and especially to methods of enriching mixtures of compounds containing one or more GAGs that bind to a polypeptide corresponding to the heparin-binding domain of a protein that binds heparin/heparan (a “heparin-binding factor”). Enrichment leads to isolation of GAGs, whether as a mixture containing different GAGs or a population of GAGs that are structurally or functionally identical (or substantially identical). The enriched mixture preferably has a modulating effect on the heparin-binding factor. 8580231 _1 (GHMatters) P86576.AU.1 9-Jan-17 8 2015200096 09 Jan 2015
The present invention also relates to mixtures of compounds enriched with one or more GAGs which possess a modulating effect on a heparin/heparan-binding factor, and methods of using such mixtures.
The present invention also relates to GAG molecules which potentiate (e.g. agonize) the activity of BMP-2 and hence its ability to stimulate stem cell proliferation and bone formation.
As used herein, the terms 'enriching', 'enrichment', 'enriched', etc. describes a process (or state) whereby the relative composition of a mixture is (or has been) altered in such a way that the fraction of that mixture given by one or more of those entities is increased, while the fraction of that mixture given by one or more different entities is decreased. GAGs isolated by enrichment may be pure, i.e. contain substantially only one type of GAG, or may continue to be a mixture of different types of GAG, the mixture having a higher proportion of particular GAGs that bind to the heparin-binding domain relative to the starting mixture. GAGs identified by the present invention are preferably GAGs that exhibit a functional effect when contacted with cells or tissue in which a protein containing the heparin-binding domain is expressed or contained. The functional effect may be a modulating or potentiating effect.
The functional effect may be to promote (stimulate) or inhibit the proliferation of the cells of a certain type or the differentiation of one cell type into another, or the expression of one or 25 more protein markers. For example, the GAGs may promote cell proliferation, i.e. an increase in cell number, or promote differentiation of stem cells into specialised cell types (e.g. mesenchymal stem cells in connective tissue), promote or inhibit the expression of protein markers indicative of the multipotency or differentiation state of the cells (e.g. markers such as alkaline phosphatase activity, detection of RUNX2, osterix, collagen I, II, IV, 30 VII, X, osteopontin, Osteocalcin, BSPII, SOX9, Aggrecan, ALBP, CCAAT/enhancer binding protein-α (C/EBPa), adipocyte lipid binding protein (ALBP), alkaline phosphatise (ALP), bone sialoprotein 2, (BSPII), Collagen2a1 (Coll2a) and SOX9).
As used herein, the term 'modulating effect' is understood to mean the effect that a first 35 entity has on a second entity wherein the second entity's normal function in another process or processes is modified by the presence of the first entity. In a preferred embodiment of the
61035$4_1 (GHMatters) P8$57$.AU.1 LEOWNR 9 2015200096 09 Jan 2015 present invention, the modulating effect may be either agonistic or antagonistic.
The modulating effect may be a potentiating effect. The term 'potentiating effect' is understood to mean the effect of increasing potency. In a preferred embodiment of the present invention, the term 'potentiating effect' refers to the effect that a first entity has on a second entity, which effect increases the potency of that second entity in another process or processes. In a further preferred embodiment of the present invention, the potentiating effect is understood to mean the effect of isolated GAGs on a heparin-binding factor, wherein the said effect increases the potency of said heparin-binding factor.
In a preferred embodiment of the present invention, the potentiating effect is an increase in bioavailability of the heparin-binding factor. In a preferred embodiment of the present invention, the potentiating effect is an increase in bioavailability of BMP2. One method of measuring an increase in bioavailability of the heparin-binding factor is through determining an increase in local concentration of the heparin-binding factor.
In another embodiment of the present invention, the potentiating effect is to protect the heparin-binding factor from degradation. In an especially preferred embodiment of the present invention, the potentiating effect is to protect BMP-2 from degradation. One method of determining a decrease in the degradation of the heparin-binding factor is through measuring an increase in the half-life of the heparin-binding factor.
In another embodiment of the present invention, the potentiating effect is to sequester heparin-binding factors away from cellular receptors. In another embodiment of the present 25 invention, the potentiating effect is to stabilise the ligand-receptor interaction.
The potentiating effect (e.g. modulation of growth or differentiation) may be determined by use of appropriate assays. For example, the effect that an HS has on the stability of BMP-2 may be determined by ELISA. The effect that an HS has on the activity of BMP-2 may be 30 determined by measuring the activation/expression of one or more of SMAD 1, 5 or 8, or measuring the expression of one or more osteogenic marker genes such as Runx2, alkaline phosphatase, Osterix, Osteocalcin and BSP1, or measuring the levels of mineralization using staining such as Alizarin Red and von Kossa.
35 As used herein, the process of 'contacting' involves the bringing into close physical proximity of two or more discrete entities. The process of 'contacting' involves the bringing into close 6103564_1 (GHMatters) P86576.AU.1 LEOWNR 10 2015200096 09 Jan 2015 proximity of two or more discrete entities for a time, and under conditions, sufficient to allow a portion of those two or more discrete entities to interact on a molecular level. Preferably, as used herein, the process of 'contacting' involves the bringing into close proximity of the mixture of compounds possessing one or more GAGs and the polypeptide corresponding to the heparin-binding domain of a heparin-binding factor. Examples of 'contacting' processes include mixing, dissolving, swelling, washing. In preferred embodiments ‘contact’ of the GAG mixture and polypeptide is sufficient for complexes, which may be covalent but are preferably non-covalent, to form between GAGs and polypeptides that exhibit high affinity for each other.
The polypeptide may comprise the full length or near full length primary amino acid sequence of a selected protein having a heparin-binding domain. Due to folding that may occur in longer polypeptides leading to possible masking of the heparin-binding domain from the GAG mixture, it is preferred for the polypeptide to be short. Preferably, the polypeptide will have an amino acid sequence that includes the heparin-binding domain and optionally including one or more amino acids at one or each of the N- and C- terminals of the peptides. These additional peptides may enable the addition of linker or attachment molecules to the polypeptide that are required to attach the polypeptide to the solid support.
In preferred embodiments in addition to the number of amino acids in the heparin-binding domain the polypeptide contains 1-20, more preferably 1-10, still more preferably 1-5 additional amino acids. In some embodiments the amino acid sequence of the heparinbinding domain accounts for at least 80% of the amino acids of the polypeptide, more preferably at least 90%, still more preferably at least 95%.
In order to adhere polypeptides to the surface of a solid support the polypeptides are preferably modified to include a molecular tag, and the surface of the solid support is modified to incorporate a corresponding molecular probe having high affinity for the molecular tag, i.e. the molecular tag and probe form a binding pair. In preferred 30 embodiments the tag and/or probe is chosen from any one of: an antibody, a cell receptor, a ligand, biotin, any fragment or derivative of these structures, any combination of the foregoing, or any other structure with which a probe can be designed or configured to bind or otherwise associate with specificity. A preferred binding pair suitable for use as tag and probe is biotin and avidin. 35
The polypeptide is preferably derived from a protein of interest. By “derived from” is meant
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 11 2015200096 09 Jan 2015 that the polypeptide is chosen, selected or prepared because it contains the amino acid sequence of a heparin-binding domain that is present in a protein of interest. In some embodiments, the amino acid sequence of the heparin-binding domain may be modified from that appearing in the protein of interest, e.g. to investigate the effect of changes in the heparin-binding domain sequence on GAG binding.
The protein of interest may be any protein that binds heparin, and therefore has a heparinbinding domain. Preferred proteins include those expressed in the extracellular matrix, in particular in the extracellular matrix of connective tissue (e.g. bone, cartilage, muscle, tendons, ligaments, fat).
Preferred proteins and their heparin-binding domains are set out below:
Protein Amino acid sequence of heparin-binding domain SEQ ID NO. BMP2 QAKHKQRKRLKSSCKRHP 1 BMP4 SPKHHSQRARKKNKNCRRH 2 FGF2 TYRSRKYTSWYVALKRTGQYKLGSKTGPGQK 3 SHH GKRRHPKKLTPLAYKQ 4 VEGF 189 KCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWS 5 FGFR1 APYWTSPEKMEKKLHAVPAAKTVK 6 VITRONECTIN RPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRR 7 PDGF B RVRRPPKGKHRKFKHTH 8 HB-EGF HGKRKKKGKGLGKKRDPCLRKYK 9 FGFR3 APYWTRPERMDKKLLAVPAANTVR 10 FIBRONECTIN TLENVSPPRRARV 11 LAMININ RYWLPRPVCFEKGMNYTVR 12 N-CAM IWKHKGRDVILKKDVRFI 13
It is understood by those skilled in the art that small variations in the amino acid sequence of 15 a particular polypeptide may allow the inherent functionality of that portion to be maintained.
It is also understood that the substitution of certain amino acid residues within a peptide with other amino acid residues that are isosteric and/or isoelectronic may either maintain or improve certain properties of the unsubstituted peptide. These variations are also encompassed within the scope of the present invention. For example, the amino acid 20 alanine may sometimes be substituted for the amino acid glycine (and vice versa) whilst maintaining one or more of the properties of the peptide. The term 'isosteric' refers to a
61035$4_1 (GHMatters) P8$57$.AU.1 LEOWNR 12 2015200096 09 Jan 2015 spatial similarity between two entities. Two examples of moieties that are isosteric at moderately elevated temperatures are the iso-propyl and tert-butyl groups. The term 'isoelectronic' refers to an electronic similarity between two entities, an example being the case where two entities possess a functionality of the same, or similar, pKa.
In embodiments of the present invention, the polypeptide corresponding to the heparinbinding domain may be synthetic or recombinant.
The solid support may be any substrate having a surface to which molecules may be attached, directly or indirectly, through either covalent or non-covalent bonds. The solid support may include any substrate material that is capable of providing physical support for the probes that are attached to the surface. It may be a matrix support. The material is generally capable of enduring conditions related to the attachment of the probes to the surface and any subsequent treatment, handling, or processing encountered during the performance of an assay. The materials may be naturally occurring, synthetic, or a modification of a naturally occurring material. The solid support may be a plastics material (including polymers such as, e.g., poly(vinyl chloride), cyclo-olefin copolymers, polyacrylamide, polyacrylate, polyethylene, polypropylene, poly(4-methylbutene), polystyrene, polymethacrylate, poly(ethylene terephthalate), polytetrafluoroethylene (PTFE or Teflon®), nylon, poly(vinyl butyrate)), etc., either used by themselves or in conjunction with other materials. Additional rigid materials may be considered, such as glass, which includes silica and further includes, for example, glass that is available as Bioglass. Other materials that may be employed include porous materials, such as, for example, controlled pore glass beads. Any other materials known in the art that are capable of having one or more 25 functional groups, such as any of an amino, carboxyl, thiol, or hydroxyl functional group, for example, incorporated on its surface, are also contemplated.
Preferred solid supports include columns having a polypeptide immobilized on a surface of the column. The surface may be a wall of the column, and/or may be provided by beads 30 packed into the central space of the column.
The polypeptide may be immobilised on the solid support. Examples of methods of immobilisation encompassed within the scope of the present invention include: adsorption, covalent binding, entrapment and membrane confinement. In a preferred embodiment of the 35 present invention the interaction between the polypeptide and the matrix is substantially permanent. In a further preferred embodiment of the present invention, the interaction
6103564_1 (GHMatters) P8$57$.AU.1 LEOWNR 13 2015200096 09 Jan 2015 between the peptide and the matrix is suitably inert to ion-exchange chromatography. In a preferred embodiment, the polypeptide is attached to the surface of the solid support. It is understood that a person skilled in the art would have a large array of options to choose from to chemically and/or physically attach two entities to each other. These options are all encompassed within the scope of the present invention. In a preferred embodiment of the present invention, the polypeptide is adsorbed to a solid support through the interaction of biotin with streptavidin. In a representative example of this particular embodiment, a molecule of biotin is bonded covalently to the polypeptide, whereupon the biotin-polypeptide conjugate binds to streptavidin, which in turn has been covalently bonded to a solid support. In another embodiment of the present invention, a spacer or linker moiety may be used to connect the molecule of biotin with the polypeptide, and/or the streptavidin with the matrix.
By contacting the GAG mixture with the solid support GAG-polypeptide complexes are allowed to form. These are partitioned from the remainder of the mixture by removing the remainder of the mixture from the solid support, e.g. by washing the solid support to elute non-bound materials. Where a column is used as the solid support non-binding components of the GAG mixture can be eluted from the column leaving the GAG-polypeptide complexes bound to the column.
In the present invention, it is understood that certain oligosaccharides may interact in a nonspecific manner with the polypeptide. In certain embodiments, oligosaccharide which interacts with the polypeptide in a non-specific manner may be included in, or excluded from the mixture of compounds enriched with one or more GAGs that modulate the effect of a heparin-binding factor. An example of a non-specific interaction is the temporary 25 confinement within a pocket of a suitably sized and/or shaped molecule. Further it is understood that these oligosaccharides may elute more slowly than those oligosaccharides that display no interaction with the peptide at all. Furthermore it is understood that the compounds that bind non-specifically may not require the input of the same external stimulus to make them elute as for those compounds that bind in a specific manner (for 30 example through an ionic interaction). The present invention is capable of separating a mixture of oligosaccharides into those components of that mixture that: bind in a specific manner to the polypeptide; those that bind in a non-specific manner to the polypeptide; and those that do not bind to the polypeptide. These designations are defined operationally for each GAG-peptide pair. 35
By varying the conditions (e.g. salt concentration) present at the surface of the solid support
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 14 2015200096 09 Jan 2015 where binding of the GAG and polypeptide occurs those GAGs having the highest affinity and/or specificity for the heparin-binding domain can be selected. GAGs may accordingly be obtained that have a high binding affinity for a protein of interest and/or the heparin-binding domain of the protein of interest. The binding affinity (Kd) may be chosen from one of: less than 10μΜ, less than 1μΜ, less than 100nM, less than 10nM, less than 1nM, less than 100pM. GAGs obtained by the methods of the invention may be useful in a range of applications, in vitro and/or in vivo. The GAGs may be provided for use in stimulation or inhibition of cell or tissue growth and/or proliferation and/or differentiation either in cell or tissue culture in vitro, or in cells or tissue in vivo.
The GAGs may be provided as a formulation for such purposes. For example, culture media may be provided comprising a GAG obtained by the method of the present invention.
Cells or tissues obtained from in vitro cell or tissue culture in the presence of GAGs obtained by the method of the present invention may be collected and implanted into a human or animal patient in need of treatment. A method of implantation of cells and/or tissues may therefore be provided, the method comprising the steps of: (a) culturing cells and/or tissues in vitro in contact with GAGs obtained by the method of the present invention; (b) collecting the cells and/or tissues; (c) implanting the cells and/or tissues into a human or animal subject in need of 25 treatment.
The cells may be cultured in part (a) in contact with the GAGs for a period of time sufficient to allow growth, proliferation or differentiation of the cells or tissues. For example, the period of time may be chosen from: at least 5 days, at least 10 days, at least 20 days, at least 30 days or at least 40 days. 30
In another embodiment the GAGs may be formulated for use in a method of medical treatment, including the prevention or treatment of injury or disease. A pharmaceutical composition or medicament may be provided comprising the GAGs and a pharmaceutically acceptable diluent, carrier or adjuvant. Such pharmaceutical compositions or medicaments 35 may be provided for the prevention or treatment of injury or disease. The use of a GAG obtained by the method of the present invention in the manufacture of a medicament for the
61035$4_1 (GHMatters) P86576.AU.1 LEOWNR 15 2015200096 09 Jan 2015 prevention or treatment of injury or disease is also provided. Optionally, pharmaceutical compositions and medicaments according to the present invention may also contain the protein of interest having the heparin-binding domain to which the GAG binds. In further embodiments the pharmaceutical compositions and medicaments may further comprise stem cells, e.g. mesenchymal stem cells.
