AU2014308552B2 - Immunoreceptor modulation for treating cancer and viral infections - Google Patents

Immunoreceptor modulation for treating cancer and viral infections Download PDF

Info

Publication number
AU2014308552B2
AU2014308552B2 AU2014308552A AU2014308552A AU2014308552B2 AU 2014308552 B2 AU2014308552 B2 AU 2014308552B2 AU 2014308552 A AU2014308552 A AU 2014308552A AU 2014308552 A AU2014308552 A AU 2014308552A AU 2014308552 B2 AU2014308552 B2 AU 2014308552B2
Authority
AU
Australia
Prior art keywords
cells
domain
antibody
mammal
antibody fragment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
AU2014308552A
Other versions
AU2014308552A1 (en
Inventor
Mark Smyth
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
QIMR Berghofer Medical Research Institute
Original Assignee
Queensland Institute of Medical Research QIMR
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from AU2013903189A external-priority patent/AU2013903189A0/en
Priority claimed from PCT/AU2013/001132 external-priority patent/WO2015024042A1/en
Application filed by Queensland Institute of Medical Research QIMR filed Critical Queensland Institute of Medical Research QIMR
Priority to AU2014308552A priority Critical patent/AU2014308552B2/en
Priority claimed from PCT/AU2014/000830 external-priority patent/WO2015024060A1/en
Publication of AU2014308552A1 publication Critical patent/AU2014308552A1/en
Application granted granted Critical
Publication of AU2014308552B2 publication Critical patent/AU2014308552B2/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • A01K67/0275Genetically modified vertebrates, e.g. transgenic
    • A01K67/0276Knock-out vertebrates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7028Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages
    • A61K31/7034Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin
    • A61K31/704Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2207/00Modified animals
    • A01K2207/12Animals modified by administration of exogenous cells
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/07Animals genetically altered by homologous recombination
    • A01K2217/075Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/15Animals comprising multiple alterations of the genome, by transgenesis or homologous recombination, e.g. obtained by cross-breeding
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0331Animal model for proliferative diseases
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/035Animal model for multifactorial diseases
    • A01K2267/0387Animal model for diseases of the immune system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Molecular Biology (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Environmental Sciences (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Animal Husbandry (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Endocrinology (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

A method of reducing or relieving immune inhibition in a mammal includes the step of at least partly inhibiting or reducing CD96 activity in one or more cells of the mammal to thereby relieve immune inhibition and/or enhance or restore immune surveillance in the mammal. Typically, inhibiting or reducing CD96 activity does not include, or depend upon, killing of CD96-expressing cells in the mammal. The method relieves immune inhibition and/or enhances or restores immune surveillance in the mammal to thereby treat or prevent cancer or cancer metastasis and/or a viral infection in the mammal. Also provided is a method of screening, designing, engineering or otherwise producing a CD96-inhibitory agent that relieves immune inhibition and/or enhances or restores immune surveillance in a mammal. Typically, the CD96-inhibitory agent is an antibody or antibody fragment.

