AU2012249622A1 - Green process for producing polyhydroxyalkanoates and chemicals using a renewable feedstock - Google Patents
Green process for producing polyhydroxyalkanoates and chemicals using a renewable feedstockInfo
- Publication number
- AU2012249622A1 AU2012249622A1 AU2012249622A AU2012249622A AU2012249622A1 AU 2012249622 A1 AU2012249622 A1 AU 2012249622A1 AU 2012249622 A AU2012249622 A AU 2012249622A AU 2012249622 A AU2012249622 A AU 2012249622A AU 2012249622 A1 AU2012249622 A1 AU 2012249622A1
- Authority
- AU
- Australia
- Prior art keywords
- organism
- ethanol
- producing
- xylose
- genetically engineered
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 229920000903 polyhydroxyalkanoate Polymers 0.000 title claims description 196
- 239000005014 poly(hydroxyalkanoate) Substances 0.000 title claims description 195
- 238000000034 method Methods 0.000 title claims description 108
- 230000008569 process Effects 0.000 title claims description 79
- 239000000126 substance Substances 0.000 title description 17
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 claims description 1271
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 claims description 391
- ZSLZBFCDCINBPY-ZSJPKINUSA-N acetyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 ZSLZBFCDCINBPY-ZSJPKINUSA-N 0.000 claims description 274
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 claims description 245
- 229910052799 carbon Inorganic materials 0.000 claims description 245
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 claims description 195
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 claims description 195
- 150000002009 diols Chemical class 0.000 claims description 100
- 241000588724 Escherichia coli Species 0.000 claims description 93
- 229920000642 polymer Polymers 0.000 claims description 77
- 229920001577 copolymer Polymers 0.000 claims description 58
- BDERNNFJNOPAEC-UHFFFAOYSA-N propan-1-ol Chemical compound CCCO BDERNNFJNOPAEC-UHFFFAOYSA-N 0.000 claims description 55
- 229920000070 poly-3-hydroxybutyrate Polymers 0.000 claims description 49
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 claims description 40
- WERYXYBDKMZEQL-UHFFFAOYSA-N butane-1,4-diol Chemical compound OCCCCO WERYXYBDKMZEQL-UHFFFAOYSA-N 0.000 claims description 35
- WNLRTRBMVRJNCN-UHFFFAOYSA-N adipic acid Chemical compound OC(=O)CCCCC(O)=O WNLRTRBMVRJNCN-UHFFFAOYSA-N 0.000 claims description 34
- 241001165345 Acinetobacter baylyi Species 0.000 claims description 26
- PHOJOSOUIAQEDH-UHFFFAOYSA-N 5-hydroxypentanoic acid Chemical compound OCCCCC(O)=O PHOJOSOUIAQEDH-UHFFFAOYSA-N 0.000 claims description 23
- 229920000954 Polyglycolide Polymers 0.000 claims description 22
- 239000004633 polyglycolic acid Substances 0.000 claims description 22
- 241000589291 Acinetobacter Species 0.000 claims description 19
- 239000001361 adipic acid Substances 0.000 claims description 17
- 235000011037 adipic acid Nutrition 0.000 claims description 17
- ALRHLSYJTWAHJZ-UHFFFAOYSA-M 3-hydroxypropionate Chemical compound OCCC([O-])=O ALRHLSYJTWAHJZ-UHFFFAOYSA-M 0.000 claims description 14
- 241000588625 Acinetobacter sp. Species 0.000 claims description 14
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 13
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 claims description 13
- ALQSHHUCVQOPAS-UHFFFAOYSA-N Pentane-1,5-diol Chemical compound OCCCCCO ALQSHHUCVQOPAS-UHFFFAOYSA-N 0.000 claims description 12
- DNIAPMSPPWPWGF-VKHMYHEASA-N (+)-propylene glycol Chemical compound C[C@H](O)CO DNIAPMSPPWPWGF-VKHMYHEASA-N 0.000 claims description 11
- YPFDHNVEDLHUCE-UHFFFAOYSA-N 1,3-propanediol Substances OCCCO YPFDHNVEDLHUCE-UHFFFAOYSA-N 0.000 claims description 11
- 229940035437 1,3-propanediol Drugs 0.000 claims description 11
- 241000186226 Corynebacterium glutamicum Species 0.000 claims description 11
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 claims description 11
- XXMIOPMDWAUFGU-UHFFFAOYSA-N hexane-1,6-diol Chemical compound OCCCCCCO XXMIOPMDWAUFGU-UHFFFAOYSA-N 0.000 claims description 11
- 229920000166 polytrimethylene carbonate Polymers 0.000 claims description 11
- RTBFRGCFXZNCOE-UHFFFAOYSA-N 1-methylsulfonylpiperidin-4-one Chemical compound CS(=O)(=O)N1CCC(=O)CC1 RTBFRGCFXZNCOE-UHFFFAOYSA-N 0.000 claims description 10
- JFCQEDHGNNZCLN-UHFFFAOYSA-N anhydrous glutaric acid Natural products OC(=O)CCCC(O)=O JFCQEDHGNNZCLN-UHFFFAOYSA-N 0.000 claims description 10
- 241000588626 Acinetobacter baumannii Species 0.000 claims description 9
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 claims description 9
- 241000588624 Acinetobacter calcoaceticus Species 0.000 claims description 7
- 241001148231 Acinetobacter haemolyticus Species 0.000 claims description 7
- 241000122229 Acinetobacter johnsonii Species 0.000 claims description 7
- 241000122230 Acinetobacter junii Species 0.000 claims description 7
- 241000122231 Acinetobacter radioresistens Species 0.000 claims description 7
- 241000508783 Acinetobacter venetianus Species 0.000 claims description 7
- 241001465318 Aspergillus terreus Species 0.000 claims description 7
- 244000063299 Bacillus subtilis Species 0.000 claims description 7
- 235000014469 Bacillus subtilis Nutrition 0.000 claims description 7
- 241000193401 Clostridium acetobutylicum Species 0.000 claims description 7
- 241000186570 Clostridium kluyveri Species 0.000 claims description 7
- 241000588749 Klebsiella oxytoca Species 0.000 claims description 7
- 241001138401 Kluyveromyces lactis Species 0.000 claims description 7
- 240000006024 Lactobacillus plantarum Species 0.000 claims description 7
- 235000013965 Lactobacillus plantarum Nutrition 0.000 claims description 7
- 241000187654 Nocardia Species 0.000 claims description 7
- 241000589540 Pseudomonas fluorescens Species 0.000 claims description 7
- 241000589776 Pseudomonas putida Species 0.000 claims description 7
- 244000057717 Streptococcus lactis Species 0.000 claims description 7
- 235000014897 Streptococcus lactis Nutrition 0.000 claims description 7
- 229940072205 lactobacillus plantarum Drugs 0.000 claims description 7
- 241000948980 Actinobacillus succinogenes Species 0.000 claims description 6
- 241000607516 Aeromonas caviae Species 0.000 claims description 6
- 241000190857 Allochromatium vinosum Species 0.000 claims description 6
- 241000228245 Aspergillus niger Species 0.000 claims description 6
- 241000195645 Auxenochlorella protothecoides Species 0.000 claims description 6
- 241000194107 Bacillus megaterium Species 0.000 claims description 6
- 241000195654 Chlorella sorokiniana Species 0.000 claims description 6
- 241000195651 Chlorella sp. Species 0.000 claims description 6
- 241001600125 Delftia acidovorans Species 0.000 claims description 6
- 241000589232 Gluconobacter oxydans Species 0.000 claims description 6
- 241000371004 Graesiella emersonii Species 0.000 claims description 6
- 235000014663 Kluyveromyces fragilis Nutrition 0.000 claims description 6
- 241000235058 Komagataella pastoris Species 0.000 claims description 6
- 241000589308 Methylobacterium extorquens Species 0.000 claims description 6
- 241000195659 Neodesmus pupukensis Species 0.000 claims description 6
- 241000195648 Pseudochlorella pringsheimii Species 0.000 claims description 6
- 241000589781 Pseudomonas oleovorans Species 0.000 claims description 6
- 241000589774 Pseudomonas sp. Species 0.000 claims description 6
- 241001299904 Pseudomonas sp. 61-3 Species 0.000 claims description 6
- 241001148115 Rhizobium etli Species 0.000 claims description 6
- 241000187563 Rhodococcus ruber Species 0.000 claims description 6
- 244000253911 Saccharomyces fragilis Species 0.000 claims description 6
- 235000018368 Saccharomyces fragilis Nutrition 0.000 claims description 6
- 241000235347 Schizosaccharomyces pombe Species 0.000 claims description 6
- 241000187432 Streptomyces coelicolor Species 0.000 claims description 6
- 241000192589 Synechococcus elongatus PCC 7942 Species 0.000 claims description 6
- 241000192581 Synechocystis sp. Species 0.000 claims description 6
- 241000191001 Thiocapsa Species 0.000 claims description 6
- 241000589153 Zoogloea ramigera Species 0.000 claims description 6
- 241000588902 Zymomonas mobilis Species 0.000 claims description 6
- 241000029538 [Mannheimia] succiniciproducens Species 0.000 claims description 6
- 229940031154 kluyveromyces marxianus Drugs 0.000 claims description 6
- 241000722954 Anaerobiospirillum succiniciproducens Species 0.000 claims description 5
- 241000193033 Azohydromonas lata Species 0.000 claims description 5
- 241000195649 Chlorella <Chlorellales> Species 0.000 claims description 5
- 241000600898 Nocardia salmonicolor Species 0.000 claims description 5
- 241000191043 Rhodobacter sphaeroides Species 0.000 claims description 5
- 241000252867 Cupriavidus metallidurans Species 0.000 claims 4
- 241000588986 Alcaligenes Species 0.000 claims 1
- 240000002853 Nelumbo nucifera Species 0.000 claims 1
- 235000006508 Nelumbo nucifera Nutrition 0.000 claims 1
- 235000006510 Nelumbo pentapetala Nutrition 0.000 claims 1
- 108090000623 proteins and genes Proteins 0.000 description 139
- 238000004519 manufacturing process Methods 0.000 description 92
- 239000000047 product Substances 0.000 description 61
- 108090000790 Enzymes Proteins 0.000 description 50
- 102000004190 Enzymes Human genes 0.000 description 47
- 230000037361 pathway Effects 0.000 description 42
- 239000013612 plasmid Substances 0.000 description 42
- 210000004027 cell Anatomy 0.000 description 41
- 230000014509 gene expression Effects 0.000 description 38
- 229920002791 poly-4-hydroxybutyrate Polymers 0.000 description 31
- 239000002609 medium Substances 0.000 description 29
- 239000002028 Biomass Substances 0.000 description 27
- 230000012010 growth Effects 0.000 description 25
- 102000007698 Alcohol dehydrogenase Human genes 0.000 description 24
- 108010021809 Alcohol dehydrogenase Proteins 0.000 description 24
- 235000000346 sugar Nutrition 0.000 description 24
- 239000013598 vector Substances 0.000 description 22
- 230000000813 microbial effect Effects 0.000 description 21
- 101710088194 Dehydrogenase Proteins 0.000 description 19
- 108020004414 DNA Proteins 0.000 description 18
- 238000005842 biochemical reaction Methods 0.000 description 18
- 230000015572 biosynthetic process Effects 0.000 description 18
- 102000004169 proteins and genes Human genes 0.000 description 18
- 230000010076 replication Effects 0.000 description 18
- IKHGUXGNUITLKF-UHFFFAOYSA-N Acetaldehyde Natural products CC=O IKHGUXGNUITLKF-UHFFFAOYSA-N 0.000 description 17
- 102000004316 Oxidoreductases Human genes 0.000 description 17
- 108090000854 Oxidoreductases Proteins 0.000 description 17
- -1 acinetoCyc pathway) Chemical compound 0.000 description 17
- 238000006243 chemical reaction Methods 0.000 description 17
- 150000001298 alcohols Chemical class 0.000 description 16
- 238000003786 synthesis reaction Methods 0.000 description 16
- 238000000855 fermentation Methods 0.000 description 15
- 230000004151 fermentation Effects 0.000 description 15
- 239000000203 mixture Substances 0.000 description 15
- 239000000243 solution Substances 0.000 description 15
- 229940044613 1-propanol Drugs 0.000 description 14
- ALRHLSYJTWAHJZ-UHFFFAOYSA-N 3-hydroxypropionic acid Chemical compound OCCC(O)=O ALRHLSYJTWAHJZ-UHFFFAOYSA-N 0.000 description 14
- 244000005700 microbiome Species 0.000 description 14
- 229960005091 chloramphenicol Drugs 0.000 description 13
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 13
- 101710124983 Acetaldehyde dehydrogenase (acetylating) Proteins 0.000 description 12
- 108020002663 Aldehyde Dehydrogenase Proteins 0.000 description 12
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 12
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 12
- 239000004472 Lysine Substances 0.000 description 12
- 238000010586 diagram Methods 0.000 description 12
- 239000012634 fragment Substances 0.000 description 12
- 239000000758 substrate Substances 0.000 description 12
- VNOYUJKHFWYWIR-ITIYDSSPSA-N succinyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CCC(O)=O)O[C@H]1N1C2=NC=NC(N)=C2N=C1 VNOYUJKHFWYWIR-ITIYDSSPSA-N 0.000 description 12
- 229920001791 ((R)-3-Hydroxybutanoyl)(n-2) Polymers 0.000 description 11
- QHHKKMYHDBRONY-RMNRSTNRSA-N 3-hydroxybutanoyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CC(O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 QHHKKMYHDBRONY-RMNRSTNRSA-N 0.000 description 11
- 241001528539 Cupriavidus necator Species 0.000 description 11
- 229960000723 ampicillin Drugs 0.000 description 11
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 11
- 239000000463 material Substances 0.000 description 11
- 239000011573 trace mineral Substances 0.000 description 11
- 235000013619 trace mineral Nutrition 0.000 description 11
- 102000005369 Aldehyde Dehydrogenase Human genes 0.000 description 10
- 101100297400 Rhizobium meliloti (strain 1021) phaAB gene Proteins 0.000 description 10
- 239000002773 nucleotide Substances 0.000 description 10
- 125000003729 nucleotide group Chemical group 0.000 description 10
- JJMDCOVWQOJGCB-UHFFFAOYSA-N 5-aminopentanoic acid Chemical compound [NH3+]CCCCC([O-])=O JJMDCOVWQOJGCB-UHFFFAOYSA-N 0.000 description 9
- 102000004357 Transferases Human genes 0.000 description 9
- 108090000992 Transferases Proteins 0.000 description 9
- 238000000769 gas chromatography-flame ionisation detection Methods 0.000 description 9
- 238000010348 incorporation Methods 0.000 description 9
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 9
- 238000012986 modification Methods 0.000 description 9
- 230000004048 modification Effects 0.000 description 9
- 108010010718 poly(3-hydroxyalkanoic acid) synthase Proteins 0.000 description 9
- 239000002243 precursor Substances 0.000 description 9
- 241000894007 species Species 0.000 description 9
- 229940043375 1,5-pentanediol Drugs 0.000 description 8
- 241000894006 Bacteria Species 0.000 description 8
- 239000003242 anti bacterial agent Substances 0.000 description 8
- 229940088710 antibiotic agent Drugs 0.000 description 8
- 230000015556 catabolic process Effects 0.000 description 8
- 238000006731 degradation reaction Methods 0.000 description 8
- 229920001519 homopolymer Polymers 0.000 description 8
- 230000037353 metabolic pathway Effects 0.000 description 8
- 239000000178 monomer Substances 0.000 description 8
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 8
- SJZRECIVHVDYJC-UHFFFAOYSA-M 4-hydroxybutyrate Chemical compound OCCCC([O-])=O SJZRECIVHVDYJC-UHFFFAOYSA-M 0.000 description 7
- VBKPPDYGFUZOAJ-UHFFFAOYSA-N 5-oxopentanoic acid Chemical compound OC(=O)CCCC=O VBKPPDYGFUZOAJ-UHFFFAOYSA-N 0.000 description 7
- OJFDKHTZOUZBOS-CITAKDKDSA-N acetoacetyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CC(=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 OJFDKHTZOUZBOS-CITAKDKDSA-N 0.000 description 7
- 238000000126 in silico method Methods 0.000 description 7
- 229930027917 kanamycin Natural products 0.000 description 7
- 229960000318 kanamycin Drugs 0.000 description 7
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 7
- 229930182823 kanamycin A Natural products 0.000 description 7
- 229920002521 macromolecule Polymers 0.000 description 7
- 150000008163 sugars Chemical class 0.000 description 7
- REKYPYSUBKSCAT-UHFFFAOYSA-N 3-hydroxypentanoic acid Chemical compound CCC(O)CC(O)=O REKYPYSUBKSCAT-UHFFFAOYSA-N 0.000 description 6
- 102100026105 3-ketoacyl-CoA thiolase, mitochondrial Human genes 0.000 description 6
- AMSWDUXCNHIVFP-ZMHDXICWSA-N 5-hydroxypentanoyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CCCCO)O[C@H]1N1C2=NC=NC(N)=C2N=C1 AMSWDUXCNHIVFP-ZMHDXICWSA-N 0.000 description 6
- 108010003902 Acetyl-CoA C-acyltransferase Proteins 0.000 description 6
- 241000897241 Acinetobacter sp. ADP1 Species 0.000 description 6
- 241000196324 Embryophyta Species 0.000 description 6
- 101100280476 Streptococcus pneumoniae (strain ATCC BAA-255 / R6) fabM gene Proteins 0.000 description 6
- 230000003698 anagen phase Effects 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 230000010354 integration Effects 0.000 description 6
- 230000002503 metabolic effect Effects 0.000 description 6
- 108020004707 nucleic acids Proteins 0.000 description 6
- 150000007523 nucleic acids Chemical class 0.000 description 6
- 102000039446 nucleic acids Human genes 0.000 description 6
- 101150110984 phaB gene Proteins 0.000 description 6
- 229920001013 poly(3-hydroxybutyrate-co-4-hydroxybutyrate) Polymers 0.000 description 6
- 239000013587 production medium Substances 0.000 description 6
- 150000003839 salts Chemical class 0.000 description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 108090000340 Transaminases Proteins 0.000 description 5
- 102000003929 Transaminases Human genes 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- 239000002551 biofuel Substances 0.000 description 5
- 210000000349 chromosome Anatomy 0.000 description 5
- 238000012239 gene modification Methods 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 108010008386 malonyl-Coa reductase Proteins 0.000 description 5
- KHPXUQMNIQBQEV-UHFFFAOYSA-N oxaloacetic acid Chemical compound OC(=O)CC(=O)C(O)=O KHPXUQMNIQBQEV-UHFFFAOYSA-N 0.000 description 5
- 239000003208 petroleum Substances 0.000 description 5
- 229920003023 plastic Polymers 0.000 description 5
- 239000004033 plastic Substances 0.000 description 5
- UIUJIQZEACWQSV-UHFFFAOYSA-N succinic semialdehyde Chemical compound OC(=O)CCC=O UIUJIQZEACWQSV-UHFFFAOYSA-N 0.000 description 5
- 230000009261 transgenic effect Effects 0.000 description 5
- 108030006814 5-aminopentanamidases Proteins 0.000 description 4
- OTIAVLWNTIXJDO-UHFFFAOYSA-N 5-aminopentanamide Chemical compound NCCCCC(N)=O OTIAVLWNTIXJDO-UHFFFAOYSA-N 0.000 description 4
- 101100536799 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) tgnE gene Proteins 0.000 description 4
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 4
- 241000233866 Fungi Species 0.000 description 4
- 108030002022 Lysine 2-monooxygenases Proteins 0.000 description 4
- 101100463818 Pseudomonas oleovorans phaC1 gene Proteins 0.000 description 4
- 240000008042 Zea mays Species 0.000 description 4
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 4
- 108091000039 acetoacetyl-CoA reductase Proteins 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 239000001913 cellulose Substances 0.000 description 4
- 229920002678 cellulose Polymers 0.000 description 4
- 230000002759 chromosomal effect Effects 0.000 description 4
- 239000005516 coenzyme A Substances 0.000 description 4
- 229940093530 coenzyme a Drugs 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- GNGACRATGGDKBX-UHFFFAOYSA-N dihydroxyacetone phosphate Chemical compound OCC(=O)COP(O)(O)=O GNGACRATGGDKBX-UHFFFAOYSA-N 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 101150043302 gabD gene Proteins 0.000 description 4
- 238000001823 molecular biology technique Methods 0.000 description 4
- 101150046540 phaA gene Proteins 0.000 description 4
- 230000008439 repair process Effects 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- 230000004102 tricarboxylic acid cycle Effects 0.000 description 4
- WHBMMWSBFZVSSR-UHFFFAOYSA-M 3-hydroxybutyrate Chemical compound CC(O)CC([O-])=O WHBMMWSBFZVSSR-UHFFFAOYSA-M 0.000 description 3
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 3
- 229920001817 Agar Polymers 0.000 description 3
- 241000192731 Chloroflexus aurantiacus Species 0.000 description 3
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 3
- 229930182566 Gentamicin Natural products 0.000 description 3
- NBBJYMSMWIIQGU-UHFFFAOYSA-N Propionic aldehyde Chemical compound CCC=O NBBJYMSMWIIQGU-UHFFFAOYSA-N 0.000 description 3
- WHBMMWSBFZVSSR-UHFFFAOYSA-N R3HBA Natural products CC(O)CC(O)=O WHBMMWSBFZVSSR-UHFFFAOYSA-N 0.000 description 3
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 3
- XJLXINKUBYWONI-DQQFMEOOSA-N [[(2r,3r,4r,5r)-5-(6-aminopurin-9-yl)-3-hydroxy-4-phosphonooxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2s,3r,4s,5s)-5-(3-carbamoylpyridin-1-ium-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphate Chemical compound NC(=O)C1=CC=C[N+]([C@@H]2[C@H]([C@@H](O)[C@H](COP([O-])(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](OP(O)(O)=O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 XJLXINKUBYWONI-DQQFMEOOSA-N 0.000 description 3
- NXBPEMOODAJTFK-BLPRJPCASA-N [[(2r,3s,4r,5r)-5-(6-aminopurin-9-yl)-4-hydroxy-3-phosphonooxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(3r)-3-hydroxy-2,2-dimethyl-4-oxo-4-[[3-oxo-3-(2-sulfanylethylamino)propyl]amino]butyl] hydrogen phosphate;4-hydroxybutanoic acid Chemical compound OCCCC(O)=O.O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCS)O[C@H]1N1C2=NC=NC(N)=C2N=C1 NXBPEMOODAJTFK-BLPRJPCASA-N 0.000 description 3
- 239000008272 agar Substances 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000003115 biocidal effect Effects 0.000 description 3
- 229920000704 biodegradable plastic Polymers 0.000 description 3
- 239000012620 biological material Substances 0.000 description 3
- 239000007795 chemical reaction product Substances 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 235000005822 corn Nutrition 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000003209 gene knockout Methods 0.000 description 3