Treatment of injury or disease may comprise the repair, regeneration or replacement of cells or tissue, such as connective tissue (e.g. bone, cartilage, muscle, fat, tendon or ligament). For the repair of tissue, the pharmaceutical composition or medicament comprising the GAG may be administered directly to the site of injury or disease in order to stimulate the growth, proliferation and/or differentiation of new tissue to effect a repair of the injury or to cure or alleviate (e.g. provide relief to the symptoms of) the disease condition. The repair or regeneration of the tissue may be improved by combining stem cells in the pharmaceutical composition or medicament.
For the replacement of tissue, GAGs may be contacted with cells and/or tissue during in vitro culture of the cells and/or tissue in order to generate cells and/or tissue for implantation at the site of injury or disease in the patient. Implantation of cells or tissue can be used to effect a repair of the injured or diseased tissue in the patient by replacement of the injured or diseased tissue. This may involve excision of injured/diseased tissue and implantation of new tissue prepared by culture of cells and/or tissue in contact with a GAG obtained by the method of the present invention.
Pharmaceutical compositions and medicaments according to the present invention may 25 therefore comprise one of: (a) GAGs obtained by the method of the invention; (b) GAGs obtained by the method of the invention in combination with stem cells; (c) GAGs obtained by the method of the invention in combination with a protein containing the heparin-binding domain bound by the GAG; 30 (d) GAGs obtained by the method of the invention in combination with stem cells and a protein containing the heparin-binding domain bound by the GAG; (e) Tissues or cells obtained from culture of cells or tissues in contact with GAGs obtained by the method of the invention.
35 GAGs isolated according to the method of the present invention may be used in the repair or regeneration of bodily tissue, especially bone regeneration, neural regeneration, skeletal 61035$4_1 (GHMatters) P8$576.AU.1 LEOWNR 16 2015200096 09 Jan 2015 tissue construction, the repair of cardio-vascular injuries and the expansion and self-renewal of embryonic and adult stem cells. Accordingly, the GAGs may be used to prevent or treat a wide range of diseases and injuries, including osteoarthritis, cartilage replacement, broken bones of any kind (e.g. spinal disc fusion treatments, long bone breaks, cranial defects), critical or non-union bone defect regeneration.
The use of GAGs according to the present invention in the repair, regeneration or replacement of tissue may involve use in wound healing, e.g. acceleration of wound healing, healing of scar or bone tissue and tissue grafting.
In another aspect, the present invention provides a biological scaffold comprising GAGs isolated by the method of the present invention. In some embodiments, the biological scaffolds of the present invention may be used in orthopaedic, vascular, prosthetic, skin and corneal applications. The biological scaffolds provided by the present invention include extended-release drug delivery devices, tissue valves, tissue valve leaflets, drug-eluting stents, vascular grafts, wound healing or skin grafts and orthopaedic prostheses such as bone, ligament, tendon, cartilage and muscle. In a preferred embodiment of the present invention, the biological scaffold is a catheter wherein the inner (and/or outer) surface comprises one or more GAG compounds attached to the catheter.
In another aspect, the present invention provides one or more GAGs isolated by the method of the present invention for use as an adjuvant. In an especially preferred aspect of the present invention, the adjuvant is an immune adjuvant. 25 In another aspect, the present invention provides pharmaceutically acceptable formulations comprising a mixture of compounds comprising one or more GAGs, said mixture being enriched with respect to GAGs that modulate a heparin-binding factor. In another aspect, the invention provides pharmaceutically acceptable formulations comprising: (i) a mixture of compounds comprising one or more GAGs, said mixture being 30 enriched with respect to GAGs that modulate a heparin-binding factor; and (ii) the heparin-binding factor, for separate, simultaneous or sequential administration. In a preferred embodiment the formulation comprises the mixture of compounds comprising one or more GAGs, said mixture being enriched with respect to GAGs that modulate a heparin-binding factor and the 35 heparin-binding factor in intimate admixture, and is administered simultaneously to a patient in need of treatment. In a further embodiment of the invention, the formulation comprises the
6103564.1 (GHMatters) P86576.AU.1 LEOWNR 17 2015200096 09 Jan 2015 mixture of compounds comprising one or more GAGs, said mixture being enriched with respect to GAGs that modulate BMP-2 and BMP-2 in intimate admixture, and is administered simultaneously to a patient in need of treatment.
In another aspect of the present invention a kit is provided for use in the repair, or regeneration of tissue, said kit comprising (i) a predetermined amount of a GAG having high affinity for a protein having a heparin-binding domain, and (ii) a predetermined amount of the protein having said heparin-binding domain.
In preferred embodiments the GAG is HS/BMP2 and the protein having the heparin-binding domain is BMP2.
The compounds of the enriched mixtures of the present invention can be administered to a subject as a pharmaceutically acceptable salt thereof. For example, base salts of the compounds of the enriched mixtures of the present invention include, but are not limited to, those formed with pharmaceutically acceptable cations, such as sodium, potassium, lithium, calcium, magnesium, ammonium and alkylammonium. The present invention includes within its scope cationic salts, for example the sodium or potassium salts.
It will be appreciated that the compounds of the enriched mixtures of the present invention which bear a carboxylic acid group may be delivered in the form of an administrable prodrug, wherein the acid moiety is esterified (to have the form -C02R'). The term "pro-drug" specifically relates to the conversion of the -OR' group to a -OH group, or carboxylate anion therefrom, in vivo. Accordingly, the prodrugs of the present invention may act to enhance 25 drug adsorption and/or drug delivery into cells. The in vivo conversion of the prodrug may be facilitated either by cellular enzymes such as lipases and esterases or by chemical cleavage such as in vivo ester hydrolysis.
Medicaments and pharmaceutical compositions according to aspects of the present 30 invention may be formulated for administration by a number of routes, including but not limited to, injection at the site of disease or injury. The medicaments and compositions may be formulated in fluid or solid form. Fluid formulations may be formulated for administration by injection to a selected region of the human or animal body. 35 Administration is preferably in a "therapeutically effective amount", this being sufficient to show benefit to the individual. The actual amount administered, and rate and time-course of
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 18 2015200096 09 Jan 2015 administration, will depend on the nature and severity of the injury or disease being treated. Prescription of treatment, e.g. decisions on dosage etc, is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington’s Pharmaceutical Sciences, 20th Edition, 2000, pub. Lippincott, Williams & Wilkins.
In this specification a patient to be treated may be any animal or human. The patient may be a non-human mammal, but is more preferably a human patient. The patient may be male or female.
Methods according to the present invention may be performed in vitro or in vivo, as indicated. The term “in vitro” is intended to encompass procedures with cells in culture whereas the term “in vivo” is intended to encompass procedures with intact multi-cellular organisms.
Stem cells
Cells contacted with GAGs obtained by the method of the present invention include stem cells.
The stem cells cultured and described herein may be stem cells of any kind. They may be totipotent or multipotent (pluripotent). They may be embryonic or adult stem cells from any 25 tissue and may be hematopoietic stem cells, neural stem cells or mesenchymal stem cells. Preferably they are adult stem cells. More preferably they are adult mesenchymal stem cells, e.g. capable of differentiation into connective tissue and/or bone cells such as chondrocytes, osteoblasts, myocytes and adipocytes. The stem cells may be obtained from any animal or human, e.g. non-human animals, e.g. rabbit, guinea pig, rat, mouse or other 30 rodent (including cells from any animal in the order Rodentia), cat, dog, pig, sheep, goat, cattle, horse, non-human primate or other non-human vertebrate organism; and/or nonhuman mammalian animals; and/or human. Optionally they are non-human.
In this specification, by stem cell is meant any cell type that has the ability to divide (i.e. self-35 renew) and remain totipotent or multipotent (pluripotent) and give rise to specialized cells if so desired.
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 19 2015200096 09 Jan 2015
Stem cells cultured in the present invention may be obtained or derived from existing cultures or directly from any adult, embryonic or fetal tissue, including blood, bone marrow, skin, epithelia or umbilical cord (a tissue that is normally discarded).
The multipotency of stem cells may be determined by use of suitable assays. Such assays may comprise detecting one or more markers of pluripotency, e.g. alkaline phosphatase activity, detection of RUNX2, osterix, collagen I, II, IV, VII, X, osteopontin, Osteocalcin, BSPII, SOX9, Aggrecan, ALBP, CCAAT/enhancer binding protein-α (C/EBPa), adipocyte lipid binding protein (ALBP), alkaline phosphatise (ALP), bone sialoprotein 2, (BSPII), Collagen2a1 (Coll2a) and SOX9.
Mesenchymal stem cells or human bone marrow stromal stem cells are defined as pluripotent (multipotent) progenitor cells with the ability to generate cartilage, bone, muscle, tendon, ligament and fat. These primitive progenitors exist postnatally and exhibit stem cell characteristics, namely low incidence and extensive renewal potential. These properties in combination with their developmental plasticity have generated tremendous interest in the potential use of mesenchymal stem cells to replace damaged tissues. In essence mesenchymal stem cells could be cultured to expand their numbers then transplanted to the injured site or after seeding in/on scaffolds to generate appropriate tissue constructs.
Thus, an alternative approach for skeletal, muscular, tendon and ligament repair is the selection, expansion and modulation of the appropriate progenitor cells such as osteoprogenitor cells in the case of bone in combination with a conductive or inductive 25 scaffolds to support and guide regeneration together with judicious selection of specific tissue growth factors.
Human bone marrow mesenchymal stem cells can be isolated and detected using selective markers, such as STRO-I, from a CD34+ fraction indicating their potential for marrow 30 repopulation. These cell surface markers are only found on the cell surface of mesenchymal stem cells and are an indication of the cells pluripotency.
In yet a further aspect of the present invention, a pharmaceutical composition comprising stem cells generated by any of the methods of the present invention, or fragments or 35 products thereof, is provided. The pharmaceutical composition useful in a method of medical treatment. Suitable pharmaceutical compositions may further comprise a pharmaceutically
$1035$4_1 (GHMatters) P8S576.AU.1 LEOWNR 20 2015200096 09 Jan 2015 acceptable carrier, adjuvant or diluent.
In another aspect of the present invention, stem cells generated by any of the methods of the present invention may be used in a method of medical treatment, preferably, a method of medical treatment is provided comprising administering to an individual in need of treatment a therapeutically effective amount of said medicament or pharmaceutical composition.
Stem cells obtained through culture methods and techniques according to this invention may be used to differentiate into another cell type for use in a method of medical treatment.
Thus, the differentiated cell type may be derived from, and may be considered as a product of, a stem cell obtained by the culture methods and techniques described which has subsequently been permitted to differentiate. Pharmaceutical compositions may be provided comprising such differentiated cells, optionally together with a pharmaceutically acceptable carrier, adjuvant or diluent. Such pharmaceutical composition may be useful in a method of medical treatment.
Glvcosaminglvcans
As used herein, the terms 'glycosaminoglycan' and 'GAG' are used interchangeably and are understood to refer to the large collection of molecules comprising an oligosaccharide, wherein one or more of those conjoined saccharides possess an amino substituent, or a derivative thereof. Examples of GAGs are chondroitin sulfate, keratin sulfate, heparin, dermatan sulfate, hyaluronate and heparan sulfate. Heparan sulfates are preferred embodiments of the present invention. 25
As used herein, the term 'GAG' also extends to encompass those molecules that are GAG conjugates. An example of a GAG conjugate is a proteoglycosaminoglycan (PGAG, proteoglycan) wherein a peptidic component is covalently bound to an oligosaccharide component. 30
In the present invention, it is understood that there are a large number of sources of GAG compounds including natural, synthetic or semi-synthetic. A preferred source of GAGs is biological tissue. A preferred source of GAGs is a stem cell. An especially preferred source of GAGs is a stem cell capable of differentiating into a cell that corresponds to a tissue that 35 will be the subject of treatment. For example, GAGs can be sourced from preosteoblasts for use in bone regeneration or skeletal tissue construction. In an especially preferred
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 21 2015200096 09 Jan 2015 embodiment of the present invention, GAGs may be sourced from an immortalised cell line. In a further preferred embodiment of the present invention, GAGs may be sourced from an immortalised cell line which is grown in a bioreactor. Another preferred source of GAGs is a synthetic source. In this respect, GAGs may be obtained from the synthetic elaboration of commercially available starting materials into more complicated chemical form through techniques known, or conceivable, to one skilled in the art. An example of such a commercially available starting material is glucosamine. Another preferred source of GAGs is a semi-synthetic source. In this respect, synthetic elaboration of a natural starting material, which possesses much of the complexity of the desired material, is elaborated synthetically using techniques known, or conceivable, to one skilled in the art. Examples of such a natural starting material are chitin and dextran, and examples of the types of synthetic steps that may elaborate that starting material, into a GAG mixture suitable for use in the present invention, are amide bond hydrolysis, oxidation and sulfation. Another example of a semisynthetic route to GAGs of the desired structure comprises the synthetic interconversion of related GAGs to obtain GAGs suitable for use in the present invention.
Heparan sulphate (HS)
In preferred aspects of the invention the glycosaminoglycan or proteoglycan is preferably a heparan sulfate.
Heparan sulfate proteoglycans (HSPGs) represent a highly diverse subgroup of proteoglycans and are composed of heparan sulfate glycosaminoglycan side chains covalently attached to a protein backbone. The core protein exists in three major forms: a 25 secreted form known as perlecan, a form anchored in the plasma membrane known as glypican, and a transmembrane form known as syndecan. They are ubiquitous constituents of mammalian cell surfaces and most extracellular matrices. There are other proteins such as agrin, or the amyloid precursor protein, in which an HS chain may be attached to less commonly found cores. 30 “Heparan Sulphate” (“Heparan sulfate" or "HS") is initially synthesised in the Golgi apparatus as polysaccharides consisting of tandem repeats of D-glucuronic acid (GIcA) and N-acetyl-D-glucosamine (GIcNAc). The nascent polysaccharides may be subsequently modified in a series of steps: N-deacetylation/N-sulfation of GIcNAc, C5 epimerisation of GIcA to iduronic 35 acid (IdoA), O-sulphation at C2 of IdoA and GIcA, O- sulphation at C6 of N-sulphoglucosamine (GIcNS) and occasional O-sulphation at C3 of GIcNS. N-
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 22 2015200096 09 Jan 2015 deacetylation/N-sulphation, 2-0-, 6-0- and 3-O-sulphation of HS are mediated by the specific action of HS N-deacetylase/N-sulfotransferase (HSNDST), HS 2-0- sulfotransferase (HS2ST), HS 6-O-sulfotransferase (HS6ST) and HS 3-O-sulfotransferase, respectively. At each of the modification steps, only a fraction of the potential substrates are modified, resulting in considerable sequence diversity. This structural complexity of HS has made it difficult to determine its sequence and to understand the relationship between HS structure and function.
Heparan sulfate side chains consist of alternately arranged D-glucuronic acid or L-iduronic acid and D-glucosamine, linked via (1 -> 4) glycosidic bonds. The glucosamine is often N-acetylated or N-sulfated and both the uronic acid and the glucosamine may be additionally O-sulfated. The specificity of a particular HSPG for a particular binding partner is created by the specific pattern of carboxyl, acetyl and sulfate groups attached to the glucosamine and the uronic acid. In contrast to heparin, heparan sulfate contains less N- and O-sulfate groups and more N-acetyl groups. The heparan sulfate side chains are linked to a serine residue of the core protein through a tetrasaccharide linkage (-glucuronosyl-p-(1-> 3)-galactosyl-p-(1—► 3)-galactosyl-p-(1—► 4)-xylosyl-p-1-0-(Serine)) region.