Description

IMMUNORECEPTOR MODULATION FOR TREATING CANCER AND VIRAL INFECTIONS
TECHNICAL FIELD
THIS INVENTION relates to the immunoreceptor CD96. More particularly, this invention relates to inhibition of CD96 to thereby enhance the ability of the immune system, to target tumours and other diseases or conditions that can evade the immune system.
BACKGROUND
The progression of a productive immune response requires that a number of immunological checkpoints be passed. Passage may require the presence of excitatory co-stimulatory signals or the avoidance of negative or co-inhibitory signals, which act to dampen or terminate immune activity. The immunoglobulin superfamily occupies a central importance in this coordination of immune responses, 15 and the CD28/cytotoxic T-lymphocyte antigen-4 (CTLA-4):B7.1/B7.2 receptor,digand grouping represents the archetypal example of these immune regulators. In part the role of these checkpoints is to guard against the possibil ity of unwanted and harmful self-directed activities. While this is a necessary function, aiding in the prevention of autoimmunity, it may act as a barrier to successful immunotherapies aimed at targeting malignant self-cells that largely display the same array of surface molecules as the cells from which they derive. Therapies aimed at overcoming these mechanisms of peripheral tolerance, in particular by blocking the inhibitory checkpoints on T cells, offer the potential to generate antitumor activity, either as monotherapies or in synergism with other therapies that directly or 25 indirectly enhance presentation of tumor epi topes to the immune system. Such anti-T cell checkpoint antibodies are showing promise in early clinical trials of advanced human cancers.
Furthermore, natural killer (NK) cells are innate lymphocytes critical to limit early tumor growth and metastasis \ NK cell functions are also regulated by the 30 integration of signals transmitted by a wide range of activating and inhibitory receptors ~. For example, the recognition of pathogen-derived or stress-induced ligands by activating receptors such as NCRs, NK.G2D, or DNAM-1 stimulate NK cells cytotoxicity and the secretion of pro-inflammatory mediators such as interferon gamma (IFN-γ) \ In contrast, inhibitory receptors protect target cells from NK cell
WO 2015/024060
PCT/AU2014/000830 mediated killing 4. These receptors mostly recognize MHC class I and MHC class 1related molecules and include the KIR (killer cell immunoglobulin-like receptors) and LIR (leukocyte immunoglobulin-like receptors) families, the Ly49 family in mice and the CD94/NKG2 heterodimers in both species.
An emerging group of immunoglobulin superfamily members that interact with ligands of the nectin and nectin-like (necl) family has recently been described to influence NK cell and T cell functions These include CD226 (DNAM-1) 6, CD96 (TACTILE) ', TIGIT (T cell immunoglobulin and ΤΠΜ domain) and CRTAM (class I restricted T cell-associated molecule) 10 DNAM-1 and TIGIT are the most 10 extensively studied members of this family and they share a common ligand, CD 155 (necl-5; PVR) and CDH2 (nectin-2; PVRL2) 8>u. TIGIT also bind an additional ligand GDI 13 (PVRL3) s. The functions of DNAM-1 and TIGIT on NK cells are reportedly counter-balancing ,2. In vitro, DNAM-1 potentiates the cytotoxicity of NK cells against a wide range of tumor cells bJ4 and is critical for tumor 15 immunosurveillan.ce in vivo 1··ι-λ1°. in contrast, TIGIT bear an 1TIM motif and has been proposed prevent self-tissue damage similar to inhibitory Ly49 or KIR interactions with MHC class 117. Indeed, engagement of TIGIT by CD 155 has been shown to limit IFNy production and cytotoxicity by NK cells in vitro 18,19. However, the role of TIGIT in NK cell biology relative to the other nectin receptors DNAM-1 and CD96 remains to be assessed in vivo, '
Despite being cloned 20 years ago , little is known about CD96, the other Ig family member that shares CD155 ligand with DNAM-1 and TIGIT ^21. In humans, CD96 expression is largely confined to NK cells, CDS T cells, and CD4 T cells 7. The major ligand of C-D96 is CD 155, but CD96 has also been reported to associate 25 with CD 111 (nectin-1) and play a role in promoting NK and T cell adhesion
SUMMARY
Surprisingly, the present inventors have discovered that CD96 acts as a negative regulator of T cell and NK cell anti-tumor functions. Accordingly, the 30 invention is broadly directed to use of agents that at least partly block or inhibit CD96 to thereby reduce or relieve CD96-mediated immune inhibition to enhance or restore immune surveillance in the mammal. In certain embodiments, this may
WO 2015/024060
PCT/AU2014/000830 facilitate treatment of diseases or conditions responsive at least partial blocking or inhibition of CD96, such as cancers and/or viral infections.
In a first aspect, the invention provides a method of reducing or relieving immune inhibition in a mammal, said method including the step of at least partly 5 inhibiting or reducing CD96 activity in one or more cells of the mammal to thereby relieve immune inhibition and/or enhance or restore immune surveillance in the mammal.
Suitably, the step of inhibiting or reducing CD96 activity in the mammal does not include, or at least depend upon, killing of CD96-expressing cells in the 10 mammal. In some embodiments, the step of inhibiting or reducing CD96 activity in the mammal includes inhibiting or reducing CD96 binding to CD 155 and/or intracellular signaling in one or more cells of the mammal that express CD96. In some embodiments, the step of inhibiting or reducing CD96 activity in the mammal includes removing and/or down-regulating cell surface expression of CD96.
hi one particular embodiment, the step of inhibiting or reducing CD96 activity in the mammal includes increasing or enhancing expression, production and/or secretion of one or more cytokines or chemokines. Preferably, the cytokine is interferon γ ( IFN-γ). Typically, the one or more cells of the mammal are T cells, inclusive of CD4‘ and CD8’ T cells, γδΤ cells, NKT cells, and natural killer (NK.) 20 cells.
hi a preferred embodiment, the method relieves immune inhibition and/or enhances or restores immune surveillance in the mammal to thereby treat or prevent cancer or cancer metastasis in the mammal.
In other embodiments, the method relieves immune inhibition and/or 25 enhances or restores immune surveillance in the mammal to thereby treat or prevent a viral infection in the mammal.
In a second aspect, the invention provides a method of screening, designing, engineering or otherwise producing a CD96-inhibitory agent, said method including the step of determining whether a candidate molecule is capable of at least partly 30 inhibiting or reducing CD96 activity to thereby relieve immune inhibition and/or enhance or restore immune surveillance in a mammal.
WO 2015/024060
PCT/AU2014/000830
In a third aspect, the invention provides a CD96-inhibitory agent screened, designed, engineered or otherwise produced according to the method of the second aspect.
In one embodiment, the CD96-inhibitory agent is an antibody or antibody fragment
In one particular embodiment, the CD96-inhibitory agent is an. anti-cancer agent.
In another particular embodiment, the CD96-inhibitory agent is an anti-viral agent.
hr a fourth aspect, the invention provides a CD96-inhibitory agent according to the third aspect for use according to the method of the first aspect.
Suitably, according to the aforementioned aspects the mammal is a human.
Unless the context requires otherwise, the terms “aimprise”, “comprises” and “comprising”, or similar terms are intended to mean a non-exclusive inclusion, such 15 that a recited list of elements or features does not include those stated or listed elements solely, but may include other elements or features that are not listed or stated.
The indefinite articles Nr’ and ‘an’ are used here to refer to or encompass singular or plural elements or features and should not be taken as meaning or 20 defining “one” or a “single” element or feature,
BRIEF DESCRIPTION OF THE FIGURES
Figure 1.: CD96 competes with DNAM-1 for CD 155 binding, a, b The expression of CD96 was analyzed by flow cytometry on the indicated spleen 25 lymphocyte populations from C57BL/6 WT (light grey) and C/JPd'mice (dark grey).
The representative FACS Histograms (a) and the mean + SD (b) of 3 mice from one representative experiment, out of 3 are shown, c, d The expression of CD96, DNAM1 and TIGIT was determined on WT spleen NK cells freshly isolated or activated for hrs- with IL-2 (1000 U/ral). e. The binding of mouse C D155-Fc coupled with AF30 647 to purified NK cells freshly isolated from WT, CD96~'\ DNAM~r'~ or DNAM-F '
CD9(F mice was assessed at the indicated concentrations by flow cytometry, f. The binding of CD 155 -Fc coupled with AF-647 (10 pg/ml) was analyzed on purified WT
NK cells in the presence of anti-CD96 and or anti-DNAM-l mAbs. g. Tire binding of
WO 2015/024060
PCT/AU2014/000830
DNAM-1-Fc labeled with AF-647 (0.5-10 pg/ml) at the cell surface of BMDC was analyzed in the presence of 50 pg/ml of control Ig, recombinant. CD96 or TIGIT-Fc. c-g. The representative FACS Histograms and the mean + SD of triplicate wells from one representative experiment out of at least 3 experiments are shown. *** p<0.001.
Student T test.
Figure 2: CD96 engagement by CD 155 regulate NK cell production of IFNy.
CD96 binding to CD155-Fc limits the production of IFN-γ by NK cells induced by exogenous cytokines (a, b, d) and NK cell receptors (c). a, b, d. We analyzed the intracellular production of IFN-γ by freshly purified CD96\ TIGIT' and WT NK cells in the presence or absence of anti-CD96 (50 pg/ml) in response ίο IL-12 (25100 pg/ml) and IL-18 (5'0 ng/ml) using plates coated with or without CD 155-Fc (0.5 pg/ well), c. We analyzed the intracellular production of IFN-γ by IL-2-activated NK. cells from CD96'and WT mice using plates coated with anti-NKI J (2.5 pg/ well) and CD 155-Fc (0.5 pg/ well). The representative FACS Histograms (a) and the mean + SD of triplicate wells (b, c, d.) from one representative experiment out of 3 are shown. *ρ <0.05. ** p <0.01, *** p<0.001. Student T test
Figure 3: CD96 limits NK cell-dependent tumor immunosurveillance, a, b.
CD96 and DNAM-1 have an opposite role in the control of B16F10 metastasis, a. 2 x 105 B16F10 cells were intravenously injected into WT, DNAM-1' and 20 DNAM-rCD9^' mice and metastatic burden was quantified in the lungs after 14 days. Representative experiment out of 3. b. Pictures showing the lung of WT and CD96' ‘ mice two weeks after the injection of 2 x 105 and 5 x 10' B16F10 cells. Representative experiment out of two. c. CD96 and TIGIT compete with DNAM-1 for the binding of CD155 at the cell surface of B16F10. The binding of DNAM-1-Fc 25 labeled with AF-647 (0.5-20 pgrinl) at the cell surface of Bl 6F10 cells was analyzed in the presence of 50 pg/ml of control Ig, recombinant CD96 or TIGIT-Fc. The FACS histograms and the mean + SD of triplicate wells from one representative experiment out of 3 are shown, d. A 4 hr slCr release assay was performed between BI6F10 cells and IL-2-activated NK cells from WT, DNAM-D' and CD96' mice at 30 the indicated effector target ratios. Solid circles represent WT NK cells, open circles represent CD96' NK cells and solid squares represents DNAM-1NK cells, e-h.
CD96 and DNAM-1 have an opposite role in the immunosurveillance of MCA Induced fibrosarcoma mediated by NK. cells. e~h Groups of 15-30 male, WT,
WO 2015/024060
PCT/AU2014/000830
ΒΝΑΜ-Γ~ and CD96' and DNAM-F CD9M mice were injected with MCA (100 pg/mouse). The survival (e-g) and the growth curves of individual mice with sarcoma (h) are shown, f. WT mice were treated with an anti-CD96, anti-DNAM-1 or anti-CD 15 5 mAbs as defined in the Materials and Methods, g. WT and. CD96' 5 mice were injected with 100 pg MCA and treated with either a control antibody, antiIFN-γ antibody, or anti-asialoGM 1. * p<0,05 Mantel-Cox test.
Figure 4: An.ti-CD96 mAb has single agent activity and enhances the anti-tumor responses of anti-PDl. C57BL/6 wild type (WT) mice were injected subcutaneously with AT3-OVAd™ tumor cells (106 cells) and treated on day 16, 20 and 24 with 10 intraperitoneal injections of anti-CD96 mAb (3.3, 250 pg i.p) or anti-PD-1 (RMPI14, 250 pg i.p.). Means ± SEM of 5 mice per group (mm) are shown (*: p<0.05 compared to cig alone by Mann-Whitney test).
Figure 5: Anti-CD96 mAb enhances anti-tumor responses generated by
Doxorubicin (DOX) chemotherapy. C57BL/6 wild type (WT), DNAM-Γ', and 15 CD96'' mice were injected subcutaneously with. AT3-OVA‘jmi tumor cells (106 cells) and treated on day 14 with control PBS or DOX (50 microliters, 2 mM, intratumor).
Some groups of WT mice also received on day 12, 14, 18, 21, 24 and 28 intraperitoneal injections of anti-CD96 mAb (3.3, 250 pg i.p) or anti-DNAM-1 (480. .1,250 pg i.p.). Means ± SEM of 5 mice per group ίιππΓ ΐ are shown.
Figure 6: Enhanced anti-tumor responses of Doxorubicin ( DOX) chemotherapy with host CD96 deficiency. C57BL/6 wild type (WT), DNAM-Γ', and CD96' ’ mice were injected subcutaneously with AT3-OVAd!I” tumor cells (106 cells) and treated on day 1.6 with control PBS or DOX (50 microliters, 2 mM, intratumor). Means ± standard errors of 5 mice per group (mnf) are shown.
Figure 7: Anti-CD96 mAb enhances anti-tumor responses generated by
Doxorubicin (DOX) chemotherapy. C57BL/6 wild type (WT) mice were injected subcutaneously with AT3-OVA*® tumor cells (10b cells) and treated on day .16 with control PBS or DOX (50 microliters, 2 mM, intratumor). Some groups of WT mice also received on. day 16, 20, and 23 intraperitoneal injections of anti-CD96 mAb 30 (3.3, 250 pg i.p). Means ± SEM of 5 mice per group (mnC) are shown (*; p<0.05 compared to cig alone by Mann-Whitney test).
Figure 8: Early anti-CD96 mAb enhances anti-tumor responses generated by anti-PD-1 and anti-CTLA-4 mAbs. C57BL/6 wild-type (WT) mice were injected
WO 2015/024060
PCT/AU2014/000830 subcutaneously with B16-OVA melanoma cells (10 cells) and treated on day 1, 5, and 9 with intraperitoneal injections of anti-CD96 mAb (3.3, 250 pg i.p), anti-PD-1 mAb (RMP1-14, 250 pg i.p.), anti-CTLA-4 (UC10-4F10, 250 pg i.p.), antiCD96/anti-PD-l mAbs (250 pg i.p each), anti-CD96/anti-CTLA-4 mAbs (250 pg i.p each) or control Ig (cig) (2A3, 250 pg i.p). Means ± SEM of 5 mice per group (mm) are shown (*: p<0.05 compared with anti-CD96 alone, by Matm-Whitney test).
Figure 9: Late anti-CD96 mAb enhances anti-tumor responses generated by anti-PD-1 mAb. C57BL/6 wild-type (WT) mice were injected subcutaneously with B16-OVA melanoma cells (105 cells) and treated on day 16, 20, and 24 with intraperitoneal injections of anti-CD96 mAb (3..3, 250 pg i.p), anti-PD-1 mAb (RMP 1.-14, 250 pg i.p.), anti-CTLA-4 (UC10-4FIO, 250 pg i.p.), anti-CD96/amiPD-1 mAbs (250 pg i.p each), anti-CD96/anli-CTLA-4 mAbs (250 pg i.p each) or control Ig (cig) (2A3, 250 pg i.p). Means ± SEM of 5 mice per group (mm) are shown (*: p- 0.05 compared with anti-CD96 alone by Mann-Whitney test).
Figure 10: Host CD96 promotes B16FI0 lung metastasis. C57BL/6 wild type (WT), DNAM-Γ', CD96'··, and DNAM-rCD96 mice were injected intravenously with B16F10 melanoma cells (10 cells) and metastatic burden was quantified in the lungs after 14 days by counting colonies on the lung surface. Means ± SEM of 9-17 mice per group are shown (*. p<0.05 compared with WT by Mann-Whitney test).
Figure 11: Host CD96 promotes RM-1 lung metastasis. C57BL/6 wild type (WT), DNAM-Γ’, CD96’ , and DNAM-T OD96 'mice were injected intravenous with RM I prostate carcinoma cells (104 cells) and metastatic burden was quantified in the lungs after 14 days by counting colonies on the lung surface. Means ± SEM of 10-15 mice per group are shown (*.: p<0.05 compared with WT by Mann-Whitney test).
Figure 12: Host CD96 promotes 3LL lung metastasis. C57BL/6 wild type ( WT), DNAM-Γ, CD96'·, and DNAM-rCD96' mice were injected intravenously with 3LL lung carcinoma cells (105 cells) and metastatic burden was quantified in the lungs after 14 days by counting colonies on the lung surface. Means ± SEM of 5 mice per group are shown (*: p<0.05 compared with WT by Mann-Whitney test).
Figure 13: Anti-CD96 suppresses B16F10 lung metastasis, alone and in combination with T ceil checkpoint blockade. C57BL/6 wild type (WT) mice were injected intravenous with B16F10 melanoma cells (10J cells). On day 0 and 3 after
WO 2015/024060