- 230000005017 genetic modification Effects 0.000 description 3
- 235000013617 genetically modified food Nutrition 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 239000000413 hydrolysate Substances 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- YEJRWHAVMIAJKC-UHFFFAOYSA-N 4-Butyrolactone Chemical compound O=C1CCCO1 YEJRWHAVMIAJKC-UHFFFAOYSA-N 0.000 description 2
- BAMBWCGEVIAQBF-CITAKDKDSA-N 4-hydroxybutyryl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CCCO)O[C@H]1N1C2=NC=NC(N)=C2N=C1 BAMBWCGEVIAQBF-CITAKDKDSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- 108010049926 Acetate-CoA ligase Proteins 0.000 description 2
- 102100035709 Acetyl-coenzyme A synthetase, cytoplasmic Human genes 0.000 description 2
- 102100033816 Aldehyde dehydrogenase, mitochondrial Human genes 0.000 description 2
- 241001244729 Apalis Species 0.000 description 2
- 101100162204 Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) aflH gene Proteins 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 2
- 241000282414 Homo sapiens Species 0.000 description 2
- LRHPLDYGYMQRHN-UHFFFAOYSA-N N-Butanol Chemical compound CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 2
- 101000746457 Neisseria gonorrhoeae UPF0213 protein in glnA 3'region Proteins 0.000 description 2
- 241000605862 Porphyromonas gingivalis Species 0.000 description 2
- 101710181816 Pyruvate-formate-lyase deactivase Proteins 0.000 description 2
- 241000481518 Ralstonia eutropha H16 Species 0.000 description 2
- 241000191025 Rhodobacter Species 0.000 description 2
- 240000000111 Saccharum officinarum Species 0.000 description 2
- 235000007201 Saccharum officinarum Nutrition 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108700005078 Synthetic Genes Proteins 0.000 description 2
- 230000000397 acetylating effect Effects 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000003044 adaptive effect Effects 0.000 description 2
- 101150024743 adhA gene Proteins 0.000 description 2
- WNLRTRBMVRJNCN-UHFFFAOYSA-L adipate(2-) Chemical compound [O-]C(=O)CCCCC([O-])=O WNLRTRBMVRJNCN-UHFFFAOYSA-L 0.000 description 2
- 150000001299 aldehydes Chemical class 0.000 description 2
- 230000006696 biosynthetic metabolic pathway Effects 0.000 description 2
- 235000010633 broth Nutrition 0.000 description 2
- 239000006227 byproduct Substances 0.000 description 2
- 239000001569 carbon dioxide Substances 0.000 description 2
- 229910002092 carbon dioxide Inorganic materials 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- RGJOEKWQDUBAIZ-UHFFFAOYSA-N coenzime A Natural products OC1C(OP(O)(O)=O)C(COP(O)(=O)OP(O)(=O)OCC(C)(C)C(O)C(=O)NCCC(=O)NCCS)OC1N1C2=NC=NC(N)=C2N=C1 RGJOEKWQDUBAIZ-UHFFFAOYSA-N 0.000 description 2
- 239000002361 compost Substances 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- KDTSHFARGAKYJN-UHFFFAOYSA-N dephosphocoenzyme A Natural products OC1C(O)C(COP(O)(=O)OP(O)(=O)OCC(C)(C)C(O)C(=O)NCCC(=O)NCCS)OC1N1C2=NC=NC(N)=C2N=C1 KDTSHFARGAKYJN-UHFFFAOYSA-N 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 239000012153 distilled water Substances 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 238000002290 gas chromatography-mass spectrometry Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000006680 metabolic alteration Effects 0.000 description 2
- 239000010813 municipal solid waste Substances 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 101150048611 phaC gene Proteins 0.000 description 2
- 229920000520 poly(3-hydroxybutyrate-co-3-hydroxyvalerate) Polymers 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 229920005604 random copolymer Polymers 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 108010037073 succinate semialdehyde reductase Proteins 0.000 description 2
- VNOYUJKHFWYWIR-FZEDXVDRSA-N succinyl-coa Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)C(O)C(=O)NCCC(=O)NCCSC(=O)CCC(O)=O)O[C@H]1N1C2=NC=NC(N)=C2N=C1 VNOYUJKHFWYWIR-FZEDXVDRSA-N 0.000 description 2
- 230000017423 tissue regeneration Effects 0.000 description 2
- 239000002699 waste material Substances 0.000 description 2
- 239000002023 wood Substances 0.000 description 2
- WHBMMWSBFZVSSR-GSVOUGTGSA-M (R)-3-hydroxybutyrate Chemical compound C[C@@H](O)CC([O-])=O WHBMMWSBFZVSSR-GSVOUGTGSA-M 0.000 description 1
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 1
- VZSRBBMJRBPUNF-UHFFFAOYSA-N 2-(2,3-dihydro-1H-inden-2-ylamino)-N-[3-oxo-3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)propyl]pyrimidine-5-carboxamide Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)C(=O)NCCC(N1CC2=C(CC1)NN=N2)=O VZSRBBMJRBPUNF-UHFFFAOYSA-N 0.000 description 1
- YVOMYDHIQVMMTA-UHFFFAOYSA-N 3-Hydroxyadipic acid Chemical compound OC(=O)CC(O)CCC(O)=O YVOMYDHIQVMMTA-UHFFFAOYSA-N 0.000 description 1
- BERBFZCUSMQABM-IEXPHMLFSA-N 3-hydroxypropanoyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CCO)O[C@H]1N1C2=NC=NC(N)=C2N=C1 BERBFZCUSMQABM-IEXPHMLFSA-N 0.000 description 1
- 108010024655 4-hydroxybutyrate CoA-transferase Proteins 0.000 description 1
- 241000193451 Acetoanaerobium sticklandii Species 0.000 description 1
- 241000589220 Acetobacter Species 0.000 description 1
- QTXZASLUYMRUAN-QLQASOTGSA-N Acetyl coenzyme A (Acetyl-CoA) Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1.O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 QTXZASLUYMRUAN-QLQASOTGSA-N 0.000 description 1
- 102000000452 Acetyl-CoA carboxylase Human genes 0.000 description 1
- 108010016219 Acetyl-CoA carboxylase Proteins 0.000 description 1
- 241000604450 Acidaminococcus fermentans Species 0.000 description 1
- 101100073734 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) ACIAD0131 gene Proteins 0.000 description 1
- 101100536797 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) tgnC gene Proteins 0.000 description 1
- 241000567139 Aeropyrum pernix Species 0.000 description 1
- 241000609240 Ambelania acida Species 0.000 description 1
- 241000722955 Anaerobiospirillum Species 0.000 description 1
- 241001136167 Anaerotignum propionicum Species 0.000 description 1
- 241000428313 Anaerotruncus colihominis Species 0.000 description 1
- 241000219195 Arabidopsis thaliana Species 0.000 description 1
- 241000203069 Archaea Species 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 241000193755 Bacillus cereus Species 0.000 description 1
- 241000194103 Bacillus pumilus Species 0.000 description 1
- 108010018763 Biotin carboxylase Proteins 0.000 description 1
- 241000193764 Brevibacillus brevis Species 0.000 description 1
- 241000244203 Caenorhabditis elegans Species 0.000 description 1
- 241000589875 Campylobacter jejuni Species 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- UGFAIRIUMAVXCW-UHFFFAOYSA-N Carbon monoxide Chemical compound [O+]#[C-] UGFAIRIUMAVXCW-UHFFFAOYSA-N 0.000 description 1
- 102000007132 Carboxyl and Carbamoyl Transferases Human genes 0.000 description 1
- 108010072957 Carboxyl and Carbamoyl Transferases Proteins 0.000 description 1
- 206010061764 Chromosomal deletion Diseases 0.000 description 1
- 241001494522 Citrobacter amalonaticus Species 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 241001468165 Clostridium aminobutyricum Species 0.000 description 1
- 241000193454 Clostridium beijerinckii Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 241000193468 Clostridium perfringens Species 0.000 description 1
- 241001508458 Clostridium saccharoperbutylacetonicum Species 0.000 description 1
- 241000186524 Clostridium subterminale Species 0.000 description 1
- 241000193449 Clostridium tetani Species 0.000 description 1
- 241000193452 Clostridium tyrobutyricum Species 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 241001517050 Corynebacterium accolens Species 0.000 description 1
- 241001288670 Corynebacterium afermentans subsp. afermentans Species 0.000 description 1
- 241001288679 Corynebacterium afermentans subsp. lipophilum Species 0.000 description 1
- 241000158508 Corynebacterium amycolatum Species 0.000 description 1
- 241000147183 Corynebacterium argentoratense Species 0.000 description 1
- 241000168411 Corynebacterium auris Species 0.000 description 1
- 241001508000 Corynebacterium bovis Species 0.000 description 1
- 241000186227 Corynebacterium diphtheriae Species 0.000 description 1
- 241001533284 Corynebacterium glucuronolyticum Species 0.000 description 1
- 241001517041 Corynebacterium jeikeium Species 0.000 description 1
- 241001517018 Corynebacterium macginleyi Species 0.000 description 1
- 241000158496 Corynebacterium matruchotii Species 0.000 description 1
- 241001518260 Corynebacterium minutissimum Species 0.000 description 1
- 241000158499 Corynebacterium propinquum Species 0.000 description 1
- 241001522132 Corynebacterium pseudodiphtheriticum Species 0.000 description 1
- 241000158523 Corynebacterium striatum Species 0.000 description 1
- 241000158520 Corynebacterium urealyticum Species 0.000 description 1
- 241000186245 Corynebacterium xerosis Species 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 101100326160 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) bktB gene Proteins 0.000 description 1
- 241000192700 Cyanobacteria Species 0.000 description 1
- 241000190844 Erythrobacter Species 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 241001646716 Escherichia coli K-12 Species 0.000 description 1
- 241000901842 Escherichia coli W Species 0.000 description 1
- 241000193456 Eubacterium barkeri Species 0.000 description 1
- 241000195619 Euglena gracilis Species 0.000 description 1
- 241000605909 Fusobacterium Species 0.000 description 1
- 241000968725 Gammaproteobacteria bacterium Species 0.000 description 1
- 241000193385 Geobacillus stearothermophilus Species 0.000 description 1
- 108010025885 Glycerol dehydratase Proteins 0.000 description 1
- 241000606768 Haemophilus influenzae Species 0.000 description 1
- 241000204946 Halobacterium salinarum Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 108090001042 Hydro-Lyases Proteins 0.000 description 1
- 102000004867 Hydro-Lyases Human genes 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 108090000604 Hydrolases Proteins 0.000 description 1
- 102000004157 Hydrolases Human genes 0.000 description 1
- 206010021639 Incontinence Diseases 0.000 description 1
- 241000588915 Klebsiella aerogenes Species 0.000 description 1
- 201000008225 Klebsiella pneumonia Diseases 0.000 description 1
- 241000588747 Klebsiella pneumoniae Species 0.000 description 1
- 241000235087 Lachancea kluyveri Species 0.000 description 1
- 241000192130 Leuconostoc mesenteroides Species 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 241001625930 Luria Species 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-N Malonic acid Chemical compound OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 1
- LTYOQGRJFJAKNA-KKIMTKSISA-N Malonyl CoA Natural products S(C(=O)CC(=O)O)CCNC(=O)CCNC(=O)[C@@H](O)C(CO[P@](=O)(O[P@](=O)(OC[C@H]1[C@@H](OP(=O)(O)O)[C@@H](O)[C@@H](n2c3ncnc(N)c3nc2)O1)O)O)(C)C LTYOQGRJFJAKNA-KKIMTKSISA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241000157876 Metallosphaera sedula Species 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 241001303121 Methylibium Species 0.000 description 1
- 240000003433 Miscanthus floridulus Species 0.000 description 1
- 102000008109 Mixed Function Oxygenases Human genes 0.000 description 1
- 108010074633 Mixed Function Oxygenases Proteins 0.000 description 1
- 241000193459 Moorella thermoacetica Species 0.000 description 1
- 241000186366 Mycobacterium bovis Species 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 101000911038 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Steroid 3-ketoacyl-CoA thiolase Proteins 0.000 description 1
- 241000863422 Myxococcus xanthus Species 0.000 description 1
- BAWFJGJZGIEFAR-NNYOXOHSSA-O NAD(+) Chemical compound NC(=O)C1=CC=C[N+]([C@H]2[C@@H]([C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 BAWFJGJZGIEFAR-NNYOXOHSSA-O 0.000 description 1
- 241000167284 Natranaerobius Species 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 101150084935 PTER gene Proteins 0.000 description 1
- 241001520808 Panicum virgatum Species 0.000 description 1
- 241000228150 Penicillium chrysogenum Species 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- 235000014676 Phragmites communis Nutrition 0.000 description 1
- 206010035717 Pneumonia klebsiella Diseases 0.000 description 1
- 235000015696 Portulacaria afra Nutrition 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 241001528479 Pseudoflavonifractor capillosus Species 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 241000589614 Pseudomonas stutzeri Species 0.000 description 1
- 101150071963 RBSK gene Proteins 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 241000516658 Roseiflexus castenholzii Species 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 241000607715 Serratia marcescens Species 0.000 description 1
- 244000044822 Simmondsia californica Species 0.000 description 1
- 235000004433 Simmondsia californica Nutrition 0.000 description 1
- 240000006394 Sorghum bicolor Species 0.000 description 1
- 235000011684 Sorghum saccharatum Nutrition 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 241000194020 Streptococcus thermophilus Species 0.000 description 1
- 101100125907 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) ilvC1 gene Proteins 0.000 description 1
- 241000205098 Sulfolobus acidocaldarius Species 0.000 description 1
- 241000205091 Sulfolobus solfataricus Species 0.000 description 1
- 241000160715 Sulfolobus tokodaii Species 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 241001399969 Syntheta Species 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 241001147775 Thermoanaerobacter brockii Species 0.000 description 1
- 241000204666 Thermotoga maritima Species 0.000 description 1
- 241000589499 Thermus thermophilus Species 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 241000589892 Treponema denticola Species 0.000 description 1
- 244000177175 Typha elephantina Species 0.000 description 1
- 235000018747 Typha elephantina Nutrition 0.000 description 1
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 1
- 241000588901 Zymomonas Species 0.000 description 1
- XTUNVEMVWFXFGV-UHFFFAOYSA-N [C].CCO Chemical compound [C].CCO XTUNVEMVWFXFGV-UHFFFAOYSA-N 0.000 description 1
- XHESKOYKUFGPAM-NDZSKPAWSA-N [[(2r,3s,4r,5r)-5-(6-aminopurin-9-yl)-4-hydroxy-3-phosphonooxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(3r)-3-hydroxy-4-[[3-[2-(3-hydroxypropylsulfanyl)ethylamino]-3-oxopropyl]amino]-2,2-dimethyl-4-oxobutyl] hydrogen phosphate Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSCCCO)O[C@H]1N1C2=NC=NC(N)=C2N=C1 XHESKOYKUFGPAM-NDZSKPAWSA-N 0.000 description 1
- 125000000218 acetic acid group Chemical group C(C)(=O)* 0.000 description 1
- VMBFYEXFNIEURO-BLPRJPCASA-N acetic acid;[[(2r,3s,4r,5r)-5-(6-aminopurin-9-yl)-4-hydroxy-3-phosphonooxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(3r)-3-hydroxy-2,2-dimethyl-4-oxo-4-[[3-oxo-3-(2-sulfanylethylamino)propyl]amino]butyl] hydrogen phosphate Chemical compound CC(O)=O.O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCS)O[C@H]1N1C2=NC=NC(N)=C2N=C1 VMBFYEXFNIEURO-BLPRJPCASA-N 0.000 description 1
- 125000002339 acetoacetyl group Chemical group O=C([*])C([H])([H])C(=O)C([H])([H])[H] 0.000 description 1
- 229940100228 acetyl coenzyme a Drugs 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 125000000304 alkynyl group Chemical group 0.000 description 1
- 210000001188 articular cartilage Anatomy 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 239000010905 bagasse Substances 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 235000015278 beef Nutrition 0.000 description 1
- 230000008238 biochemical pathway Effects 0.000 description 1
- 230000003851 biochemical process Effects 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 244000309464 bull Species 0.000 description 1
- ZTQSAGDEMFDKMZ-UHFFFAOYSA-N butyric aldehyde Natural products CCCC=O ZTQSAGDEMFDKMZ-UHFFFAOYSA-N 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 229910002091 carbon monoxide Inorganic materials 0.000 description 1
- 125000001721 carboxyacetyl group Chemical group 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical group 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 235000021310 complex sugar Nutrition 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229910000366 copper(II) sulfate Inorganic materials 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 101150021834 davT gene Proteins 0.000 description 1
- 238000003066 decision tree Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 150000001991 dicarboxylic acids Chemical class 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- CZZYITDELCSZES-UHFFFAOYSA-N diphenylmethane Chemical compound C=1C=CC=CC=1CC1=CC=CC=C1 CZZYITDELCSZES-UHFFFAOYSA-N 0.000 description 1
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 229920001971 elastomer Polymers 0.000 description 1
- 238000004134 energy conservation Methods 0.000 description 1
- 238000012407 engineering method Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 229940092559 enterobacter aerogenes Drugs 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000009483 enzymatic pathway Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 125000000816 ethylene group Chemical group [H]C([H])([*:1])C([H])([H])[*:2] 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 239000003337 fertilizer Substances 0.000 description 1
- 101150093898 fimD gene Proteins 0.000 description 1
- 230000004907 flux Effects 0.000 description 1
- 239000000446 fuel Substances 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 230000004077 genetic alteration Effects 0.000 description 1
- 231100000118 genetic alteration Toxicity 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 230000004110 gluconeogenesis Effects 0.000 description 1
- 108010000361 glycerol 2-dehydrogenase (NADP+) Proteins 0.000 description 1
- 108010032776 glycerol-1-phosphatase Proteins 0.000 description 1
- 230000009643 growth defect Effects 0.000 description 1
- 229940047650 haemophilus influenzae Drugs 0.000 description 1
- 239000004009 herbicide Substances 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000003301 hydrolyzing effect Effects 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 101150090497 ilvC gene Proteins 0.000 description 1
- 238000012405 in silico analysis Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- 235000009973 maize Nutrition 0.000 description 1
- LTYOQGRJFJAKNA-DVVLENMVSA-N malonyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CC(O)=O)O[C@H]1N1C2=NC=NC(N)=C2N=C1 LTYOQGRJFJAKNA-DVVLENMVSA-N 0.000 description 1
- LTYOQGRJFJAKNA-VFLPNFFSSA-N malonyl-coa Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)C(O)C(=O)NCCC(=O)NCCSC(=O)CC(O)=O)O[C@H]1N1C2=NC=NC(N)=C2N=C1 LTYOQGRJFJAKNA-VFLPNFFSSA-N 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- DNIAPMSPPWPWGF-UHFFFAOYSA-N monopropylene glycol Natural products CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 1
- 238000000465 moulding Methods 0.000 description 1
- 239000002362 mulch Substances 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 235000012149 noodles Nutrition 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 239000012074 organic phase Substances 0.000 description 1
- 230000000399 orthopedic effect Effects 0.000 description 1
- 239000012785 packaging film Substances 0.000 description 1
- 229920006280 packaging film Polymers 0.000 description 1
- 239000003973 paint Substances 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 238000003068 pathway analysis Methods 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 239000000575 pesticide Substances 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 230000000243 photosynthetic effect Effects 0.000 description 1
- 230000027086 plasmid maintenance Effects 0.000 description 1
- 239000013502 plastic waste Substances 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 238000002203 pretreatment Methods 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 229960005335 propanol Drugs 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 150000003333 secondary alcohols Chemical class 0.000 description 1
- 238000011218 seed culture Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000001577 simple distillation Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 238000009987 spinning Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 239000010902 straw Substances 0.000 description 1
- 101150031436 sucD gene Proteins 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 239000001384 succinic acid Substances 0.000 description 1
- 230000009469 supplementation Effects 0.000 description 1
- 210000002435 tendon Anatomy 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- 239000002966 varnish Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 238000003260 vortexing Methods 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
- 235000013618 yogurt Nutrition 0.000 description 1
Description
GREEN PROCESS FOR PRODUCING POLYHYDROXYALKANOATES AND CHEMICALS USING A RENEWABLE FEEDSTOCK
RELATED APPLICATION
[0001] This application claims the benefit of U.S. Provisional Application No. 61/480,870, filed on April 29, 2011, the entire teachings of which are incorporated herein by reference.