Both heparan sulfate chains and core protein may undergo a series of modifications that may ultimately influence their biological activity. Complexity of HS has been considered to surpass that of nucleic acids (Lindahl et al, 1998, J. Biol. Chem. 273, 24979; Sugahara and Kitagawa, 2000, Curr. Opin. Struct. Biol. 10, 518). Variation in HS species arises from the synthesis of non-random, highly sulfated sequences of sugar residues which are separated by unsulfated regions of disaccharides containing N- acetylated glucosamine. The initial 25 conversion of N-acetylglucosamine to N- sulfoglucosamine creates a focus for other modifications, including epimerization of glucuronic acid to iduronic acid and a complex pattern of O-sulfations on glucosamine or iduronic acids. In addition, within the non-modified, low sulfated, N-acetylated sequences, the hexuronate residues remain as glucuronate, whereas in the highly sulfated N-sulfated regions, the C-5 epimer iduronate predominates. 30 This limits the number of potential disaccharide variants possible in any given chain but not the abundance of each. Most modifications occur in the N-sulfated domains, or directly adjacent to them, so that in the mature chain there are regions of high sulfation separated by domains of low sulfation (Brickman et al. (1998), J. Biol. Chem. 273(8), 4350-4359, which is herein incorporated by reference in its entirety). 35
It is hypothesized that the highly variable heparan sulfate chains play key roles in the 6103564.1 (GHMatters) P86576.AU.1 LEOWNR 23 2015200096 09 Jan 2015 modulation of the action of a large number of extracellular ligands, including regulation and presentation of growth and adhesion factors to the cell, via a complicated combination of autocrine, juxtacrine and paracrine feedback loops, so controlling intracellular signaling and thereby the differentiation of stem cells. For example, even though heparan sulfate glycosaminoglycans may be genetically described (Alberts et al. (1989) Garland Publishing, Inc, New York & London, pp. 804 and 805), heparan sulfate glycosaminoglycan species isolated from a single source may differ in biological activity. As shown in Brickman et al, 1998, Glycobiology 8, 463, two separate pools of heparan sulfate glycosaminoglycans obtained from neuroepithelial cells could specifically activate either FGF-1 or FGF-2, depending on mitogenic status. Similarly, the capability of a heparan sulfate (HS) to interact with either FGF-1 or FGF-2 is described in WO 96/23003. According to this patent application, a respective HS capable of interacting with FGF-1 is obtainable from murine cells at embryonic day from about 11 to about 13, whereas a HS capable of interacting with FGF-2 is obtainable at embryonic day from about 8 to about 10.
As stated above HS structure is highly complex and variable between HS. Indeed, the variation in HS structure is considered to play an important part in contributing toward the different activity of each HS in promoting cell growth and directing cell differentiation. The structural complexity is considered to surpass that of nucleic acids and although HS structure may be characterised as a sequence of repeating disaccharide units having specific and unique sulfation patterns at the present time no standard sequencing technique equivalent to those available for nucleic acid sequencing is available for determining HS sequence structure. In the absence of simple methods for determining a definitive HS sequence structure HS molecules are positively identified and structurally characterised by 25 skilled workers in the field by a number of analytical techniques. These include one or a combination of disaccharide analysis, tetrasaccharide analysis, HPLC and molecular weight determination. These analytical techniques are well known to and used by those of skill in the art. 30 Two techniques for production of di- and tetra- saccharides from HS include nitrous acid digestion and lyase digestion. A description of one way of performing these digestion techniques is provided below, purely by way of example, such description not limiting the scope of the present invention. 35 Nitrous acid digestion
Nitrous acid based depolymerisation of heparan sulphate leads to the eventual degradation $103564_1 (GHMatters) P86576.AU.1 LEOWNR 24 2015200096 09 Jan 2015 of the carbohydrate chain into its individual disaccharide components when taken to completion.
For example, nitrous acid may be prepared by chilling 250 μΙ of 0.5 M H2S04| and 0.5 M Ba(N02)2 separately on ice for 15 min. After cooling, the Ba(N02)2is combined with the H2S04 and vortexed before being centrifuged to remove the barium sulphate precipitate. 125 μΙ of HN02 was added to GAG samples resuspended in 20 μΙ of H20, and vortexed before being incubated for 15 min at 25°C with occasional mixing. After incubation, 1 M Na2C03 was added to the sample to bring it to pH 6. Next, 100 μΙ of 0.25 M NaBH4 in 0.1 M NaOH is added to the sample and the mixture heated to 50°C for 20 min. The mixture is then cooled to 25°C and acidified glacial acetic acid added to bring the sample to pH 3. The mixture is then neutralised with 10 M NaOH and the volume decreased by freeze drying. Final samples are run on a Bio-Gel P-2 column to separate di- and tetrasaccharides to verify the degree of degradation.
Lyase digestion
Heparinise III cleaves sugar chains at glucuronidic linkages. The series of Heparinase enzymes (I, II and III) each display relatively specific activity by depolymerising certain heparan sulphate sequences at particular sulfation recognition sites. Heparinase I cleaves HS chains with NS regions along the HS chain. This leads to disruption of the sulphated domains. Heparinase III depolymerises HS with the NA domains, resulting in the separation of the carbohydrate chain into individual sulphated domains. Heparinase II primarily cleaves in the NA/NS “shoulder” domains of HS chains, where varying sulfation patterns are found. Note: The repeating disaccharide backbone of the heparan polymer is a uronic acid 25 connected to the amino sugar glucosamine. “NS” means the amino sugar is carrying a sulfate on the amino group enabling sulfation of other groups at C2, C6 and C3. “NA” indicates that the amino group is not sulphated and remains acetylated.
For example, for depolymerisation in the NA regions using Heparinase III both enzyme and 30 lyophilised HS samples are prepared in a buffer containing 20 mM Tris-HCL, 0.1 mg/ml BSA and 4 mM CaCI2 at pH 7.5. Purely by way of example, Heparinase III may be added at 5 mU per ^g of HS and incubated at 37°C for 16 h before stopping the reaction by heating to 70°C for 5 min. 35 Di- and tetrasaccharides may be eluted by column chromatography.
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 25 2015200096 09 Jan 2015
Heparin-binding domains
Cardin and Weintraub (Molecular Modeling of Protein-Glycosaminoglycan Interactions, Arteriosclerosis Vol. 9 No.1 Jan/Feb 1989 p.21-32), incorporated herein in entirety by reference, describes consensus sequences for polypeptide heparin-binding domains. The consensus sequence has either a stretch of di- or tri-basic residues separated by two or three hydropathic residues terminated by one or more basic residues. Two particular consensus sequences were identified: XBBXBX [SEQ ID NO: 15] and XBBBXXBX [SEQ ID NO: 16] in which B is a basic residue (e.g. Lysine, Arginine, Histidine) and X is a hydropathic residue (e.g. Alanine, Glycine, Tyrosine, Serine). Heparin-binding domains are reported to be abundant in amino acids Asn, Ser, Ala, Gly, lie, Leu and Tyr and have a low occurrence of amino acids Cys, Glu, Asp, Met, Phe and Trp.
These consensus sequences may be used to search protein or polypeptide amino acid sequences in order to identify candidate heparin-binding domain amino acid sequences which may be synthesised and tested for GAG binding in accordance with the present invention. WO 2005/014619 A2 also discloses numerous heparin-binding peptides. The contents of WO 2005/014619 A2 are incorporated herein in entirety by reference.
Proteins containing heparin-binding domains
The following proteins are known to contain heparin-binding domains, and polypeptides 25 derived from the amino acid sequences of these proteins may be used for the identification of GAGs according to the present invention.
Mitogens/Morphogens/ Chemokines
Fibroblast Growth Factors (FGF-1, FGF-2, FGF-3, FGF-4, FGF-5, FGF-6, FGF-7, FGF-8, 30 FGF-9) as well as the FGF receptors FGFR1, FGFR2, FGFR3; HGF (Hepatocyte growth factor); VEGFs (Vascular endothelial growth factor); Activins; BMPs (Bone morphogenetic protein, e.g. BMP-2, BMP-4); TGF-Bs (Transforming growth factor); PDGFs (Platelet-derived growth factor); OPG (Osteoprotegerin); HB-GAM (Heparin-binding growth-associated molecules); pleiotropins; GM-CSF (Granulocyte-macrophage colony-stimulating factor); 35 lnterferon-χ; NT4/5 (Neurotophin); GDNF (Glial cell-derived neurotrophic factor); Wnts Hedgehogs.
61035$4_1 (GHMatters) P86576.AU.1 LEOWNR 26 2015200096 09 Jan 2015
Antagonists
Noggin, Chordin, Sclerostin, CTGF (Connective Tissue Growth Factor), Follistatin, Gremlin. Adhesive Glycoproteins
Fibronectin, Vitronectin, Laminin, Collagens, Thrombospondin, Tenascin, vonWillebrand Factor, NCAM (Neural Cell Adhesion Molecule), N-cadherin
Enzymes
Lipoprotein Lipase, Hepatic Lipase, Phospholipase, Apolipoprotein B, Apolipoprotein E. Serine protease inhibitors
Antithrombin III, Heparin Co-factor II, Protease Nexins Other Factors
Superoxide Dimustase, Elastase, Platelet Factor 4, N-CAM, Transcription Factors, DNA Topoisomerase, RNA Polymerase, Tumor Necrosis Factor.
The invention includes the combination of the aspects and preferred features described except where such a combination is clearly impermissible or expressly avoided.
The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described. 25 Aspects and embodiments of the present invention will now be illustrated, by way of example, with reference to the accompanying figures. Further aspects and embodiments will be apparent to those skilled in the art. All documents mentioned in this text are incorporated herein by reference. 30 Brief Description of the Figures
Embodiments and experiments illustrating the principles of the invention will now be discussed with reference to the accompanying figures in which:
Figure 1. Anion exchange chromatography of MX samples disrupted using 8 M 35 Urea/CHAPS buffer. A large GAG peak is observed after 1M NaCI elution.
$1035$4_1 (GHMatters) P86576.AU.1 LEOWNR 27 2015200096 09 Jan 2015
Figure 2. Representative chromatogram of the desalting system during MX-derived GAG purification. The initial peak (12-18 min) represents full length GAG chains. The conductivity peak and debris peak (19-30 min) represent salt and GAG debris elution.
Figure 3. tGAGs (2.5 mg) loaded onto an underivatised Hi-Trap streptavidin column. All GAGs elute from the column in the flowthrough, indicating no “background” attachment of GAGs to the column.
Figure 4. BMP2-HBP (1 mg) pre-incubated with tGAGs (25 mg) for 30 min. Elution profile shows the peptide (280 nm) exiting the column in the flowthrough together with the tGAG sample.
Figure 5. BMP2-HBP (1 mg) loaded onto a Hi-Trap column. The 280 nm absorbance levels indicate that the peptide remains attached to the column even under high salt conditions; thus there was successful coupling of the biotinylated peptide to the streptavidin linker.
Figure 6. BMP2-HBP (1 mg) coupled column loaded with of 25 mg of tGAGs. The chromatogram (232 nm) clearly shows both an overloading of the column, in the flow through as well as the binding of some GAGs to the BMP2-HBP bed.
Figure 7. Re-application of the GAG- (flowthrough) fractions from the previous experiment (Fig. 6). The presence of a significant GAG+ elution peak indicates that all available BMP2-HBP binding sites had been saturated, resulting in a large proportion of susceptible GAGs exiting the column in the flowthrough.
Figure 8. BMP2-HBP (2 mg) coupled column loaded with tGAGs (6 mg). The chromatogram (232 nm) clearly shows no overloading of the column, and the presence of a GAG subpopulation with a relative affinity for the BMP2-HBP. 30 Figure 9. Re-run of GAG- (flowthrough) from previous run (Fig. 8). The absence of a GAG+ elution peak indicates that the available BMP2-HBP binding sites were not saturated in the previous run, allowing the efficient extraction of GAG+ sugars in a single run.
Figure 10. Re-application of isolated full length GAG+ fractions (2 mg) shows no change in 35 affinity for the BMP2-HBP (2 mg) column prior to heparinase III digestion. A reapplication of GAG- fractions against the BMP2-HBP column also showed no change in affinity, with all
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 28 2015200096 09 Jan 2015 GAGs exiting the column in the flowthrough essentially as in Figure 9.
Figure 11. GAG- fractions (1 mg) digested with heparinase III before loading onto the BMP2-HBP (2 mg) column. The chromatogram (232 nm) clearly shows that no GAG samples remain bound to the column, but exit in the flowthrough. This indicates the absence of any GAG+ domains in the full length GAG- chains.
Figure 12. GAG+ fractions (2 mg) digested with heparinase 3 before loading onto the BMP2-HBP (2 mg) column. The chromatogram (232 nm) demonstrates that the GAG+ samples are retained by the column, suggesting that all domains on the full length GAG+ chain have a relative affinity for the BMP2-HBP. The increase in the absorbance peak, as compared to the same dry weight quantity of GAG+ (Fig. 10), indicates the efficacy of the heparinase 3 treatment.
Figure 13. Full length GAG+ chains separated using a Biogel P10 column with an exclusion limit of between 1.5 kDa and 20 kDa . The chromatogram shows that a large proportion of the sample chains have an overall molecular weight of more than 20 kDa.
Figure 14. Full length GAG+ sugar chains treated with nitrous acid for 20 min to diagnostically degrade heparan sulfate species. The chromatogram, generated from a Biogel P10 sizing column, shows an almost complete degradation of all GAG+ chains as compared to Figure 13, indicating that GAG+ isolated chains consist primarily of heparan sulfate. 25 Figure 15. Chondroitin-4-sulfate (6 mg) loaded onto BMP2-HBP (2 mg) column. The chromatogram clearly illustrates a significant proportion of the GAG chains having an affinity for the peptide, as they eluted at a similar salt concentration as the GAG+ samples.
Figure 16. Chondroitin-6-sulfate (6 mg) loaded onto BMP2-HBP (2 mg) column. The 30 chromatogram indicates that few of the C6S GAG chains have any affinity for the peptide column.
Figure 17. Dermatan sulfate (6 mg) loaded onto the BMP2-HBP (2 mg) affinity column. The chromatogram indicates that few of the DS GAG chains had any affinity for the peptide, with 35 only a small proportion of the GAGs being eluted at a similar salt concentration to GAG+ samples.
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 29 2015200096 09 Jan 2015
Figure 18. Bovine heparan sulfate (2.5 mg) loaded onto the BMP2-HBP (2 mg) column. The chromatogram (232 nm) reveals only a small fraction of the GAGs binding to the column.
Figure 19. Heparin-LMW (50 mg) loaded onto the BMP2-HBP (2 mg) column. The chromatogram (232 nm) reveals that almost no GAG bound to the peptide.
Figure 20. Heparin-HMW (28 mg) loaded onto the BMP2-HBP (2 mg) column. The chromatogram (232 nm) reveals that almost no GAG bound to the peptide.
Figure 21. Heparin-HMW (25 mg) predigested with heparinase I was loaded onto the BMP2-HBP (2 mg) column. The chromatogram (232 nm) reveals that very few GAG fragments bound to the peptide.
Figure 22. Chromatogram showing steps in isolation of BMP-2 peptide specific HS by affinity chromatography.
Figure 23. Chromatogram showing elution of BMP-2 peptide specific HS (GAG+) by affinity chromatography.