PCT/AU2014/000830 tumor inoculation, mice were treated with intraperitoneal injections of anti-CD96 mAh (3.3, 250 pg i,p), anti-PD-1 mAh (RMP1-14, 250 pg i.p.), anti-CTLA-4 (UC104F.10, 250 pg i.p.), anti-CD96/anti-PD-l mAbs (250 pg i.p each), anti-CD96/antiCTLA-4 mAbs (250 pg i.p each) or control Ig (cig) (2A3, 250 pg i.p). Metastatic burden was quantified in the lungs after 14 days by counting colonies on the lung surface. Means ± SEM of 5 mice per group are shown (*: p<0.05 compared with anti-CD96 alone by Mann-Whitney test).
Figure 14: Anti-CD96 suppresses RM-1 lung metastasis, alone and in combination with T cell checkpoint blockade. C57BL/6 wild type (WT) mice were injected intravenous with RM-1 prostate carcinoma cells (104 cells). On day 0 and 3 after tumor inoculation, mice were treated with intraperitoneal injections of antiCD96 mAb (3.3, 250 pg i.p), anti-PD-1 mAb (RMP.1-14, 250 pg i.p.), anti-CTLA-4 (UC10-4F10, 250 pg i.p.), anti-CD96/anti-PD-I mAbs (250 pg i.p each), antiCD96/anti-CTLA-4 mAbs (250 pg i.p each) or control Ig (cig) (2A3, 250 pg i.p). Metastatic burden was quantified in the lungs after 14 days by counting colonies on the lung surface. Means ± SEM of 5 mice per group are shown .(*: p<0.05 compared with anti-CD96 alone by Mann-Whitney test).
Figure 15: Late anti-CD96 mAb enhances anti-tumor responses generated by anti-PD-1 mAb. C57BL/6 wild-type (WT) mice were injected subcutaneously with Μί38-θνΑώ™ colon adenocarcinoma cells (IO'1 cells) and treated on day 14, 18, 22, and 26 with intraperitoneal injections of anti-CD96 mAb (3.3, 250 pg i.p), anti-PD-1 mAb (RMPI-14, 250 pg i.p.), anti-CTLA-4 (UC10-4FI0, 250 pg i.p.), antiCD96/anti-PD-I mAbs (250 pg i.p each), anti-CD96/anti-CTLA-4 mAbs (250 pg i.p each) or control Ig (cig) (2A3, 250 pg i.p). Means ± SEM of 5 mice per group (mm2) are shown (*: p<0.05 compared with anti-CD96 alone by Mann-Whitney test).
Fig. 16. Mechanism of the anti-tumor effect of anti-CD96 alone against AT3-OVAd,ni mammary carcinoma. (A-B) C57BL/6 wild-type (WT) and pfp ‘ mice were injected s.c. with AT3-OVAdi,n mammary carcinoma (1 x 106 cells). On (A) day 16, 20, and. 24 or (B) day 12, 1.6 and 18 after tumor inoculation mice were treated with i.p. injections of cig (250 pg i.p.) or anti-CD96 mAb (250 pg i.p.). Some groups of mice were treated on (A) days 14, 16, and 23 after tumor inoculation with cig, antiCD4/anti-CD8P (100 pg i.p.) or anti-asGMl (100 pg i.p.) or (B) days 10, 12 and 18 after tumor inoculation with cig or anti-IFN-y (250 pg i.p.). Mice were then
WO 2015/024060
PCT/AU2014/000830 monitored for tumor growth. Means ± SEM of 5 mice per group (mm) are shown (*: p<0.05 of cig-treated mice compared with anti-CD96 mAb-treated mice by MannWhitney test).
Fig 17. hi Vitro NK cell activation. To analyse the production of IFNy from human NK cells, 96 well U bottom plates were coated with recombinant human CD15.5-FC chimera overnight at 4°C (0.25pg/well). After three washes, 2.5 x 10 human NK cells, freshly isolated from buffy coats and FACS sorted were plated in complete RPMI supplemented with human IL-12 (10 ng/ml), IL-15 (100 ng/ml) and IL-18 (100 ng/ml) in the presence or absence of human anti~CD96 antibody (clone NK92.39, 50 pg/ml). Cultures were also set up in wells not containing CD155-Fc coating. After 24 hours incubation, cells were harvested and analysed for IFNy production by Flow Cytometry. All conditions were run in triplicate and error bars represent the ±SEM. (A) Flow cytometry results using IL-12, 18 and 15; and (B) result from a different donor (not donor 1 shown in 17A) showing the proportion of IFNy positive NK cells.
Fig 18. Binding of human CD96 mAb (NK92.39) to human NK cells reduced the levels of CD96 present on the NK cell surface. Total NK cells were purified from peripheral blood mononuclear cells (PBMCs) by negative selection using human NK cell isolation kit (Miltenyi Biotec.). Isolated NK cells were then labeled with carboxyfluorescein diacetate succinmidyl ester (CFSE; Biolegend) to measurecelhilar proliferation. CFSE-labeled NK cells were plated in 96 well Ubottom plate at 5 x 104 cells/well and stimulated with recombinant IL-2 at indicated concentrations (10 units/ml and 25 units/ml), in the presence of control IgG or antiCD96 mAb (clone NK92-39) at 30 pg/ml. NK cells were assessed for changes in proliferation (A) or the presence/absence of surface CD96; and (B) at day 3 and 6 using BD FACS Canto II (BD Biosciences) and analysis was carried out using Flow Jo (Tree Star).
DETAILED DESCRIPTION
The present invention is at least partly predicated on the unexpected discovery that CD96 is highly expressed by resting NK cells and T cell subsets and competes with DNAM-1 for the binding of CD 155 on resting NK. cells. Using CD96' ‘ mice, it is demonstrated that CD96 dampens or suppresses NK cell production of
WO 2015/024060
PCT/AU2014/000830
IFN-γ in vitro and in vivo, through competition with DNAM-I for CD 155 binding and also through a direct inhibition. Furthermore, CD96 mice were shown to be more resistant to 3’-methylcholanthrene (MCA)-induced tumor formatian as an indicator of carcinogenesis, or BL6F10 (melanoma), RM-1 (prostate cancer), 3LL (lung cancer) experimental metastasis. In human. NK cells, administration of antiCD96 antibody appears to remove or result in the loss of cell surface CD96 and/or cause a down-regulation of CD96 cell surface expression. Based on these observations, it is proposed that CD96 uorm.al.ly acts as a negative regulator of T and NK cell anti-tumor functions, particularly although not exclusively through suppression of IFN-γ production and/or secretion. Accordingly, the invention provides methods of relieving or reducing the negative immunoregulatory function of CD96 to thereby promote or restore immune surveillance, particularly by T cells and NK. cells, to thereby treat or prevent cancer, cancer cell metastasis and/or viral infections.
An aspect of the invention therefore provides a method of reducing or relieving immune inhibition in a mammal, said method including the step of at least partly inhibiting or reducing CD96 activity in one or more cells of the maximal to thereby relieve immune inhibition and/or enhance or restore immune surveillance in the mammal.
By “relieving immune inhibition” in the context of CD96 is meant at least partly eliminating, removing or overcoming a normal activity or function of CD96 in suppressing or inhibiting one or more immune functions of cells that normally express CD96. Typically, the one or more cells that normally express CD96 are T cells, inclusive of CD4: and CDS ’ T cells, γδΤ cells, NKT cells, and natural killer (NK) cells. In some embodiments, relieving immune inhibition may include or relate to abrogating peripheral tolerance to foreign pathogens, host cells displaying foreign pathogens (e.g displaying foreign pathogen-derived peptides in the context of selfMHC) and/or cancerous cells or tissues of the host.
By “enhance or restore immune surveillance” is meant at least partly improving or promoting the ability of one or more elements of the immune system to monitor, detect and/or respond to foreign pathogens, host cells displaying foreign pathogens (e.g displaying foreign pathogen-derived peptides in the context of selfMHC) and/or cancerous cells or tissues of the host. Suitably, the elements of the io
WO 2015/024060
PCT/AU2014/000830 immune system are one or more cells that normally express CD96, such as T cells, inclusive of CD4 and CD8* T cells γδΤ cells, NK.T cells and natural killer (NK) cells.
At least partly inhibiting or reducing CD96 activity in one or more cells of the mammal may be performed, facilitated or achieved by administration of a “CDVti-inhibitory agent” to the mammal. A CD96-inhibitory agent may be any molecule that possesses or displays an ability to at least partly inhibit or reduce a biological activity of CD96. Biological activities of CD96 include one or more of binding CD 155, cell surface expression, eliciting intracellular signaling and/or stimulating or inducing expression and/or secretion of cytokines or chemokines. Preferably, the cytokines or chemokines include any pro-inflammatory cytokine or chemokine inclusive of ΜΙΡ-Ια, ΜΙΡ-Ιβ, RANTES, TNF-α and IFN-γ, although without limitation thereto. Preferably, the cytokine is IFN-γ.
As disclosed herein, CD96 is a transmembrane protein which in the- human, exists in two isoforms. Isoform 1 has been detected in acute myeloid leukaemia and includes additional amino acids compared with isoform 2. Isoform 2 is the more common form in humans and the predicted domain architecture of isoform 2 has three (3) external immunoglobulin-like domains (domains 1, 2 and 3) as listed in Table 1. The amino acid sequence of human CD96 isoform 1 is set forth in SEQ ID NO:2. The nucleotide sequence encoding isoform 2 is set forth in SEQ ID NO;1 Murine CD96 exists as a single isoform, the amino acid sequence of which is set forth in SEQ ID N'O:4. The nucleotide sequence encoding murine CD96 is set forth in SEQ ID NO:3 The external immunoglobulin-like domains (domains 1, 2 and 3) of murine CD96 are also listed in Table 1.
In a preferred form, the CD96-inhibitory agent binds or interacts with an amino acid sequence of one or a plurality of external immunoglobulin-like domains of CD96. For example, the CD96-inhibitory agent may bind or interact with an amino acid sequence of: domain 1; domain 2; domain 3; domain 1 and domain 2; domain 1 and domain 3: domain 2 and domain 3; or domain I, domain 2 and domain 3.
In one embodiment, the CD96-inhibitory agent binds or interacts with one or a plurality of external i mmunoglobulin-like domains of human CD96 isoform 2.
WO 2015/024060
PCT/AU2014/000830
It will also be appreciated that the CD96-inhibitory agent may bind or interact with other CD96 domains or amino acid sequences in addition to one or a plurality of the external or extracellular immunoglobulin-like domains.
Tn one embodiment, the CD96-inhibitory agent inhibits, blocks or antagonizes a binding interaction between CD96 and CD 155. By way of example only, the CD96-mhibitory agent may bind to an extracellular domain of CD96, or a portion thereof, that is capable of interacting with CD 155 (e.g. binding CD155 or being bound by CD 155) to thereby at least partly inhibit or block CD96 binding to CD 155.
hi another embodiment, the CD96-inhibitory agent is a molecule that possesses or displays an ability to inhibit or reduce CD96 signaling activity. Inhibition or reduction of CD96 signaling activity may be through inhibiting, blocking or antagonizing a binding interaction with CD 155 or may be through blocking CD96-initiated signaling that would normally occur in response to CD 155 binding. By way of example, CD96 comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM). ITIMs are structurally defined as 6-amino acid sequences comprising a tyrosine (Y) residue with partly conserved N-terminal (Y-2) and Cterminal (Y+3) residues. A general but non-limiting motif is (S/l/V/LXYXXI/V/L), wherein X is any amino acid. For example, isoform 1 of CD96 comprises the ITIM 20 sequence IKYTCI wherein Y is residue 566.
It has been proposed that when co-aggregated with activating receptors,
ITIMs are phosphorylated by Src-family tyrosine kinases, which enables them to recruit Src homology 2 domain-containing phosphatases (PTPases) that antagonize activation signals. Accordingly, in one embodiment the CD96-inhibitory agent 25 possesses or displays an ability to inhibit or reduce CD96 signaling activity mediated by the CD96 ITIM. Preferably, inhibition or reduction of CD96 signaling activity mediated by the CD96 ITIM enables increased or enhanced cytokine (e.g lFN-γ) expression, production and/or secretion by a cell expressing CD96.
In another embodiment, the CD96-inhibitory agent is a molecule that 30 removes cell surface CD96 and/or reduces or down-regulates cell surface expression ofCD96.
The CD96-inhibitory agent may be a protein (inclusive of peptides, antibodies and antibody fragments), a nucleic acid (inclusive of inhibitory RNA
WO 2015/024060
PCT/AU2014/000830 molecules such as ribozymes, RNAi, miRNA and siRNA, although without limitation thereto), a lipid, a carbohydrate, a small organic molecule or any combination of these (<?.g a glycoprotein, a lipoprotein, a peptide-nucleic acid etc).
In one particular embodiment, the CD96-inhibitory agent is an antibody or 5 antibody fragment that binds CD96.
In a preferred form, the antibody or antibody fragment binds or interacts with an amino acid sequence of one or a plurality of external or extracellular immunoglobulin-like domains of CD96. For example, the antibody or antibody fragment may bind or interact with an amino acid sequence of: domain 1; domain 2;
domain 3; domain 1 and domain 2; domain 1 and domain 3: domain 2 and domain 3; or domain 1, domain 2 and domain 3.
In one embodiment, the antibody binds or interacts with one or a plurality of external immunoglobulin-like domains of human CD96 isoform 2.
Ln one form the antibody binds CD96 and at least partly blocks or inhibits 15 CD96 binding to CD 155.
Antibodies may be polyclonal or monoclonal, native or recombinant, Antibody fragments include Fab and Fab’2 fragments, diabodies and single chain antibody fragments (e.g. scVs), although without limitation thereto. Antibodies and antibody fragments may be modified so as to be administrable to one species having 20 being produced in, or originating from, another species without eliciting a deleterious immune response to the “foreign” antibody. In the context of humans, this is “humanization” of the antibody produced in, or originating from, another species. Such methods are well known in the art and generally involve recombinant “grafting” of non-human antibody complementarity determining regions (CDRs) 25 onto a human antibody scaffold or backbone.
Suitably, the step of inhibiting or reducing CD96 activity in the mammal does not include killing CD96-expressing cells in the mammal. In this context, “killing” may refer to any antibody-mediated cytotoxic mechanism such as complementmediated cytolysis and. antibody-mediated cell-mediated cytotoxicity (ADCC), the 30 latter typically mediated by natural killer (NK) cells, macrophages, neutrophils and eosinophils. In this regard, it may be advantageous to use antibody fragments lacking an Fc portion or having a mutated Fc portion.
The step of inhibiting or reducing CD96 activity in the mammal may be achieved or facilitated by administering a CD96-inhibitory agent to the mammal.
WO 2015/024060
PCT/AU2014/000830
By “admmistermg” is meant the introduction of the CD96-inhibitory agent into the mammal by a particular route. Suitably, a therapeutically effective amount of the CD96-hdiibitory agent is administered to the mammal.
The term “therapeutiaalfy effective amount” describes a quantity of a specified agent sufficient to achieve a desired effect in a mammal being treated with that agent.
Generally, the method of the invention may be useful in reducing or relieving CD96-mediated immune inhibition, suppression or peripheral tolerance. Suitably, the method facilitates treatment or prevention of one or more diseases or conditions that 10 are responsive to at least partly blocking CD96-mediated immune inhibition, suppression or peripheral tolerance.
As used herein, ‘ftrea/mg” or “treat” or “treatment” refers to a therapeutic intervention that at least party eliminates or ameliorates one or more existing or previously identified .symptoms of a disease or condition that is responsive to at least 15 partly blocking CD96-mediated immune inhibition, suppression or peripheral tolerance.
As used herein, “preventing” or “prevent” or “prevention” refers to a prophylactic treatment initiated prior to the onset of a symptom of a disease or condition that is responsive to at least partly blocking CD96-mediated immune 20 inhibition, suppression or peripheral tolerance, so as to at least partly or temporarily prevent the occurrence of the symptom.
Typically, the disease or condition that is responsive to at least partlyblocking CD96-mediated immune inhibition, suppression or peripheral tolerance is any disease or condition where enhanced or restored immune surveillance can 25 benefit a subject suffering from the disease or condition. Such diseases and conditions may include those where persistence of the disease or condition can be controlled or suppressed by cell-mediated immunity. Non-limiting examples include cancers and viral infections. Particular viral infections contemplated by the invention include persistent viral infections such as caused by human immunodeficiency virus 30 (HIV), Epstein Barr Virus (EBV), Herpes Simplex Virus (HSV inclusive of HSV1 and HSV2), Human Papillomavirus (HPV), Varicella zoster virus (VSV) and Cytomegalovirus (CMV), although without limitation thereto.