FIELD OF THE INVENTION
[0002] The invention is related to the production of polyhydroxyalkanoate polymers, copolymers, diols, and diacids in microbes that are genetically engineered to produce these products using ethanol as a carbon source.
BACKGROUND
[0003] With dwindling petroleum resources, increasing energy prices, and environmental concerns, development of energy efficient biorefmery processes to produce biobased chemicals and materials from renewable, low cost, carbon resources offers a unique solution to overcoming the increasing limitations of petroleum-based chemicals.
[0004] Fuels, plastics, and chemicals derived from agricultural feedstocks are receiving considerable attention as the world looks for solutions to dwindling nonrenewable petroleum resources (Herrera, Nature Biotechnol. 24:755-760 (2006); Kamm et at, Adv. Biochem. Eng. Biotechnol. 105: 175-204 (2007); Ragauskas et al. , Science 311 :484-489 (2006)). In the United States, efforts have primarily focused on biofuels such as ethanol produced from the starch in maize kernels. Efforts in other parts of the world like Brazil use sugar feedstocks from sugarcane. Currently there are extensive efforts to develop new sources of feedstocks for ethanol production including cellulose hydrolysate from biomass.
[0005] Polyhydroxyalkanoates (PHAs), a family of naturally renewable and biodegradable plastics, occur in nature as a storage reserve in some microbes faced with nutrient limitation (Madison et al , Microbiol. Mol. Biol. Rev. 63:21-53 (1999)) and possess properties enabling their use in a variety of applications currently served
by petroleum-based polymers. PHAs can be extracted from microorganisms or genetically engineered crops and used in polymer form as PHA biobased plastics or can be chemically or thermally converted to a range of renewable chemicals. PHA biobased plastics can be produced via commercial large scale fermentations of microbial strains and the marketing of these plastics in a variety of applications is well under way (Bieles, Plastics and Rubber Weekly, Feb. 17:1 (2006)). Since they are inherently biodegradable in soil, compost, and marine environments, they can decrease plastic waste disposal issues.
[0006] Existing fermentation methods for producing polyhydroxyalkanoates utilize wild-type or transgenic microorganisms cultured on specific substrates to produce the desired PHA polymer composition. In many cases the polymers of interest are copolymers of the (D)-isomer of 3-hydroxybutyrate copolymerized with one other 3, 4 or 5-hydroxyacids. These copolymers are produced as granular inclusions inside the cells and are random copolymers. Existing fermentation methods generally use clean sugars, fatty acids or vegetable oils as the primary feedstock for the microorganisms. Secondary feedstocks are usually supplied to enable the incorporation of the second monomer.
[0007] The availability and cost of corn or cane sugars as a feedstock can be prohibitively high especially when growing microbes on an industrial scale.
Therefore there is a need to find lower cost carbon substrates for producing PHAs via microbial fermentation processes.
SUMMARY OF THE INVENTION
[0008] Disclosed herein are organisms for producing polyhydroxyalkanoates, diols, and diacids when grown on ethanol (or xylose) as a carbon source. The organisms described are genetically engineered to incorporate enzymes of metabolic pathways for utilizing ethanol as a carbon source to produce sufficient amounts of polyhydroxyalkanoates or copolymers that can be further converted to diols, higher alcohols or diacids. The yield achieved by such processes is an economically viable alternative due to increasing production or improved production of the desired products or by reducing side products.
[0009] In some embodiments, if the microbial organism is naturally capable of using ethanol as a carbon source (e.g., having a pathway comprising an aldehyde dehydrogenase and alcohol dehydrogenase for utilizing ethanol (e.g., acinetoCyc pathway), for example A. baylyi ADPI or corynebacterium glutamicum having Cgl07 and Cg3098)), additional enzymes of the pathway for producing
polyhydroxyalkanoates or copolymers can be incorporated by genetic modification of the organism.
[0010] Additionally, if the organism is not capable of utilizing ethanol as a carbon source then enzyme(s) for the metabolic pathway of converting ethanol to acetyl coA are introduced into the genome. For example, genes encoding aldehyde dehydrogenase and alcohol dehydrogenase enzymes are incorporated for producing a sufficient amount of enzymes for utilizing ethanol as the carbon source.
[0011] In one aspect, the invention discloses an organism homologously capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source, where the organism is genetically engineered to produce a polyhydroxyalkanoate polymer. In these embodiments, the organism (e.g., microbe, bacteria) is genetically modified to incorporate the enzymes in a metabolic pathway for converting acetyl- CoA to a desired product(s), for example poly-3-hydroxybutyrate (e.g., see FIG.3), poly-4-hydroxybutyrate (e.g., see FIG.4), poly-3-hydroxypropionate (e.g., see FIG.5), poly-5-hydroxyvalerate (e.g., see FIG.6), poly-3-hydroxybutyrate-co-4- hydroxybutyrate copolymer (e.g., see FIG.7), poly-3-hydroxybutyrate-co-5- hydroxyvalerate copolymer (e.g., see FIG.8), 1.4-butanediol (e.g., see FIG. 9), isopropanol (e.g., see FIG. 10), 1-propanol (e.g., see FIG.l 1), or adipate (e.g., see FIG.12).
[0012] Also disclosed is an organism homologously capable of producing polyhydroxyalkanoate polymer, where the organism is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source. The appropriate enzymes in the metabolic pathway to convert ethanol to acetyl-CoA are incorporated into the organism (e.g., see FIG.l).
[0013] In another aspect, the invention discloses an organism that is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon
source, and genetically engineered to produce polyhydroxyalkanoate polymer. In this aspect both pathways (ethanol to acetyl-CoA pathway) and the desired polyhydroxyalkanoate polymer pathway are incorporated into the genome of the organism.
[0014] Such organisms produce one or more polyhydroxyalkanoate polymers or copolymers when grown on ethanol as a carbon source. The polyhydroxyalkanoate polymer can be polyglycolic acid (PGA), poly-3-hydroxybutyrate (P3HB), poly-3- hydroxypropionate (P3HP), poly-4-hydroxybutyrate (P4HB), poly-5- hydroxyvalerate (P5HV), poly-3-hydroxybutyrate-co-4-hydroxybutyrate (P(3HB-co- 4HB)), poly-3-hydroxybutyrate-co-3 -hydroxy valerate (P(3HB-co-3HV)), or poly-3- hydroxybutyrate-co-5-hydroxyvalerate (P(3HB-co-5HV)) or combinations and copolymers of these.
[0015] In a further aspect, the invention discloses an organism homologously capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source, where the organism is genetically engineered, for example, by genetically introducing non-naturally produced enzymes in a pathway to produce diol (e.g., 1,3- propanediol, 1,4-butanediol, 1,5-pentanediol, or 1,6-hexanediol and the like).
[0016] In another aspect, the invention discloses an organism homologously capable of producing diol, where the organism is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source.
[0017] An additional aspect of the invention discloses an organism that is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, and genetically engineered to produce diol (e.g., 1,3 -propanediol, 1,4-butanediol, 1,5-pentanediol, or 1,6-hexanediol and the like).
[0018] Also disclosed is an organism homologously capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source, where the organism is genetically engineered to produce diacid (e.g., succinic acid, glutaric acid, or adipic acid).
[0019] A further disclosure reveals an organism homologously capable of producing diacid, where the organism is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source.
[0020] Also disclosed is an organism that is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, and genetically engineered to produce diacid.
[0021] Such organisms can produce diacids when grown on ethanol as a carbon source. The diacid can be succinic acid, glutaric acid, or adipic acid.
[0022] Also disclosed is an organism homologously capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source, where the organism is genetically engineered to produce higher alcohols (e.g., isopropanol, 1- propanol and the like).
[0023] A further disclosure reveals an organism homologously capable of producing higher alcohols, where the organism is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source.
[0024] Also disclosed is an organism that is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, and genetically engineered to produce higher alcohols.
[0025] Such organisms can produce higher alcohols when grown on ethanol as a carbon source. The higher alcohols can be isopropanol or 1-propanol.
[0026] Also disclosed herein are processes for producing
polyhydroxyalkanoates, diols, diacids, and higher alcohols from organisms grown on ethanol as a carbon source.
[0027] In one aspect, the invention discloses a process for producing polyhydroxyalkanoate, comprising: providing an organism capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source; genetically engineering the organism to produce polyhydroxyalkanoate polymer, thereby producing an ethanol-utilizing organism genetically engineered to produce polyhydroxyalkanoate; and providing ethanol to the ethanol-utilizing organism genetically engineered to produce polyhydroxyalkanoate; thereby producing polyhydroxyalkanoate.
[0028] Also disclosed is a process for producing polyhydroxyalkanoate, comprising: providing an organism capable of producing polyhydroxyalkanoate polymer; genetically engineering the organism to convert ethanol to acetyl-CoA
when grown on ethanol as a carbon source, thereby producing a
polyhydroxyalkanoate-producing organism genetically engineered to utilize ethanol; and providing ethanol to the polyhydroxyalkanoate-producing organism genetically engineered to utilize ethanol; thereby producing polyhydroxyalkanoate.
[0029] In a further aspect, the invention discloses a process for producing polyhydroxyalkanoate, comprising: providing an organism; genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing an organism genetically engineered to utilize ethanol; genetically engineering the organism to produce polyhydroxyalkanoate polymer, thereby producing an organism genetically engineered to produce
polyhydroxyalkanoate and utilize ethanol; and providing ethanol to the organism genetically engineered to produce polyhydroxyalkanoate and utilize ethanol; thereby producing polyhydroxyalkanoate.
[0030] In such processes, the polyhydroxyalkanoate polymer can be
polyglycolic acid (PGA), poly-3-hydroxybutyrate (P3HB), poly-3- hydroxypropionate (P3HP), poly-4-hydroxybutryrate (P4HB), poly-5- hydroxyvalerate (P5HV), poly-3-hydroxybutyrate-co-4-hydroxybutyrate (P(3HB-co- 4HB)), poly-3-hydroxybutyrate-co-3-hydroxyvalerate (P(3HB-co-3HV)), or poly-3- hydroxybutyrate-co-5-hydroxyvalerate (P(3HB-co-5HV)) and combinations and copolymers of these. In certain embodiments, the copolymers are a poly(3- hydroxybutyrate-co-4-hydroxybutyrate) with 2% to 50% 4-hydroxybutyrate content, a poly(3-hydroxybutyrate-co-3 -hydroxy valerate) with 2% to 50% 3-hydroxyvalerate content, a poly(3-hydroxybutyrate-co-5-hydroxyvalerate) with 2% to 50% 5- hydroxyvalerate content, a poly(3-hydroxybutyrate-co-4-hydroxybutyrate) with 5% to 15% 4-hydroxybutyrate content, a poly(3-hydroxybutyrate-co-3-hydroxyvalerate) with 5% to 40%) 3-hydroxyvalerate content, a poly(3-hydroxybutyrate-co-5- hydroxyvalerate) with 5% to 40% 5-hydroxyvalerate content.
[0031] Also disclosed herein is a process for producing diol, comprising:
providing an organism capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source; genetically engineering the organism to produce diol, thereby producing an ethanol-utilizing organism genetically engineered to produce
diol; and providing ethanol to the ethanol-utilizing organism genetically engineered to produce diol; thereby producing diol.
[0032] Another process is disclosed for producing diol, comprising: providing an organism capable of producing diol; genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing a diol-producing organism genetically engineered to utilize ethanol; and providing ethanol to the diol-producing organism genetically engineered to utilize ethanol; thereby producing diol.
[0033] Also disclosed is a process for producing diol, comprising: providing an organism; genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing an organism genetically engineered to utilize ethanol; genetically engineering the organism to produce diol, thereby producing an organism genetically engineered to produce diol and utilize ethanol; and providing ethanol to the organism genetically engineered to produce diol and utilize ethanol; thereby producing diol.
[0034] In such processes, the diol can be 1,3-propanediol, 1 ,4-butanediol, 1,5- pentanediol, or 1,6-hexanediol.
[0035] Also disclosed herein is a process for producing diacid, comprising: providing an organism capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source; genetically engineering the organism to produce diacid, thereby producing an ethanol-utilizing organism genetically engineered to produce diacid; and providing ethanol to the ethanol-utilizing organism genetically engineered to produce diacid; thereby producing diacid.
[0036] In an additional aspect, the invention discloses a process for producing diacid, comprising: providing an organism capable of producing diacid; genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing a diacid-producing organism genetically engineered to utilize ethanol; and providing ethanol to the diacid-producing organism genetically engineered to utilize ethanol; thereby producing diacid.
[0037] A further aspect discloses a process for producing diacid, comprising: providing an organism; genetically engineering the organism to convert ethanol to
acetyl-CoA when grown on ethanol as a carbon source, thereby producing an organism genetically engineered to utilize ethanol; genetically engineering the organism to produce diacid, thereby producing an organism genetically engineered to produce diacid and utilize ethanol; and providing ethanol to the organism genetically engineered to produce diacid and utilize ethanol; thereby producing diacid.
[0038] In such processes, the diacid can be succinic acid, glutaric acid, and adipic acid.
[0039] Also disclosed herein is a process for producing higher alcohol, comprising: providing an organism capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source; genetically engineering the organism to produce higher alcohol, thereby producing an ethanol-utilizing organism genetically engineered to produce higher alcohol; and providing ethanol to the ethanol-utilizing organism genetically engineered to produce higher alcohol; thereby producing higher alcohol.
[0040] In an additional aspect, the invention discloses a process for producing higher alcohol, comprising: providing an organism capable of producing higher alcohol; genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing a higher alcohol- producing organism genetically engineered to utilize ethanol; and providing ethanol to the higher alcohol-producing organism genetically engineered to utilize ethanol; thereby producing higher alcohol.
[0041] A further aspect discloses a process for producing higher alcohol, comprising: providing an organism; genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing an organism genetically engineered to utilize ethanol; genetically engineering the organism to produce higher alcohol, thereby producing an organism genetically engineered to produce higher alcohol and utilize ethanol; and providing ethanol to the organism genetically engineered to produce higher alcohol and utilize ethanol; thereby producing higher alcohol.
[0042] In such processes, the higher alcohol can be isopropanol or 1-propanol.
[0043] In one aspect, the invention discloses an organism homologously capable of converting xylose to acetyl-Co A when grown on xylose as a carbon source, where the organism is genetically engineered to produce polyhydroxyalkanoate polymer.
[0044] Also disclosed is an organism homologously capable of producing polyhydroxyalkanoate polymer, where the organism is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source.
[0045] In another aspect, the invention discloses an organism that is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source, and genetically engineered to produce polyhydroxyalkanoate polymer.
[0046] Such organisms can produce polyhydroxyalkanoate polymer when grown on xylose as a carbon source. The polyhydroxyalkanoate polymer can be polyglycolic acid (PGA), poly-3-hydroxybutyrate (P3HB), poly-3- hydroxypropionate (P3HP), poly-4-hydroxybutryrate (P4HB), poly-5- hydroxyvalerate (P5HV), poly-3-hydroxybutyrate-co-4-hydroxybutyrate (P(3HB-co- 4HB)), poly-3-hydroxybutyrate-co-3 -hydroxy valerate (P(3HB-co-3HV)), or poly-Shy droxybutyrate-co- 5 -hy droxyvaler ate (P(3 HB -co - 5HV)) .
[0047] In a further aspect, the invention discloses an organism homologously capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source, where the organism is genetically engineered to produce diol.
[0048] In another aspect, the invention discloses an organism homologously capable of producing diol, where the organism is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source.
[0049] An additional aspect of the invention discloses an organism that is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source, and genetically engineered to produce diol.
[0050] Such organisms can produce diols when grown on xylose as a carbon source. The diol can be 1,3-propanediol, 1 ,4-butanediol, 1,5-pentanediol, or 1,6- hexanediol.
[0051] Also disclosed is an organism homologously capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source, where the organism is genetically engineered to produce diacid.
[0052] A further disclosure reveals an organism homologously capable of producing diacid, where the organism is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source.
[0053] Also disclosed is an organism that is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source, and genetically engineered to produce diacid.
[0054] Such organisms can produce diacids when grown on xylose as a carbon source. The diacid can be succinic acid, glutaric acid, or adipic acid.
[0055] Also disclosed is an organism homologously capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source, where the organism is genetically engineered to produce higher alcohol.
[0056] A further disclosure reveals an organism homologously capable of producing higher alcohol, where the organism is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source.
[0057] Also disclosed is an organism that is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source, and genetically engineered to produce higher alcohol.
[0058] Such organisms can produce higher alcohol when grown on xylose as a carbon source. The higher alcohol can be isopropanol or 1-propanol.
[0059] Also disclosed herein are processes for producing
polyhydroxyalkanoates, diols, diacids, and higher alcohols from organisms grown on xylose as a carbon source.