Figure 24. Chromatogram showing elution of BMP-2 peptide non-specific HS (GAG-) by affinity chromatography.
Figure 25. Chromatogram showing elution of Sigma HS (H9902) standard under size 25 exclusion chromatography on Superdex 75 column.
Figure 26. Chromatogram showing elution of BMP-2 peptide specific HS (GAG+) under size exclusion chromatography on Superdex 75 column. 30 Figure 27. Graph showing Osterix expression in C2C12 cells in response to control media, 100ng/ml BMP2 and 300ng/ml BMP2.
Figure 28. Graph showing Osteocalcin expression in C2C12 cells in response to control media, 100ng/ml BMP2 and 300ng/ml BMP2. 35
Figure 29. Graph showing Runx2 expression in C2C12 cells in response to control media, 6103564_1 (GHMatters) P86576.AU.1 LEOWNR 30 2015200096 09 Jan 2015 100ng/ml BMP2 and 300ng/ml BMP2.
Figure 30. Graph showing expression of Alkaline Phosphatase as measured by quantative PCR in C2C12 cells in response to control media, BMP-2, Negative GAG (GAG-), Positive GAGs (GAG+), Total HS and Heparin (Hep).
Figure 31. Graph showing expression of Osterix as measured by quantative PCR in C2C12 cells in response to control media, BMP-2, Negative GAG (GAG-) + BMP-2, Positive GAGs (GAG+) + BMP-2, Total HS and Heparin (Hep).
Figure 32. Graph showing expression of Bspll as measured by quantative PCR in C2C12 cells in response to control media, BMP-2, Negative GAG (GAG-) + BMP-2, Positive GAGs (GAG+) + BMP-2, Total HS and Heparin (Hep).
Figure 33. Graph showing expression of Runx2 as measured by quantative PCR in C2C12 cells in response to control media, BMP-2, Negative GAG (GAG-) + BMP-2, Positive GAGs (GAG+) + BMP-2, Total HS and Heparin (Hep).
Figure 34. Graph showing expression of Osteocalcin in C2C12 cells in response to BMP and GAG+ (+ BMP-2) isolated from MC3T3-E1 cells.
Detailed Description of the Invention
The details of one or more embodiments of the invention are set forth in the accompanying description below including specific details of the best mode contemplated by the inventors 25 for carrying out the invention, by way of example. It will be apparent to one skilled in the art that the present invention may be practiced without limitation to these specific details.
We investigated the potential of GAGs to augment the activities of bone morphogenic protein 2 (BMP2). The highly osteoinductive activity of BMP2 for the murine myogenic 30 cell line C2C12 have been well characterised. Studies both in this cell line, and in vivo, have implicated a role for glycosaminoglycans in modulating this activity. BMP2’s affinity for heparin has similarly been well characterised. Numerous studies have been conducted that have sought to examine the dynamic interaction between 35 BMP2 and GAGs. Some have proposed that the interaction is inhibitory, and so responsible for either sequestering the cytokine away from the receptor or inducing its
$1035$4_1 (GHMatters) P8657$.AU.1 LEOWNR 31 2015200096 09 Jan 2015 association with its numerous inhibitors, such as noggin, that have been shown, similarly, to have an affinity for heparin. Alternative findings implicate the interaction between BMP2 and GAGs is one of maintaining a local concentration of the cytokine around cells that require its signalling in order to differentiate into the osteoblast lineage.
These findings also suggest that the association serves to significantly lengthen the half-life of the homodimer, so allowing it to remain active in the ECM for longer periods. As is the case with most systems, the actual role of this interaction is likely to be blend of some, or all of the above.
Although many studies have provided evidence for the interaction that BMP2 has with model sugars, the specific interaction between the BMP2 heparin-binding peptide (BMP2-HBP), a string of amino acids (QAKHKQRKRLKSSCKRHP [SEQ ID NO: 1]) located at the N-terminal end of each BMP2 monomer, and appropriate glycosaminoglycans has received relatively little attention. A major question that arises is whether there is a complementary saccaharide sequence embedded within an HS chain that controls the association with an absolute, or at least relative, specificity.
We sought to isolate a sequence-specific glycosaminoglycan that could modulate BMP2 activity via a direct interaction with the cytokine.
Example 1 25 MATERIALS AND METHODS Buffer Preparation
Preparation of all buffers for GAG extraction and analysis is conducted with strict attention paid to quality. It is vital that the pH of buffers is maintained at the correct level and that all 30 buffers be filtered and degassed in order to prevent the clogging of columns with precipitates or bubbles. The formation of bubbles, in particular, can cause serious damage to columns, and in the case of sealed, pre-fabricated columns, leads to them becoming unusable.
All buffers used were filtered with 1x PBS without Ca2+ or Mg2+ (150mM NaCI), or double 35 distilled (ddH20) to make the final solutions.
6103564_1 (GHMatters) P8$57$.AU.1 LEOWNR 32 2015200096 09 Jan 2015
Disruption Buffer
The 8M Urea/CHAPS disruption buffer consisted of PBS (150mM NaCI) with 1% CHAPS, 8M Urea and 0.02% NaN3 to prevent contamination by microbial growth during storage. This solution was used to disrupt matrix (MX) samples, so was not degassed or filtered. PGAG Anion Exchange Low Salt (250mM) Buffer
Low salt PGAG anion exchange buffer comprised PBS (150mM NaCI) with an additional 100mM NaCI. The buffer was equilibrated to pH 7.3 with NaOH and 0.02% NaN3. The solution was then degassed under negative pressure and constant stirring until no further bubbles were released before being filtered through a 0.4 pm filter. PGAG Anion Exchange High Salt (1M) Buffer
High salt PGAG anion exchange buffer comprised PBS (150mM NaCI) with an additional 850 mM NaCI. The buffer was equilibrated to pH 7.3 with NaOH and 0.02% NaN3 added. The solution was then degassed under negative pressure and constant stirring before being filtered through a 0.4 pm filter.
Pronase/Neuraminidase PGAG Reconstitution Buffer This buffer was used to reconstitute desalted PGAG samples after anion exchange in order to prepare them for enzymatic digestion of the associated core proteins. It consisted of 25 mM sodium acetate (CH3COOHNa). The buffer was 25 equilibrated to pH 5.0 with glacial acetic acid (CH3COOH). Both pronase and neuraminidase enzymes were reconstituted according to the manufacturer’s instructions. GAG Affinity Chromatography Low Salt (150mM1 Buffer 30 Low salt GAG anion exchange buffer was made using PBS (150mM NaCI) without any additional salt. The buffer was equilibrated to pH 7.3 with NaOH and 0.02% NaN3. The solution was degassed under negative pressure and constant stirring until no further bubbles were released before being filtered through a 0.4 pm filter.
6103564.1 (GHMatters) P86576.AU.1 LEOWNR 33 2015200096 09 Jan 2015 GAG Affinity Chromatography High Salt (1M) Buffer
High salt GAG anion exchange buffer was made using PBS (150 mM NaCI) with an additional 850 mM NaCI. The buffer was equilibrated to pH 7.3 with NaOH and 0.02% NaN3 was added,, the solution was then degassed and filtered through a 0.4 pm filter.
Desalting Solution
The desalting solution was made using ddH20 that was equilibrated to pH 7.0 with 0.02% NaN3. The solution was then degassed and filtered.
Sample Preparation
Matrix samples were disrupted using Disruption Buffer (8M Urea/CHAPS), then scraped off the culture surface in this buffer and stirred overnight at 37°C to ensure maximal lysis. The samples were then centrifuged at 5000 g for 30 min and the supernatant was clarified through a 0.4 pm filter in preparation for PGAG extraction via anion exchange chromatography.
Column Preparation & Usage
The choice and preparation of the types of columns to be used for each sequential step in the isolation and characterisation of GAGs is of major importance for the success of the protocol. It was vital that at each step the columns were equilibrated and cleaned with great care.
Anion Exchange Columns 25 Due to the relatively large quantities of MX substrate used for GAG extraction, and the high load this places on the column system, it was necessary to pack and prepare a large anion exchange column manually, specifically for this study.
Capto Q anion exchange beads (Pharmacia) were packed into a Pharmacia XK 26 column (Pharmacia) to produce a column with a maximum loading capacity of 30 500 ml of MX lysate per run.
Prior to use, both the column and all buffers were equilibrated to room temperature for 30 min, before washing and equilibrating the column in PGAG Anion Exchange Low Salt (250 mM) Buffer for 30 min until all absorbance 35 channels remained stable. The clarified cell lysate was then passed through the column which was again rinsed in 500 ml of low salt buffer to remove any nonspecifically
6103564.1 (GHMatters) P86576.AU.1 LEOWNR 34 2015200096 09 Jan 2015 bound debris. PGAGs were then eluted using 250 ml of PGAG Anion Exchange High Salt (1M) Buffer and lyophilised prior to desalting. The column was then rinsed in low salt buffer and returned to 4°C for storage.
Desalting Protocol
After PGAG/GAG isolation it was necessary to remove the high amount of salt that accumulated in the sample during elution from the column. For this step, all eluted samples of the same experimental group were combined and loaded onto 4x Pharmacia HiPrepTM 26/10 desalting columns. Prior to use, both the columns and all solutions were equilibrated to room temperature for 30 min before washing and equilibrating the column in Desalting Solution for 30 min until all absorbance channels achieved stability. Lyophilised samples were reconstituted in Desalting Solution in the minimum possible volume that resulted in a clear solution. This combination of columns permitted the loading of up to 60 ml of sample. Those fractions eluting from the column first were lyophilised and retained for further separation or cell culture application. The columns were then rinsed in Desalting Solution and returned to 4°C for storage. BMP2-HBP Column Preparation
The isolation of GAGs carrying relative affinities for BMP2 was conducted using a BMP2-HBP column. Approximately 2 mg of biotinylated BMP2-HBP was prepared in 1 ml of the GAG Affinity Chromatography Low Salt (150mM) Buffer.
This amount was loaded onto a HiTrap Streptavidin HP column (Pharmacia) and allowed to attach to the column for 5 min. The column was then subjected to a 25 complete run cycle in the absence of GAGs. The column was washed in 13 ml of low salt buffer at a flow rate of 0.5 ml/min before being subjected to 10 ml of GAG High salt buffer at 1 ml/min. Finally the column was rinsed with 10 ml of low salt buffer. During this process data was carefully monitored to ensure that no peptide elution or column degradation was observed. 30 GAG+ Sample Isolation
Once the BMP2-HBP column had been prepared and tested for stability under normal running conditions, it was ready to be used for the separation of GAG+ chains from tGAG (total GAG) samples. tGAG samples (6 mg) were prepared in 3 ml of 35 GAG affinity low salt (150 mM) buffer and injected into a static loop for loading onto the column. Prior to use both the BMP2-HBP column and all buffers were equilibrated to room
61035$4_1 (GHMatters) P86576.AU.1 LEOWNR 35 2015200096 09 Jan 2015 temperature for 30 min before washing and equilibrating the column in low salt buffer for 30 min until all absorbance channels were stable. The sample was then loaded onto the column at 0.5 ml/min and the column and the sample rinsed in 10 ml of low salt buffer at 0.5 ml/min. Retained GAG+ samples were subsequently recovered by elution with 10 ml of high salt (1 M) buffer and lyophilised for desalting. The column was then rinsed in 10 ml of low salt buffer and stored at 4°C.
Pronase/Neuraminidase Treatment
In order to isolate GAG chains from their core proteins, they were digested using pronase and neuraminidase. Lyophilized PGAG samples were resuspended in a minimum volume of 25 mM sodium acetate (pH 5.0) and clarified by filtration through a 0.4 pm syringe filter. Total sample volume was dispensed into 10 ml glass tubes in 500 pi aliquots. 500 pi of 1 mg/ml neuraminidase was added and incubated for 4 h at 37°C. After incubation 5 ml of 100 mM Tris-acetate (pH 8.0) was added to each sample. An additional 1.2 ml of 10 mg/ml pronase, reconstituted in 500mM Tris-acetate, 50 mM calcium acetate (pH 8.0), was added to each sample and incubated for 24 h at 36°C. After treatment all volumes were combined and prepared for anion exchange processing by centrifugation and filtration. GAG Digestion Protocols
The analysis of GAGs, including their sulfated domain sizes and relative sulfation levels, was carried out by using established protocols including degradation by 25 either nitrous acid or lyases.
Nitrous Acid Digestion
Nitrous acid-based depolymerisation of heparan sulfate leads to the eventual degradation of the carbohydrate chain into its individual disaccharide components when 30 taken to completion. Nitrous acid was prepared by chilling 250
pi of 0.5 M H2S04 and 0.5 M Ba(N02)2 separately on ice for 15 min. After cooling, the Ba(N02)2 was combined with the H2S04 and vortexed before being centrifuged to remove the barium sulfate precipitate. 125 pi of HN02 was added to GAG samples resuspended in 20 pi of H20, and vortexed before being 35 incubated for 15 min at 25°C with occasional mixing. After incubation, 1 M Na2C03 was added to the sample to bring it to pH 6. Next, 100 pi of 0.25 M
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 36 2015200096 09 Jan 2015
NaBH4 in 0.1 M NaOH was added to the sample and the mixture was heated to 50°C for 20 min. The mixture was then cooled to 25°C and acidified with glacial acetic acid to pH 3 in the fume hood. The mixture was then neutralised with 10 M NaOH and the volume was then decreased by freeze drying. The final samples were run on a Bio-Gel P-2 column to separate di- and tetrasaccharides to verify degradation.
Heoarinase III Digestion
Heparinase III is an enzyme that cleaves sugar chains at glucuronidic linkages.
The series of heparinase enzymes (I, II and III) each display relatively specific activity by depolymerising certain heparan sulfate sequences at particular sulfation recognition sites. Heparinase I cleaves HS chains within NS regions along the chain. This leads to the disruption of the sulfated domains that are thought to carry most of the biological activity of HS. Heparinase III depolymerises HS within the NA domains, resulting in the separation of the carbohydrate chain into individual sulfated domains. Lastly, Heparinase II primarily cleaves in the NA/NS “shoulder” domains of HS chains, where varying sulfation patterns are found.
In order to isolate potential active domains we focused on the depolymerisation of GAG+ NA regions. Both the enzyme and lyophilised HS samples were prepared in a buffer containing 20 mM Tris-HCI, 0.1 mg/ml BSA and 4 mM CaCI2 at pH 7.5. The concentration of heparinase III added to each sample is governed by the relative quantity of HS components in the sample. Our analysis, via nitrous 25 acid depolymerisation, indicated that the GAG+ samples consisted of predominantly HS; thus the enzyme was used at 5 mU per 1 pg of HS. The sample was incubated at 37°C for 16 h before the reaction was stopped by heating to 70°C for 5 min. The sample was then applied to the appropriate column system for further analysis. 30 Cell Culture GAG Production
In order to isolate GAG species representative of developing osteoblasts, MC3T3 cells were grown in osteogenic conditions for 8 days. The cellular component was removed via incubation in a dilute solution of 0.02 M ammonium hydroxide (NH4OH) at 25°C for 5 min. 35 After 5 min, NH4OH was removed by inversion of the culture surfaces. Treated cultures were allowed to dry in a laminar flow cabinet overnight. The following day the treated cultures
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 37 2015200096 09 Jan 2015 were washed three times with sterile PBS and allowed to dry in the laminar flow cabinet. Prepared matrix cultures were then stored under sterile conditions in 4°C until primary proteoglycans were liberated via treatment with disruption buffer and anion exchange chromatography. BMP2-Specific GAG Bioactivitv C2C12 myoblasts were subcultured every 48 h, to a maximum of 15 passages, by plating at 1.3 x 104 cells/cm2 in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 10% FCS. Osteogenic differentiation was induced at 2 x 104 cells/cm2 in DMEM supplemented with 5% FCS, nominated concentrations of recombinant human bone morphogenic protein-2 (rhBMP2) and glycosaminoglycan fractions with a positive or negative affinity for rhBMP2 (GAG+ and GAG- respectively). rhBMP2 and GAG fractions were pre-incubated for 30 min at 25°C prior to addition to their corresponding C2C12 cultures. The cultures were permitted to grow under these conditions for 5 days, with media for each condition being changed every 48 h, before mRNA samples were extracted and prepared for RQ-PCR analysis. Real time PCR for osteocalcin expression was conduced using the ABI Prism 7000® sequence detection system (PerkinElmer Life Sciences). Primers and probes were designed using Primer Express software (v2.1, PE Applied Biosystems). The target probe was redesigned to incorporate LNA bases and labelled with BHQ-1 (Sigma-Proligo). The ribosomal subunit gene 18S (VIC/TAMRA) was used as an endogenous control, with each condition consisting of three repeats, each tested in triplicate. The raw PCR data was analysed using the ABI Sequence Detector software. Target gene expression values were normalised to 18S 25 expression prior to the calculation of relative expression units (REUs).