In a preferred embodiment, the method reduces or relieves immune inhibition in a mammal sufficient to treat or prevent cancer or cancer metastasis in the
WO 2015/024060
PCT/AU2014/000830 mammal Suitably, the cancer may be any that is responsive to at least partly blocking CD96-mediated immune inhibition, suppression or peripheral tolerance. Cancers may be in the .form of solid tumors, sarcomas, lymphomas, myelomas, carcinomas, melanomas, cytomas and meningiomas, although without limitation 5 thereto. Non-limiting examples of cancers include cancers of the adrenal gland, bladder, bone, bone marrow, brain, breast, cervix, gall bladder, ganglia, gastrointestinal tract, heart, kidney, liver, lung, muscle, ovary, pancreas, pituitary, parathyroid, prostate, salivary glands, skin, spleen, testis, thyroid, and uterus. Particular non-limiting examples of cancers include colon cancer, lung cancer and 10 prostate cancer. In some embodiments, the cancer is a metastatic cancer, which is capable of migrating to another site, tissue or organ in the body and forming a tumor at that site, tissue or organ. This may occur repeatedly over time. A particularly aggressive metastatic cancer contemplated by the invention is metastatic melanoma.
It will also be appreciated that the method of treatment or prevention of 15 cancer may further include co-administration of one or more other therapeutic agents that facil itate cancer treatment or prevention . By way of example only, these include: chemotherapeutic agents such as paclitaxel, doxorubicin, methotrexate and cisplatin, although without limitation thereto; and/or bio therapeutic agents such as anti-PD-1 antibodies (e.g. Nivolumab) and anti-CTLA4 antibodies (e.g Ipilimumab), although 20 without limitation thereto. Also contemplated are bi-specific antibodies that bind both CD96 and one or more other molecules including but not limited to PD-1 and CTLA4.
The one or more other agents that facilitate cancer treatment or prevention may be administered in combination with the CD96-inhibitory agent or be 25 administered separately, as is well understood in the art.
In some embodiments, the CD96-inhibitory agent may be formulated alone or together with the one or more other agents is in the form of a pharmaceutical composition.
Suitable dosages of CD96-mhibrtory agents, alone or together with other 30 therapeutic agents, for mammalian administration, including human administration, may be readily determined by persons skilled in the art.
Suitably, the pharmaceutical composition comprises an appropriate phannaceutieally-acceptable carrier, diluent or excipient.
WO 2015/024060
PCT/AU2014/000830
Preferably, the pharmaceufically-acceptable earner, diluent or excipient is suitable for administration to mammals, and more preferably, to humans.
By iSpharmaceutically-acceptable carrier, diluent or excipient” is meant a solid or liquid filler, diluent or encapsulating substance that may be safely used in systemic administration. Depending upon the particular route of administration, a variety of carriers, diluents and excipients well known in the art may be used- These carriers may be selected from a group including sugars, starches, cellulose and its derivatives, malt, gelatine, talc, calcium sulfate, vegetable oils, synthetic oils, polyols, alginic acid, phosphate buffered solutions, emulsifiers, isotonic saline and 10 salts such as mineral acid salts including hydrochlorides, bromides and sulfates, organic acids such as acetates, propionates and malonates, and pyrogen-free water.
A useful reference describing pharmaceutically acceptable carriers, diluents and excipients is Remington’s Pharmaceutical Sciences (Mack Publishing Co. NJ USA, 1991).
Any safe route of administration may be employed for providing a subject with compositions comprising the CD96-inhibitory agent. For example, oral, rectal, parenteral, sublingual, buccal, intravenous, intra-articular, intra-muscular, intradermal, subcutaneous, inhalational, intraocular, intraperitoneal, intracerebroventricular, ttansdermal, and the like may be employed.
A further aspect of the invention provides a method of screening, designing, engineering or otherwise producing a CD96-inhibitory agent, said method including the step of determining whether a candidate molecule is capable of at least partly inhibiting or reducing C.D96 activity to thereby relieve immune inhibition and/or enhance or restore immune surveillance in a mammal.
The invention also provides a C2D96-inhibitOFy agent screened, designed, engineered or otherwise produced according to the aforementioned aspect.
The candidate molecule may be a protein (inclusive of peptides, antibodies and antibody fragments), a nucleic acid (inclusive of inhibitory RNA molecules such as ribozymes, RNAi, miRNA and siRNA, although without limitation thereto), a 30 lipid, a carbohydrate, a small organic molecule or any combination of these (e.g a glycoprotein, a lipoprotein, a peptide-nucleic acid etc).
In some embodiments, the candidate modulator may be rationally designed or engineered de novo based on desired or predicted structural characteristics or features that indicate the candidate modulator could block, or inhibit one or more
WO 2015/024060
PCT/AU2014/000830 biological activities ofCD96, such as CD 155 binding, intracellular signaling and/or IFN-γ production and/or secretion. In other embodiments, the candidate modulator may be identified by screening a library of molecules without i nitial selection based on desired or predicted structural characteristics or features that indicate the candidate modulator could block or inhibit one or more biological activities of CD96. Such libraries may comprise randomly generated or directed libraries of proteins, peptides, nucleic acids, recombinant antibodies or antibody fragments (e.#. phage display libraries), carbohydrates and/or lipids, libraries of naturally-occurring molecules and/or combinatorial libraries of synthetic organic molecules.
Non-limiting examples of techniques applicable to the design and/or screening of candidate modulators may employ X-ray crystallography, NMR spectroscopy, computer assisted screening of structural databases, computer-assisted modelling or biochemical or biophysical techniques which detect molecular binding interactions, as are well known in the art.
Biophysical and biochemical techniques which identify molecular interactions include competitive radioligand binding assays, co-immunoprecipitation, fluorescence-based assays including fluorescence resonance energy transfer (FRET) binding assays, electrophysiology; analytical ultracentrifugation, label transfer, chemical cross-linking, mass spectroscopy, microcalorimetry, surface plasmon resonance and optical biosensor-based methods, such as provided in Chapter 20 of CURRENT PROTOCOLS IN PROTEIN SCIENCE Eds. Coligan et al, (John Wiley & Sons, 1997) Biochemical techniques such as two-hybrid and phage display screening methods are provided in Chapter 19 of CURRENT PROTOCOLS IN PROTEIN SCIENCE Eds. Coligan etal., (John Wiley & Sons, 1997).
Accordingly, an initial step of the method may include identifying a plurality of candidate molecules that are selected according to broad structural and/or functional attributes, such as an ability to bind CD96.
The method may include a further step that measures or detects a change in one or more biological activities of CD96 in response to the candidate molecule(s). These may include CD 155 binding, the presence or absence of cell surface CD96, intracellular signaling, cytokine and/or chemokine production or secretion and/or protection from tumor challenge in an m vivo model.
WO 2015/024060
PCT/AU2014/000830
Inhibition of CD 155 binding to CD96 by a candidate molecule may be determined by any of several techniques known in the art including competitive radioligand binding assays, surface plasmon resonance (e.g. BIACore™ analysis), co-immunoprecipitation and fluorescence-based analysis of the ability of a candidate 5 inhibitor to block CD155 binding to CD96 (such as by flow cytometry where CD 155 is labeled with a fluorophore). Non-limiting examples of fluorophores include fluorescein isothiocyanate (FITC), allophycocyanin (APC), fluorescein derivatives such as FAM and ROX. Texas Red, tetramethyl rhodamine isothiocyanate (TRITL), R-Phycoerythrin (RPE), Alexa and Bodipy fluorophores, although without limitation 10 thereto.
Alternatively, this fluorescence-based analysis could include FRET analysis (e'.g. one protein coupled to a donor fluorophore, the other coupled to an acceptor fluorophore), although without limitation thereto.
Ln some embodiments, intracellular signaling may be measured directly at the 15 level of CD96, such as by measuring recruitment of SH2 domain-containing PTPases by CD96 expressed by NK cells, or T cell subsets. A candidate molecule of the invention suitably prevents or reduces recruitment of SH2 domain-containing PTPases by CD96 in the presence of CD 155. According to this embodiment, the candidate molecule may at least partly inhibit or prevent binding between CD96 and 20 CD 155, thereby at least partly inhibiting or preventing intracellular signaling by CD96, and/or at least partly inhibit or prevent intracellular signaling by CD96 despite CD 155 binding.
In other embodiments, an effect of a candidate molecule on CD96 may be determined by measuring expression, production and/or secretion of one or more 25 cytokines or chemokines by cells expressing CD96. Generally, changes in cytokine or chemokine expression production and/or secretion may be measured by RT-PCR of cytokine niRNA, measurement of cytokine or chemokine protein located intracellularly (e.g by immunocytochemistry using cytokine- or chemokine-specific antibodies) and/or measurement of secreted cytokines or chemokines such as by flow 30 cytometric Cytokine Bead Array (such as commercially available from BD Biosciences), by ELISA using cytokine- or chemokine-specific antibodies and by bioassays that use cytokine- or chemokine-responsive cell lines to measure cytokines and/or chemokines secreted into cell supernatants. The cytokine may be any pro
WO 2015/024060
PCT/AU2014/000830 inflammatory cytokine or chemokine inclusive of MIP-Ia, MIP-Ιβ, RANTES, TNFα and IFN-γ, although without limitation thereto. Preferably, the cytokine is LFN-γ.
The effect of a candidate CD96 inhibitory agent may be upon CD96 expression, inclusive of cell surface expression and CD96 gene expression. It will be 5 appreciated that in certain cells, such as NK cells although without limitation thereto, CD96 inhibitory agents may cause or facilitate a removal, loss and/or downregulation of CD96 expression. In some embodiments, thus may include removal, loss and/or down-regulation of CD96 expression at the cell-surface. This may occur as a result of enhanced internalization or endocytosis of cell surface CD96 and/or by 10 a down-regulation or suppression of CD96 gene expression. In particular embodiments, CD96 cell surface expression may be detected or measured by flow cytometry, immunoprecipitation, immunocytochemistry or immunohistochemistry, typically by way of an antibody or antibody fragment which binds CD96, as hereinbefore described. In particular embodiments, CD96 gene expression may be 15 measured by nucleic acid sequence amplication (e.g. PCR inclusive of quantitative and semi-quantitaive PCR) or nucleic acid hybridization techniques such as Northern blotting.
Preferably, the CD96-inhibitory effect of a candidate molecule may be determined using an in vivo tumor challenge model. For example, a mouse model 20 using CD96-expressing mice may be used to determine the ability of a candidate molecule to inhibit or prevent tumor formation and/or growth in response to an administered carcinogenic agent such as methycholanthrene (MCA). In another example, a mouse model using CD96-expressing mice may be used to determine the ability of a candidate molecule to inhibit or prevent tumor formation and/or growth 25 in response to administration of tumor cells such as melanomas, colon adenocarcinomas, prostate carcinomas and mammary carcinomas, although without limitation thereto. Other mouse models may utilize mice that are predisposed to spontaneously forming tumors including but not limited to MMTV-polyoma, MT mammary cancer, DMBA/TPA induced skin cancer, p53 loss lymphoma/sarcoma 30 and TRAMP Tg prostate cancer.
It will be understood that the method of this aspect may be performed iteratively, whereby multiple rounds of screening, design, and biological testing are performed. This may include where a candidate molecule is structurally modified before each round, thereby enabling “fine-tuning” of the candidate molecule.
WO 2015/024060
PCT/AU2014/000830
It will also be appreciated that the method may be performed in a “high throughput5’, “automated” or “semi-automated” manner, particularly during early stages of candidate molecule identification and selection.
In a preferred embodiment, the candidate molecule is an antibody or antibody fragment. As hereinbefore described, antibodies may be polyclonal or monoclonal,, native or recombinant. Antibody fragments include Fab and Fab’2 fragments, diabodies and single chain antibody fragments (e.g. scVs), although without limitation thereto. Well-known protocols applicable to antibody production, selection, purification and use may be found, for example, in Chapter 2 of Coligan et 10 al., CURRENT PROTOCOLS IN IMMUNOLOGY (John Wiley & Sons NY, 1991 1994) and Harlow, E. & Lane, D. Antibodies: A Laboratory Manual, Cold Spring Harbor, Cold Spring H arbor Laboratory, 1988, which are both herein incorporated by reference.
Polyclonal antibodies may be prepared for example by injecting CD96 or a fragment (e.g a peptide) thereof into a production species, which may include mice or rabbits, to obtain polyclonal antisera. Methods of producing polyclonal antibodies are well known to those skilled in the art. Exemplary protocols that may be used are described for example in Coligan et al., CURRENT PROTOCOLS IN IMMUNOLOGY, supra, and in.Harlow & Lane, 1988, supra.
Monoclonal antibodies may be produced using the standard method as for example, described in an article by Kohler & Milstem, 1975, Nature 256,495, which is herein incorporated by reference, or by more recent modifications thereof as for example, described in Coligan et al., CURRENT PROTOCOLS IN IMMUNOLOGY, supra by immortalizing spleen or other antibody producing cells 25 derived from a production species which has been inoculated with one or more of the isolated proteins, fragments, variants or derivatives of the invention. Suitably, the antibody or antibody fragment is suitable for administration to a human. In this context, as hereinbefore described the antibody or antibody fragment may be a “humanized” form of an antibody or antibody fragment produced in, or originating 30 from, another species. Such methods are well known in the art and generally involve recombinant “grafting” of non-huraan antibody complementarity determining regions (CDRs) onto a human antibody scaffold or backbone.
In a preferred embodiment, the antibody or antibody fragment does not kill CD96-expressing cells upon administration to a human. In this context, “killing”
WO 2015/024060
PCT/AU2014/000830 may refer to any antibody-mediated cytotoxic mechanism such as complementmediated cytolysis and antibody-mediated cell-mediated cytotoxicity (ADCC), the latter typically mediated by natural killer (NK) cells, macrophages, neutrophils and eosinophils. In this regard, it may be advantageous to use antibody fragments lacking 5 an Fc portion or having a human Fc portion (e.g a humanized antibody).
A CD96-mhibitory agent screened, designed, engineered or otherwise produced according to the aforementioned aspect, may be used according to the method of the first aspect (e.g as an anti-cancer agent and/or an anti-viral agent), preferably in the form of a pharmaceutical composition as hereinbefore described.
So that the invention may be readily understood and put into practical effect, reference is made to the following non-limiting examples.
WO 2015/024060
PCT/AU2014/000830
EXAMPLES
Example 1
CD96 binding to €1)155 and the effects of CD96 inhibition and knockout in mouse tumor models
Materials and Methods
Mice
Wild Type C57BL/6 mice were purchased from the- Walter and Eliza Hall