[0060] In one aspect, the invention discloses a process for producing polyhydroxyalkanoate, comprising: providing an organism capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source; genetically engineering the organism to produce polyhydroxyalkanoate polymer, thereby producing a xylose-utilizing organism genetically engineered to produce polyhydroxyalkanoate; and providing xylose to the xylose-utilizing organism genetically engineered to produce polyhydroxyalkanoate; thereby producing polyhydroxyalkanoate.
[0061] Also disclosed is a process for producing polyhydroxyalkanoate, comprising: providing an organism capable of producing polyhydroxyalkanoate polymer; genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing a
polyhydroxyalkanoate-producing organism genetically engineered to utilize xylose; and providing xylose to the polyhydroxyalkanoate-producing organism genetically engineered to utilize xylose; thereby producing polyhydroxyalkanoate.
[0062] In a further aspect, the invention discloses a process for producing polyhydroxyalkanoate, comprising: providing an organism; genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing an organism genetically engineered to utilize xylose; genetically engineering the organism to produce polyhydroxyalkanoate polymer, thereby producing an organism genetically engineered to produce
polyhydroxyalkanoate and utilize xylose; and providing xylose to the organism genetically engineered to produce polyhydroxyalkanoate and utilize xylose; thereby producing polyhydroxyalkanoate.
[0063] In such processes, the polyhydroxyalkanoate polymer can be
polyglycolic acid (PGA), poly-3-hydroxybutyrate (P3HB), poly-3- hydroxypropionate (P3HP), poly-4-hydroxybutryrate (P4HB), poly-5- hydroxyvalerate (P5HV), poly-3-hydroxybutyrate-co-4-hydroxybutyrate (P(3HB-co- 4HB)), poly-3-hydroxybutyrate-co-3-hydroxyvalerate (P(3HB-co-3HV)), or poly-3- hydroxybutyrate-co-5-hydroxyvalerate (P(3HB-co-5HV)), copolymers and mixtures of these polymers.
[0064] Also disclosed herein is a process for producing diol, comprising:
providing an organism capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source; genetically engineering the organism to produce diol, thereby producing an xylose-utilizing organism genetically engineered to produce diol; and providing xylose to the xylose-utilizing organism genetically engineered to produce diol; thereby producing diol.
[0065] Another process is disclosed for producing diol comprising: providing an organism capable of producing diol; genetically engineering the organism to convert
xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing a diol-producing organism genetically engineered to utilize xylose; and providing xylose to the diol-producing organism genetically engineered to utilize xylose; thereby producing diol.
[0066] Also disclosed is a process for producing diol, comprising: providing an organism; genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing an organism genetically engineered to utilize xylose; genetically engineering the organism to produce diol, thereby producing an organism genetically engineered to produce diol and utilize xylose; and providing xylose to the organism genetically engineered to produce diol and utilize xylose; thereby producing diol.
[0067] In such processes, the diol can be 1,3 -propanediol, 1,4-butanediol, 1,5- pentanediol, or 1,6-hexanediol.
[0068] Also disclosed herein is a process for producing diacid, comprising: providing an organism capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source; genetically engineering the organism to produce diacid, thereby producing an xylose-utilizing organism genetically engineered to produce diacid; and providing xylose to the xylose-utilizing organism genetically engineered to produce diacid; thereby producing diacid.
[0069] In an additional aspect, the invention discloses a process for producing diacid, comprising: providing an organism capable of producing diacid; genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing a diacid-producing organism genetically engineered to utilize xylose; and providing xylose to the diacid-producing organism genetically engineered to utilize xylose; thereby producing diacid.
[0070] A further aspect discloses a process for producing diacid, comprising: providing an organism; genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing an organism genetically engineered to utilize xylose; genetically engineering the organism to produce diacid, thereby producing an organism genetically engineered to produce diacid and utilize xylose; and providing xylose to the organism
genetically engineered to produce diacid and utilize xylose; thereby producing diacid.
[0071] In such processes, the diacid can be succinic acid, glutaric acid, and adipic acid.
[0072] Also disclosed herein is a process for producing higher alcohol, comprising: providing an organism capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source; genetically engineering the organism to produce higher alcohol, thereby producing an xylose-utilizing organism genetically engineered to produce higher alcohol; and providing xylose to the xylose-utilizing organism genetically engineered to produce higher alcohol; thereby producing higher alcohol.
[0073] In an additional aspect, the invention discloses a process for producing higher alcohol, comprising: providing an organism capable of producing higher alcohol; genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing a higher alcohol-producing organism genetically engineered to utilize xylose; and providing xylose to the higher alcohol-producing organism genetically engineered to utilize xylose; thereby producing higher alcohol.
[0074] A further aspect discloses a process for producing higher alcohol, comprising: providing an organism; genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing an organism genetically engineered to utilize xylose; genetically engineering the organism to produce higher alcohol, thereby producing an organism genetically engineered to produce higher alcohol and utilize xylose; and providing xylose to the organism genetically engineered to produce higher alcohol and utilize xylose;
thereby producing higher alcohol.
[0075] In such processes, the higher alcohol can be isopropanol or 1-propanol.
[0076] The organisms disclosed herein, and those used in the processes, can be Escherichia coli, Ralstonia eutropha, Acinetobacter baumannii, Acinetobacter baylyi, Acinetobacter aceti, Acinetobacter sp. O I, Acinetobacter calcoaceticus, Acinetobacter haemolyticus, Acinetobacter johnsonii, Acinetobacter junii,
Acinetobacter Iwoffii, Acinetobacter radioresistens, Acinetobacter venetianus, Acinetobacter sp. DSM, Zoogloea ramigera, Allochromatium vinosum,
Rhodococcus ruber, Delftia acidovorans, Aeromonas caviae, Synechocystis sp. PCC 6803, Synechococcus elongatus PCC 7942, Thiocapsa pfenigii, Bacillus
megaterium, Clostridium kluyveri, Methylobacterium extorquens, Nocardia corralina, Nocardia salmonicolor, Pseudomonas fluorescens, Pseudomonas oleovorans, Pseudomonas sp. 6-19, Pseudomonas sp.61-3 and Pseudomonas putida, Rhodobacter sphaeroides, Alcaligenes latus, Klebsiella oxytoca,
Anaerobiospirillum succiniciproducens, Actinobacillus succinogenes, Mannheimia succiniciproducens, Rhizobium etli, Bacillus subtilis, Corynebacterium glutamicum, Gluconobacter oxydans, Zymomonas mobilis, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, Clostridium acetobutylicum, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Kluyveromyces lactis, Kluyveromyces marxianus, Aspergillus terreus, Aspergillus niger, Pichia pastoris, Chlorella spp., Chlorella minutissima, Chlorella emersonii, Chlorella sorokiniana, Chlorella ellipsoidea, Chlorella sp., and Chlorella protothecoides.
[0077] It is understood that any of a number of genetic modifications, as disclosed herein, can be used alone or in various combinations of one or more of the genetic modifications in one or more pathways to utilize ethanol as a carbon source and produce polyhydroxyalkanoates, diols, diacids, higher alcohols and the like. It should be understood that this invention is not limited to the embodiments disclosed in this Summary, and it is intended to cover modifications that are within the spirit and scope of the invention, as defined by the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0078] Fig. 1 is a diagram showing the pathway for converting ethanol to acetyl- CoA, and the enzymes involved.
[0079] Fig. 2 is a graph showing growth curves of A. baylyi ADP1 wild-type strain (■) and its single gene knock-out mutants (AACIAD3339 (A) and
AACIAD2015 (·)) in lx E2 medium supplemented with 0.5% (v/v) ethanol.
[0080] Fig. 3 is a diagram showing the pathway from acetyl-CoA to poly-3- hydroxybutyrate (P3HB).
[0081] Fig. 4 is a diagram showing the pathway from acetyl-CoA and succinyl- CoA to poly-4-hydroxybutyrate (P4HB).
[0082] Fig. 5 is a diagram showing the pathway from acetyl-CoA to poly-Shy droxypropionate (P3HP).
[0083] Fig. 6 is a diagram showing the pathways from acetyl-CoA and lysine to poly-5 -hydroxy valerate (P5HV).
[0084] Fig. 7 is a diagram showing the pathways from acetyl-CoA and succinyl-
CoA to poly(3-hydroxybutyrate-co-4-hydroxybutyrate) (P(3HB-co-4HB)).
[0085] Fig. 8 is a diagram showing the pathways from acetyl-CoA and lysine to poly(3-hydroxybutyrate-co-5-hydroxyvalerate) (P(3HB-co-5HV)).
[0086] Fig. 9 is a diagram showing the pathway from acetyl-CoA to 1 ,4- butanediol.
[0087] Fig. 10 is a diagram showing the pathway from acetyl-CoA to isopropanol.
[0088] Fig. 11 is a diagram showing the pathway from dihydroxyacetone phosphate to 1-propanol.
[0089] Fig. 12 is a diagram showing the pathway from succinyl-CoA and acetyl- CoA to adipate.
DETAILED DESCRIPTION
[0090] Disclosed are organisms genetically engineered to make useful products when grown on ethanol as a carbon source. The organisms are genetically engineered to produce various useful products such as polyhydroxyalkanoates (including, but not limited to, polyglycolic acid (PGA), poly-3-hydroxybutyrate (P3HB), poly-3-hy droxypropionate (P3HP), poly-4-hydroxybutyrate (P4HB), poly- 5 -hydroxy valerate (P5HV), poly-(3-hydroxybutyrate-co-4-hydroxybutyrate) (P3HB- co-4HB), poly-3-hydroxybutyrate-co-3 -hydroxy valerate (P(3HB-co-3HV)), poly-(3- hydroxybutyrate-co-5-hydroxyvalerate) (P3HB-co-5HV)), or copolymers and mixtures of these polymers, diols (including, but not limited to, 1,3 -propanediol
(1.3PD), 1,4-butanediol (1,4BD), 1,5-pentanediol (1,5PD), 1,6-hexanediol (1.6HD)), and other chemicals, such as higher alcohols (e.g., isopropanol, 1-propanol) and diacids (e.g., adipic acid, glutaric acid, and succinic acid). The organisms are engineered to efficiently utilize ethanol (or in some cases xylose) as the carbon source to produce a product with a yield that is cost effective. In certain
embodiments, the yield of product from the ethanol carbon source is an increased yield that approaches the theoretic yield of the reaction. For example, the yield should be 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 100% of the theoretical yield. In certain aspects of the invention, the organism is modified to use ethanol as the energy source to product a desirable product without diverting energy to the conversion of undesirable products. Modification of the metabolic pathways or incorporation of metabolic pathways for grown on ethanol as the carbon source to increase production of polyhydroxyalkanoates or other end-products.
[0091] In one aspect, an organism that naturally produces such products can be engineered or selected to grow on ethanol as a carbon source. For instance,
Ralstonia eutropha is a microbe known to produce polyhydroxyalkanoates. As shown herein, such organisms can be altered so that they grow on ethanol as a carbon source. The polymers produced can be the polyhydroxyalkanoate polymer can be polyglycolic acid (PGA), poly-3-hydroxybutyrate (P3HB), poly-3- hydroxypropionate (P3HP), poly-4-hydroxybutryrate (P4HB), poly-5- hydroxyvalerate (P5HV), poly-3-hydroxybutyrate-co-4-hydroxybutyrate (P(3HB-co- 4HB)), poly-3-hydroxybutyrate-co-3 -hydroxy valerate (P(3HB-co-3HV)), or poly-3- hydroxybutyrate-co-5-hydroxyvalerate (P(3HB-co-5HV)), copolymers and mixtures of these polymers. The organism is genetically-engineered to use ethanol as a carbon source by introducing or altering enzymes in a pathway to convert ethanol to acetyl-coA.
[0092] In another aspect, organisms that are known to utilize ethanol as a carbon source (e.g. , Acinetobacter baylyi) can be engineered to produce
polyhydroxyalkanoates and other products as described above.
[0093] In still another aspect, organisms can be engineered to produce polyhydroxyalkanoates and other useful products, and also engineered to do so using ethanol as a carbon source (e.g., Escherichia coli).
[0094] Polyhydroxyalkanoates (PHAs) are biodegradable plastics which can be used to make, without limitation, films {e.g., packaging films, agricultural films, mulch film), golf tees, caps and closures, agricultural supports and stakes, paper and board coatings (e.g., for cups, plates, boxes, etc.), thermoformed products (e.g., trays, containers, yogurt pots, plant pots, noodle bowls, moldings, etc.), housings (e.g., for electronic items) bags (e.g., trash bags, grocery bags, food bags, compost bags, etc.), hygiene articles (e.g., diapers, feminine hygiene products, incontinence products, disposable wipes, etc.) and coatings including paints and varnishes as well as coatings for pelleted products (e.g., pelleted fertilizer, herbicides, pesticides, seeds, etc.).
[0095] PHAs have also been used to develop biomedical devices including sutures, repair devices, repair patches, slings, cardiovascular patches, orthopedic pins, adhesion barriers, stents, guided tissue repair/regeneration devices, articular cartilage repair devices, nerve guides, tendon repair devices, bone marrow scaffolds, and wound dressings.
[0096] Polyhydroxyalkanoates can be produced by a fermentation process.
Existing fermentation methods for producing polyhydroxyalkanoates utilize wild- type or transgenic microorganisms cultured on specific substrates to produce the desired PHA polymer composition. In many cases the polymers of interest are copolymers of the (D)-isomer of 3-hydroxybutyrate copolymerized with one other 3, 4 or 5-hydroxyacids. These copolymers are produced as granular inclusions inside the cells and are random copolymers. Mixtures of one or more copolymers or homopolymers or combination of these polyhydroxyalkanoate monomers are also contemplated herein.
[0097] PHAs, diols, diacids and higher alcohols are industrially useful. It is highly desirable to use non-petroleum renewable carbon substrates as feedstock for the production of PHAs, diols, diacids and higher alcohols both to lower cost and to provide materials that are made entirely from renewable resources. It is also
desirable to develop processes for the production of these products which reduce the production of greenhouse gasses. The methods described herein provide the process for producing PHAs, diols, diacids and higher acids from organisms that are naturally grown or genetically altered to use ethanol as a carbon source.
[0098] The term "PHA copolymer" refers to a polymer composed of at least two different hydroxyalkanoic acid monomers.
[0099] The term "PHA homopolymer" refers to a polymer that is composed of a single hydroxyalkanoic acid monomer.
[00100] As used herein, a "vector" is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. The vectors can be expression vectors.
[00101] As used herein, an "expression vector" is a vector that includes one or more expression control sequences.
[0102] As used herein, an "expression control sequence" is a DNA sequence that controls and regulates the transcription and/or translation of another DNA sequence.
[0103] As used herein, "operably linked" means incorporated into a genetic construct so that expression control sequences effectively control expression of a coding sequence of interest.
[0104] As used herein, "transformed" and "transfected" encompass the introduction of a nucleic acid into a cell by a number of techniques known in the art.
[0105] As used herein "overproduced" means that the particular compound is produced at a higher quantity in the engineered organism as compared to the non- engineered organism.
[0106] As used herein the terms "renewable feedstock", "renewable carbon substrate" and "renewable substrate" are all used interchangeably.
[0107] "Plasmids" are designated by a lower case "p" preceded and/or followed by capital letters and/or numbers.
[0108] As used herein, the term "heterologous" means that a gene or gene fragment encoding a protein is obtained from one or more sources other than the genome of the species within which it is ultimately expressed. The source can be natural, e.g., the gene can be obtained from another source of living matter, such as
bacteria, yeast, fungi and the like, or a different species of plant. The source can also be synthetic, e.g., the gene or gene fragment can be prepared in vitro by chemical synthesis. "Heterologous" can also be used in situations where the source of the gene fragment is elsewhere in the genome of the plant in which it is ultimately expressed.
[0109] As used herein, to say that an organism is "homologously" capable of a biochemical reaction, means that the organism naturally possesses the genetic and cellular machinery to undertake the stated reaction. For instance, an organism that is homologously capable of converting ethanol to acetyl-CoA is an organism that naturally is capable of doing so. Similarly, an organism that is homologously capable of producing polyhydroxyalkanoate polymer is an organism that is naturally capable of producing such polymers.
[0110] A "diol" is a chemical compound containing two hydroxyl (-OH) groups.
[0111] A "diacid" or dicarboxylic acid, is an organic compound that contains two carboxylic acid functional groups. These groups are often written as HOOC-R- COOH, where R may be an alkyl, alkenyl, alkynyl, or aryl group. Dicarboxylic acids can make up copolymers such as polyesters.
[0112] A "higher alcohol" (or secondary alcohol) is an alcohol containing more than two carbons.
[0113] As used herein "yield" refers to the amount of product per amount of carbon source (g/g or wt/wt). The maximal theoretical yield calculated by various techniques provides the greatest (maximum) yield (wt/wt) for any given biochemical process from carbon source to end-product. See below for examples.
Synthesis of Polyhydroxyalkanoate
[0114] During the mid-1980's, several research groups were actively identifying and isolating the genes and gene products responsible for PHA synthesis. These efforts led to the development of transgenic systems for production of PHAs in both microorganisms and plants, as well as enzymatic methods for PHA synthesis. Such routes could increase further the available PHA types. These advances have been
reviewed in Williams & Peoples, CHEMTECH, 26:38-44 (1996) and Williams & Peoples, Chem. Br. 33:29-32 (1997).
[0115] Methods which can be used for producing PHA polymers suitable for subsequent modification to alter their rates of degradation are described, for example, in U.S. Pat. No. 4,910,145 to Holmes, et al. ; Byrom, "Miscellaneous Biomaterials" in Biomaterials (Byrom, Ed.), pp. 333-59 (MacMillan Publishers, London 1991); Hocking & Marchessault, "Biopolyesters" in Chemistry and
Technology of Biodegradable Polymers (Griffin, Ed.), pp. 48-96 (Chapman and Hall, London 1994); Holmes, "Biologically Produced (R)-3-hydroxyalkanoate Polymers and Copolymers," in Developments in Crystalline Polymers (Bassett Ed.), vol. 2, pp. 1-65 (Elsevier, London 1988); Lafferty et al, "Microbial Production of Poly-b-hydroxybutyric acid" in Biotechnology (Rehm & Reed, Eds.) vol. 66, pp. 135-76 (Verlagsgesellschaft, Weinheim 1988); Muller & Seebach, Angew. Chem. Int. Ed. Engl. 32:477-502 (1993); Steinbuchel, "Polyhydroxyalkanoic Acids" in Biomaterials (Byrom, Ed.), pp. 123-213 (MacMillan Publishers, London 1991); Williams & Peoples, CHEMTECH, 26:38-44, (1996); Steinbuchel & Wiese, Appl. Microbiol Biotechnol, 37:691-697 (1992); U.S. Pat. Nos. 5,245,023; 5,250,430; 5,480,794; 5,512,669; and 5,534,432; Agostini, et al, Polym. Sci, PartA-1, 9:2775- 87 (1971); Gross, et al, Macromolecules, 21 :2657-68 (1988); Dubois, et al, Macromolecules, 26:4407-12 (1993); Le Borgne & Spassky, Polymer, 30:2312-19 (1989); Tanahashi & Doi, Macromolecules, 24:5732-33 (1991); Hori, et al , Macromolecules, 26:4388-90 (1993); Kemnitzer, et al, Macromolecules, 26:1221- 29 (1993); Hori, et al, Macromolecules, 26:5533-34 (1993); Hocking, et al, Polym. Bull , 30:163-70 (1993); Xie, et al, Macromolecules, 30:6997-98 (1997); U.S. Pat. No. 5,563,239 to Hubbs; U.S. Pat. Nos. 5,489,470 and 5,520,116 to Noda, et al. The PHAs derived from these methods may be in any form, including a latex or solid form.
[0116] Identification, cloning and expression of the genes involved in the biosynthesis of PHAs from several microorganisms within recombinant organisms allow for the production of PHAs within organisms that are not native PHA producers. A preferred example is E. coli, which is a well-recognized host for
production of biopharmaceuticals, and PHAs for medical and other applications. Such recombinant organisms provide researchers with a greater degree of control of the PHA production process because they are free of background enzyme activities for the biosynthesis of unwanted PHA precursors or degradation of the PHA.