RESULTS
Anion Exchange Chromatography 30 In order to successfully extract GAGs from MX samples, it is necessary to remove other matrix proteins that may contaminate the sample. As GAGs constitute the most negatively charged molecules in the ECM, this is most effectively accomplished with anion exchange chromatography. 35 Samples were disrupted using 8M Urea/CHAPS buffer and loaded onto the anion exchange column. Unwanted protein and ECM debris were washed from the column and the
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 38 2015200096 09 Jan 2015 negatively charged GAGs eluted with 1 M NaCI. A typical chromatogram (Fig. 1) clearly shows the flowthrough of a large amount of nonadherent debris, as well as the clean and tight elution of a large quantity of GAGs from the MX preparation. Thus not only does this result demonstrate the purification of GAGs by this method, it also confirms the retention of a large number of GAGs in the ECM after treatment with NH4OH.
Desalting
Virtually all chromatography methods employed to purify and analyse GAGs at various stages of processing require elution with high-salt buffers. As high salt conditions interfere with affinity-based chromatography, it is necessary to desalt samples after each stage of processing. This process is generally completed with size exclusion chromatography. Under these conditions larger molecules, such as GAGs, exit the column before small molecules, including the salt and small GAG debris. The separation of GAGs from the contaminating salt can be followed on the resulting chromatogram (Fig. 2) which also serves to confirm that the GAG chains remained intact during the treatment process. BMP2-HBP Column System Column Preparation
Due to the prohibitive costs involved in creating a BMP2 growth factor column with commercially available reagents, we instead utilised a biotinylated preparation of the known heparin-binding domain of BMP2 (BMP2-HBP). This peptide was immobilised on a Hi-Trap Streptavidin HP column (1 ml) in order to specifically retain GAG chains with an affinity for the specific heparin-binding 25 domain peptide.
First we examined any background affinity the GAGs may have had for the naked streptavidin column by running the total GAG (tGAG) fraction against a column bed devoid of BMP2-HBP (Fig. 3). Our results confirmed that our MX 30 derived tGAG samples carried no inherent affinity for the streptavidin column.
We further investigated two separate methods of exposing tGAGs to the BMP2-HBP for the purpose of separating chains with a specific affinity. The peptide was either pre-incubated for 30 min with 25 mg of tGAGs prior to loading onto the streptavidin column, or was loaded first, with the tGAGs being run through the 35 column bed thereafter.
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 39 2015200096 09 Jan 2015
Pre-incubation of tGAGs with the BMP2-HBP revealed the complete inability of the peptide to associate with the column (Fig. 4), let alone mediate any isolation of specific GAGs. When the peptide was loaded onto the column alone, however, its association with the column was absolute, with effectively no elution of peptide, even under 1 M salt conditions (Fig. 5). This high affinity association indicates that the biotin-streptavidin association is functioning correctly, and suggests a possible inhibition of binding to the column, when loaded together with tGAGs, due to steric hindrance.
Column Loading Capacities
As the proportion of tGAGs that were likely to have a relative affinity for the BMP2-HBP was unknown, we first sought to standardise the quantities of tGAGs loaded onto the peptide column at each run for separation. Hi-Trap columns were prepared by immobilising 1 mg of the BMP2-HBP for the extraction of tGAGs with a specific affinity for the BMP2 heparin-binding site. This amount was selected so as to maximise the quantity of available peptide for future experiments should column stability become compromised overtime. Instability is a significant problem with peptide columns, with corresponding impacts on consistency.
Initial attempts at loading of 25 mg of tGAGs onto a 1 mg BMP2-HBP coupled column resulted in a clear overloading, as observed via absorbance at 232 nm in the flowthrough (Fig. 6). Although a significant elution peak was observed, tGAGs with affinity for the HBP were lost in the flowthrough due to overloading.
This was examined by re-running the flowthrough through the peptide column (Fig. 7). This resulted in a significant GAG+ (elution) peak, indicating that the previous run had saturated the column.
Further optimisation led us to routinely load no more than 6 mg of tGAGs onto a 2 mg BMP2-HBP column. This, as evidenced by the flowthrough peak (Fig. 8) and the absence of a positive-binding fraction (Fig. 9), forestalled column overloading. The extraction of those tGAGs with an affinity for the BMP-HBP 30 from each sample set in a single pass allowed us, in turn, to separate GAG+ and GAG- fractions more efficiently. GAG Domain Analysis GAG+ Chain Specificity 35 With the establishment of a standardised protocol, we were able to reproducibly isolate GAG+ fractions for further analysis.
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 40 2015200096 09 Jan 2015
Given the domain structure of heparan sulfate that mediates the binding specificity for proteins, it is likely that multi-domain GAG chains that bind to the column are in fact composed of a large proportion of chain with little or no specific affinity for BMP2. Similarly, it is possible that chains that appeared GAG- may in fact contain domains that carry some affinity for the BMP2-HBP. In order to examine these possibilities, it was necessary to break down the GAG chains into their component domains for more extensive examination.
The enzyme heparinase III (heparitinase I) cleaves HS chains primarily in those areas flanking highly sulfated regions, thereby liberating the highly charged, protein-associating domains that bind susceptible growth factors, in this case the BMP2-HBP. Both GAG+ and GAG- fractions were exposed to heparinase digestion, although neither fraction showed any change in their affinity for the BMP2-HBP (Fig. 10).
Heparinase III digestion of both full length GAG+ and GAG- fractions was subsequently conducted, and both digested sample sets subsequently loaded onto the BMP2-HBP column to assess retention affinity.
The efficacy of the heparinase digestion was validated by the increase in relative absorbance of samples of equal dry weight after enzymatic digestion, as shown in Figures 10 and 12. As the monitoring of GAG chains at 232 nm is via the sugar chain itself and, in particular, unsaturated bonds, any cleavage along the chain’s length by heparinase III, resulting in unsaturated bonds of HS fragments, leads to an increase in absorbance. 25
Interestingly, heparinase digestion of full length GAG- chains yielded no fractions carrying any notable affinity for the BMP2-HBP (Fig. 11). However, the digestion of full-length GAG+ samples similarly resulted in no fractions that lacked affinity for the BMP2-HBP (Fig. 12). This result suggests that entire chains of BMP-binding GAG are produced 30 containing domain repeats that have a specific affinity for the HBP. Alternatively, the HBP may not be able to yield sufficient discrimination between GAG+ domains with varying affinity under these minimalist conditions. GAG+ Composition 35 Full Length GAG+ Sizing
In order to examine the composition of GAG+ fractions from the BMP2-HBP column, we first
61035$4_1 (GHMatters) P8$57$.AU.1 LEOWNR 41 2015200096 09 Jan 2015 examined their average size. This was to ensure that we were actually separating GAG chains of reasonable length, rather than small fragments not carrying any specific affinity. Although any sizing of GAG chains is problematical, owing to their relatively rigid rod-like conformation, a set of assumptions invoking Stake’s radius and apparent sphericity can be made.
Full length GAG+ samples were loaded onto Biogel P10 gel filtration columns (1 cm x 120 cm) with an exclusion limit of between 20 kDa to 1.5 kDa. Absorbance measured at 232 nm indicated a large proportion of GAG+ molecules had an overall apparent size greater than 20 kDa (Fig. 13).
It has been posited that sugar chains must be longer than approximately 10-14 rings in order to potentiate significant biological activity for the FGF family of mitogens. In terms of apparent molecular weight, a chain of 14 fully sulfated disaccharides corresponds to approximately 8.7 kDa. As the majority of chains found in the GAG+ samples show an apparent molecular weight > 20 kDa, it is reasonable to assume that the interaction that they carry for the BMP2-HBP has some specific affinity and is not the result of a general non-specific interaction. GAG+ Sugar Species
There are five major glycosaminoglycan sugar families: hyaluronan, keratan sulfate, dermatan sulfate, chondroitin sulfate and heparan sulfate. Of these five, only heparan sulfate, chondroitin sulfate and dermatan sulfate have the capacity to generate variably sulfated domains that may code for specific interactions with 25 particular cytokines such as BMP2. The identification of the type of sugar species isolated using the BMP2-HBP column was of crucial importance for this study, and was determined using a combination of diagnostic chemical and enzymatic degradations. In particular, heparan sulfate, one of the major GAG candidates for the interaction with BMP2, can be completely degraded into its 30 disaccharide components in the presence of nitrous acid.
Thus, our HBP-retained GAG samples were incubated with nitrous acid for 20 min prior to separation on a Biogel P10 sizing column. Examination of the resulting chromatogram revealed an almost complete degradation of all GAG+ 35 sugar samples, as measured by absorbance at 232 nm and 226 nm (Fig. 14).
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 42 2015200096 09 Jan 2015
This result strongly suggests that the full length sugar chains isolated specifically against the BMP2-HBP consist primarily of heparan sulfate, as other sugar chains are not affected by nitrous acid depolymerisation.
Although almost all the GAG+ chains could be degraded in such a manner, a small peak was nevertheless observed at higher molecular weights (>20 kDa). It can be postulated to consist of chondroitin sulfates, of which CS-B (dermatan sulfate) and CS-E (chondroitin-4,6-sulfate) demonstrate sulfation complexity akin to heparan sulfates. GAG Species Analysis BMP2-HBP Specific GAGs (Alternative Species)
The degradation of full length GAG+ chains by exposure to nitrous acid clearly indicated that the majority of GAG+ sugar chains consisted of the heparan sulfate sugar species (Fig. 14). The degradation of the GAG+ sample was not, however, complete as was observed by the remnant peak in the high molecular weight region. The presence of this peak points strongly to the possibility of other species of sugar chains, such as chrondroitin or dermatan sulfate. We next sought to examine the possible affinity the other two sugar types may have for this cytokine by first examining a variety of commercially available chondroitin and dermatan sugars for their affinity to the BMP2-HBP column.
We tested chondroitin-4-sulfate (C4S), chondroitin-6-sulfate (C6S) and dermatan sulfate (DS) by, in each instance, loading 6 mg of the sugar onto the BMP2-HBP column under the same conditions used to isolate GAG+ chains from MC3T3 matrix samples. 25
The chromatograms illustrating the affinity of each of the 3 sugar chain types showed that only C4S (Fig. 15) had any significant affinity for the peptide. This affinity taken together with the lack of affinity for the BMP2-HBP column observed for both C6S (Fig. 16) and DS (Fig. 17) samples, appears to 30 indicate that C4S has a particular, potentially significant, interaction with the BMP2 heparin-binding site.
As any potential interaction between chondroitin sulfate and BMP2 has not yet been well characterised, these results led us to question the validity of column 35 chromatography as an accurate monitor of the BMP2/heparan interaction. In order to further explore the specificity of the interaction dynamic, we tested
6103564.1 (GHMatters) P86576.AU.1 LEOWNR 43 2015200096 09 Jan 2015 several commercially available sugar species for their affinity to the column.
These included heparan sulfate, low molecular weight heparin (Heparin-LMW), high molecular weight heparin (Heparin-HMW) and Heparin-HMW treated with heparinase I.
Interestingly, none of these commercially available GAG species appeared to demonstrate any specific interaction with the peptide column. Heparan sulfate from bovine kidney had very little affinity (Fig. 18), a behaviour that was further confirmed by its inability to positively augment FGF2-mediated cell proliferation (data not shown), as is observed in the presence of HS2. This reduced ability of this GAG sample to bind the column may be as a result of it being sold in a relatively unsulfated form.
None of the tested heparin samples showed even a minor affinity for the column.
This is of particular interest as BMP2 itself was historically first isolated using heparin columns. In order to confirm this result, both LMW (Fig. 19) and HMW (Fig. 20) heparin were tested; neither showed any appreciable affinity for the column.
As we surmised that the relatively small BMP2-HBP peptide may have had difficulty maintaining its association with the much larger heparin molecules, we next predigested the heparin-HMW samples using heparinase I. These smaller heparin-HMW fragments were then run over the BMP2-HBP column; this treatment did not, however, appear to improve the ability of any of the heparin 25 samples to bind the peptide column (Fig. 21).
This inability of the peptide column to show any specific interaction with any of the various preparations of heparin was somewhat unexpected, due to BMP2 conventionally being isolated via heparin affinity. It is possible, however, that this may be as a result of the 30 reversing of the “receptor-ligand” order of interaction; in this case the BMP2-HBP represented the fixed “receptor” asopposed to the heparin that represented the “ligand”, or that the concentrations of BMP2-HBP or soluble heparin favour a dissociated state that rapidly negates any affinity under flow/salt stress.
61035$4_1 (GHMatters) P86576.AU.1 LEOWNR 44 2015200096 09 Jan 2015
CONCLUSIONS
The use of a preosteoblast-derived ECM substrate provided us with a useful model for simulating the activity of natively secreted, ECM-associated GAGs in relation to such osteoinduction. Though numerous previous studies have examined the role that this native interaction has in modulating the activity of BMP2, this has usually been conducted at the level of the cytokine, rather than with a view to exploring the sequence specificity of the biomodulating GAGs.
Hence here we sought to exploit the availability of natively secreted GAGs in the MX substrate and their potential for direct, sequence-specific interaction and modulation of BMP2-induced C2C12 myoblast commitment to the osteogenic lineage.
Anion Exchange
The use of this particular standard and well characterised protocol provided us with conclusive evidence for GAG accessibility from the NH4OH-treated MX substrate. Our initial concerns were centred around the harsh chemical treatment used to lyse the cellular components of the ECM, and that this may have also resulted in the stripping of the majority of GAGs from the ECM. However, the significant, high affinity peak observed in the anion exchange chromatogram clearly illustrates the retention of a large quantity of GAGs within the MX substrate. While this particular methodology does not allow for the identification of individual GAG species, it does offer conclusive evidence of their presence in the sample due to their being amongst the most negatively-charged molecules secreted by cells. 25 BMP2-HBP Column System
Previous research into the functional role of the BMP2 heparin-binding peptide provided us with a useful tool to investigate the potentially specific interaction that BMP2 has with GAGs. This single string of amino acids, located at the N-terminus of each BMP2 monomer, appears to be solely responsible for mediating BMP2’s affinity for 30 GAGs.
We thus investigated the use of this region of the BMP2 molecule as a ligand “bait” in attempts to retain those GAG chains that carried relative affinity for the cytokine. The use of the BMP2-HBP in this manner resulted in a significant retention of HS to the peptide column 35 (GAG+).