Institute for Medical Research or ARC Animal Resource Centre. C57BL/6 CD96 mice were generated by Dr, Marco Colonna and Dr. Susan Gilfillan at the Washington University School of Medicine (St Louis, MO, USA) as follows. A targeting construct designed to replace exons 1 and 2 of CD96, including the start 15 site, with a MCl-neor gene flanked by loxP sites was electroporated into El. 4..1 (129P2/01aHsd) embryonic stem cells (Fig, SI). Chimeras transmitting the targeted allele were obtained from two clones following injection into C57BL/6 blastocysts. Mice carrying the targeted allele were bred to C57BL/6 mice expressing a Cre transgene under the CMV promoter to delete the MCl-neor gene (Schwenk et al., 20 1995). The CD96 deletion was backcrossed onto a C57BL/6 background, facilitated by a genome-wide screening of polymorphic microsatellite markers at 10centiMorgan intervals at each generation. CD96'’ >99% C57BL/6 mice were intercrossed to generate the CD96 ' mice. DNAM-Γ’ mice have already been described. DNAM-Γ CD96’ ’ were generated by intercrossing CD96 with DNAM25 1” mice. Mice were bred and used between the ages of 6-14 weeks. All experiments were approved by animal ethics committee.
Cell Culture
B16F10, RM-1, 3LL, AT3, MC38 and YAC-1 cell lines were grown in 30 complete RPM1 Medium (Gibco, Invitrogen,) i.e supplemented with 10% FCS (Thermo Scientific), L-Glutamine (Gibco), Non-Essential Amino Acids, Sodium Pyruvate, HEPES (Gibco) and Penicillin'Streptomycin (Gibco), at 37 °C in 5% COa. For cytotoxicity assays and IL.- 12/TL-l 8 titration experiments, primary NK cells were harvested from the spleen, sorted using a mouse NK cell isolation kit (Miltenyi
WO 2015/024060
PCT/AU2014/000830
Biotec) and AutoMACS (Miltenyi Biotec), and subsequently cultured for 5 days in RPMI Medium supplemented with 10% FCS, L-Glutamine, Penicillin/StTeptoniycin, Non-Essential Amino Acids (Gibco), Sodium Pyruvate (Gibco), HEPES (Gibco), β2-mercaptoethanol (Calbiochem), and 1000 lU/ml recombinant human IL-2 (Chiron 5 Corporation). All cells were incubated at 37(>C in 5% CO^
In vivo LPS challenges
EPS (from £. Coli 0127/B8, Sigma) suspended in PBS was injected intraperitoneally into mice at the described doses. For survival curves, mice were 10 checked hourly for symptoms of sepsis. Serum from these mice was taken at various time points by retro-orbital or cardiac bleeding for cytokine analysis. Spleens were also taken from mice at various time points to analyse receptor and ligand expression, and intracellular IFN-γ expression from NK cells.
In vivo famor challenges
Mouse B16F10 or BI6-OVA melanomas, RM-1 prostate carcinoma, 3LL lung carcinoma, MC38-OVAdnn colon adenocarcinoma or AT3-0VAd!1B mammary carcinoma, were injected into WT, DNAM-1”, CD96, or DNAM-r 'CD96 mice subcutaneously or intravenously at the indicated doses and monitored for solid tumor 20 growth or metastasis, respectively. Treatments were administered as indicated in the Figure legends. To monitor solid tumor growth, the area of the ensuing tumor was calculated by taking the length and width of palpable tumors by calipers and plotted against time. To monitor metastasis formation, 14 days after cells were injected, lungs were harvested, placed in Bouin’s fixative, and metastases were counted using 25 a dissection microscope.
MCA - induced fibrosarcoma
WT, DNAM-Γ', CD96'* and DNAM-I‘CD96*' mice were injected subcutaneously on the right flank with various doses of MCA (5-400 pg, e.g. 100 pg 30 MC A) and were monitored over time for fibrosarcoma formation. In addition, some mice were treated with control antibody, depleted of NK cells by treatment with antiasialoGMl (Wako Chemicals; 100 pg injected i.p. at day -1, 0 and then weekly until
WO 2015/024060
PCT/AU2014/000830 week 8), neutralized for IFN-γ (H22, 250 pg injected i.p. at day -1, 0 and then weekly until week 8), for CD 15 5, for DNAM-l or CD96.
Dendritic cells (BMDC): NK cell cocullure assays
BM.DC were generated as described previously. Briefly, we harvested bone marrow cells from the femur and tibia of mice and cultured them in DMEM supplemented with 10% FCS, L-Glutamine, Penicillin/Streptomycin, Non-Essential Amino Acids, Sodium Pyruvate, β-2-mercaptoethanol and 250 ng/ml GM-CSF (eBioscience) for 6 days. WT or CD96“ ’ NK cells were harvested from the spleens and FACS sorted to purity by staining with NK1.1 (PK136) and TCRp (1157-597) and CD3 (17A2) antibodies. NK cells were harvested on the day of the assay. For assay set up, 5 x 10 BMDM were plated in 96 well U bottom plates. NK cells were then added to the BMDM at varying titrations (2:1, 1:1, 0.5:1, and 0.25:1). BMDM only and NK only were always included in the assay as controls. Once all cells were plated, each well was filled with the appropriate amount of media to yield equivalent volumes between wells. 100 ng/ml of EPS was then added to the wells for 2 h, followed by 5 mM purified ATP (Sigma) for 30 mins. This was performed at 37”C in 5% CO;- EPS only and ATP only controls were also included in the assay as controls. After 30 mins with ATP, supernatants were harvested and stored at -20°C until analysed.
'!Cr Cytotoxicity Assays
Standard 51Cr cytotoxicity assays were used to analyse the ability of WT and CD96 NK cells to kill targets. Briefly 20,000 targets labeled with 100 pCt of >JCr were added to V bottom plates and NK cells were then added to the targets at defined effector to target ratios. After 4 h at 3 7 °C in 5% CO?, supernatants were harvested, and tire level of ?4Cr was quantified by a gamma counter (Wallac Wizard). Percentage specific killing was determined using the formula (Sample Cr releaseSpontaneous Cr release)/(Total Cr release-Spontaneous Cr release) x 100.
Cytokine Detection
All cytokine detection in serum or supernatants except IL-18 was achieved by utilising Cytometric Bead Array (CBA) technology (BD Biosciences). Acquisition
WO 2015/024060
PCT/AU2014/000830 was completed using a Canto II or LSRII Flow Cytometric Analyser (BD Biosciences). Analysis was performed using the FC.AP array software. IL-18 was detected by an ELISA according to manufacturer’s instructions (MRL). For intracellular cytokine detection, isolated lymphocytes were obtained from the liver, 5 stained for surface markers, fixed and permeabilised (BD Biosciences), and stained with an anti-IFN-y antibody (XMG 1.2).
Flow Cytometry Analysis and Sorting
Analysis of Immune Cell Homeostasis and CD96/CD155 expression; Various 10 organs (lymph node, lung, spleen, bone marrow, and liver) were processed into single lymphocyte suspensions that included red blood cell lysis. Between 1 x 106 and 5 x 10f’ cells were initially subject to incubation with 2.4G2 to block non-specific Fc antibody binding before specific antibodies were utilised. To analyse NK cell homeostasis and IFN-γ production, the following antibodies were used: anti mouse15 NK1.I, -TCRp, -CD27 (LG.7F9), -CDllb (MI/70), and -IFN-γ. For T cells: anti mouse- TCRp, -CDS (53-6.7). and -CD4 (RM4-5). For B cells: anti mouse -B220 (RA3-6B2), -CD 19 (1D3). For NKT cells: mouse CD Id tetramer loaded with agalactosylceramide (kindly provided by Professor Dale Godfrey, University of Melbourne), anti mouse- TCRp or -CD3, -CD4, and -NK1.1. For macrophages: anti 20 mouse- F4/80 (BM8) and -CD1 lb. For neutrophils: anti mouse- Ly6G (1A8) and CDllb. For conventional DC: anti mouse- MHC 11 (M5/114.15.2) and -CDLie (N4I8). For γδ T cells: anti mouse -γδ TCR (GL3) and -CDS. To analyse CD96 and CD155 expression, the specific cell type of interest was gated upon using the above antibody cocktails along with anti mouse- CD96 (3.3.3) or anti mouse- CD155 25 (4.24.3). Acquisition was performed using an LSR II, or Canto II flow cytometric analyser (BD Biosciences). Analysis was achieved using Flowjo (Treestar).
Cell Sorting
Naive NK cells and macrophages from the spleen were prepared and stained 30 for as described above. These cells were then sorted to purity using an Aria II FACS sorter (BD Bioscienees).
WO 2015/024060
PCT/AU2014/000830
Statistical Analysis
Statistical analysis was achieved using Graphpad Prism Software. Data was considered to be statistically significant where the p value was equal to or less than 0.05. Statistical tests used were the unpaired Student’s t test, Mann Whitney t test, 5 and the Mantel-Cox test for survival. The appropriate test used is defined in the Figure legends.
Results
CD96 competes with DNAM-1 for CD 155 binding (Figure 1) and CD96 10 engagement by CD 155 down-regulates NK cell production of IFNy (Figure 2). CD96 limits NK cell-dependent tumor immunoswveillance in MCA-treated mice and promotes experimental Bl 6F10 lung metastasis (Figure 3).
The data in Figure 4 show that anti-CD96 mAb has single agent activity (i.e without anti-PDl treatment) while also enhancing the anti-tumor responses of anti15 PD1. Anti-CD96 mAb treatment also enhances anti-tumor responses generated by Doxorubicin (DOX) chemotherapy (Figures 5 & 7) which is consistent with Figure 6 where enhanced anti-tumor responses to Doxorubicin (DOX) chemotherapy were observed in host with CD96 deficiency. Referring to Figures 8 & 9, given early or late, anti-CD96 mAh enhances anti-tumor responses generated by anti-PD-1 and 20 anti-CTLA-4 mAbs and shows a particularly strong synergy with anti-PD-1.
The effect of CD96 in promotion of tumour metastasis was also investigated. In Figure 10, regulation of B16F10 lung metastasis was investigated in C57BL/6 wild type (WT), DNAM-1CD96 , and DNAM- r CD96“' mice In Figure 11, host CD96 promoted RM-1 lung metastasis and in Figure 12, host CD96 promoted 3LL 25 lung metastasis Figure 13 shows that anti-CD96 mAb suppresses B16F10 lung metastasis, alone and in combination with a T cell checkpoint blockade. In Figure 14, anti-CD96 mAb suppresses RM-1 lung metastasis, alone and in combination with T cell checkpoint blockade. In Figure 15, anti-CD96 mAb enhances anti-tumor responses generated by anti-PD-1 and anti-CTLA-4 .mAbs against MC38 colon 30 tumors and shows a particularly strong synergy with anti-PD-1.
WO 2015/024060
PCT/AU2014/000830
Example 2
Screening assays far identifying anti-CD96 antibodiesIntroduction
The following assays may be used to identify antibodies usefi.il in the invention. The first assay would be used to identify human antibodies capable of blocking or inhibiting binding between human CD96 and human CD 155, The second assay may be used to test whether or not the identified antibodies cause antibody-dependent cell-mediated cytotoxicity (ADCC). The third assay can then be applied to lead candidates and involves determining whether or not a human CD96 antibody can modulate human lymphocyte effector function.
Materials and Methods
Assay 1: CD96 binding to CD155
The ability of candidate anti-CD96 antibodies to prevent the binding of CD 155 to the cell surface of CD96 expressing cells (such as NK cells) will be tested as follows. Recombinant Human CD155 fused to the C terminal Fc region of human IgGl (such as CD155-Fc available from Sino Biological) will be labeled with a fluorophore such as Alexa Fluor 647 (AF647) using Zenon Human IgG Labeling kit (Molecular Probe) accordingly to the manufacturer’s instructions. NK cells or other CD96-expressing cells freshly isolated from the peripheral blood of healthy donors will be incubated with AF647 labeled CD155-Fc in the presence of anti-CD96 or control Ig at different concentrations ( The cells will be harvested and the cell surface binding of AF647-CDI55-Fc will be tested by flow cytometry). Antibodies that prevent binding of CD 155 cells to CD96-expressing cells will be identified by their ability to block binding of CD155-Fc to CD96-expressing cells.
ris.wry 2: ADCC assay
The survival of immune cells (such as NK cells and/or T cells) in the presence of anti-CD96 antibodies will be analyzed as follows. The peripheral blood immune cells from healthy donors will be isolated by Ficoll gradient separation. Immune cells will be plated in 96 well plates in the presence of human IL-2 at an appropriate dosage and increasing concentrations of anti-CD96 mAbs. The survival as well as the percentages of CD96 expressing cells (such as NK cells and/or T cells)
WO 2015/024060
PCT/AU2014/000830 will be analyzed over time by flow cytometry. A non-limiting example of a suitable commercially available kit for this assay is the Annexin V Apoptosis Detection Kit
Assay 5: Assay for modulation of human leukocyte effector function by human CD96 antibodies
Fresh blood samples will be collected from healthy donors. Peripheral blood mononuclear cells (PBMC) will be prepared on a Ficoll-Paque density gradient by centrifugation. Highly pure CD3-CD56+ NK cells will be obtained from PBMC by magnetically activated cell sorting. To analyze the ability of CD96 to impact human 10 NK cell production of IFN-γ, 96 well U bottom plates will be coated overnight at 4°C with recombinant Human CD155-Fc chimera (Sino Biological Inc.; 0.25 pg/ well) or with non-relevant human IgG 1 antibodies. Freshly purified human NK cells will then be plated in complete RMPI media supplemented with Human IL-12, IL-18 and optionally IL-15 for 24 h and the intracellular content and the level of IFN-γ in the 15 supernatant will be analysed in the different cultures. Alternatively, human NK cells will be stimulated for 24 h in wells coated with anti-NKG2D, anti-NKp46, antiNKp30 or anti-CD16 antibodies to analyze the ability of CD96 signalling to interact with other NK cells receptors. The auti-human CD96 antibodies to be tested or control antibodies will be added to the cultures prior to the cytokines or antibodies 20 above to confirm the ability of these test anti-human CD96 antibodies to enhance the IFNy production of the human NK cells. Statistical increases in IFNy production above the control would be considered significant.
Example 3
Assay for modulation of mouse NK cell function by anti-Cl)96 antibodies
Additional anti-mouse CD96 antibodies would also be screened for the ability to modulate CD96 signalling activity. To analyse mouse NK cell production of IFNγ, 96 well U bottom plates would be coated overnight at 4°C with recombinant 30 mouse CD155-Fc chimera (Sino Biological Inc.; 0.25 pg/ well) or with non-relevant human IgGl antibodies. After three washes with PBS, freshly purified NK cells from the indicated mouse strains would be plated in complete RMPI media supplemented with mouse IL-12 (ebiosciences; 25-100 pg/ml) and mouse IL-18 (R&D; 50 ng/ml)
WO 2015/024060
PCT/AU2014/000830 tor 24 h. Alternatively, IL-2-activated NK cells would be stimulated for 6 h m wells coated with anti-NKl.l (PK136; 0.125 pg/ well). At different time points, antimouse CD96 antibodies (50-2.00 gg/ml) or control antibodies will be added to determine whether these enhance NK cell IFN-g production as measured by CBA analysis.
Example 4
Production of mouse and'human anti-CI)96 antibodies
Human CD96 is a transmembrane protein that exists in two isoforms. Isoform 1 has been detected in acute myeloid leukaemia and includes additional amino acids compared with isoform 2. Isoform 2 is the common form in humans and the predicted domain architecture of isoform 2 has three (3) external immunoglobulin-like domains (domains I, 2 and 3), as listed in Table 1. Antibodies against isoform 2 are preferred for use in the present invention. The nucleic and amino acid sequences of isoform 2 are given in the NCBI consensus sequence number CCDS2958.1 (SEQ ID NOS: .1 and 2 respectively).
SEQ ID NO: I. Human CD96 CDNA isoform 2.
A'x GG ACAAAAAATGGAAATAC.xG'CGC X' G’c CTA’XTAC-Ax CAT CGAGA'xAC Ax TT x' GTCAAGGGAGT x‘ TG: GGAAAAAAC AGx C. AACAcAGAAGAAAATG T T'i'ATGGT AC AC T TGGCT CTGATGx C AAvt '£ G AC CT G;..C. AAACACAGACAGTAGGCxTOTTCGTGCAGATGCAATGGxCCAAGGTCACGAATAAGATAGACCTGATT GCTGTCTATCATCCCCAATACGGCTTCTACTGTGCCTATGGGAGACCCTGTGAGTCACTTGzGACTTT CACAGAAACxCCTGAGAATGGGxCAAA.ATGGACTCTGCACTAAAGGAATATGTCTTGxTCAGxCAGTG gaaggtacgagtgtatgcxTgttc.tgtatccagagggc'attcagactaaaatctacaaccttctcaxT cagacacacgttacagcagatgaatggaacagcaaccatacgatagaaatagagataaatcagactct GGAAA.~ACCATGCx~TCAAAA.TAGCTCCTC.AAAA.ATTxC.ATCTGAGTTCA.CC'xATGCATGGTCGGxGG .AGGATAATGGAACTCAGGAAACACTTATCTCCCAAAATCACCTCATGAGCAATxCCAC.ATTACTTAAA GATAGAGTCAAGCTTGGTACAGACTACAGACTCCACCTCTCTCCAGTCCAAATCTTCGATGATGGGCG GAAGTTCTCTTGCCACATTAGAGTCGGTCCTAACAAAAxCTTGAGGAGCxCCACCACAGTCAAGGTTT TTGCTAAACCAGAAATCCCTGTGATTGTGGAAAATAACICCACGGATGTCTTGGTAGAGAGAAGATTT Ax,,, TGC ΤΤ AC i AAAgAA’i GTATTT CK-^AAAGCAAATAl’C .Ax-ATxcGTT‘X Ax A'xAxGGAAxfTT x xG’Xx ί.·Α TGATGAAAAAGAAGGAATATATATTACTAATGAAGAGAGAAAAGGCAAAGATGGATTTTTGGAACTGA AGTCTGTTTTAACAAGGGTACATAGTAATAAACCAGCCCAAxCAGACAACTTGACCATTTGGTGTATG GC'xC TgTCZI CGAGxGCGAGGAAAxAAAGTGTGGAACA.Z. GTGAxCAGAAAAGAxCAs-· xTTTC λ GT‘x AGG 1? I CTG AAA x x x GC x CAAC AG ACvCTCCACτ G AGT -- TACxxGAA 1 GT ACC·'·-, x TG AC AC- C... A.AC cTx C x G CAGCCAGCAGTGTATCrCCTGCAAGATATCCAGrTACAT7TTCAoTGAG<'CT'cTAGATGT«AGTGCC Tc GAxTixr^TXiA.xiCAx.i.^.ACTCCi CAagCCaGgAaTTCCAxxX'ATGAG.'x Ag.UCGAGGCTTCxCxCTAx GCgTG: GAC CTC CAGT GGGACAGATACCAAAAAATCAGTTτCACGGATACCTAGTGAAACATACAGTTCATC CC CGxCAGG'TggAGGCxCAAQAC x TCAi GACAAt.GTQTTTACCAGCACAGCCAGAG.CATtTTCAGAAGTC CgGAC AACX GC CaA‘1 GGATCT ACGAAAAC TAA’xCACG x CGAt AT C AG TgG x AT T GT GG x CAA’x AAGCC CAAAGA-TGGAATGTCCTGGCC.AGx GATTGTAGCAGGTx'TACx CTTx'i'GCTGCAxGATATTGTTTGGTC TTGG.AGTGAG.AAAATGGxGTCAGTAGOAAAAAGAAAT?.ATGGA,AAGACCTCOACCtTTCAAGCCACCA CCACCtCCCATCAAGTACAOTTGCAxTCAAGAGC:CCAACGAAAGTgATCxGCCttATCATGAGATGGA GACCCTCTAG