Additionally, the proper selection of a recombinant organism may facilitate purification of, or allow for increased biocompatibility of, the produced PHA.
Ethanol as a Feedstock
[0117] Biofuels, predominantly ethanol, dominate the production of biobased products worldwide. Although there is considerable interest in producing more advanced biofuels from renewable resources by far the simplest to produce is ethanol. Currently ethanol is produced at a scale of over 20 billion gallons per year through a combination of the fermentation of corn in the United States and sugar from sugarcane in Brazil. There is considerable effort to extend ethanol production to other renewable feedstocks including biomass such as straw, bagasse and wood as well as dedicated energy crops for example Sorghum, switchgrass, miscanthus and elephant grass. The use of these renewable resources has the potential to improve the overall energy balance of ethanol production and to separate biofuel production from the direct use of food crops. The overall economics of biomass based biorefineries will be dramatically improved by producing value added co-products including biobased chemicals and bioplastics in addition to biofuels such as ethanol. Clearly integrated biomass biorefineries based on cellulose hydrolysate technologies will optimize the separation of sugar feedstocks to maximize the product yields and economic and energy values. For this reason it is likely that some biomass biorefineries will produce only a mixed sugar stream containing primarily glucose (C6) and xylose (C5), whereas others will deploy different pre-treatment and hydrolysis conditions which enable the production of separate C6 and C5 streams. In the case of separate streams, the C6 stream can be readily converted to ethanol using existing industrial yeast strains without further genetic engineering. This then requires that the C5 sugar stream, which will contain at least 60%, 70%, 80%, 90%), 95%), 99%) xylose has an end use consistent with the quantities that would typically
be produced. As a general estimate a typical biomass facility producing separate sugar streams would produce around 1 ton of C5 sugars for every 3-5 tons of C6 sugars. A particularly attractive use of the clean C5 stream would be for the production of polyhydroxyalkanoate polymers, copolymers, diols, diacids and higher alcohols in microbes that are genetically engineered to produce these products as taught in the examples herein by replacing the ethanol feed with xylose (C5) sugars.
[0118] In addition there are efforts to produce ethanol directly from carbon dioxide using photosynthetic organisms including algae and cyanobacteria. Another source of carbon which is being developed is the use of waste streams such as municipal solid waste which can be converted to syngas (carbon monoxide, carbon dioxide and hydrogen) and then fermented to ethanol. Collectively these efforts to produce ethanol from renewable or waste carbon resources have the potential to make renewable resource based ethanol a very low cost high volume commodity feedstock which has many advantages for the production of other value added fermentation products in biorefmeries. Ethanol production is well suited to using a wide range of relatively impure or complex feedstocks including for example dry mill corn or cellulose hydrolysate because it is volatile and hence readily recovered from complex fermentation broths through simple distillation. Microorganisms have been developed to produce ethanol from the complex sugar mixtures produced by the hydrolytic or thermal breakdown of cellulose and lignocellulose. These feedstocks typically contain both 5 carbon (C5, mostly xylose), and 6 carbon (C6, mostly glucose) sugars in the mix. In some biorefmery settings with for example wood based feedstocks it is relatively straightforward to separate the feedstocks to produce separate C5 and C6 feed streams. This opens the possibility of using these streams to produce different end products through fermentation. The C6 stream is well suited to the traditional ethanol process using industrial yeast strains. The C5 stream can be used separately to produce other value added biobased products such as for example the PHA polymers, diols, diacids, and higher alcohols described herein. Ethanol produced from the mixed C6 sugars can then also be used to practice the invention disclosed herein.
[0119] There are a number of advantages to being able to use ethanol over sugar as a feedstock for microbes producing polyhydroxyalkanoates and other chemicals. "Sugar" is actually a large class of compounds, of wildly varying types,
concentrations, and purities. Ethanol' s concentration and purity are more standardized and easily ascertainable than that of any sugar. Ethanol is already a standardized and widely transported feedstock in a number of industrial processes, and it is more logistically available than sugar. Ethanol also has a longer shelf life than sugar. Sugar cannot be sterilized when in solid form, so it must be dissolved in water for sterilization prior for introduction to the microbes. In contrast, ethanol is an alcohol, and is therefore self-sterilizing, and at certain concentrations, can be added to unsterilized water to produce a self-sterilizing sterile feedstock. To be added to a fermentation tank, sugar must first be dissolved in water. Adding it to a fermenter therefore increases the volume within the vessel after it is consumed by the microbes, as the residual water is left behind. In contrast, ethanol is already in liquid form, and adding it does not contribute additional water and volume to a fermenter after it is consumed. Use of ethanol in fed-batch fermentation processes may be especially advantageous in this regard, as it can be added over time, both reducing the risk of toxicity to the microbes, and obviating the need for a larger fermentation vessel.
[0120] Ethanol may be a more expensive feedstock for microbes than sugar, but the secondary costs associated with using sugar (shorter shelf life, sterilization requirements, and addition of diluent water to the fermentation tanks), may easily outweigh those costs. Moreover, production of ethanol is becoming less expensive as new industrial processes are refined. Having ethanol as a feedstock option for microbes producing polyhydroxyalkanoates and other chemicals therefore allows one to choose feedstocks in light of market availability and price.
[0121] A quantitative decision tree can be used for fermentation feedstock selection. Cost of a feedstock is a primary concern which drives the economic feasibility of a process. In general, the cost of a feedstock i ( ) is related to the price of the feedstock i (P,) and the yield of the product P from that feedstock (Yp/i), such that:
Ci =—L- (Equation - 1)
YP/i
[0122] For the substrates ethanol (E) and dextrose sugar (S), the equations read:
CE = -—— (Equation - 2)
YP/B
Cs = - ^- (Equation - 3)
YP/S
[0123] In some cases, the direct cost of the substrate is insufficient to capture the total cost of the system. In particular, the purity of the feedstock, feedstock concentration, byproducts, capital utilization, and the local availability of the resource dictate external costs which are not captured.
[0124] In comparing the cost parameters presented in Equations 2 and 3, a discount fraction (fois) must be applied to capture the externalities. This variable represents the magnitude of the discount related to using the new feedstock. The range of the variable is 0 to 1, where a discount fraction of 0 represents no discount and a fraction of 1 represents a complete discount.
[0125] The cost ratio (Rc) is created to quantitatively determine the feedstock choice between two alternatives. This parameter is calculated in Equation - 4, with dextrose sugar as the base feedstock choice and ethanol as the new feedstock choice.
Rc (Equation - 4)
[0126] If the cost ratio (Rc) is above 1 , the costs increase when using the new feedstock and the base feedstock should be chosen. If the cost ratio is below 1, the costs decrease when using the new feedstock and the new feedstock should be chosen. At a cost ratio equal to one, the scenarios are equal and a decision is not determined.
[0127] One can also conduct an in silico analysis (model) of the biochemical networks for the production of Escherichia coli biomass from ethanol as a carbon source. A variety of techniques have been used by those of ordinary skill in the art to construct and simulate model biochemical networks for the purposes of calculating the maximum theoretical yield.
[0128] In planning the examples presented herein, a biochemical network was constructed using reactions annotated to known examples of Escherichia coli
models, including model compositions for the biomass components (Edwards J, Ibarra R, Palsson BO, Nat. Biotech. 19:125-130 (2001); Reed JL, VO TD, Schilling CH, Palsson BO, Genome Biology. 4:R54 (2003)). The biochemical network was supplemented with additional reactions known to accommodate the utilization of ethanol, as described in Table 1.
[0129] A variety of analytical techniques were used to analyze this network for the maximum theoretical yield of biomass and biomass components from ethanol based on principles of mass and energy conservation (Clarke BL, J. Chem. Phys. 75:4970-4979 (1981); Roels JA, Energetics and kinetics in biotechnology, Elsevier, New York (1983); Reder C, J. Theor. Biol. 135: 175-201 (1988); Schuster R, Schuster S, CABIOS 9:79-85 (1993)), including: thermodynamic free energy evaluation, extreme pathway analysis (Schilling CH, Letscher D, Palsson B, J. Theor. Biol. 203:229-248 (2000)), elementary mode analysis (Schuster S, Hilgetag S, J. Biol. Syst. 2: 165-182 (1994); Schuster S, Dandekar T, Fell DA, Trends Biotechnology 17:53-60 (1999)), and flux balance analysis (Edwards J, Ibarra R, Palsson BO, Nat. Biotech. 19: 125-130 (2001)).
[0130] These in silico scenarios indicated that supplementation of the E. coli network with the aforementioned reactions for the incorporation of ethanol is sufficient for growth on ethanol. The maximum theoretical yield was calculated as 0.72 (wt/wt) E. coli biomass per ethanol.
[0131] As shown in the examples below, ethanol-degrading genes can be identified from microbes capable of growing on ethanol as a carbon source, and transformed into E. coli, thus creating a strain of E. coli capable of growing on ethanol as a carbon source. This strain can then be further engineered to produce various useful products such as polyhydroxyalkanoates (including, but not limited to, polyglycolic acid (PGA), poly-3-hydroxybutyrate (P3HB), poly-3- hydroxypropionate (P3HP), poly-4-hydroxybutyrate (P4HB), poly-5- hydroxyvalerate (P5HV), poly-(3-hydroxybutyrate-co-4-hydroxybutyrate) (P3HB- co-4HB), poly-(3-hydroxybutyrate-co-5-hydroxyvalerate) (P3HB-co-5HV)), diols (including, but not limited to, 1,3 -propanediol (1,3PD), 1 ,4-butanediol (1,4BD), 1,5- pentanediol (1,5PD), 1,6-hexanediol (1,6HD)), and other chemicals.
[0132] Acinetobacter baylyi is capable of growing on ethanol as a carbon source (see Example 1), and is therefore a candidate source of ethanol-degrading genes. However, publicly-available information on the metabolic pathways in A. baylyi provides conflicting information regarding the pathways involved in ethanol degradation. The database "MetaCyc" provides the following pathway: alcohol aldehyde acetyl- dehydrogenas dehydrogenas CoA
e e synthetas
e
ethano ~ acetaldehyd acetat acetyl
1 e e -CoA
In contrast, the database "AcinetoCyc" provides the following pathway: alcohol aldehyde dehydrogenase dehydrogenase
ethanol ~^ acetaldehyde acetyl-
CoA
[0133] Corymb acterium glutamicum also grows on ethanol as a carbon source, and its two ethanol utilizing genes were used to search for corresponding genes in A. baylyi, revealing ACIAD3339 and ACIAD2018 (Example 2). When Acinetobacter baumanii was grown on ethanol, its two most up-regulated genes were identified, and used to search for corresponding genes in A. baylyi. This search revealed ACIAD2015 and ACIAD2018 (Example 2). ACIAD2018 was found to be the aldehyde dehydrogenase gene (ACIAD2018), but the identity of the alcohol dehydrogenase was still not clear. Additional experiments (Examples 3, 4) showed that ACIAD2015 was the ethanol dehydrogenase gene, and that the AcinetoCyc pathway was correct, while the MetaCyc pathway was not.
[0134] These genes were then cloned into broad host-range plasmids (Example 5). These plasmids were then used in conjunction with other plasmids to engineer host microorganisms to successfully utilize ethanol as a carbon source to make various useful products, including P3HB (Example 6), P4HB (Example 7), P3HP
(Example 8), P4HV (Example 9), P3HB-co-4HB (Example 10), and P3HB-co-5HV (Example 1 1).
Suitable Host Strains
[0135] Recombinant organisms having enzymes for the biochemical pathways to convert ethanol to acetyl-CoA, and/or to produce useful products such as PHAs, diols, diacids, and higher alcohols, are provided. Host strains are genetically engineered to express the enzymes necessary to accomplish the metabolism of ethanol as a substrate, and the production of such useful products.
[0136] The host strain can be a bacterium, a fungus, an alga, or other microbe. Organisms of cells that can be modified for production of PHAs, diols, diacids and higher alcohols include prokaryotes and eukaryotes. Suitable prokaryotes include bacteria.
[0137] The host strain can be, for example, Escherichia coli. In certain embodiments, the host strain is E. coli -12 strain LS5218 (Spratt et al. , J.
Bacteriol. 146 (3):1166-1169 (1981); Jenkins and Nunn, J. Bacteriol. 169 (l):42-52 (1987)) or DH5a (Raleigh et al, In: Ausubel et al, (Eds.) Current Protocols in Molecular Biology, p. 14 New York: Publishing Associates and Wiley Interscience (1989)). Other suitable E. coli K-12 host strains include, but are not limited to, MG1655 (Guyer et al, Cold Spr. Harb. Symp. Quant. Biol. 45:135-140 (1981)), WG1 and W3110 (Bachmann Bacteriol. Rev. 36(4):525-57 (1972)). Alternatively, E. coli strain W (Archer et al, BMC Genomics 2011, 12:9 doi:10.1186/1471-2164- 12-9) or E. coli strain B (Delbruck and Luria, Arch. Biochem. 1 : 111-141 (1946)) and their derivatives such as REL606 (Lenski et al, Am. Nat. 138: 1315-1341 (1991)) are other suitable E. coli host strains.
[0138] Other exemplary microbial host strains include but are not limited to: Ralstonia eutropha, Acinetobacter baumannii, Acinetobacter baylyi, Acinetobacter aceti, Acinetobacter sp. DR1, Acinetobacter calcoaceticus, Acinetobacter haemolyticus, Acinetobacter johnsonii, Acinetobacter junii, Acinetobacter Iwoffii, Acinetobacter radioresistens, Acinetobacter venetianus, Acinetobacter sp. DSM, Zoogloea ramigera, Allochromatium vinosum, Rhodococcus ruber, Delftia
acidovorans, Aeromonas caviae, Synechocystis sp. PCC 6803, Synechococcus elongatus PCC 7942, Thiocapsa pfenigii, Bacillus megaterium, Clostridium kluyveri, Methylobacterium extorquens, Nocardia corralina, Nocardia
salmonicolor, Pseudomonas fluorescens, Pseudomonas oleovorans, Pseudomonas sp. 6-19, Pseudomonas sp.61-3 and Pseudomonas putida, Rhodobacter
sphaeroides, Alcaligenes latus, Klebsiella oxytoca, Anaerobiospirillum
succiniciproducens, Actinobacillus succinogenes, Mannheimia succiniciproducens, Rhizobium etli, Bacillus subtilis, Corynebacterium glutamicum, Gluconobacter oxydans, Zymomonas mobilis, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, and Clostridium acetobutylicum.
[0139] Exemplary yeasts or fungi include species selected from Saccharomyces cerevisiae, Schizosaccharomyces pombe, Kluyveromyces lactis, Kluyveromyces marxianus, Aspergillus terreus, Aspergillus niger and Pichia pastoris.
[0140] These include organisms that already produce polyhydroxyalkanoates, modified to utilize alternative substrates or incorporate additional monomers, or to increase production, and organisms that do not produce polyhydroxyalkanoates, but which express none to some of the enzymes required for production of
polyhydroxyalkanoates. R. eutropha is an example of an organism which produces PHAs naturally. E. coli and C. glutamicum are examples of organisms where it would be necessary to introduce transgenes which encode the enzymes for PHA production.
Source of Recombinant Genes
[0141] Sources of encoding nucleic acids for an ethanol utilizing pathway enzyme can include, for example, any species where the encoded gene product is capable of catalyzing the referenced reaction. Such species include both prokaryotic and eukaryotic organisms including, but not limited to, bacteria (including archaea and eubacteria), and eukaryotes (including yeast, plant, insect, animal, and mammal, including human). Exemplary species for such sources include, for example, Acinetobacter species, including Acinetobacter baumannii, Acinetobacter baylyi, Acinetobacter aceti, Acinetobacter sp. DR1, Acinetobacter calcoaceticus,
Acinetobacter haemolyticus, Acinetobacter johnsonii, Acinetobacter junii,
Acinetobacter Iwoffli, Acinetobacter radioresistens, Acinetobacter venetianus, Acinetobacter sp. DSM, and Corynebacterium species, including Corynebacterium glutamicum, Corynebacterium diphtheriae , Corynebacterium xerosis,
Corynebacterium striatum, Corynebacterium minutissimum, Corynebacterium amycolatum, Corynebacterium glucuronolyticum, Corynebacterium argentoratense, Corynebacterium matruchotii, Corynebacterium afermentans subsp. afermentans, Corynebacterium auris, Corynebacterium pseudodiphtheriticum, Corynebacterium propinquum, Corynebacterium jeikeium, Corynebacterium urealyticum,
Corynebacterium afermentans subsp. lipophilum, Corynebacterium accolens, Corynebacterium macginleyi, Corynebacterium bovis, and Methylibium
petroleiphilum PM1, Escherichia colt, Saccharomyces cerevisiae, Saccharomyces kluyveri, Clostridium kluyveri, Clostridium acetobutylicum, Clostridium beijerinckii, Clostridium saccharoperbutylacetonicum, Clostridium perfringens, Clostridium difficile, Clostridium botulinum, Clostridium tyrobutyricum, Clostridium
tetanomorphum, Clostridium tetani, Clostridium propionicum, Clostridium aminobutyricum, Clostridium subterminale, Clostridium sticklandii, Ralstonia eutropha, Mycobacterium bovis, Mycobacterium tuberculosis, Porphyromonas gingivalis, Arabidopsis thaliana, Thermus thermophilus, Pseudomonas species, including Pseudomonas aeruginosa, Pseudomonas putida, Pseudomonas stutzeri, Pseudomonas fluorescens, Chlorella minutissima, Chlorella emersonii, Chlorella sorokiniana, Chlorella ellipsoidea, Chlorella sp., Chlorella protothecoides, Homo sapiens, Oryctolagus cuniculus, Rhodobacter spaeroides, Thermoanaerobacter brockii, Metallosphaera sedula, Leuconostoc mesenteroides, Chloroflexus aurantiacus, Roseiflexus castenholzii, Erythrobacter, Simmondsia chinensis, Porphyromonas gingivalis, Sulfolobus tokodaii, Sulfolobus solfataricus, Sulfolobus acidocaldarius, Bacillus subtilis, Bacillus cereus, Bacillus megaterium, Bacillus brevis, Bacillus pumilus, Rattus norvegicus, Klebsiella pneumonia, Klebsiella oxytoca, Euglena gracilis, Treponema denticola, Moorella thermoacetica,
Thermotoga maritima, Halobacterium salina rum, Geobacillus stearothermophilus, Aeropyrum pernix, Sus scrofa, Caenorhabditis elegans, Corynebacterium
glutamicum, Acidaminococcusfermentans, Lactococcus lac tis, Lactobacillus plantarum, Streptococcus thermophilus, Enterobacter aerogenes, Candida,
Aspergillus terreus, Pedicoccus pentosaceus, Zymomonas mobilus, Acetobacter pasteurians, Kluyveromyces lactis, Eubacterium barkeri, Bacteroides capillosus, Anaerotruncus colihominis, Natranaerobius thermophilusm, Campylobacter jejuni, Haemophilus influenzae, Serratia marcescens, Citrobacter amalonaticus,
Myxococcus xanthus, Fusobacterium nuleatum, Penicillium chrysogenum marine gamma proteobacterium.
[0142] For example, microbial hosts (e.g., organisms) having the capability to utilize ethanol as a carbon source are exemplified herein with reference to an E. coli host. However, with the complete genome sequence available for now more than 550 species (with more than half of these available on public databases such as the NCBI), including 395 microorganism genomes and a variety of yeast, fungi, plant, and mammalian genomes, the identification of genes encoding the requisite ethanol utilization activity for one or more genes in related or distant species, including for example, homologues, orthologs, paralogs and non-orthologous gene displacements of known genes, and the interchange of genetic alterations between organisms is routine and well known in the art. Accordingly, the metabolic alterations enabling production of PHA and chemicals from ethanol as a carbon source described herein with reference to a particular organism such as E. coli can be readily applied to other microorganisms, including prokaryotic and eukaryotic organisms alike. Given the teachings and guidance provided herein, those skilled in the art will know that a metabolic alteration exemplified in one organism can be applied equally to other organisms.