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 45 2015200096 09 Jan 2015
Column Preparation
Using an N-terminal biotinylated HBP we prepared a BMP2-HBP affinity chromatography column, and were able to successfully retain GAG samples that were candidates for controlling the native BMP2 homodimer. Initial preparations of the column highlighted some interesting problems. Preparations of biotinylated BMP2-HBP that were premixed with tGAGs showed an inability to bind to the column. As later tests showed that the BMP2-HBP easily attached to the streptavidin column when loaded on its own this result indicated that the GAGs interfered with the ability of the peptide’s biotinylation site to associate with the streptavidin column. The tGAGs themselves carried no affinity for the streptavidin, indicating that the direct interaction with the BMP2-HBP, possibly via steric hindrance, was responsible for this.
Column Optimisation
Without any direct information that would allow us to estimate the binding capacities of GAG+ sugars in our samples, our peptide column needed to be optimised to ensure that excessive sample loading would not lead to column saturation and consequent sample loss. This initially involved intentionally saturating the column in order to examine the binding capacity of a known quantity of BMP2-HBP. Even with a large quantity of tGAGs the peptide was capable of retaining the majority of GAG+ sugar chains. Under these conditions as little as 1 mg of BMP2-HBP was able to completely retain all GAG+ chains within two cycles. The column thus appeared to “simulate” a true BMP2 growth factor column and provide an extremely efficient way of extracting GAG+ samples.
The optimisation of peptide-based columns for specific GAG isolation is a 25 complex procedure that varies greatly depending on the size and individual chemical characteristics of the protein used. Previous studies, utilising FGF-1 and 2 growth factor columns (Turnbull and Nurcombe, personal communication), also showed a significant need for continual column maintenance and short viable column life-spans. These studies demonstrate the laborious nature of working with peptide columns and the care that must be 30 taken to correctly optimise this manner of system.
Unfortunately, while other systems for the analysis of specific protein-GAG interactions exist, these generally lack the capacity to isolate sufficient quantities of GAGs for further analysis, making them inappropriate for our intended course of study. 35
61035$4_1 (GHMatters) P86576.AU.1 LEOWNR 46 2015200096 09 Jan 2015 GAG Domain Analysis GAG sulfation patterns are, particularly in the case of heparan sulfate (HS), frequently concentrated into domains of high sulfation that are interspaced with regions of little sulfation. This grouping of sulfation sites into domains is what provides region-specific binding of ligands to the GAG chain, allowing a single sugar molecule to potentially bind a variety of different targets, and to stabilise the interaction between these, as is seen in the FGF system. Exceptions to this proposed model for HS-ligand interactions include the interaction between interferon gamma (IFNy) and heparan sulfate. In this instance the interaction between the GAG and IFNy leads to an increased potency of the cytokine. IFNy that remains dissociated from local GAGs is rapidly processed into an inactive form, thereby preventing its signalling in inappropriate areas after diffusion. IFNy also displays four separate heparin-binding domains, each with a different sequence, a finding not unusual for heparin-binding proteins. However, only two domains found immediately at the C-terminus of the protein have been shown to mediate INFy’s heparin-binding characteristics. Importantly, sequence analysis of the HS sequence with specific affinity for these two IFNy heparin-binding sites revealed an interesting difference in comparison to the commonly observed model of HS-ligand interaction. In this case, the sequence of HS responsible for the binding of IFNy was found to be composed of a predominantly N-acetylated region, carrying little sulfation. This region was flanked by two small N-sulfated regions. This differs significantly with the system observed in FGF, where sulfation patterns in NS domains are responsible for mediating the interaction between FGF and HS. In recent years, this type of interaction has been observed in numerous other systems, such as PDGF, IL-8 and endostatin. The discovery of this kind of interaction with HS, as observed in 25 these cytokines, may be able to explain the bioactivity observed in hyaluronan, which carries no sulfation patterns at any point along its chain and yet has the ability to modulate the activity of such factors as NF-KB. 30 These observed interactions between ligands and GAGs, in particular that of IFNy, differ significantly to the proposed, and our observed, mode of interaction between HS and BMP2. BMP2’s single, N-terminal heparin-binding domain exhibits no secondary structure and appears to interact with HS solely on the basis of charge. While in-depth sequence analysis of HS that binds this peptide sequence was not conducted, its 35 requirement to be eluted under approximately 300 mM NaCI conditions lead us to suspect the presence of a moderate degree of sulfation, thereby placing this interaction within the
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 47 2015200096 09 Jan 2015 conventional model of sulfation patterns mediating specific interactions. GAG+ Chain Specificity
The allocation of sulfation patterns into domains that give HS its ability to stabilise proteomic interactions also results in the possibility that a GAG+ sugar chain of sufficient length and complexity may carry several domains that have no direct affinity for the BMP2-HBP on their own, due to their carrying a different sulfation sequence. Conversely, it is also possible that some full-length sugar chains that were identified as having little affinity for the BMP2-HBP (GAG-) may contain some cryptic domains that do carry such affinity.
In recent years, numerous reports have been published that provide strong evidence for a “sulfation code” within these complex carbohydrate chains. While the details of this “sulfation code” remain difficult to elucidate, and the sequencing of long chains of sulfated carbohydrates is a complex and time consuming process, a number of possible modes of specific interaction between GAGs and ligands have been proposed. One observation in particular has led to the characterisation of numerous GAG-ligand models; the grouping of sulfation into discrete regions, or “domains”, along the length of many types of GAGs, such as heparan sulfate. Interestingly no template for this phenomenon has yet been observed, and it appears to be primarily a result of the temporal activity of the sulfotransferase enzymes responsible for this phase of GAG synthesis.
Particularly useful tools in the study of specific GAG sequences are a number of heparin lyases that can be used to examine targeted depolymerisation of complex carbohydrate chains, thereby providing insight into their structure. One particular heparan 25 lyase, heparinase III (heparitinase), cleaves heparin sulfate chains at sites flanking the highly sulfated domains that may occur in heparan sulfate chains. Thus, using this enzyme, it is possible to liberate these potentially active regions from the full length sugar chains and separate them, if they function as single domains, via affinity chromatography, from regions with no specific affinity for the BMP2-HBP. 30
It is important to note that, in the case of GAG-ligand interactions, affinity by sequence does not necessarily guarantee bioactivity. The mode of activity mediated by GAGs during their association with their various ligands differs greatly depending on the system. In some instances where the sugar chain is responsible for prolonging protein-protein interaction via 35 stabilisation of tertiary protein structures, such as is found between FGF and its receptor, and the interaction between HGF/SF and Met, multiple discrete sulfation regions may be
6103564.1 (GHMatters) P86576.AU.1 LEOWNR 48 2015200096 09 Jan 2015 involved in mediating the intended bioactivity of the sugar chain. In such instances the isolation of individual sulfated domains from a full length carbohydrate chain may, in fact, result in an inhibition of sugar bioactivity since though each “domain-fragment” still binds its intended target it is unable to mediate the intended biological effect of a combined full length carbohydrate chain.
Interestingly, this particular characteristic of GAG-ligand interactions is precisely what makes this manner of approach useful for modulating BMP2 activity. The proposed model for GAG modulation of BMP2 bioactivity involves immobilization of the cytokine to GAGs in the ECM or on the cell surfaces. In this type of system the application of exogenous GAGs specific to the heparin-binding domain of BMP2 would prevent this interaction, increasing shortterm BMP2 mediated signalling, similar to the effect observed during the addition of soluble heparin. While there is some indication that this manner of interaction would continue to protect the cytokine from proteolytic degradation, delocalization of BMP2 from its intended region of bioactivity has the potential to negatively impact the cytokines effectiveness in the long term.
Control testing of our full length GAG+ and GAG- chains resulted in similar profiles to those observed during their primary separation. Analysis of GAG+ and GAG- chains post treatment with heparinase III, however, gave surprising results. The digestion of GAG+ chains did not seem to generate separable fragments based on simple affinity for the BMP2-HBP. Furthermore, the digestion of full length GAG- chains yielded no liberation of positive domains from the negative sugar chains. There is some possibility that the enzymatic digestion did not go to completion. However, the resulting chromatogram clearly showed a 25 large increase in the absorbance at 232 nm when compared to the full length GAG chains. As a large proportion of the absorbance of glycosaminoglycans at 232nm is mediated via absorbance of unsaturated bonds, such as those formed during enzymatic depolymerisation, it strongly indicates that the enzymatic digestion was, in fact, successful. 30 The implications of this result are somewhat unusual. This data suggests that GAG chains are not only synthesised by cells to specifically interact with BMP2, but that, in the case of MC3T3 cells, these sugar chains carry a number of sequence repeats specific for aspects of BMP2 metabolism. The fact that BMP2 is an extremely potent factor may offer an explanation for this observation. The effects of BMP2 on the osteoinduction of mesenchymal 35 progenitor cells is well documented, as is its ability to induce ectopic bone formation in cells that are even more removed from the osteogenic lineage. Given this potency, aberrant
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 49 2015200096 09 Jan 2015 signalling of BMP2 is known to have deleterious consequences both for healing and in development. It is possible that numerous repeats of the BMP2-HBP interaction sequence on preosteoblast GAGs are designed to ensure a maximal binding, and thereby the modulation, of this cytokine’s ability to induce altered cell fate. Conversely, the extremely low concentrations of BMP2 produced in vivo may also require this type of sugar chain production in order to ensure the retention of a sufficient local concentration, an observation supported by the extremely high concentrations of BMP2 required in vitro to induce the osteogenic differentiation of C2C12 myoblast cells.
Of particular interest is the fact that this repetition of BMP2-binding domains is produced via a synthesis pathway for which no template or timing mechanism has yet been elucidated. The accuracy and reproducibility of sequence specific domains within a single sugar chain (as opposed to the random clustering of such domains with those against other ligands) strongly suggests that these cells do, in fact, have the ability to direct the generation of specific sugar sequences. The current understanding of HS structure implicates the progressive post-synthesis “editing” of the carbohydrate chain in the generation of sequence-specific regions, with observations pointing towards some manner of enzymatic “template”, whereby the local concentrations of particular sulfotransferases as well as other interacting molecules are used to directly control the generation of specific sugar sequences. Our current understanding of this mode of specific synthesis is largely formulated based on numerous studies including those by Lindahl et al. that investigated the high affinity interaction between antithrombin III and heparin, and those by Esko et al. involving Chinese hamster ovary (CHO) cell mutants with altered GAG synthesis pathways. These studies, while varying significantly in their approaches to GAG 25 analysis, all point towards a highly conserved system of specific GAG synthesis, for the directed modulation of cytokine and receptor activity. Importantly, these studies also serve to explain the potential generation of such BMP2 repeats as were observed in our study. 30 GAG+ Constitution
Full Length GAG+ Size
The bioactivity of individual GAGs chains for FGFs is closely related to carbohydrate chain length. A common approach to assessing GAG bioactivity is to assay ever shorter sulfated domain fragments and so determine the shortest possible sequence required to mediate the 35 activity observed.
61035$4_1 (GHMatters) PS6576.AU.1 LEOWNR 50 2015200096 09 Jan 2015
Using this approach we first examined full length GAG+ sugar chains, and determined that they were >20KDa in size, long enough to carry multiple domains with affinity for BMP2. Interestingly, this observation provided support for the earlier observation that GAG+ samples treated with heparinase 3 showed multiple repeats of carbohydrate chain segments with a specific affinity for BMP2, since a variably sulfated sugar chain of this size has the capacity to carry numerous sulfated domains. GAG+ Sugar Species
With the majority of the five glycosaminoglycan types that constitute the “glycome” able to encode the observed specific interactions with BMP2, it was necessary to elucidate which of these GAG types could be involved in this specific association. Although the prime candidate for this interaction is a heparan sulfate, analogous growth factor interactions have also been identified for chondroitin and dermatan sulfates.
Heparan sulfate can be totally depolymerised into its disaccharide components with nitrous acid. This particular characteristic, shared with heparin and keratan sulfate, is essential for the analysis of specific GAG populations. In the case of our analysis of the carbohydrate constituents of our GAG+ samples, degradation due to nitrous acid was diagnostic of heparan sulfate. This probability is primarily due to its heparan sulfate’s higher degree of charge patterning via sulfation in comparison to either heparin or keratan sulfate. Ultimately, this charge patterning is responsible for BMP2’s specific interaction with HS.
Our analysis utilising the nitrous acid protocol showed a complete degradation of the GAG+ sample set indicating that the majority of sugars in the GAG+ sample set were in fact 1,3-25 linked and, thus, were heparan sulfate. This result supports the numerous observations in regards to the specificity of heparan sulfate cytokine interactions, particularly the interaction that BMP2 exhibits with heparin and HS. GAG Species Analysis 30 BMP2-HBP Specific GAGs (Alternative Species)
The small remnant peak that was observed after the degradation of GAG+ samples by nitrous acid supports the possibility that other sulfated GAGs carrying some specific affinity for BMP2 may be found in the GAG+ sample set. Given our current understanding of the role of sulfation in mediating the interaction beween GAGs and BMP2, chondroitins and 35 dermatans are the most likely alternative sugars to show a specific interaction with BMP2 as these show the highest potential diversity in sulfation patterns.
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 51 2015200096 09 Jan 2015 A methodology frequently employed for GAG analysis includes examining the role of individual sulfation positions on GAG-ligand interactions. This method of analysis gives an indication of the importance of individual sulfation positions in maintaining the interaction between the GAG chain and its specific target. Furthermore, since the different species of GAGs only have the potential to carry sulfation patterns specific to their species, this can aid in narrowing the possible glycosaminoglycan candidates that may show an affinity for a specific ligand.
To this end we examined the affinity for the BMP2-HBP carried by variably sulfated CS chains, C4S and C6S, and standard DS. Interestingly, only C4S carried any significant affinity for the BMP2-HBP. This data indicates that it is likely that the 4-O-sulfation is necessary for CS to interact with the BMP2-HBP. Interestingly, dermatan sulfate showed no affinity for the BMP2-HBP. This observation is of interest since DS is the only CS species that demonstrates diversity in sulfation similar to that of HS. Furthermore, our observations indicate a possibility that the epimerisation of GIcA to IdoA in DS compromises the ability of this sugar type to bind the BMP2-HBP. Both C4S and DS are able to carry 4-O-sulfation, yet only small quantities of DS were retained on the column in comparison to C4S. Alternatively, this lack of affinity may simply be due to this particular batch of DS not carrying sufficient 4-O-sulfation to effectively mediate binding to the BMP2-HBP. Interestingly, these particular observations appear to demonstrate an interaction between BMP2 and CS carrying 4-O-sulfation. While previous studies have investigated the use of CS-BMP2 interactions in drug delivery systems, not much is known about any sequence specific interaction between individual CS species and BMP2. However, since HS chains are composed of 1,4-linked 25 disaccharide units, the observed 4-O-sulfation responsible for CS-BMP2 interactions is not found in HS-BMP2 interactions, pointing to a sequence specific interaction not found in CS. Thus it is likely that the remnant peak observed post-nitrous acid treatment may contain small quantities of 4-O-sulfate carrying C4S or DS. 30
Further investigation revealed that neither commercial HS nor heparin held any significant affinity for the peptide column. The HS used for this assay was purchased commercially from Sigma-Aldrich and was derived from bovine kidney. Given what is known about the tissue specificity of HS it is possible that this commercially available HS, isolated from 35 bovine kidney sources, carried negligible carbohydrate sequences required to specifically mediate an interaction with BMP2. Similarly neither LMW nor HMW heparin showed any
6103564.1 (GHMatters) P86576.AU.1 LEOWNR 52 2015200096 09 Jan 2015 affinity for the peptide column. The heparin used for this analysis was also purchased from Sigma-Aldrich, and was derived from porcine intestinal mucosa.