SEQ ID NO:2. Human CD96 protein sequence isoform 2
2015/024060
PCT/AU2014/000830
ME KKWKTCAVYYIΪ QI H FVKGWEKT VNT EENVYATLGS DVNLTCQ T QTVG E FVQMQ W S KVTNKIDLI AVYHPQYGFYCAYGPPCESLVTFTETPENGSKWTLHLRmMSCSVSGRYECMLVLYFEGXQTKIYNLLI QTHVTADEWNSNHTIEXEINQTLEIPCsQNSSSKXSSEFTYARSVEPNGTQETLISQNHLISNSTLLK DRVKLGTDYRLHLSPVQXFDDGRKFSCHIP. VGPNKIEPS STTVKVFAKPEXPVIVENNS TDVLVERRF TCLLKNVFPKANITWFXDGSFLHDEKEGIYITNEERKGKDGFLELKSVLTRVH3EPFA?’L2.LTXWCM ALSPVPGNKWNISSEK~TFLLGSETSFTDPPLSVTESTLDTQP,3PASSVSPARYP*T^V'TVDvSA LRPNTTPQPSNSSMTTRGFNYPWTSSGTuTKKSVSRIPSETYSSEPS.GA.GSTLHDNVFTSTARAFSEV PTTANGSTKTMHVHXTGIWNKPKBGHSWVXVAALLFCCMILFGLGVRKWQYQKEIMERPPPFiCPF PFPIKYTC XQEPNESEL FYEEMETL
The Mouse CD96 protein is also a transmembrane protein but only a single transcript/isofonn is known in the mouse as shown in SEQ ID NOs. 3 and 4.
SL.Q ID NO: 3. Mouse cDNA
ATGGG GAGAAAAT GGACATATT GTGTTG'TTTAGACCATCATCCAGATACAGTTTTTCAGGGGAGTGTG GGAAGAGCTATTCAATGTTGGAGATGACGTGTATGCTCTACCTGGTTCTGACATCAACTTGACCTGCC AAACAAAGGAGAAAAACTTCTTGGTACAGATGQAGTGGTCGAAGGTCACAGATAAGAATGACATGATT GCTCTTTATCATCCCCAATATGGCCTCTACTGTGGGCAGGAGCATGCCTGTGAGTCACAAGTGGCTGC CACAGAAACT GAGAAGGGTGTAACAAATT GGACTCTGTAG TTAAGGAATAT CTCTTCIGCCCTGGGTG' GAAAGTATGAGTGCATCTTTACTCTGTATCCAGAAGGCATCAAGACTACAGTCTACAACCTCATTGTG GAACCCTATACACAAGATGAACACAACTATACAATAGAAATAGAGACTiAATCGGACTCTGGAAATACC ATGCTTTCAAAATACCTCCTCAGAAATTCCACCTAGGTTCACCTTTTCATGGTTGGTGGAGAAAGATG GAGTGGAAGAAGTTCTCTTCACCCACC.ATCACCACGTCAACAATTCCACATCAtTTAAAGGCAGAATC AGGCTGGGTGGAGACTATAGACTCCACCTCTCCCCAGTCCAAATCCAAGACGATGGCAGGACATTCTC ttgccatctgactgtcaatcctctcaaagcctggaagatgtccaccacagtcaaggtttttgctaaac CAGAAATCCTCATGACTGTGG.RAAACAGCACCATGGATGTCTTAGGAGAGAGAGTATTTACCTGCCTA CTGAAGAATGTGTTCCCCAAGGDAAAT.ATCA.DCTGGTTTATAGACGG.AAGATTTCTTCAAGGCAACGA AGAAGGAATATACATTACAAATGAAGAGAAGAATTGCAGTAGCGG.ATTTTGGGAACTGAAGTCAGTTT TAACAAGGAT GCACAGT GGACCATC C CAAT CAAACAACATGACAGC T TGGT GTATGGC T CTGTCT CCA GGGCCCAGAAATAAAATGTGGAATACTTCATCACAACCCATCAGGGTTTCOTTTGATTGGGTGATAGC CCCAACGAAACATCTACCCACTGTGACAGGTTCTACCCTGGGTACACAACCTTTTTCAGATGCTGGAG TATCTCCTACAGGGTATCTAGCTACACCTTCAGTGACAATTGTAGATGAAAATGGGTTGACACCAGAT G CAAC T CCTCAAACCAGCAATTCCAGCATGACTACTAAAGATGGCAACTATTTGGAAGCCTCCAGTGG GACAGATGCCAAGAACTCCTCAAGAGCTGCTGCTTCTTCTAAAAGTGGATCTTGGCCTTTTCCTTTCA CTTCTCCTCCAG.AATGGC.ACTCACTGCCTGGTACCTCCACTGGACCCCAAGAACCAGACTCCCCACTT T CATGGATAC CCAGTGAAGTACAC ACTTCAGCCCCTTTGGAC GCCAGCTTAGCTCCTCATGATACCAT CATCAGTACAACCACAGAATTTCCAAATGTCCTCACAACTGCAAATGGAACTACTAAAATTGACCATG G ACCT ATCACCAGT ATC ATAGT TAAT CAACCCAGTGATGG AATGTCC TGGCCTGTGC T T:GTCGCGGCT: TTGCTCTTTTTCTGCACAGTATTGTTTGGGCTTGGAGTAAGAAAATGGTATCGGTATGAAAATGAAAT CATGGAGAGACCCCCACCTTTCAAGCGACCACCACCTCCCATCAAGTACACGTATATTCAAGAACCCA TTGGATGCGACCTGTGTTGTCATGAGATGGAGGTCCTCTAA
SF.Q ID NO:4. Mouse CD96 amino acid sequence
ΜΟΡΚ5·ΪΤΥΤννΥΤΙϊ2ΐςΡΕΡανΝΕΕΤΕΝναηϋνΥΑΤΡΑ80ΣΝΕΤΟ<2ΤΚΕΚΝΕΤνςΜ2Ώ5ΚνΤΕΕΝΏΜΙ ALYHPQYGLYCGQEHACESQvAATETEKGVTNWTLYLRNISSALGGKYEClFTLYPEGIKTTVYNLIV
E P YTQDEHNY T IE IE TNRTLEIP CECNT S SEIF FRETFS WLVEKDGVEEVLFTHHHHVWS T 5 FKGRI ΚΕ?αϋΥΚΕΗΕδΕνΏΙ0Ε©ΘΕΤΕ5αΗΕΤνΝΕΑΚΑΚΚΜ?ΤΤνκνΕΑΚΡΕΙΕΜΤνΞΝ3ΤΜΕνΕ6ΞβνΕΤεΕ LKNVFPKAN~TWFTDGRFLQGNEEGIYTTNEEKNCG5GFv7ELKSVLTRMHSGFSQSN?<iMTANCMALSP GPRNKMWNTSGQPITVSFDSVIAPTKHLFTVTGSTLGTQPFSpAGVSPTGYLATPSVTTVDSNGLTPD ATPQTSNSSMTTKDGNYLEASSGTDAKNSSRAAA6SKSGSWPFPFTSPPEWHSLPGTSTGFQE;PDSPV: wΣ p SE VHT 5APL DAS L APHDT X X δ ϊ TTE FPNVFT TANGTTKIDHGF ITS IIVN-QFS DGMSXf FVL VAA ΤΕΕΕσΤΤΤΕΟΕενΕΚ^ΥΡΥςΝΕΧΜΞΡΡΡΡΕΚΡΡΡΡΡΙΚΥΤΥΙΟΕΡΪΕΕΕϊ,ΕαΗΕΜΕνΧ
Table 1: External immunoglobulin like domains of CD96 from Interpro predictions
WO 2015/024060
PCT/AU2014/000830
i Human CD96 isoform 2 I residue numbers Mouse CD96 residue numbers
Domain 1 30-137 30-137
Domain 2 148-250 145-247
Domain 3 i 253-359 250-355
The external domains of the mouse and human CD96 proteins will be cloned into appropriate expression constructs for expression in mammalian cells such as human embryonic kidney cells. Suitable expression constructs typically include a CMV promoter to drive expression of the CD96 gene fragment. Following transfection into mammalian cells the protein will be expressed under suitable culture conditions before being purified prior to antibody production.
Four CD96 knockout mice will be Immunized with the mouse CD96 external domain protein and likewise four CD96 knockout mice will be immunized with the purified human CD96 external domain protein. Immunisations will be made at approximately three times at four week .intervals. The mice will be bled 10-12 days following the third immunization and the sera titrated on the screening antigens by ELISA. The mice with the highest antibody titres would be used for fusion, otherwise if mice have not responded adequately further immunisations would be undertaken. Selected hybridomas will be cloned and mAbs purified from each clone before the individual human or mouse mAbs arc screened using the screening assays of Examples 2 or 3 respectively. Isotyping of clones would optionally be undertaken in order to identify antibodies that are less likely or unable to induce ADCC, such as IgG2 and IgG4 antibodies. Approximately 20 antibodies against human CD96 and 20 antibodies against mouse CD96 would be obtained as listed in Table 1 of Example 4.
Example 5
Screening of mouse and human anti-CD96 antibodies
Approximately 20 each of anti-mouse CD96 and anti-human CD96 monoclonal antibodies would be obtained as described in Example 4, The antihuman CD96 antibodies would be screened for the ability to modulate CD96 signalling activity using the Human NK cell assays described in Example 2. An additional four commercially available anti-human CD96 antibodies (1C8, NK92.39,
WO 2015/024060
PCT/AU2014/000830
3H8, MAA6359) will also be screened for the ability to modulate CD96 signalling. Anti-mouse CD96 mAbs would be also screened for their ability to modulate NK cell function as described in Example 3.
As can occur with antibodies, not all antibodies are expected to have a useful effect on a given target. Accordingly, CD96 signalling for each antibody will be assessed using the human or mouse NK cell assays to determine which antibodies have an effect upon CD96 signalling.
Preliminary results using the human NK cell assay
Using the human NK cell assay described in Example 2, the NK92.39 human
CD96 mAb was found to increase the levels of IFN-γ in human NK cells as shown in Figure 17A and 17B. This result indicates that antibodies against the human CD96 receptor can be effective in increasing IFN-yproduction in human NK cells.
Example 6
Anti-mouse CD96 antibody testing in cancer models
Anti-mouse CD96 antibodies that are found to be active in modulating CD96 signalling will be tested for their ability to relieve immune inhibition, reduce CD96 20 activity and/or enhance or restore immune surveiHan.ee in mouse cancer models.
Approximately 10 active anti-mouse CD96 antibodies will be individually tested in approximately 5-7 cancer models using In viva tumor challenges, the same or similar to those used in Example 1.
The efficacy of each CD96 antibody against a respective tumour and/or in a 25 tumour model may vary and some may be more responsive to treatment than others. Non-limiting examples of tumours and tumour models to be tested may include breast, prostate, lung, melanoma, colorectal, pancreatic, endometrial, kidney, bowel, gastric, oesophageal, leukaemia, lymphoma, ovarian, bladder and brain cancers including primary' tumours and/or metastases of the aforementioned cancers..
Example 7
Human CD96-antibody binding studies
A subset of anti-human CD96 antibodies will be examined further to determine which domains of C.D96 are bound by effective CD96 antibodies. As
WO 2015/024060
PCT/AU2014/000830 discussed in Example 3 above, isoform 2 of CD96 includes three external domains (Domains 1, 2 and 3).
Antibodies will be bound to the CD96 protein and the specific CD96 protein residues bound will be determined using hydrogen/deuterium exchange and mass 5 spectrometry.3'*' Alternatively, other methods may be employed to probe antibodyCD96 binding sites such as X-ray crystallography, site directed mutagenesis or other methods known in the art.
It is anticipated that effective antibodies may bind one or multiple external domains of the CD96 protein. For example anti-CD96 antibodies that modulate 10 human NK cell function may bind any of the following combinations of external CD96 domains, with each possible single or combination binding domain shown in brackets: (1.), (2), (3), (1,2), (1,3), (2,3), (1,2,3).
Example 8
CD96 roles in both NKand T cell function
Natural killer (NK) cells are innate lymphocytes which may be critical, to limit early tumour growth and metastasis while T cells may be more important in the control of established and primary tumours. CD96 is a checkpoint immunomodulator that can affect both NK and T cell function.
Primary tumors were used to examine the role of CD96 in T cells. The AT3C)VAdiro model was used where CD8 T effector cells are known to naturally control tumor growth. AT3-OVAd!r!1 mammary carcinoma (lx 10° cells) were injected subcutaneously. Mice were then monitored for tumor growth and measurements . ) made with a caliper square as the product of two perpendicular diameters (mm*).
Anti-CD96 treatment greatly reduced the rate of tumour growth and this beneficial effect could be removed by depletion of CD4 and CD8 T cells using anti CD4/CD8 antibody or by treatment with anti-IFN-γ (Figure .16A and 16B). This demonstrates that anti-CD96 mAb critically required CD8' T cells and IFN-γ for full anti-tumour activity in this particular tumour model.
WO 2015/024060
PCT/AU2014/000830
Example 9
Loss ofCD96 from the NK cell surface after aCD96 mAb binding
The mechanistic/signaling effects that may occur upon antibody binding to CD96 may also reveal functional information about the effects' of CD96-CDI55 binding. To further investigate this, total NK cells were purified from human peripheral blood mononuclear cells (PBMCs) by negative selection using human NK cell isolation kit (Miltenyi Biotec.). Isolated NK cells were then labeled with carboxyfluorescein diacetate succinmidyl ester (CFSE; Biolegend) to measurecellular proliferation. CFSE-labeled NK cells were plated in 96 well U10 bottom plate at 5 x 104 cells/well and stimulated with recombinant IL-2 at indicated concentrations (10 units/ml and 25 units/ml), in the presence of control IgG or antihuman CD96 mAb (clone NK92-39) at 30 pg/ml. NK cells were assessed for changes in proliferation or the presence/absence of surface CD96 at day 3 and 6 using BD FACS Canto II (BD Biosciences) and analysis was carried out using 15 FlowJo (Tree Star) (Figure 18 (A) and (B). Anti-CD96 binding to CD96 had no effect on NK cell proliferation but appeared to greatly reduce the level of CD96 on the cell surface by day 6, either by internalization of CD96 following mAb binding or possibly via a reduction in CD96 expression.
Throughout the specification the aim has been to describe the preferred embodiments of the invention without limiting the invention to any one embodiment or specific collection of features. It will therefore be appreciated by those of skirl in the art that, in light of the instant disclosure, various modifications and changes can be made in the particular embodiments exemplified without departing from the scope of the present invention.
All computer programs, algorithms, patent and scientific literature referred to herein is incorporated herein by reference.
WO 2015/024060
PCT/AU2014/000830
REFERENCES
1. Vivier, E,, Tomasello, E, Baratin, M., Walzer, T. & Ugolini, S. Functions of natural killer cells. Nature immunology 9, 503-510 (2()08).
2. Lanier, L.L. Up cm the tightrope; natural killer cell activation and inhibition.
Nature immunology 9, 495-502 (2()08).
3. Chan, C.J.. Smyth, M.J. < Martinet, L. Molecular mechanisms of natural killer cell activation in response to cellular stress. Cell death and differentiation (2013).
4. Raulet, D.H. cir Vance, R.E. Self-tolerance of natural killer cells. Nature reviews 6, 520-531 (2006).
5. Fuchs, A. & Colonna, M. The role of NK cell recognition of tied in and nedht-like proteins in tumor immunosurveillance. Seminars in cancer biology 16, 359-366 (2006).
6, Shibuya, A., et al. DNAM-1, a novel adhesion molecule involved in the cytolytic function of T lymphocytes. Immunity 4, 573-581 (1996).
7. Wang, P.L., O’Farrell, S., Clayberger, C. & Krensky, A.M. Identification and molecular cloning of tactile. A novel human T cell activation antigen that is a member of the Ig gene superfamily. J Immunol 148, 2600-2608 (1992).
8. Yu, X., et al. The surface protein TlCdT suppresses T cell activation by promoting, the generation of mature immunoregulatary dendritic cells. Nature immunology 111, 48-57 (2009).
9. Boles, K.S., et al. A novel molecular interaction for the adhesion of follicular CD4 T cells to follicular DC. European journal of immunology 39, 695-703 (2009).
10. Kennedy, J., et al. A molecular analysis of NKT cells: identification of a class-I restricted T cell-associated molecule (CRTAM). Journal of leukocyte biology 67, 725-734(2000).
II . Bottino, C., el al. Identification of P VR (CD 155) and Nectin-2 (CD112) as cell surface ligands for the. human DNAM-1 (CD226) activating molecule.
The Journal of experimental medicine 198, 557-567 (2003).
12. Lozano, E.f Dominguez-Villar, M, Kuchroo, V. & Hafler, I).A. The T1GIT/CD226 axis regulates human T cell function. Journal of immunology 188, 3869-3875 (2012).
WO 2015/024060
PCT/AU2014/000830
13. Lakshmikanth, T., el al,. NCRs and DNAM-1 mediate NK cell recognition and
lysis of human and mouse melanoma cell lines in vitro and in vivo. The
Journal o f clinical im .’estigafion 119, 1251-1263 (2009).
L I. Chan, C.J., et al. Ih N4M-1/CD155 interactions promote cytokine and NK
5 cell-mediated suppre sston of poorly immunogenic melanoma metastases. J
Immunol 184, 902-91 1 (2010).
15. Gilfilian, 8., et al. DNAM-1 promotes activation of cytotoxic lymphocytes by nonprdfejsional antigen-presenting cells and tumors. The Journal of experimental medicine 205, 2965-2973 (2008).
16. Iguchi-Manaka, A., et al. Accelerated tumor growth in mice deficient in
DNAM-1 receptor. The Journal of experimental medicine 205, 2959-2964 (2008).
17. Slametsky, N, et al. The interaction of TIGIT with PVR and PVRL2 inhibits human NK cell cytotoxicity. Proceedings of the National Academy of of the United States of America 106,17858-17863 (2009).
18. Stanieisky, N., et al. Mouse TIGIT inhibits NK-cell cytotoxicity upon interaction with PVR. European journal of immunology (2013).
19. Liu, S., et al. Recruitment of Grb2 a nd SHIP 1 by the ITT-like mo tif of TIGIT suppresses granule polarization and cytotoxicity of NK cells. Cell death and differentiation 20, 456-464 (2013).
20. Fuchs, A., Celia, M., Kondo, T. & Colonna, M. Paradoxic inhibition of human natural interferon-producing cells by the activating receptor NKp44. Blood 106, 2076-2082 (2005).
21. Seth, S., et al. The murine pan T cell marker CD96 is an adhesion receptor for CD 155 and nectin-l. Biochemical and biophysical research communications 364, 959-965 (2007).
22. Fuchs, A,, Celia, M., Giurisato, E., Shaw, A.S, $ Colonna, M. Cutting edge: CD96 (tactile) promotes NK cell-target cell adhesion by interacting with the poliovirus receptor (GDI55). J Immunol 172, 3994-3998 (2004).
23. Ahn, J., Sktlfon, J. & Yu, K. Hydrogen·· Deuterium Exchange Mass
Spectrometry: An Emerging Biophysical Tool for Probing Protein Behavior and Higher-Order Structure. LCGC NORTH AMERICA VOLUME 31 NUMBER 6 (2013).
WO 2015/024060
PCT/AU2014/000830
24. Percy, A. ./., Rey, M.„ Bums, K. M. & Schriemer, D. C. Probing protein interactions with hydrogen/deuterium exchange and mass spectrometry—A review. Analytica Chimica Acta 721 (2012) 7-- 21 (2012).