Production of Transgenic Hosts
[0143] Transgenic (recombinant) hosts capable of utilizing ethanol as a carbon source are genetically engineered using conventional techniques known in the art. The genes cloned and/or assessed for host strains producing PHA and chemicals are presented below in Table 1 A, along with the appropriate Enzyme Commission number (EC number) and references. Some genes can be synthesized for codon
optimization or can be cloned via PCR from the genomic DNA of the native or wild- type host. As used herein, "heterologous" means from another host. The host can be the same or different species.
[0144] Fig. 1 is a schematic diagram showing the biochemical reaction from ethanol to acetyl-coenzyme A (Acetyl-CoA).
Table 1 A. Genes in microbial host strains using ethanol as a carbon source.
Reaction Enzyme Name EC Accession No.
number Number
(Fig. 1)
1 alcohol 1.1.1.1 ACIAD2015
dehydrogenase
2 acetaldehyde 1.2.1.10 ACIAD2018
dehydrogenase
(acetylating)
[0145] Other proteins capable of catalyzing the reactions listed in Table 1 A can be discovered by consulting the scientific literature, patents or by BLAST searches against e.g. nucleotide or protein databases at NCBI (www.ncbi.nlm.nih.gov/). Synthetic genes can then be created to provide an easy path from sequence databases to physical DNA. Such synthetic genes are designed and fabricated from the ground up, using codons to enhance heterologous protein expression, optimizing
characteristics needed for the expression system and host. Companies such as e.g. DNA 2.0 (Menlo Park, CA 94025, USA) will provide such routine service. Proteins that may catalyze some of the biochemical reactions listed in Table 1 A are provided in Tables IB and 1C.
Table IB. Suitable homologues for the Adh protein (alcohol dehydrogenase, from A. baylyi ADP 1 ; EC No. 1.1.1.1, which acts on an alcohol such as ethanol to produce an aldehyde such as acetaldehyde; protein acc. no. ACIAD2015).
Protein Name Protein Accession
No.
alcohol dehydrogenase P33010
alcohol dehydrogenase Q64413
alcohol dehydrogenase Q70UP6
alcohol dehydrogenase P49385
alcohol dehydrogenase Q6LCE4
alcohol dehydrogenase Q4J781
alcohol dehydrogenase Q3Z550
alcohol dehydrogenase P85440
alcohol dehydrogenase P25141
alcohol dehydrogenase P04707
Table 1C. Suitable homologues for the Aldl protein (acetaldehyde dehydrogenase (acetylating), from /1 baylyi ADPl, EC No. 1.2.1.10, which acts on acetaldehyde to produce acetyl-CoA; protein acc. no. ACIAD2018).
Protein Name Protein Accession
No.
acetaldehyde dehydrogenase (acetylating) C1DMT1
acetaldehyde dehydrogenase (acetylating) A5V6T7
acetaldehyde dehydrogenase (acetylating) Q0S9X0
acetaldehyde dehydrogenase (acetylating) Q764S1
acetaldehyde dehydrogenase (acetylating) A4XAK8
acetaldehyde dehydrogenase (acetylating) A1UM81
acetaldehyde dehydrogenase (acetylating) A0R4S7
acetaldehyde dehydrogenase (acetylating) Q79AF6
acetaldehyde dehydrogenase (acetylating) B9LCM0
acetaldehyde dehydrogenase (acetylating) D1WHZ7
Suitable Extrachromosomal Vectors and Plasmids
[0146] A "vector," as used herein, is an extrachromosomal replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. Vectors vary in copy number and depending on the origin of their replication they contain, in their size, and the size of insert. Vectors with different origin of replications can be propagated in the same microbial cell unless they are closely related such as pMBl and ColEl .
Suitable vectors to express recombinant proteins can constitute pUC vectors with a pMBl origin of replication having 500-700 copies per cell, pBluescript vectors with a ColEl origin of replication having 300-500 copies per cell, pBR322 and derivatives with a pMBl origin of replication having 15-20 copies per cell, pACYC and derivatives with a pi 5 A origin of replication having 10-12 copies per cell, and pSClOl and derivatives with a pSClOl origin of replication having 2-5 copies per cell as described in the QIAGEN® Plasmid Purification Handbook ( found on the world wide web at:
//kirshner.med.harv ard.edu/files/protocols/QIAGEN_QIAGENPlasmidPurification_ EN.pdf). Another useful vector is the broad host-range cloning vector pBBRlMCS with a pBBRl origin of replication and its derivatives that contain different antibiotic resistance cassettes (Kovach et al, Gene 166: 175-176 (1995)). These vectors are compatible with IncP, IncQ and IncW group plasmids, as well as with ColEl- and pl5A-based replicons.
Suitable Strategies and Expression Control Sequences for Recombinant Gene Expression
[0147] Strategies for achieving expression of recombinant genes in E. coli have been extensively described in the literature (Gross, Chimica Oggi 7(3):21 -29 (1989); Olins and Lee, Cur. Op. Biotech. 4:520-525 (1993); Makrides, Microbiol. Rev. 60(3):512-538 (1996); Hannig and Makrides, Trends in Biotech. 16:54-60 (1998)). Expression control sequences can include constitutive and inducible promoters,
transcription enhancers, transcription terminators, and the like which are well known in the art. Suitable promoters include, but are not limited to, Piac, Ptac, Ptrc PR, PL, Ptrp, PphoA, Para, PusPA, PrspU, Ptet, P Syn (Rosenberg and Court, Ann. Rev. Genet.
13:319-353 (1979); Hawley and McClure, Nucleic Acids Res. 11 (8):2237-2255 (1983); Harley and Raynolds, Nucleic Acids Res. 15:2343-2361 (1987); also ecocyc.org and partsregistry.org).
Construction of Recombinant Hosts
[0148] Recombinant hosts containing the necessary genes that will encode the enzymatic pathway for the conversion of a carbon substrate such as e.g. ethanol to PHA and chemicals may be constructed using techniques well known in the art.
[0149] Methods of obtaining desired genes from a source organism (host) are common and well known in the art of molecular biology. Such methods can be found described in, for example, Sambrook et al, Molecular Cloning: A Laboratory Manual, Third Ed., Cold Spring Harbor Laboratory, New York (2001); Ausubel et al. , Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, MD (1999). For example, if the sequence of the gene is known, the DNA may be amplified from genomic DNA using polymerase chain reaction (Mullis, U.S. Pat. No. 4,683,202) with primers specific to the gene of interest to obtain amounts of DNA suitable for ligation into appropriate vectors. Alternatively, the gene of interest may be chemically synthesized de novo in order to take into consideration the codon bias of the host organism to enhance heterologous protein expression. Expression control sequences such as promoters and transcription terminators can be attached to a gene of interest via polymerase chain reaction using engineered primers containing such sequences. Another way is to introduce the isolated gene into a vector already containing the necessary control sequences in the proper order by restriction endonuclease digestion and ligation. One example of this latter approach is the BIOBRICK™ technology (see the world wide web at biobricks.org) where multiple pieces of DNA can be sequentially assembled together in a standardized way by using the same two restriction sites.
[0150] In addition to using vectors, genes that are necessary for the enzymatic conversion of a carbon substrate such as e.g. ethanol to PHA and chemicals can be introduced into a host organism by integration into the chromosome using either a targeted or random approach. For targeted integration into a specific site on the chromosome, the method generally known as Red/ET recombineering is used as originally described by Datsenko and Wanner (Proc. Natl. Acad. Sci. USA, 97:6640- 6645 (2000)). Random integration into the chromosome involved using a mini-Tn5 transpo son-mediated approach as described by Huisman et al. (US Patent Nos. 6,316,262 and 6,593,116).
[0151] Using the engineering methods described herein, one of ordinary skill in the art can (1) start with an organism capable of growing on ethanol as a carbon source and engineer it to make useful products as described herein, (2) start with an organism capable of making useful products and engineer it to be capable of growing on ethanol as a carbon source, or (3) start with an organism, and engineer it to be capable of growing on ethanol as a carbon source and engineer it to make useful products as described herein.
[0152] For instance, one can start with an organism such as Acinetohacter baylyi, which is known to utilize ethanol as a carbon source, and engineer it according to methods described herein to make useful products. Alternatively, one can start with an organism such as Ralstonia eutropha, which is known to make polyhydroxyalkanoate polymers, and engineer it as described herein to grow on ethanol as a carbon source. Also shown below are microbes that neither use ethanol nor make polyhydroxyalkanoates naturally, and are engineered to utilize ethanol as a carbon source and make polyhydroxyalkanoates and other useful products.
[0153] Methods of culturing such engineered organisms to produce useful products are known in the art. To make some products, co-feeds besides ethanol may be required, for instance, depending on the pathway(s) engineered into the organism, a co-feed of propionate or propanol may be required to produce polymers containing 3-hydroxyvalerate. For polymers containing 4-hydroxybutyrate, a co- feed of 1 ,4-butanediol or gamma butyrolactone may be needed. For copolymers
containing 5-hydroxyvalerate, a co-feed of 5-hydroxyvalerate or 1,5-pentanediol could be required.
EXAMPLES
Example 1. Growth of Acinetobacter baylyi ADPl on Ethanol
[0154] This example shows the ability of Acinetobacter baylyi ADPl utilizing ethanol as a carbon source.
[0155] A single colony of A. baylyi ADPl was inoculated into 3 mL of LB medium (1.0% Tryptone, 0.5% Yeast Extract, 1.0% NaCl, pH 7.0) and grown over night in an orbital shaker at 37°C. Thirty μΕ of the preculture was then transferred into the production medium which consisted of lx E2 minimal salts solution containing 2 mM MgS04, lx Trace Salts Solution and 0.1% (v/v) of ethanol. 5Qx E2 stock solution consists of 1.275 M NaNH4HP04 H20, 1.643 M K2HP04, and 1.36 M KH2P04. lOOOx stock Trace Salts Solution is prepared by adding per 1 L of 1.5 N HCL: 50 g FeSO4-7H20, 11 g ZnS04-7H20, 2.5 g MnS04-4H20, 5 g
CuS04-5H20, 0.5 g (ΝΗ4)6Μο7024·4Η2Ο, 0.1 g Na2B407, and 10 g CaCl2-2H20.
[0156] The doubling time was calculated to be about 30 min and reached a final OD6oo of 1.15 demonstrating that A. baylyi ADPl contains genes that enable growth on ethanol as a carbon source.
Example 2. Identification of Putative Ethanol Utilizing Genes in Acinetobacter
[0157] Publicly-available metabolic databases provided conflicting information regarding the pathway for converting ethanol to acetyl-CoA.
[0158] Examination of MetaCyc, a database of nonredundant, experimentally elucidated metabolic pathways containing more than 1600 pathways from more than 2000 different organisms ( found at http://metacyc.org/), indicated that three biochemical reactions in A. baylyi ADPl convert ethanol to acetyl-CoA: (a) ethanol to acetaldehyde using an alcohol dehydrogenase (EC 1.1.1.1), (b) acetaldehyde to acetate using an aldehyde dehydrogenase (EC 1.2.1.3), and (c) acetate to acetyl-CoA using an acetyl-CoA synthetase (EC 6.2.1.1). In contrast, examination of
AcinetoCyc, a pathway genome database dedicated to A. baylyi ADPl (found on the
world wide web at genoscope.cns.fr/acinetocyc), indicated that only two
biochemical reactions are required: (a) ethanol to acetaldehyde using an alcohol dehydrogenase (EC 1.1.1.1) and (b) acetaldehyde to acetyl-CoA using an acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10). \Table 2 provides an overview of the gene candidates as identified by MetaCyc and AcinetoCyc. Since both public pathway databases indicate different biochemical reactions and multiple annotated gene candidates, it is unclear which reactions and genes enable cell growth on ethanol as a carbon source.
Table 2. Gene candidates for ethanol degradation listed by MetaCyc and AcinetoCyc
EC number and MetaCyc Gene Candidates AcinetoCyc Gene Candidates Enzyme Name
1.1.1 , 1 ACIAD3339 (adhA) ACIAD3339 (adhA) alcohol ACIAD1950 ACIAD1950 dehydrogenase ACIAD2015 ACIAD2015
ACIAD2929 ACIAD2929
1.2.1.3 ACIA2018 (aldl) NA
Aldehyde ACIAD0131
dehydrogenase ACIAD2542
1.2.1.10 NA ACIA2018 (aldl) Acetaldehyde ACIA3616 (air A) dehydrogenase
(acetylating)
6.2.1.1 ACIAD3475 (acs) NA
acetate-CoA ACIAD1606
ligase ACIAD1611
[0159] Corynebacterium glutamicum was shown to be able to grow on ethanol as a carbon source and the two ethanol-utilizing genes were identified as Cg3107 encoding ethanol dehydrogenase (EC 1.1.1.1) and Cg3096 encoding aldehyde dehydrogenase (EC 1.2.1.3) (Arndt and Eikmanns, J. Bacteriol. 189(20):7408-7416
(2007)); Auc ter et al., J. Biotechnol 140:84-91 (2009); Amdt et al. , J. Mol.
Microbiol. Biotechnol. 15:222-233 (2008)). BLASTP searches (Altschul, J Mol. Biol. 219:555-65 (1991)) using the protein sequences of Cg3107 and Cg3096 against the protein sequences of A. baylyi ADPl identified ACIAD3339 and ACIAD2018, respectively, as best hits for ethanol dehydrogenase and aldehyde dehydrogenase.
[0160] Global gene expression profiles of the pathogenic A. baumannii were analyzed under ethanol-induced pathogenesis and compared to glucose growth conditions (Camarena et al, PLoS Pathog. 6(4):el000834.
doi: 10.1371/journal.ppat.1000834). The two most up-regulated genes under ethanol- induced conditions were A1S_2098 and A1S_2102, which are annotated as ethanol dehydrogenase and aldehyde dehydrogenase, respectively. BLASTP searches using the protein sequences of A1S_2098 and A1S_2102 against the protein sequences of A. baylyi ADPl identified ACIAD2Q15 and ACIAD2018 as best hits for alcohol dehydrogenase and aldehyde dehydrogenase, respectively.
[0161] From these two lines of experimental evidence, it seems clear that ACIAD2018 is the best candidate for aldehyde dehydrogenase. But it remains unclear which alcohol dehydrogenase enables growth on ethanol, ACIAD3339 or ACIAD2015.
Example 3. Identification of Alcohol Dehydrogenase in baylyi ADPl by Gene Knock-Out
[0162] In order to experimentally verify which of the two alcohol
dehydrogenase genes from A. baylyi ADPl (ACIAD3339 or ACIAD 2015) is responsible for growth on ethanol as a carbon source, individual gene knock-outs of ACIAD3339 and ACIAD2015 were constructed.
[0163] The coding sequences of the native genes were replaced by the kanamycin resistance marker using well known molecular biology techniques as described by Metzgar et al. {Nucleic Acids Res. 32:5780-5790 (2004)) and de Berardinis et al. {Mol. Syst. Biol. 4:174; doi: 10.1038/msb.2008.10. (2008); Young et al., Annu. Rev. Microbiol. 59:519-551 (2005)). The two gene knock-out strains were first grown over night in 3 mL tubes containing LB medium (see Example 1 for
composition) supplemented with 50 ug/mL kanamycin at 37°C and then inoculated at a 1 :100 dilution into lx E2 medium supplemented with 0.5% ethanol and 50 ug/mL kanamycin. Both E2 medium and trace elements are described in Example 1. As a control, the wild-type strain was included.
[0164] The growth profile is shown in Fig. 2 and shows that only the deletion of ACIAD2015 exhibited a measurable growth defect on ethanol with a longer lag phase and a lower final OD600. This result indicates that more than one alcohol dehydrogenase enables growth on ethanol and that ACIAD2015 seems to be more important for ethanol degradation than ACIAD3339.
Example 4. Heterologous Expression of Putative Alcohol Degradation Genes in E. coli
[0165] In this example, the alcohol dehydrogenase and aldehyde dehydrogenase gene combinations of ACIAD3339 + ACIAD2018 and ACIAD2015 + ACIAD2018 were tested against each other. As shown below, it was found that ACIAD2015 and ACIAD2018 support growth on ethanol as a carbon source.
[0166] The two A. baylyi ADP1 genes ACIAD3339 and ACIAD2018 were cloned into a vector in E. coli and expressed from the Ptet promoter. This plasmid was constructed in a three step process. First, the ACIAD3339 and ACIAD2018 genes were PCR-amplified individually from a genomic DNA preparation from A. baylyi ADP1 using primers ZZ212/ZZ213 yielding PCR product 1 and
ZZ214/ZZ215 yielding PCR product 2, respectively (Table 3). Primers ZZ212 and ZZ215 were designed to incorporate BamHI and BspHI restriction sites,
respectively, on their 5' ends. The sequences of primers ZZ213 and ZZ214 are reverse-complementary so that the sequences of 39 bps of 3 '-end ACIAD3339 fragment (PCR product 1) and 39 bps of 5 '-end ACIAD2018 fragment (PCR product 2) were the same. Following the method of Murphy et al, {Gene 246:321- 330 (2000)), the two DNA fragments were sewed together by PCR simply using small amounts of PCR products 1 and 2 as template without additional primers, yielding PCR product 3. Finally, the PCR product 3 containing the two amplified ACIAD3339 and ACIAD2018 genes in an operon was digested with BamHI and
BspHI and ligated to pJB78, a pACYC184 derivative vector (Farmer et al, US Patent Application No. 2010/0168481 Al) that had been digested with the same enzymes, thus creating plasmid pZZ9 which expressed the ACIAD3339 and
ACIAD2018 genes in an operon under the control of the constitutive Ptet promoter.
Table 3. Primers used in Example 4.
Primer Sequence (5'→ 3')
ZZ212 CCCGGATCCAGGAGGTTTTTATGGGAAGTTTAATGAAAGC (SEQ ID NO: 1) ZZ213 TCGATATAACGCATAAAAACCTCCTTTAGAGTTTAAGGTCAATCA (SEQ ID NO:
2)
ZZ214 ACCTTAAACTCTAAAGGAGGTTTTTATGCGTTATATCGATCCTAA (SEQ ID NO: 3) ZZ215 CCCTCATGATTAGAAGAAGCCCATTGGTT (SEQ ID NO: 4)
ZZ226 CCCGACGTCAGGAGGTTTTTATGGCTTTTAAAAATATTGCTGACC (SEQ ID NO: 5) ZZ227 AACGCATAAAAACCTCCTTCTAGGTTTAC AATGCTGCTGTGAAAA(SEQ ID NO :
6)
ZZ228 ATTGTAAACCTAGAAGGAGGTTTTTATGCGTT ATATCGATCCTAA(SEQ ID NO:
7)
ZZ229 GGGCCCGGGTTAGAAGAAGCCCATTGGTTTTGTT (SEQ ID NO: 8)
[0167] Plasmid pZZ9 was transformed into E. coli strain DH5cc and the resulting strain was first grown in LB supplemented with 25 μg/mL chloramphenicol over night at 37°C and was then inoculated 1 : 100 into lx E2 minimal medium
supplemented with 0.1% (v/v) ethanol and 25 μg/mL chloramphenicol at 37°C. Both E2 medium and trace elements are described in Example 1. After 24 h of incubation no measurable cell growth was detected.