While heparin’s interaction with antithrombin III has been well characterised, and notwithstanding its versatile role in the isolation of susceptible molecules, heparin’s interaction with growth factors is not, in general, regarded to be specific due to its uniform sulfation. However, given that heparin is routinely used to isolate BMP2, it is somewhat surprising that neither of the heparin samples interacted with the peptide column to any significant degree. A further possibility for this lack of interaction between the peptide column and heparin is due to the difference in molecular weights between the two molecules. The small BMP2-HBP attached to the column may have difficulty in maintaining its association with the larger, heavily sulfated heparin chain. The inability of heparinase-cleaved heparin to bind the column, however, appeared to indicate that the steric effects of using full length heparin on the column were not solely responsible for disrupting the potential interaction between the sugars and the BMP2-HBP. There is no immediately apparent reason for this inability for commercial heparin to associate with the BMP2-HBP column, though it may be postulated that further spatial separation of the BMP2-HBP from its associated bead via spacer chains may help to ameliorate this problem.
SUMMARY
In this study we have demonstrated the use of affinity chromatography to isolate a subset of 25 glycosaminoglycans that carry a specific affinity for the BMP2-HBP, and have shown the potential for this procedure to yield reproducible results. During this portion of our investigation into the interaction between matrix based GAGs and BMP2, we have made several observations with regards to both the type of GAGs involved in mediating this association and their structure. 30
Our results have implicated heparan sulfate for mediating the majority of the affinity BMP2 has for the preosteoblast ECM, an interaction which is increasingly recognised as being responsible for the modulation of BMP2 activity. Furthermore, our investigation into the likely structure of the ECM-resident GAGs isolated on the basis of their 35 affinity for the BMP2 heparin-binding site have yielded a surprising result.
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 53 2015200096 09 Jan 2015
Our data indicates that full length BMP2 GAG+ chains do not consist of individual domains with specific affinity for BMP2 interspersed with regions of little or no affinity for the factor. Instead, our results imply that these GAG+ chains consist of multiple BMP2-binding domain repeats. This result is surprising on several levels. Firstly, the repetition required to fulfil this observation over the full length of a >20kDa carbohydrate chain points to the presence of some manner of synthetic template. Indeed, while previous studies have been unable to derive a template for the assembly of tissue-specific GAG chains, the very fact that such specificity exists supports the presence of a template-based system. Although no genomic template has been elucidated for this process there exists some possibility of a proteomic, perhaps enzymatic, template.
Secondly, this observation provides some evidence as to the importance of the interaction between BMP2 and GAGs. Multiple repeats of the BMP2 affinity site along the length of the carbohydrate chain may be required to ensure maximal binding of BMP2 to the ECM. This particular association has been shown to significantly lengthen the factor’s half life, as well as probably being responsible for maintaining a significant local concentration in order to maintain signalling. Alternatively, some studies have proposed a model whereby BMP2 is spatially inhibited from interacting with its receptors due to the interactions with ECM-based GAGs. In this particular scenario the repetition of BMP2 affinity sequences would ensure a maximal binding of the factor, thus reducing the chance of it interacting with its receptors.
Our cumulative results indicated that this system for the isolation of GAGs from the ECM is viable and likely to yield GAG chains that have a specific affinity for BMP2.
This study supports previous findings in regards to the interaction between GAGs and BMP2. Although the prevention of BMP2 associating with the ECM in vitro through the addition of exogenous GAG+ appears to increase BMP2 signalling and upregulates osteogenic gene expression, observations to the contrary have 30 also reported. In these studies, in vivo examination of BMP2’s modulation via the HBP showed a distinct improvement in long term osteogenesis when the association with ECM GAGs was increased. It is possible that this interaction plays a major role in maintaining local concentrations by preventing the factor from diffusing away from its sites of primary activity. In light of these studies and our own observations, we propose that BMP2’s activity 35 is both positively and negatively regulated by its association with GAGs. Negative regulation may occur precisely via the model proposed by Katagiri and colleagues, whereby the
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 54 2015200096 09 Jan 2015 retention of BMP2 in the ECM, away from its receptors, leads to a downregulation of BMP2 signalling. However, cells that require signalling by this factor may potentially secrete various enzymes to remodel extracellular sugar chains, such as sulfatases and heparinases, in order to “clip away” GAGs retaining BMP2 in the ECM, thereby liberating the factor and allowing it to signal, leading to the BMP2-ECM interaction ultimately becoming one of positive maintenance of the cytokine’s activity. Alternatively, negative regulation of BMP2 by cell surface GAGs, may be via the internalisation of GAG chains with their associated BMP2 molecules, as has been observed by Jiao and colleagues.
These previous studies, in conjunction with our own observations, have lead us to conclude that the sequence-specific interplay between BMP2 and heparin sulfate represents an intricate control mechanism that has the capacity to both positively and negatively regulate BMP2 signaling. Physiologically this interaction is responsible for enforcing context dependent responses to this potent cytokine in respect to many facets of embryonic development, precursor commitment and wound healing.
Example 2 - Purification of BMP2 Peptide Specific HS
We used a peptide having heparin-binding properties from the mature BMP-2 sequence to identify novel HS that bind to the peptide.
Mature BMP-2 amino acid sequence: 25 QAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTN HAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKWLKNYQDMWEGCGCR [SEQ ID NO: 14]
Heparin-binding peptide amino acid sequence: 30 QAKHKQRKRLKSSCKRHP [SEQ ID NO: 1]
To replicate the natural presentation of the heparin-binding site we biotinylated the peptide on it’s C-terminus and kept the proline (P) to improve the flexibility/accessibility of the peptide once bound to the streptavidin column. 35
6103564_1 (GHMatters) P86576.AU.1 LEOWNR 55 2015200096 09 Jan 2015
Isolation of BMP2 peptide specific HS
Materials used included a BMP2 - peptide coupled Streptavidin column, HiPrep Desalting Column (GE Healthcare), 20 mM PBS + 150 mM NaCI (Low Salt Buffer), 20 mM PBS + 1.5 M NaCI (High Salt Buffer), HPLC grade Water (Sigma), Biologic-Duoflow Chromatography system (Bio-Rad) and a Freeze Drier.
The column was equilibrated with Low Salt buffer and 1mg Sigma HS (H9902) was dissolved in low salt buffer and passed through the BMP2-Streptavidin column. Unbound media components were removed from the column by washing low salt buffer (20 mM PBS, pH 7.2, 150 mM NaCI) until the absorbance of the effluent at 232 nm almost return to zero. HS bound to the matrix was eluted with high salt buffer (20 mM PBS, pH 7.2, 1.5 M NaCI). Peak fractions were pooled and freeze dried for 48 hrs. HS 1 mg was applied to the column and washed with 20 mM PBS buffer containing a low (150 mM) NaCI concentration. After washing with low salt buffer, the bound HS were eluted with 20 mM PBS buffer containing a high (1.5 M) NaCI concentration. Peaks representing retained fractions (monitored at 232 nm) were collected and subjected to further desalting.
After freeze drying 6 mg of positive HS (GAG+) and 1.8 mg of negative HS (GAG-) were obtained.
Example 3 - Evaluation of BMP-2 specific heparan sulfates 25 C2C12 are mouse mesenchymal stem cells normally exhibiting myogenic differentiation but capable of being directed in the osteogenic lineage with supplementation of BMP-2 at passage 3. C2C12 cells at passage 3 were maintained in DMEM with 1000 g/L glucose (low glucose), 10 % of FCS, 1 % of P/S and without L-glutamine (maintenance media). 30 DMEM with 1000 g/L glucose (low glucose), 5 % of FCS, 1 % of P/S and without L-glutamine was used as differentiation media.
Effect of BMP-2 on osteogenesis
We evaluated the effects of exogenous BMP-2 on osteogenesis by measuring the levels of 35 expression of osteogenic markers (osteocalcin, osterix, Runx2).
$1035$4_1 (GHMatters) P86576.AU.1 LEOWNR 56 2015200096 09 Jan 2015
Through assaying the effect of addition of different amounts (100ng/ml and 300ng/ml) of BMP-2 to the cells we observed a significant decrease at day 5 in the expression of osterix, osteocalcin and Runx2 in cells having 100ng/ml BMP-2 compared to addition of 300ng/ml BMP-2 (Fig.s 27-29). Thus we chose this time point for future tests, as any changes should be readily observable.
Materials and Methods C2C12 cells at passage 3 were used. Cells were kept in liquid Nitrogen at Passage 3 with 1x106 cells/vial. Once cells were taken from liquid Nitrogen, we added 500 μΙ of culture media, pipetted up and down to refreeze the cells and immediately added 15ml of culture media.
Culture media was DM EM with 1000 g/L glucose (low glucose), 10 % of FCS, 1 % of P/S and without L-glutamine. Treatment media was DMEM with 1000 g/L glucose (low glucose), 5 % of FCS, 1 % of P/S and without L-glutamine. C2C12 cells were allowed to grow to 75 % confluence before harvesting (normally 2 to 3 days) in culture media.
Cells were counted as follows. Media was first aspirated/discarded; 15 ml of PBS added, discard the PBS and add 3 ml of trypsin, incubate at 37°C for 5 min to lift the cells from the flask. 9 ml of culture media added to neutralize the trypsin. GUAVA used to determine the amount of cells for subsequent cell seeding onto the experiment plates. For example, for 3 25 sets of 12-well plates 30,000 cells x 36 wells x 3.7 cm2 = 4, 000, 000 cells. Dilute the cells from the stock and add the desired amount of culture media for cell seeding (each well requiring 500 μΙ of media with 30,000 cells).
To prepare BMP2 stock 10 pg rhBMP2 (Bone Morphogenetic Protein 2) was re-suspended 30 in 100 μΙ of4mM HCI/0.1 % BSA.
The following RNA extraction protocol was used. 350 μΙ of RA1 buffer was used for cell lysis. Cells were frozen with RA1 at -80°C for one day after which cells were thawed and the lysate filtered for 1 min at 11,000 g. The filtrate was mixed with 350 μΙ 70 % ethanol in 1.5 35 ml tubes and centrifuged for 30s at 11,000 g. 350 μΙ of MDB buffer was added and the mixture centrifuged for 1 min at 11,000 g. 95 μΙ of Dnase reaction mixture added and
6103564.1 (GHMatters) P86576.AU.1 LEOWNR 57 2015200096 09 Jan 2015 mixture left at room temperature for at least 15 min. Then wash with 200 pi of RA2 buffer (to deactivate the Dnase), and centrifuge for 30s at 11,000 g. Wash with 600 μΙ of RA3 buffer, centrifuge for 30 second at 11,000 g. Wash with 250 μΙ of RA3 buffer, centrifuge for 2 min at 11,000 g. Elute the RNA with 60 μΙ of Rnase-free H20, centrifuge for 1 min at 11,000 g. Measure the concentration using Nanodrop (unit in ng/μΙ). RT (reverse-transcription) experiments were performed as follows. The following were mixed in a PCR tube: Random Primer (0.1 μΙ), DNTP (1 μΙ), RNA (250/500 ng), Rnase-Free H20 (topped up to a final volume of 13 μΙ). Incubate at 65°C for 5 min. Incubate on ice forat least 1 min. Collect the contents and centrifuge briefly before adding: 1st Strand Buffer (4 μΙ), DTT (1 μΙ), RnaseOUT (1 μΙ), SSIII Reverse (1 μΙ). Top up to final volume of 20 μΙ. Mix by pipetting up and down. Incubate at room temperature for 5 min. Incubate at 50°C for 60 mins. Inactivate the reaction at 70°C for 15 min.
Reverse-transcription experiments were performed twice on separate days and the PCR products pooled together and diluted to a final concentration of 2.5 ng/μΙ for subsequent Real-Time PCR.
The Real-Time PCR was performed using a TaqMan® Fast Universal PCR master Mix (2X) (Applied Biosystem). PCR master Mix (10 μΙ), ABI probe (1 μΙ), cDNA (1 μΙ), ddH20 (8 μΙ). GAPDH and Beta actin were used as control genes against the experimental targets OSX (osterix), OCN (Osteocalcin) and Runx2.
Effect of BMP-2 specific HS GAG+ on osteogenesis 25
We evaluated the effects of the BMP-2 specific HS (GAG+) isolated in Example 2 on osteogenesis by measuring the levels of expression of osteogenic markers (osterix, Runx2, alkaline phosphatase and Bspll) by quantitative polymerase chain reaction (qPCR). A time course was prepared to compare the expression of the markers over a course of 10 days to 30 compare the control to a low and a high dose of BMP-2, the high dose being the optimal conditions to induce differentiation of the cells.
Materials and methods
35 Cells were seeded at 30,000 cell/cm2 in maintenance media and left to attach overnight. The following day we switched to differentiation media with: 6103564_1 (GHMatters) P86576.AU.1 LEOWNR 58 2015200096 09 Jan 2015 • No additives • 100ng/ml BMP-2 (positive control) • 100ng/ml BMP-2 + 30pg/ml -GAG (Neg GAGs) • 100ng/ml BMP-2 + 30pg/ml +GAG (Pos GAGs) • 100ng/ml BMP-2 + 30pg/ml Heparin (Sigma # H3149) • 100ng/ml BMP-2 + 30pg/ml Total Heparan Sulfate (Sigma # H9902 - HS prior to fractionation)
The carbohydrates and BMP-2 were mixed together in the smallest volume possible and incubated at room temperature for 30 minutes before their addition to the media and on the cells.
After 5 days, RNA was extracted using the Macherey-Nagel kits and Reverse-Transcription was performed.
As we show in Fig.s 30-33, the Heparan sulfate from porcine mucosa (Total HS) can increase the activity of BMP-2 (shown through GAG+ induced increases in the expression of Alkaline Phosphatase, osterix, Bspll and Runx2) and this activity is contained within the fraction that binds BMP2 (Pos GAGs). This means that we can isolate the BMP enhancing fraction of a commercial HS by passing them on the BMP-HBD peptide column.
Example 4 MC3T3-E1 (s14) preosteoblast cells (a mouse embryo calvaria fibroblast cell line 25 established from the calvaria of an embryo) were expanded in aMEM media supplemented with 10% FCS, 2 mM L-glutamine, 1 mM sodium pyruvate and Penicillin/Streptomycin every 72 hours until sufficient cells were generated for plating. The cells were differentiated by plating at 5 x 104 cells/cm2 in aMEM media supplemented with 10% FCS, 2 mM L-glutamine, 25 pg/ml ascorbic acid, 10 mM β-glycerol phosphate and Penicillin/Streptomycin. The media 30 was changed every 72 hours for 8 days at which point the cells and media were harvested. The media was retained and clarified by high speed centrifugation and filtration through a 0.4 pm filter. The cell layer was disrupted using a cell scraper and an extraction buffer containing PBS (150 mM NaCI w/o Ca2+ and Mg2+), 1% CHAPS, 8 M Urea and 0.02% NaN3.
35 At all stages (unless otherwise stated), samples were clarified before loading onto column systems. This process included high speed centrifugation at 5000g for 30 min, and filtration 61035$4_1 (GHMatters) P8$576.AU.1 LEOWNR 59 2015200096 09 Jan 2015 through a 0.4 μιτι syringe filter. The samples were always clarified directly prior to loading through the column system to prevent precipitates forming in stagnant solutions.