Claims (22)

1. A method of reducing or relieving immune inhibition in a mammal, said method including the step of at least partly inhibiting or reducing CD96 activity in one or more cells of the mammal to thereby relieve immune inhibition and/or enhance or restore immune surveillance in the mammal, wherein the step of at least partly inhibiting or reducing CD96 activity in the mammal includes administering an anti-CD96 antibody or antibody fragment to the mammal.
2. Use of an anti-CD96 antibody or antibody fragment in the manufacture of a medicament for at least partly inhibiting or reducing CD96 activity in one or more cells of the mammal to thereby relieve immune inhibition and/or enhance or restore immune surveillance in the mammal.
3. The method of Claim 1 or the use of Claim 2, wherein at least partly inhibiting or reducing CD96 activity in the mammal does not include, or at least depend upon, killing of CD96-expressing cells in the mammal.
4. The method or use of any one of the preceding claims, wherein the anti-CD96 antibody or antibody fragment binds or interacts with one or a plurality of external immunoglobulin-like domains of CD96.
5. The method or use of any one of the preceding claims, wherein the anti-CD96 antibody or antibody fragment binds or interacts with: one or a plurality of external immunoglobulinlike domains of CD96 selected from the group consisting of: domain 1; domain 2; domain 3; domain 1 and domain 2; domain 1 and domain 3: domain 2 and domain 3; and domain 1, domain 2 and domain 3.
6. The method or use of Claim 4 or Claim 5, wherein the anti-CD96 antibody or antibody fragment binds or interacts with one or a plurality of external immunoglobulin-like domains of human CD96 isoform 2 (SEQ ID NO:2).
7. The method or use of any one of the preceding claims, wherein the anti-CD96 antibody or antibody fragment at least partly blocks or inhibits CD96 binding to CD 155 and/or intracellular signaling by CD96.
8. The method or use of any preceding claim, which includes administering one or more other therapeutic agents or the medicament includes one or more other therapeutic agents.
9. The method or use of Claim 8, wherein the one or more other therapeutic agents include a chemotherapeutic agent and one or more antibodies or antibody fragments that bind PD1 and/or CTLA4.
2014308552 21 Jan 2020
10. The method or use of any preceding claim, wherein the anti-CD96 antibody or antibody fragment increases or enhances cytokine and/or chemokine expression and/or secretion by one or more cells in the mammal.
11. The method or use of Claim 10, wherein the cytokine and/or chemokines include MIPla, MIP-Ιβ, RANTES, TNF-a and IFN-γ,
12. The method or use of Claim 11, wherein the cytokine is interferon γ (IFN-γ).
13. The method or use of Claim 10, Claim 11 or Claim 12, wherein the one or more cells are T cells, inclusive of CD4+ and CD8+ T cells, γδ T cells and NK T cells and natural killer (NK) cells.
14. The method or use of any preceding claim, which treats or prevents cancer or cancer metastasis in the mammal or the medicament is for treating or preventing cancer or cancer metastasis in the mammal.
15. The method or use of any preceding claim, which treats or prevents a viral infection in the mammal or the medicament is for treating or preventing a viral infection in the mammal.
16. A method of screening, designing, engineering or otherwise producing an anti-CD96 antibody or antibody fragment, said method including the step of determining whether a candidate antibody or antibody fragment is capable of at least partly inhibiting or reducing CD96 activity to thereby relieve immune inhibition and/or enhance or restore immune surveillance in a mammal.
17. The method of Claim 16 wherein the anti-CD96 antibody or antibody fragment binds or interacts with one or a plurality of external immunoglobulin-like domains of CD96.
18. The method of Claim 17, wherein the anti-CD96 antibody or antibody fragment binds or interacts with one or a plurality of external immunoglobulin-like domains of CD96 selected from the group consisting of: domain 1; domain 2; domain 3; domain 1 and domain 2; domain 1 and domain 3: domain 2 and domain 3; and domain 1, domain 2 and domain 3.
19. The method of Claim 17 or Claim 18 wherein the anti-CD96 antibody or antibody fragment binds or interacts with one or a plurality of external immunoglobulin-like domains of human CD96 isoform 2 (SEQ ID NO:2).
20. The method of any one of Claims 16-19, wherein the anti-CD96 antibody or antibody fragment is an anti-cancer agent.
21. The method of any one of Claims 16-20, wherein the anti-CD96 antibody or antibody fragment is an anti-viral agent.
22. The method or use of any one of the preceding claims, wherein the mammal is a human.
AU2014308552A 2013-08-22 2014-08-22 Immunoreceptor modulation for treating cancer and viral infections Active AU2014308552B2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
AU2014308552A AU2014308552B2 (en) 2013-08-22 2014-08-22 Immunoreceptor modulation for treating cancer and viral infections