[0168] Since the two A. baylyi ADP1 genes ACIAD3339 and ACIAD2018 did not support growth on ethanol as a carbon source, the two A. baylyi ADP1 genes ACIAD2015 and ACIAD2018 were cloned. This plasmid was made similarly as pZZ9. First, the ACIAD2015 and ACIAD2018 genes were PCR-amplified individually from a genomic DNA preparation using primers ZZ226/ ZZ227 yielding PCR product 1 and ZZ228/ZZ229 yielding PCR product 2, respectively. Primers ZZ226 and ZZ229 were designed to incorporate Aatll and Xmal restriction sites, respectively, on their 5' ends. The sequences of primers ZZ227 and ZZ228 are
reverse-complementary so that the sequences of 32 bps of 3'-end ACIAD2015 fragment (PCR product 1) and 32 bps of 5'-end ACIAD2018 fragment (PCR product 2) were the same. Following the method of Murphy et ah, (Gene 246:321- 330 (2000)), the two DNA fragments were sewed together by PCR simply using small amounts of PCR products 1 and 2 as template without additional primers, yielding PCR product 3. Finally, the PCR product 3 containing the two amplified ACIAD2015 and ACIAD2018 genes in an operon was digested with Aatll and Xmal and ligated to pJB78 that had been digested with the same enzymes. The resulting plasmid expressed the ACIAD2015 and ACIAD2018 genes in an operon under the control of the constitutive Ptei promoter.
[0169] The plasmid was transformed into E. coli strain DH5a and two clones were tested for their ability to grow on ethanol as a carbon source. The strains were first grown in LB supplemented with 25 μg/mL chloramphenicol over night at 37°C and were then inoculated 1 : 100 into lx E2 minimal medium supplemented with 0.1% (v/v) ethanol and 25 ^g/mL chloramphenicol at 37°C. After 24 h of incubation one clone (clone 6) reached an OD6oo of 0.3 whereas, surprisingly, the other one (clone 7) reached on OD600 of 1.25. DNA sequence analysis confirmed that clone 6 exhibited the correct DNA sequence of the cloned ethanol-utilizing genes. However, clone 7 contained a deletion in the Shine-Dalgarno (SD) sequence of ACIAD2015. The intended SD sequence of ACIAD2015 in clone 6 was 5'-AGGAGG-3', whereas the mutated SD sequence of ACIAD2015 in clone 7 was 5'-AG_AGG-3'. The plasmid of clone 7 was named pZZIO and the plasmid of clone 6 was named pZZ12.
Example 5. Cloning of Ethanol Degradation Genes into Broad Host-Range Plasmids
[0170] To enable production of various PHA and chemicals in E. coli and various other microbes, the ethanol-degradation genes ACIAD2015 and
ACIAD2018 were cloned into the broad host-range vector pBBRlMCS and its derivatives (Kovach et ah , Gene 166:175-176 (1995)). Plasmids pZZ17, pZZ18 and pZZ22 were made by first PCR-amplifying the terACIAD2015-ACIAD2Q18 operon from plasmid pZZIO using primers ZZ235 and ZZ236, which were designed
to incorporate Sail and Sacl restriction sites on their 5' ends, respectively. The resulting PCR product was digested with Sail and Sacl and ligated to similarly digested broad host-range vectors pSS7 (kanamycin-resistant (Km)) creating pZZ17, to pBBRlMCS-4 (ampicillin-resistant (ApR)) (GenBank Accession No. U25060) creating pZZ18, and to pBBRlMCS (chloramphenicol-resistant (CmR)) (GenBank Accession No. U02374) creating pZZ22, respectively. Vector pSS7 (KmR) was made by PCR-amplification of the kan cassette from pKD4 (Datsenko and Warmer, Proc. Natl, Acad. Sci. USA. 97:6640-6645 (2000)) with primers SS62 and SS63 (Table 4), which were engineered to introduce ApaLI and Seal restriction sites, respectively. Then the PCR product was digested with ApaLI and Seal and cloned into pBBRlMCS-4 (ApR) vector that were digested with the same enzymes to generate pSS7 (KmR). Plasmid pZZ23 was constructed by first PCR-amplifying the PterACIAD2015-ACIAD2018 operon from plasmid pZZIO using primers ZZ268 and ZZ236, which contains Xbal and Sacl restriction sites on their 5' ends, respectively. The resulting PCR product was digested with Xbal and Sacl and ligated to similarly digested broad host-range vector pBBRlMCS-3 (tetracycline- resistant (TcR)) (GenBank accession No. U25059) creating pZZ23. All these broad host-range plasmids containing the different antibiotic resistances are compatible with ColEl- and pl5A-based replicons (Kovach, et al , Gene 166:175-176 (1995)).
Table 4. Primers used in Example 5.
Primer Sequence (5'→ 3')
5562 ATGCGTGCACGTGTAGGCTGGAGCTGCTTC (SEQ ID NO: 9)
5563 ATGCAGTACTATGGGAATTAGCCATGGTCC (SEQ ID NO: 10) ZZ235 CCCGTCGACAATTCTCATGTTTGACAGCTT (SEQ ID NO: 1 1 ) ZZ236 CCCGAGCTCTTAGAAGAAGCCCATTGGTTT (SEQ ID NO: 12) ZZ268 CCCTCTAGAAATTCTCATGTTTGACAGCTT (SEQ ID NO: 13)
Example 6. P3HB Production From Ethanol as A Carbon Source in
Recombinant E. coli Cells
[0171] This example shows poly-3-hydroxybutyrate (P3HB) production from ethanol as a carbon source in recombinant E. coli cells. The pathway from acetyl- CoA to P3HB is shown in Fig. 3, and involves the phaA5, phaB5 and phaC3/C5 genes to convert acetyl-CoA to acetoacetyl-CoA (via beta-ketothiolase (PhaA5)), acetoacetyl-CoA to 3-hydroxybutyryl-CoA (via acetoacetyl-CoA reductase
(PhaBs)), and 3-hydroxybutyryl-CoA to P3HB (via PHA synthase (PhaC3/C5)).
[0172] To produce P3HB from ethanol as a carbon source in recombinant E. coli cells, a derivative strain of LS5218 (Jenkins and Nunn, J. Bacteriol. 169:42-52 (1987)) was used that expressed the phaA^, phaBs and phaC^/Cs genes as described previously by Huisman et al. (US Patent No. 6,316,262). To enable growth on ethanol as the carbon source, plasmid pZZ18 containing the PterACIAD2015- ACIAD2018 operon in pBBRlMCS-4 (ApR) was transformed into this strain, resulting in strain MBX4900. These gene modifications and host strains are shown in Tables 5 and 6, below.
Table 5. Microbial strain used to produce P3HB from ethanol as sole carbon source.
Strain Relevant host genome modifications MBX4900 P 12-phaA 5-phaB5-kan; phaC3/C5-cat
Table 6. Genes in microbial host strains producing P3HB.
Gene Enzyme Name EC Reference
Name Number
phaA5 β-ketoacyl-CoA thiolase 2.3.1.9 US Patent No. 6,316,262 phaBs acetoacetyl-CoA reductase 1.1.1.36 US Patent No. 6,316,262 phaC3/C5 Polyhydroxyalkanoate 2.3. l .n US Patent No. 6,316,262 synthase fusion protein
[0173] To examine production of 3HB homopolymer from ethanol, strain MBX4900 was cultured for 7h in a sterile tube containing 3 mL of LB supplemented
with 100 μg/mL ampicillin and 25 μg/mL chloramphenicol. Then 60 μΐ^ was added to a sterile tube containing 3 niL of lx E2 medium supplemented with 1.0% (v/v) ethanol and 100 μg/mL ampicillin and 25 μg/mL chloramphenicol. Both E2 medium and trace elements are described in Example 1. The tube cultures were incubated over night with shaking at 250 rpm at 37°C. From this, 25 \i was added as seeds in triplicate to Duetz deep-well shake plate wells containing 475 μΐ, of lx E2 medium supplemented with 2.0% (v/v) ethanol and 100 μg/mL ampicillin and 25 μg/mL chloramphenicol. The cells were grown for 6h at 37°C followed by 42h at 30°C with shaking at 250 rpm. Thereafter, production well sets were combined (1.5 mL total) and analyzed for polymer content. At the end of the experiment, cultures were spun down at 4150 rpm, washed twice with distilled water, frozen at -80°C for at least 30 minutes, and lyophilized over-night. The next day, a measured amount of lyophilized cell pellet was added to a glass tube, followed by 3 mL of butanolysis reagent that consisted of an equal volume mixture of 99.9% n-butanol and 4.0 N HCl in dioxane with 2 mg/mL diphenylmethane as internal standard. After capping the tubes, they were vortexed briefly and placed on a heat block set to 110°C for 3h with periodic vortexing. Afterwards, the tube was cooled down to room temperature before adding 3 mL distilled water. The tube was vortexed for approximately 10 s before spinning down at 620 rpm (Sorvall Legend RT benchtop centrifuge) for 2 min. One mL of the organic phase was transferred into a GC vial, which was then analyzed by gas chromatography-flame ionization detection (GC-FID) (Hewlett- Packard 5890 Series II).
[0174] The quantity of P3HB homopolymer in the cell pellet was determined by comparing against standard curves that were made by adding defined amounts of P(3HB) (Aldrich Chemical Co., Milwaukee WI) in separate butanolysis reactions. Four 3HB standards ranging from 0.5-10 mg were used to create the standard curves. Strain MBX4900 produced a total biomass titer of 3.96±0.07 g/L from 2.0% (v/v) of ethanol, containing 32.19±1.45 % (dry cell weight (dew)) of P3HB.
Example 7. P4HB Production From Ethanol as a Carbon Source in
Recombinant E. coli Cells
[0175] This example illustrates poly-4-hydroxybutyrate (P4HB) production from ethanol as the carbon source in recombinant E. coli cells. The pathway from acetyl- CoA to P4HB is shown in Fig. 4. Acetyl-CoA is naturally converted to succinyl- CoA by the organism, and so no engineering is required to convert acetyl-CoA to succinyl-CoA. The pathway from succinyl-CoA to P4HB includes the conversion of succinyl-CoA to succinate semialdehyde (via succinyl-CoA oxidoreductase), succinate semialdehyde to 4-hydroxybutyrate (via succinate semialdehyde
reductase), 4-hydroxybutyrate to 4-hydroxybutyrate-CoA (via CoA transferase), and 4-hydroxybutyrate-CoA to P4HB (via PHA synthase).
[0176] To produce P4HB from ethanol as a carbon source in recombinant E. coli cells, a derivative strain of LS5218 was used that contains chromosomal deletions of the native genes gabD and ynel and expresses a CoA-transferase gene orfZ from Chlostridium kluyveri. Single null gabD and ynel mutants were constructed as described by Farmer et al. (US Patent Application No. 2010/0168481 Al) and used the Red/ET recombineering method originally described by Datsenko and Wanner (Proc. Natl. Acad. Sci. USA 97:6640-6645 (2000)), a method well known for those skilled in the art. Expression of orfZ involved a mini-Tn5 transposon-mediated approach described by Huisman et al. (US Patent Nos. 6,316,262 and 6,593,116). To produce P4HB from ethanol, 3 plasmids were individually transformed into strain LS5218 resulting in strain MBX4978 that expressed the recombinant genes outlined in Table 7. The source of the recombinant genes is listed in Table 8.
Table 7. Microbial strain used to produce P4HB from ethanol as a carbon source. A star (*) after the gene name denotes that the nucleotide sequence was optimized for expression in E. coli.
Relevant host genome Genes overexpressed from a Plasmid origin of
Strain
modifications plasmid replication
Psynl-SUCD *-ssaRAt* ColEl (ApR)
Aynel AgabD Prpsu-
MBX4978 Ptet-phaCl pi 5 A (CmR) οτβ
Pter ACIAD2015-ACIAD2018 pBBRl (KmR)
Table 8. Genes in microbial host strains producing P4HB and 4HB copolymer. A star (*) after the gene name denotes that the nucleotide sequence was optimized for expression in E. coli.
Gene Enzyme EC Accessio
Nam Name Numbe n No. e r
sucD* Succinate 1.2.1.76 YP_001396394 semialdehyde
dehydrogenase
ssaRA * Succinic 1.1.1.61 AAK94781 semialdehyde
reductase
Οΐβ CoA transferase 2.8.3.n AAA92344 phaCl Polyhydroxyalkanoat 2.3. l .n YP_725940
. e synthase
ynel Succinate- 1.2.1.24 NP_416042 semialdehyde
dehydrogenase,
NADP+-dependent
gabD Succinate- 1.2.1.16 NP_417147 semialdehyde
dehydrogenase,
NADP+-dependent
[0177] To produce P4HB from ethanol, strain MBX4978 was grown in a 53h shake plate assay. The seeds culture was prepared the same way as described in Example 6. The production medium consisted of lx E2 minimal salts solution containing 3.0% (v/v) of ethanol, lx Trace Salts Solution and appropriate antibiotics (100 μg/mL ampicillin, 25 μg/mL chloramphenicol and 50 μg/mL kanamycin). Both E2 medium and trace elements are described in Example 1. At the end of the growth
phase, the biomass and P4HB titers were determined as described previously (Van Walsem et al , International Publication No. WO/2011/100601). The P4HB content was measured by gas chromatography-flame ionization detection (GC-FID)
(Hewlett-Packard 5890 Series II) and the identity of the 4HB monomer was further confirmed by GC-MS (Agilent GC model 6890N and Agilent MS model 5973).
[0178] Strain MBX4978 produced a total biomass titer of 2.59±0.02 g/L from 3.0% (v/v) of ethanol, containing 0.48±0.02 % (dew) of P4HB.
Example 8. P3HP Production From Ethanol as a Carbon Source in
Recombinant E. coli Cells
[0179] This example demonstrates poly-3-hydroxypropionate (P3HP)
production from ethanol as a carbon source in recombinant E. coli cells. This pathway is shown in Fig. 5, and involves the conversion of acetyl-CoA to malonyl- CoA (via acetyl-CoA carboxyltransferase), malonyl-CoA to 3-hydroxypropionate (via malonyl-CoA reductase), 3-hydroxypropionate to 3-hydroxypropionyl-CoA (via CoA transferase), and 3-hydroxypropyl-CoA to P3HP (via PHA synthase).
[0180] To produce P3HP from ethanol as a carbon source in recombinant E. coli cells, a derivative strain of LS 5218 was used harboring 2 plasmids resulting in strain MBX4938 that expressed the recombinant genes outlined in Table 9. The sources of the recombinant genes are listed in Table 10.
Table 9. Microbial strain used to produce P3HP from ethanol as a carbon source. A star (*) after the gene name denotes that the nucleotide sequence was optimized for expression in E, coli.
Relevant host genome Genes overexpressed from a Plasmid origin of
Strain
modifications plasmid replication
Ptrc-mcr*-phaC3/Cl * ColEl (ApK)
MBX4938 Prpsu- rfZ
PfcrACIAD2015-ACIAD2018 pBBRl (KmR)
Table 10. Genes in microbial host strains producing P3HP. A star (*) after the gene name denotes that the nucleotide sequence was optimized for expression in E. coli.
Gene Name Enzyme Name EC Accession No. or Reference
Number
mcr* malonyl-CoA reductase 1.1.1.298 Q6QQP7; Gene ID 001 phaC3/Cl* Polyhydroxyalkanoate 2.3.1.n Van Walsem et al. , synthase fusion protein International Application Nc
PCT/US 11/024612
[0181] To produce P3HP from ethanol, strain MBX4938 was grown in a 103h
shake plate assay. The seeds culture was prepared the same way as described in
Example 6. The production medium consisted of lx E2 minimal salts solution
containing either 2.0% or 3.0% (v/v) of ethanol, lx Trace Salts Solution, O.lmM
IPTG and appropriate antibiotics (100 μg/mL ampicillin and 50 μg/mL kanamycin).
The initial ethanol concentration was 2.0% (v/v) for both, but 1.0% (v/v) ethanol
was added at 27 h for one of the cultures. Both E2 medium and trace elements are
described in Example 1. At the end of the growth phase, the biomass and P3HP
titers were determined as described previously (Skraly and Peoples, US Patent No.
6,329,183).
[0182] Strain MBX4938 produced a total biomass titer of 0.73±0.21 g/L from
2.0% (v/v) ethanol, containing 2.83±0.79 % (dew) of P3HP. From 3.0% (v/v) of
ethanol, strain MBX4938 produced a total biomass titer of 1.99±0.06 g/L,
containing 0.38±0.07 % (dew) of P3HP.
Example 9. P5HV Production From Ethanol as a Carbon Source in
Recombinant E. coli Cells
[0183] This example demonstrates poly-5 -hydroxy valerate (P5HV) production from ethanol as a carbon source in recombinant E. coli cells. The pathway from
acetyl-CoA to P5HV is illustrated in Fig. 6. The organisms naturally convert acetyl- CoA to lysine from the TCA cycle intermediate oxaloacetate (OAA) via the lysine biosynthesis pathway. Lysine is then converted to 5-aminopentanamide (via lysine
2-monooxygenase (EC 1.13.12.2)), 5-aminopentanamide to 5-aminopentanoate (via 5-aminopentanamidase {a.k.a, delta-aminovaleramidase (EC 3.5.1.30))), 5- aminopentanoate to glutarate semialdehyde (via 5-aminopentanoate transaminase {a.ka, delta-aminovalerate transaminase (EC 2.6.1.48))), glutarate semialdehyde to 5-hydroxyvalerate (via glutarate semialdehyde reductase {a.ka, 5-glutarate semialdehyde reductase (EC 1.1.1.61))), 5-hydroxyvalerate to 5 -hydroxy valeryl- CoA (via CoA transferase (EC 2.8.3.n))), and 5-hydroxyvaleryl-CoA to P5HV (via PHA synthase (EC 2.3.1 ,n)). Although the organisms naturally make lysine from acetyl-CoA, this conversion can be enhanced, as was done in Farmer et al. , US Patent Application No. 2010/0168481 Al.
[0184] To produce P5HV from ethanol as a carbon source in recombinant E. coli cells, plasmid pZZ18, expressing the terACIAD2015-ACIAD2018 in pBBRlMCS- 4 (ApR), was transformed into MBX3342 [pJG22, pJB91] (Farmer et al., US Patent Application No. 2010/0168481 Al). The resulting strain was designated MBX4994. The strain and the genes expressed in the strain are shown in Tables 11 and 12, below.
Table 11. Microbial strain used to produce P5HV from ethanol as sole carbon source. A star (*) after the gene name denotes that the nucleotide sequence was optimized for expression in E. coli.
Relevant host Plasmid origin
Genes overexpressed from a
genome of replication plasmid
modifications
Ptrc-phaCl -ssaR t *-orfZ- ColEl (Gm )
Psynl -dapAaS2T
MBX4994 Aynel AgabD PompA-davB-davA-davT pl5A (CmK)
Ptet-ACIAO2015- pBBRl (ApR) ACIAD2018
Table 12. Genes in microbial host strains producing P5HV and 5HV copolymer. A star (*) after the gene name denotes that the nucleotide sequence was optimized for expression in E. coli.
Gene Enzyme EC Accessio
Nam Name Numbe n No. e r
dapAC3S2T dihydrodipicplinate 4.2.1.52 NP_416973 synthase
davB lysine 2- 1.13.12.2 BAG54787 monooxygenase
davA 5- 3.5.1.30 BAG54788 aminopentanamidase
davT 5-aminopentanoate 2.6.1.48 AAK97868 transaminase
ssaR-At* Succinic 1.1.1.61 AAK94781 semialdehyde
reductase
ονβ CoA transferase 2.8.3.n AAA92344 phaCl Polyhydroxyalkanoat 2.3. l .n YP_725940 e synthase
ynel Succinate- 1.2.1.24 NP_416042 semialdehyde
dehydrogenase,
NAD+-dependent
gabD Succinate- 1.2.1.16 NP_417147 semialdehyde
dehydrogenase,
NADP+-dependent
[0185] To produce P5HV from ethanol, strain MBX4994 was grown in a shake tube assay for 96 h. The seeds culture was prepared the same way as described in
Example 6. The production medium consisted of lx E2 minimal salts solution containing 0.5% (v/v) of ethanol, lx Trace Salts Solution, O. lmM IPTG and appropriate antibiotics (100 μg/mL ampicillin, 25 μg/mL chloramphenicol and 30 μg/mL gentamycin). Both E2 medium and trace elements are described in Example 6. At the end of the growth phase, the biomass and P5HV titers were determined as described previously (Farmer et al, US Patent Application No. 2010/0168481 Al). The P5HV content was measured by gas chromatography-flame ionization detection (GC-FID) (Hewlett-Packard 5890 Series II) and the identity of the 5HV monomer was further confirmed by GC-MS (Agilent GC model 6890N and Agilent MS model 5973.