Anion exchange chromatography was used to isolate proteoglycosaminoglycan (PGAG) fractions from both the media and cell layer samples. In each case, the media or cell layer samples were run through a Pharmacia XK 26 (56-1053-34) column packed with Capto Q Anion Exchange Beads (Biorad) at a flow rate of 5 ml/min on a Biologic DuoFlow system (Biorad) using a QuadTec UV-Vis detector. The samples were loaded in a low salt buffer containing PBS (150 mM NaCI w/o Ca2+ and Mg2+), 100 mM NaCI, 0.02% NaN3 at pH 7.3. The samples were eluted in a high salt buffer containing PBS (150 mM NaCI w/o Ca2+ and Mg2+), 850 mM NaCI and 0.02% NaN3 at pH 7.3. The relevant fractions were collected and pooled into a single PGAG sample and lyophilized in preparation for desalting.
The PGAG sample was desalted through four sequentially joined Pharmacia HiPrep™ 26/10 (17-5087-01) columns at a flow rate of 10 ml/min on a Biologic DuoFlow system (Biorad) using a QuadTec UV-Vis detector. The relevant fractions were collected and pooled into a single sample set and lyophilized in preparation for further treatment.
In the fourth step, the PGAG sample set obtained from the desalting procedure was subjected to a pronase and neuraminidase treatment, in order to digest away core proteins and to subsequently liberate GAG chains. In this respect, lyophilized PGAG samples were resuspended in a minimum volume of 25 mM sodium acetate (pH 5.0) and clarified by filtration through a 0.4 pm syringe filter. The total sample volume was dispensed into 10 ml glass tubes in 500 pi aliquots. To this aliquot was added 500 pi of 1 mg/ml neuraminidase 25 before the mixture was incubated for 4 hours at 37 °C. Following incubation, 5 ml of 100 mM Tris-acetate (pH 8.0) was added to each sample. An additional 1.2 ml of 10 mg/ml pronase, reconstituted in 500 mM Tris-acetate and 50 mM calcium acetate (pH 8.0), was added to each sample before the mixture was incubated for 24 hrs at 36°C. Following this treatment, all volumes were combined and prepared for anion exchange chromatography by 30 centrifugation and filtration.
In a fifth step, the GAG sample isolated following protein cleavage was eluted through a Pharmacia XK 26 (56-1053-34) column packed with Capto Q Anion Exchange Beads (Biorad) at a flow rate of 5 ml/min on a Biologic DuoFlow system (Biorad) using a QuadTec 35 UV-Vis detector. In this respect, the sample was loaded in a low salt buffer containing PBS (150 mM NaCI w/o Ca2+ and Mg2+) and 0.02% NaN3 at pH 7.3. The sample was eluted in a
61035$4_1 (GHMatters) P8$57$.AU.1 LEOWNR 60 2015200096 09 Jan 2015 high salt buffer containing PBS (150 mM NaCI w/o Ca2+ and Mg2+), 850 mM NaCI and 0.02% NaN3 at pH 7.3. The relevant fractions were pooled, lyophilized and desalted as per the aforementioned protocol for desalting the PGAG sample. N-terminal biotinylated peptide (1 mg), corresponding to the heparin-binding domain of BMP-2, and comprising an amino acid sequence represented by QAKHKQRKRLKSSCKRH [SEQ ID NO: 17], was mixed with low salt buffer containing PBS (150 mM NaCI w/o Ca2+ and Mg2+). The mixture was eluted through a column packed with a streptavidin-coated resin matrix. The column was then exposed to a high salt buffer containing PBS (150 mM NaCI w/o Ca2+ and Mg2+), 850 mM NaCI and 0.02% NaN3 at pH 7.3, to ascertain whether, under those conditions the peptide had bound securely to the matrix. No substantial loss of peptide from the column was observed. The column was subsequently washed with the low salt buffer in preparation for sample loading.
The GAG mixture (2 mg), isolated using the procedure outlined in Example 1, was suspended in low salt sodium phosphate buffer (1 ml_), and loaded onto the peptide column of Example 2. The sample was eluted with a low salt buffer containing PBS (150 mM NaCI w/o Ca2+ and Mg2+). A peak corresponding to GAGs with negligible BMP-2 affinity was observed in the UV-Vis detector trace. The column fractions responsible for giving rise to this peak were combined. These fractions are known as 'GAG-' - the minus sign denoting the lack of affinity with the column. When it became evident from the UV-Vis detector that the trace had flattened to the baseline, and that no further oligosaccharide was eluting, the eluting solvent was changed to a high salt buffer containing PBS (150 mM NaCI w/o Ca2+ and Mg2+), 850 mM NaCI and 0.02% NaN3 at pH 7.3. Following this change in the eluting solvent, a peak corresponding to BMP-2 specific GAGs was observed in the UV-Vis detector trace. The column fractions responsible for giving rise to this peak were combined. These fractions are known as 'GAG+' - the plus sign denoting the presence of affinity with the column. In the case of GAG compounds sourced from preosteoblast cells, the GAG+ fraction represented 10% of the overall GAG mixture. 5 Example 5
The addition of BMP2 has a clearly defined capacity to induce osteogenic differentiation in C2C12 myoblasts. Similarly, the pre-incubation of BMP2 with heparin has been shown to both extend the cytokines half life and its immediate potency in vitro. Here we examined the 10 capacity of GAG+ and GAG- fractions to augment the osteoinduction of C2C12 cells in vitro
S1035$4_1 (GHMatters) P86576.AU.1 LEOWNR 61 2015200096 09 Jan 2015 by BMP2.
The GAG+ sample from Example 4 (0, 10, 100, 1000 ng/mL) was added to C2CI2 myoblasts in vitro in the presence of BMP-2 (0, 50, 100 ng/mL). Measurement of the relative expression of the osteocalcin gene indicated that the GAG+ sample was able to potentiate BMP-2 to effect osteocalcin gene expression at levels of BMP-2 far below those currently used in therapy (300 ng/mL). The results of this assay (including calculated p-values and errors) are represented graphically in Figure 34 in which the experimental conditions for each 'culture condition' are as follows: 1. Control cells, no BMP-2 added, no GAG added
2. BMP-2 at 50 ng/mL
3. BMP-2 at 50 ng/mL, GAG+ at 10 ng/mL
4. BMP-2 at 50 ng/mL, GAG+ at 100 ng/mL
5. BMP-2 at 50 ng/mL, GAG+ at 1000 ng/mL
6. BMP-2 at 100 ng/mL
7. BMP-2 at 100 ng/mL, GAG+at 10 ng/mL
8. BMP-2 at 100 ng/mL, GAG+ at 100 ng/mL
9. BMP-2 at 100 ng/mL, GAG+ at 1000 ng/mL
Interestingly, while 1000 ng/ml of GAG+ is able to significantly augment BMP2 mediated osteocalcin expression, the addition of concentrations of GAG+ below 1000 ng/ml appear to progressively inhibit this expression. Furthermore, the addition of sufficient GAG+ also managed to drive the induction of osteocalcin by 50 ng/ml of BMP2 above that of 100 ng/ml of BMP2 on its own, indicating the potency of this interaction. 25 This cell culture based analysis demonstrated that the addition of GAG+ to C2C12 osteogenic cultures together with BMP2 resulted in a significant upregulation of osteocalcin expression indicating an increase in BMP2 signalling efficacy. This result supports the specific association of GAG+ chains with BMP2, thereby blocking the BMP2-HBP and preventing its association with matrix-based PGAGs. The resulting upregulation of 30 osteogenic gene expression is comparable to that observed in previous studies utilising heparin to achieve a similar effect. Interestingly, the addition of concentrations of GAG+ that fall below 1000 ng/ml appear to have an initially antagonistic effect on BMP2 signalling.
One possible hypothesis to explain this observation revolves around the capacity
for a given number of GAG+ molecules to bind a certain number of BMP2 molecules. Under 6103564_1 (GHMatters) P8$57$.AU.1 LEOWNR 62 2015200096 09 Jan 2015 conditions where no exogenous GAG+ is added to the culture system the majority of BMP2 molecules will be able to associate with the ECM, thereby being localised away from their cognate receptors and being unable to immediately initiate signalling. Subsequent dissociation of BMP2 from the ECM, both spontaneously and by targeted enzymatic alteration of their associated GAG chains, has the capacity to induce long term BMP2 signalling. The addition of a large number of GAG+ molecules to this system, as is the case in samples supplemented with 1000 ng/ml of GAG+, permits the majority of BMP2 molecules to remain in solution where they are free to mediate receptor dimerisation and induce downstream signalling. Both these processes of cytokine/receptor interaction likely require particular concentration thresholds in order maintain an efficient level of signalling. Under culture conditions containing 50 ng/ml of BMP2, the addition of low concentrations of GAG+ allows for a portion of the available cytokine to remain soluble while the remaining portion associates with the ECM. Under these conditions only a small quantity of BMP2 remains soluble but, due to its low concentration, becomes highly diffuse in the media leading to negligible signalling. Similarly, due to a portion of the BMP2 remaining solubilised, a reduced quantity of BMP2 can be found in the ECM, resulting in a decrease in signalling from BMP2 liberated from the ECM by direct cellular activity. However, under culture conditions containing 100 ng/ml of BMP2 the combined effects of soluble and ECM based BMP2 are, with the addition of 100 ng/ml of GAG+, sufficient to induce BMP2 signalling similar to control levels. Without further study, however, the dynamics involved in BMP2/GAG+ signalling remain unclear. Future studies utilising surface plasmon resonance may help elucidate the efficiency of BMP2/GAG+ interactions and may aid in clarifying these observations. 25
Example 6
The enzyme heparanase 3 was used to cleave GAG+ and GAG- sugar chains from Example 4 according to the following method. GAG+ and GAG- were each treated separately at a concentration of 4 mg/mL, with heparanase 3 (250 mU enzyme per 100 pg oligosaccharide) for 16 hours at 37°C. Subsequently, the mixture was heated for 5 minutes at 70°C to inactivate the heparanase 3. The digested GAG+ and GAG- mixtures were each subjected to the peptide column separately. The UV-Vis detector trace of each chromatographic run indicated that the digested material showed the same affinity for the column as the undigested material.
6103564_1 (GHMatters) P86576.AU.1 LEOWNR
Claims (7)
- Claims:1. A method of isolating heparan sulphate capable of specific and high affinity binding to a protein having a heparin-binding domain, the method comprising: (i) providing a solid support having peptide molecules adhered to the support, wherein the peptide molecules comprise the heparin-binding domain and optionally one or more additional amino acids at one or each of the N- and C-terminal ends wherein the number of such additional amino acids is 1-20; (ii) contacting the peptide molecules with a glycosaminoglycan mixture enriched for heparan sulphate such that peptide-heparan sulphate complexes form; (iii) partitioning peptide-heparan sulphate complexes from the remainder of the mixture which does not bind the heparin-binding domain, or does not specifically bind the heparin-binding domain; (iv) dissociating heparan sulphate from the peptide-heparan sulphate complexes; and (v) collecting the dissociated heparan sulphate, wherein the dissociated heparan sulfate is enriched for molecules that are capable of specific and high affinity binding to the heparin binding domain.
- 2. A method of identifying heparan sulphate capable of stimulating or inhibiting growth and/or differentiation of cells and/or tissues, the method comprising: (i) providing a solid support having peptide molecules adhered to the support, wherein the peptide molecules comprise a heparin-binding domain and optionally one or more additional amino acids at one or each of the N- and C-terminal ends wherein the number of such additional amino acids is 1-20; (ii) contacting the peptide molecules with a glycosaminoglycan mixture enriched for heparan sulphate such that peptide-heparan sulphate complexes form; (iii) partitioning peptide-heparan sulphate complexes from the mixture remainder which does not bind the heparin-binding domain, or does not specifically bind the heparin-binding domain; (iv) dissociating heparan sulphate from the polypeptide-heparan sulphate complexes; (v) collecting the dissociated heparan sulphate, wherein the dissociated heparan sulfate is enriched for molecules that are capable of specific and high affinity binding to the heparin binding domain; (vi) adding the collected heparan sulphate to cells or tissues in which a protein comprising the heparin-binding domain amino acid sequence is present; and (vii) measuring one or more of: proliferation of the cells, differentiation of the cells, expression of one or more protein markers.
- 3. The method of claim 1 or claim 2 wherein the method comprises selecting heparan sulphate having the highest affinity and/or specificity for the heparin-binding domain by varying a salt concentration present at the surface of the solid support.
- 4. The method of any one of claims 1 to 3 wherein the method comprises obtaining heparan sulphate having a binding affinity for the peptide molecules of less than 1 μΜ.
- 5. The method of any one of claims 1 to 4 wherein the method further comprises subjecting the collected heparan sulphate to further analysis in order to determine structural characteristics of the heparan sulphate.
- 6. The method of any one of claims 1 to 5 wherein the peptide-heparan sulphate complexes are contacted with a lyase.
- 7. An isolated heparan sulphate when obtained by the method of any one of claims 1 to 4.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2015200096A AU2015200096B2 (en) | 2008-09-11 | 2015-01-09 | Isolation and identification of glycosaminoglycans |
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US9627408P | 2008-09-11 | 2008-09-11 | |
US61/096,274 | 2008-09-11 | ||
GBGB0818255.2A GB0818255D0 (en) | 2008-10-06 | 2008-10-06 | Isolation and identification of glycosaminoglycans |
GB0818255.2 | 2008-10-06 | ||
PCT/GB2009/000469 WO2010029278A2 (en) | 2008-09-11 | 2009-02-19 | Isolation and identification of glycosaminoglycans |
AU2009290755A AU2009290755B2 (en) | 2008-09-11 | 2009-02-19 | Isolation and identification of glycosaminoglycans |
AU2015200096A AU2015200096B2 (en) | 2008-09-11 | 2015-01-09 | Isolation and identification of glycosaminoglycans |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2009290755A Division AU2009290755B2 (en) | 2008-09-11 | 2009-02-19 | Isolation and identification of glycosaminoglycans |
Publications (2)
Publication Number | Publication Date |
---|---|
AU2015200096A1 AU2015200096A1 (en) | 2015-02-05 |
AU2015200096B2 true AU2015200096B2 (en) | 2017-02-02 |
Family
ID=52465044
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2015200096A Active AU2015200096B2 (en) | 2008-09-11 | 2015-01-09 | Isolation and identification of glycosaminoglycans |
Country Status (1)
Country | Link |
---|---|
AU (1) | AU2015200096B2 (en) |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050288252A1 (en) * | 2004-05-07 | 2005-12-29 | The University Of Queensland | Composition for stimulating bone growth and differentiation and method for isolating same |
-
2015
- 2015-01-09 AU AU2015200096A patent/AU2015200096B2/en active Active
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050288252A1 (en) * | 2004-05-07 | 2005-12-29 | The University Of Queensland | Composition for stimulating bone growth and differentiation and method for isolating same |
Non-Patent Citations (1)
Title |
---|
LIU, S. et al., PNAS, 1997, vol. 94, pages 1739-1744 * |
Also Published As
Publication number | Publication date |
---|---|
AU2015200096A1 (en) | 2015-02-05 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20180360916A1 (en) | Isolation and Identification of Glycosaminoglycans | |
US10220054B2 (en) | Glycosaminoglycans | |
CA2912710C (en) | Heparan sulphates | |
EP3220922B1 (en) | Heparan sulphates for use in repair and/or regeneration of skin | |
CN107001488B (en) | Heparan sulfate | |
EP3242669B1 (en) | Pdgf-b /pdgf-bb binding variants of heparan sulphates | |
AU2015200096B2 (en) | Isolation and identification of glycosaminoglycans |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FGA | Letters patent sealed or granted (standard patent) |