Applications Claiming Priority (11)

Application Number Priority Date Filing Date Title
AU2013903189 2013-08-22
AU2013903189A AU2013903189A0 (en) 2013-08-22 Immunomodulator
AUPCT/AU2013/001132 2013-10-03
PCT/AU2013/001132 WO2015024042A1 (en) 2013-08-22 2013-10-03 Immunoreceptor modulation for treating cancer and viral infections
AU2013398294A AU2013398294A1 (en) 2013-08-22 2013-10-03 Immunoreceptor modulation for treating cancer and viral infections
AU2014900741A AU2014900741A0 (en) 2014-03-05 Immunoreceptor modulation for treating cancer and viral infections
AU2014900741 2014-03-05
AU2014901002 2014-03-21
AU2014901002A AU2014901002A0 (en) 2014-03-21 Immunoreceptor modulation for treating cancer and viral infections
PCT/AU2014/000830 WO2015024060A1 (en) 2013-08-22 2014-08-22 Immunoreceptor modulation for treating cancer and viral infections
AU2014308552A AU2014308552B2 (en) 2013-08-22 2014-08-22 Immunoreceptor modulation for treating cancer and viral infections

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
AU2013398294A Division AU2013398294A1 (en) 2013-08-22 2013-10-03 Immunoreceptor modulation for treating cancer and viral infections

Publications (2)

Publication Number Publication Date
AU2014308552A1 AU2014308552A1 (en) 2016-03-17
AU2014308552B2 true AU2014308552B2 (en) 2020-02-13

Family

ID=69405696

Family Applications (1)

Application Number Title Priority Date Filing Date
AU2014308552A Active AU2014308552B2 (en) 2013-08-22 2014-08-22 Immunoreceptor modulation for treating cancer and viral infections

Country Status (1)

Country Link
AU (1) AU2014308552B2 (en)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008073316A2 (en) * 2006-12-07 2008-06-19 The Board Of Trustees Of The Leland Stanford Junior University Identification and isolation of acute myeloid leukemia stem cells
WO2009126688A2 (en) * 2008-04-09 2009-10-15 Genentech, Inc. Novel compositions and methods for the treatment of immune related diseases
WO2011057216A1 (en) * 2009-11-06 2011-05-12 The Pennsylvania State Research Foundation Bioconjugation of calcium phosphosilicate nanoparticles for selective targeting of cells in vivo
CN102204901A (en) * 2010-03-30 2011-10-05 中国科学院上海生命科学研究院 Reagent and method for regulating immune molecules

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008073316A2 (en) * 2006-12-07 2008-06-19 The Board Of Trustees Of The Leland Stanford Junior University Identification and isolation of acute myeloid leukemia stem cells
WO2009126688A2 (en) * 2008-04-09 2009-10-15 Genentech, Inc. Novel compositions and methods for the treatment of immune related diseases
WO2011057216A1 (en) * 2009-11-06 2011-05-12 The Pennsylvania State Research Foundation Bioconjugation of calcium phosphosilicate nanoparticles for selective targeting of cells in vivo
CN102204901A (en) * 2010-03-30 2011-10-05 中国科学院上海生命科学研究院 Reagent and method for regulating immune molecules

Non-Patent Citations (8)

* Cited by examiner, † Cited by third party
Title
BARTH, B.M. et al. "Targeted indocyanine-green-loaded calcium phosphosilicate nanoparticles for in vivo photodynamic therapy of leukemia." ACS Nano. 2011 Jul 26;5(7):5325-37. Epub 2011 Jul 8 *
FUCHS, A. et al. "Cutting edge: CD96 (tactile) promotes NK cell-target cell adhesion by interacting with the poliovirus receptor (CD155)." J Immunol. 2004 Apr 1;172(7):3994-8. *
GONG, J. et al. "Establishment of an enzyme-linked immunosorbent assay system for determining soluble CD96 and its application in the measurement of sCD96 in patients with...." Clin Exp Immunol. 2009 Feb;155(2):207-15. Epub 2008 Nov 24. *
GRAMATZKI, M. et al. "Antibodies TC-12 ("unique") and TH-111 (CD96) characterize T-cell acute lymphoblastic leukemia and a subgroup of acute myeloid leukemia." Exp Hematol. 1998 Dec;26(13):1209-14. *
LARSEN, H. et al. "Nonviral transfection of leukemic primary cells and cells lines by siRNA-a direct comparison between Nucleofection and Accell delivery." Exp Hematol. 2011 Nov;39(11):1081-9. Epub 2011 Aug 18. *
MOHSENI NODEHI, S. et al. "Enhanced ADCC activity of affinity maturated and Fc-engineered mini-antibodies directed against the AML stem cell antigen CD96." PLoS One. 2012;7(8):e42426. Epub 2012 Aug 3. *
SETH, S. et al. "The murine pan T cell marker CD96 is an adhesion receptor for CD155 and nectin-1." Biochem Biophys Res Commun. 2007 Dec 28;364(4):959-65. Epub 2007 Oct 29. *
ZENG, J.M. et al. "Human CD96 gene cloning, expression and identification". Nan Fang Yi Ke Da Xue Xue Bao. 2011 Jun;31(7):1232-5. *Abstract only *

Also Published As

Publication number Publication date
AU2014308552A1 (en) 2016-03-17

Similar Documents

Publication Publication Date Title
US20210047403A1 (en) Immunoreceptor modulation for treating cancer and viral infections
US20160200814A1 (en) Immunoreceptor modulation for treating cancer and viral infections
JP6923714B2 (en) T cell receptor that recognizes MHC class II restrictive MAGE-A3
ES2967467T3 (en) Combination of a cell therapy and an immunomodulatory compound
JP2021501606A (en) Chimeric antigen receptor specific for B cell maturation antigen (BCMA)
JP2022505679A (en) NY-ESO-1 T cell receptors and methods of their use
AU2019377854A1 (en) Methods and combinations for treatment and T cell modulation
BR112021008289A2 (en) METHODS FOR TREATMENT USING CHIMERIC ANTIGEN RECEPTORS SPECIFIC FOR B CELL MATURATION ANTIGEN
US20240302349A1 (en) Methods of assessing or monitoring a response to a cell therapy
WO2019089753A2 (en) Cd137 antibodies and pd-1 antagonists and uses thereof
CN120359243A (en) LILRB2 antibody products and methods
AU2014308552B2 (en) Immunoreceptor modulation for treating cancer and viral infections
Saha Targeting the TIGIT/CD226/CD96 signaling Axis using the IgV domain of PVR
WO2025220689A1 (en) Bispecific antibody that is effective for t-cell tumor patients with t-cell dysfunction
KR20250113410A (en) Patient selection and treatment monitoring for autoimmune disorders
WO2025114541A1 (en) Antibodies capable of binding to ox40 in combination therapy
WO2025219577A1 (en) Cancer immunotherapy
WO2017082254A1 (en) Anti-phosphorylated-bach2 antibody and method for screening antitumor immunoactivators

Legal Events

Date Code Title Description
DA3 Amendments made section 104

Free format text: THE NATURE OF THE AMENDMENT IS: AMEND THE NAME OF THE INVENTOR TO READ SMYTHE, MARK

DA3 Amendments made section 104

Free format text: THE NATURE OF THE AMENDMENT IS: AMEND THE NAME OF THE INVENTOR TO READ SMYTH, MARK

DA3 Amendments made section 104

Free format text: THE NATURE OF THE AMENDMENT IS: AMEND THE DIVISIONAL DETAILS TO READ 2013398294

FGA Letters patent sealed or granted (standard patent)