[0186] Strain MBX4994 produced a total biomass titer of 0.72 g/L from 0.5% (v/v) of ethanol, containing 1.45 % (dew) of P5HV.
Example 10. P(3HB-co-4HB) Production From Ethanol as a Carbon Source in Recombinant E. coli Cells
[0187] This experiment demonstrates the production of poly-(3- hydroxybutyrate-co-4-hydroxybutyrate) (P(3HB-co-4HB)) copolymer in a recombinant E, coli strain from ethanol as a carbon source. These pathways are illustrated in Fig. 7. 3-hydroxybutyryl-CoA is made from acetyl-CoA, and 4- hydroxybutyryl-CoA from succinyl-CoA. The organisms naturally convert between acetyl-CoA and succinyl-CoA via the TCA cycle. To make 3-hydroxybutyryl-CoA from acetyl-CoA, acetyl-CoA is converted to acetoacetyl-CoA (via beta-ketothiolase (phaA)), acetoacetyl-CoA to 3-hydroxybutyryl-CoA (via acetoacetyl-CoA reductase iphaB)), and 3-hydroxybutyryl-CoA to P(3HB-co-4HB) (via PHA synthase (phaQ). To make 4-hydroxybutyryl-CoA from succinyl-CoA, succinyl-CoA is converted to succinate semialdehyde (via succinyl-CoA oxidoreductase), succinate semialdehyde to 4-hydroxybutyrate (via succinate semialdehyde reductase), and 4-hydroxybutyrate to 4-hydroxybutyrate-CoA (via CoA transferase). PHA synthase then combines the two to make P(3HB-co-4HB).
[0188] To produce P(3HB-co-4HB) from ethanol as a carbon source in recombinant E. coli cells, a derivative of strain LS5218 was used that harbored 3
plasmids, resulting in strain MBX4998 that expressed the recombinant genes outlined in Table 13. The sources of the recombinant genes are listed in Tables 8 and 14.
Table 13. Microbial strain used to produce P(3HB-co-4HB) from ethanol as a carbon source. A star (*) after the gene name denotes that the nucleotide sequence was optimized for expression in E. coli.
Plasmid origin of
Relevant host
Genes overexpressed from replication genome
a plasmid (antibiotic modifications
resistance)
Psynl-SUCD *-ssaRAt* ColEl (Ap )
Aynel AgabD
Ptet-phaCl pi 5 A (CmR)
MBX4998 PrpSu-orfZ Pyfdz- iVACIAD2015- pBBRl (TcR) bktB-phaB
ACIAD2018
Table 14. Genes in microbial host strains producing P(3HB-co-4HB) copolymer.
Gene Name Enzyme Name EC Number Accession No.
bktB β-ketothiolase 2.3.1.9 AAC38322 phaB acetoacetyl-CoA 1.1.1.36 AAD05259
reductase
[0189] To produce P(3HB-co-4HB) copolymer from ethanol, strain MBX4998 was grown in a 43 h shake plate assay. The seeds culture was prepared the same way as described in Example 6. The production medium consisted of lx E2 minimal salts solution containing either 1.0% or 2.0% (v/v) of ethanol, lx Trace Salts Solution, O.lmM IPTG and appropriate antibiotics (100 μg/mL ampicillin, 25 μg/mL chloramphenicol and 15 μg/mL tetracycline). The initial ethanol concentration was 1.0% (v/v) for both, but 1.0% (v/v) ethanol was added at 28 h for one of the cultures. Both E2 medium and trace elements are described in Example 1. At the end of the growth phase, the biomass and PHA titers, and 3HB and 4HB compositions in PHA,
were determined as described previously (Van Walsem et al. , International Application No. PCT US 11/024612).
[0190] Strain MBX4998 produced a total biomass titer of 1.53±0.09 g/L from 1.0% (v/v) ethanol, containing 8.23±1.83 % (dew) copolymer. The copolymer contained 96.90±1.14 (% PHA) of 3HB and 3.10±1.14 (% PHA) of 4HB. From 2.0% (v/v) of ethanol, strain MBX4998 produced a total biomass titer of 2.56±0.13 g/L, containing 21.66±0.88 % (dew) copolymer. The copolymer contained
97.33±0.09 (% PHA) of 3HB and 2.67±0.09 (% PHA) of 4HB.
Example 11. P(3HB-co-5HV) Production From Ethanol as a Carbon Source in Recombinant E. coli Cells
[0191] This experiment demonstrates the production of poly-(3- hydroxybutyrate-co-5-hydroxyvalerate) (P(3HB-co-5HV)) copolymer in a recombinant E. coli strain from ethanol as a carbon source. These pathways are illustrated in Fig. 8. 3-hydroxybutyryl-CoA is made from acetyl-CoA, and 5- hydroxyvaleryl-CoA from lysine. The organisms naturally convert between acetyl- CoA and oxaloacetate (OAA) via the TCA cycle. Lysine is being naturally produced from the TCA cycle intermediate OAA via the lysine biosynthesis pathway. To make 3-hydroxybutyryl-CoA from acetyl-CoA, acetyl-CoA is converted to acetoacetyl-CoA (via beta-ketothiolase (phaA)), acetoacetyl-CoA to 3- hydroxybutyryl-CoA (via acetoacetyl-CoA reductase (phaB)), and 3- hydroxybutyryl-CoA to P(3HB-co-4HB) (via PHA synthase (pha ). To make 5- hydroxyvaleryl-CoA from lysine, lysine is converted to 5-aminopentanamide (via lysine 2-monooxygenase (EC 1.13.12.2)), 5-aminopentanamide to 5- aminopentanoate (via 5-aminopentanamidase (a.ka, delta-aminovaleramidase (EC 3.5.1.30))), 5-aminopentanoate to glutarate semialdehyde (via 5-aminopentanoate transaminase (a.ka, delta-aminovalerate transaminase (EC 2.6.1.48))), glutarate semialdehyde to 5-hydroxyvalerate (via glutarate semialdehyde reductase (a.ka, glutarate semialdehyde reductase (EC 1.1.1.61))), 5-hydroxyvalerate to 5- hydroxyvaleryl-CoA (via Co A transferase (EC 2.8.3.n))). PHA synthase then
combines 3-hydroxybutyryl-CoA and 5-hydroxyvaleryl-CoA to make P(3HB-co- 5HV).
[0192] To produce P(3HB-co-5HV) from ethanol as a carbon source in recombinant E. coli cells, plasmid pZZ18, expressing i ter ACIAD2015-ACIAD2018 in pBBRlMCS-4 (ApR), was transformed into strain MBX3344 [pJG22, pJB91] (Farmer et al, US Patent Application No. 2010/0168481 Al). The resulting strain was designated MBX4995. The gene modifications in this strain are shown in Table 15, below.
Table 15. Microbial strain used to produce P(3HB-co-5HV) from ethanol as sole carbon source. A star (*) after the gene name denotes that the nucleotide sequence was optimized for expression in E. coli.
Relevant host genome Genes overexpressed from a Plasmid origin
Strain
modifications plasmid of replication
Ptrc-phaCl-ssaRAt*-orfZ-
ColEl (Gm )
Psynl-dapAas2T
Aynel, AgabD,
MBX4995 P ompA-davB-davA -dav T pi 5 A (CmK)
Pyfdz-bktB-phaB
P,erACIAD2015- pBBRl (Ap ) ACIAD2018
[0193] To produce P(3HB-co-5HV) copolymer from ethanol, strain MBX4995 was grown in a 76 h shake plate assay. The seed culture was prepared the same way as described in Example 6. The production medium consisted of lx E2 minimal salts solution containing either 1.0% or 2.0% (v/v) ethanol, lx Trace Salts Solution, O.lmM IPTG and appropriate antibiotics (100 μg/mL ampicillin, 25 μg/mL chloramphenicol and 30 μg/mL gentamycin). Both E2 medium and trace elements are described in Example 1. At the end of the growth phase, the biomass and PHA titers, and 3HB and 5HV compositions in PHA, were determined as described previously (Farmer et al. , US Patent Application No. 2010/0168481 Al).
[0194] Strain MBX4995 produced a total biomass titer of 1 ,46±0.13 g/L from 1.0%) (v/v) ethanol, containing 6.43±0.45 % (dew) copolymer. The copolymer
contained 82.49±0.99 (% PHA) of 3HB and 17.51±0.99 (% PHA) of 5HV. From 2.0% (v/v) of ethanol, strain MBX4995 produced a total biomass titer of 2.54±0.11 g/L, containing 13.30±1.09 % (dew) copolymer. The copolymer contained
66.43±2.39 (% PHA) of 3HB and 33.57±2.39 (% PHA) of 5HV.
Example 12. Growth of Other Microorganisms on Ethanol
[0195] This example describes how to enable growth on ethanol in
microorganisms that cannot naturally grow on ethanol as a carbon source. An exemplary microbe is Ralstonia eutropha, which makes polyhydroxyalkanoates naturally, but does not grow on ethanol as a carbon source. The broad host-range plasmid pZZ17 described in Example 5 that contained the PterACIAD2Q15- ACIAD2018 operon in pSS7 (KmR) was transformed into wild-type R. eutropha H- 16 obtained from the NCIMB culture collection (Accession No. 10442) using well known molecular biology techniques. The resulting strain MBX4914, along with its parent harboring no plasmid, were initially grown in Nutrient Broth (3 g/L beef extract, 5 g/L peptone) overnight at 30°C and then were diluted 1 : 100 into shake tubes containing 3 mL lx E2 minimal medium supplemented with either 0.1%) (v/v) or 1.0%) (v/v) ethanol and 50 μg/mL kanamycin. Both E2 medium and trace elements are described in Example 1. The parental R. eutropha H-16 strain did not show visible growth after 5 days whereas strain MBX4914 reached final OD6o0 of 1.25 and 6.24 using 0.1 % (v/v) and 1.0% (v/v) of ethanol, respectively, after 16 hours of growth at 30°C.
[0196] R. eutropha is a natural PHA-producer. To examine the PHA production from ethanol as a carbon source, recombinant R. eutropha HI 6 expressing the Pter ACIAD2015-ACIAD2018 operon would be cultured in lx E2 medium
supplemented with ethanol concentrations between 0.5-5.0%) (v/v) in an orbital shaker at 30°C. The amount of PHA produced is then measured by gas
chromatography-flame ionization detection (GC-FID) (Hewlett-Packard 5890 Series II), as described in Example 6.
Example 13. Adaptive Evolution of a Microbial Strain to Increase Growth Rate on Ethanol as a Carbon Source
[0197] This example describes how one would improve the growth rate of a microbial strain using ethanol as the carbon source by adaptive laboratory evolution, the method of which is well-known to the artisan (Elena and Lenski, Nat. Rev.
Genet. 4 (6): 457-469 (2003)); Herring et al., Nat. Genet. 38: 1406-1412 (2006)). E. coli could be used as the target organism to improve the growth rate on ethanol. Such an E. coli strain could encompass a polycistronic DNA fragment containing iVACIAD2015-ACIAD2018 and an rrnB T2 terminator from pZZIO as described in Example 4 inserted into the E. coli chromosome to provide efficient gene expression and stability. Using well known molecular biology techniques, chromosomal integration is achieved by inserting the polycistronic DNA fragment by targeted knocked-in using the λ red homologous recombination method described by Datsenko and Wanner (Proc. Nat. Acad. Sci. USA 97:6640-6645 (2000)) into a locus that is preferably close to the E. coli origin of chromosomal replication, such as, but not limited to, the rbsK, ilvC, rrnC and fimD gene loci.
[0198] Another method well known to the artisan is to use miniTn5-mediated random integration as described by Huisman et al. (US Patent Nos. 6,316,262 and 6,593,116). For both approaches, the ethanol utilizing clones are selected on minimal medium agar plates containing ethanol as a carbon source. Suitable E2 minimal medium and trace elements are described in Example 1. E. coli clones capable of growing on minimal medium agar plates containing ethanol as a carbon source are initially grown over night in liquid LB medium before being transferred into E2 minimal liquid medium with ethanol concentrations between 0.5-5.0% (v/v) in an orbital shaker at 37°C. The cells are grown to an OD600 of about 0.5 before being diluted by passage into fresh E2 ethanol medium. The dilution factor at each passage is adjusted daily to account for changes in growth rate. Cultures are evolved until a stable growth rate of about 0.70 h"1 is achieved. Following evolution, individual colonies are isolated on E2 minimal medium agar plates containing ethanol as a carbon source, and growth in aerobic flasks is compared to that of the
initial un-evolved clone. The evolved strain with improved ethanol utilizing rate can be used to produce PHA and chemicals from ethanol as a carbon source.
Example 14. PHA Production From Ethanol as a Carbon Source in
Recombinant Acinetobacter Cells
[0199] This example describes how to engineer PHA production into
microorganisms that naturally grow on ethanol as a carbon source but cannot naturally produce PHA. An exemplary microbe would be A. baylyi ADPl . To accomplish this, the PHA biosynthesis genes from other microorganisms that naturally produce PHA would be heterologously expressed in baylyi ADPl . The source of the PHB genes could be Ralstonia eutropha (Peoples and Sinskey, J Biol. Chem. 264:15293-15297 (1989)). The PHB genes phaA, phaB, and phaC under the control of a suitable promoter can be obtained as a 5.2 kb fragment from R. eutropha chromosome 1 (Accession No. NC_008313) using appropriate primers. Suitable promoter regions that are highly expressed in Acinetobacter have been identified by Camarena et al. (PLoS Pathog. 6(4): el000834. doi: 10.1371/journal.ppat.1000834). Exemplary promoter regions include those of genes A1S 2098 and A1S_2102 that were shown to be highly induced by growth on ethanol.
[0200] Since efficiency of natural transformation in Acinetobacter allows introduction of modified DNA into recipient strains with high frequency, gene replacement with engineered DNA can be achieved efficiently in A. baylyi ADPl through a two-step process in which a cassette containing both selectable and counter-selectable genes is introduced into the target region and then replaced with the modified DNA using well known molecular biology techniques (Metzgar et al, Nucleic Acids Res. 32:5780-5790 (2004); de Berardinis et al, Mol. Syst. Biol. 4: 174; doi: 10.1038/msb.2008.10. (2008); Young et al. , Annu. Rev. Microbiol 59:519-551 (2005)). Suitable chromosomal integration sites are chosen to be close to the A. baylyi ADPl origin of chromosomal replication for high expression of the integrated genes. To examine PHA production from ethanol as a carbon source, recombinant A. baylyi ADPl strain harboring the phaA, phaB and phaC genes is cultured in lx E2 medium supplemented with ethanol concentrations between 0.5-5.0% (v/v) in an
orbital shaker at 30°C. The amount of PHA produced is then measured by gas chromatography-flame ionization detection (GC-FID) (Hewlett-Packard 5890 Series II), as described in Example 6.
Example 15. Production of 1,4-Butanediol From Ethanol as a Carbon Source in Recombinant Escherichia coli
[0201] This example describes production of 1,4-butanediol (1,4BD) from ethanol as a carbon source.
[0202] An E. coli biochemical network model as described in the specification above was supplemented with biochemical reactions suitable for the incorporation of ethanol. Utilization of ethanol by Escherichia coli is enabled through the
heterologous expression of genes leading to enzymes suitable for the task, as shown in Examples 4-11.
[0203] Routes for the production of 1 ,4BD were added to the in silico E. coli model to discover the feasibility for 1,4BD production from ethanol as a carbon source. Table 16 details exemplary EC numbers and enzymes names for a feasible route from succinyl-CoA, a well-known metabolic intermediate (the organisms naturally convert between acetyl-CoA and succinyl-CoA). Fig. 9 illustrates this pathway. The theoretical yield of BDO from ethanol using this biochemical reaction set was calculated to be 0.67 (wt/wt). To enable production of 1,4BD, genes listed in Table 16 are heterologously expressed in E. coli. Techniques related to heterologous expression of multiple genes under a variety of promoters in a single E. coli cell is well understood (as is demonstrated herein in Examples 6-11) for the synthesis of various products from ethanol as a carbon source.
Table 16. Exemplary EC numbers and enzyme names participating in the synthesis of 1 ,4-butanediol from ethanol.
EC Number Enzyme Name
1.2.1.76 Succinyl-CoA oxidoreductase
1.1.1.61 Succinate semialdehyde reductase
2.8.3.n 4-hydroxybutyrate CoA transferase
1.2.1.3 Propionaldehyde dehydrogenase
1.2.1.4 Aldehyde dehydrogenase
1.1.1.- 1 ,4-butanediol dehydrogenase
Example 16. Production of PoIy(3-Hydroxybutyrate) From Ethanol as a Carbon Source in Recombinant Escherichia coli
[0204] This example describes production of poly(3-hydroxybutyrate) (P3HB) from ethanol as a carbon source. The routes for production of P3HB that were determined in this example were confirmed experimentally in the data and results presented in Example 6.
[0205] An E. coli biochemical network model as described in the specification above was supplemented with biochemical reactions suitable for the incorporation of ethanol. Utilization of ethanol by Escherichia coli is enabled through the heterologous expression of genes leading to enzymes suitable for the task, as shown in Examples 4-11.
[0206] Routes for the production of P3HB were added to the in silico E. coli model to discover the feasibility for P3HB production from ethanol as a carbon source. Table 17 details exemplary EC numbers and enzymes names for a feasible route from acetyl-CoA, a well-known metabolic intermediate. The theoretical yield of P3HB from ethanol using this biochemical reaction set was calculated to be 0.91 (wt/wt). To enable production of P3HB, genes listed in Table 17 are heterologously expressed in E. coli. Techniques related to heterologous expression of multiple genes under a variety of promoters in a single E. coli cell is well understood (as is demonstrated herein in Example 6) for the synthesis of P3HB from ethanol as a carbon source.
Table 17. Exemplary EC numbers and enzyme names participating in the synthesis of poly(3-hydroxybutyrate) from ethanol.
EC Number Enzyme Name
2.3.1.9 beta-Ketothiolase
1.1.1.36 Acetoacety 1-CoA reductase
2.3.1.- Polyhydroxyalkanoate synthase
Example 17. Production of Isopropanol From Ethanol as a Carbon Source in Recombinant Escherichia coli
[0207] This example describes production of isopropanol (IPA) from ethanol as a carbon source.
[0208] An E. coli biochemical network model as described in the specification above was supplemented with biochemical reactions suitable for the incorporation of ethanol. Utilization of ethanol by Escherichia coli is enabled through the
heterologous expression of genes leading to enzymes suitable for the task, as shown in Examples 4-1 1.
[0209] Routes for the production of IPA were added to the in silico E. coli model to discover the feasibility for IPA production from ethanol as a carbon source. Table 18 details exemplary EC numbers and enzymes names for a feasible route from acetyl-CoA, a well-known metabolic intermediate. Fig. 10 illustrates this pathway. The theoretical yield of IPA from ethanol using this biochemical reaction set was calculated to be 0.65 (wt/wt). To enable production of IPA, genes listed in Table 18 are heterologously expressed in E. coli. Techniques related to
heterologous expression of multiple genes under a variety of promoters in a single E. coli cell is well understood (as is demonstrated herein in Examples 6-11) for the synthesis of various products from ethanol as a carbon source.
Table 18. Exemplary EC numbers and enzyme names participating in the synthesis of isopropanol from ethanol.
EC Number Enzyme Name
2.3.1.9 beta-Ketothiolase
2.8.3.8 Coenzyme A transferase
4.1.1.4 Acetoacetyl decarboxylase
1.1.1.80 Acetone reductase
Example 18. Production of 1-PropanoI from Ethanol as a Carbon Source in Recombinant Escherichia coli
[0210] This example describes production of 1-propanol from ethanol as a carbon source.
[0211] An E. coli biochemical network model as described in the specification above was supplemented with biochemical reactions suitable for the incorporation of ethanol. Utilization of ethanol by Escherichia coli is enabled through the heterologous expression of genes leading to enzymes suitable for the task, as shown in Examples 4-11.
[0212] Routes for the production of 1-propanol were added to the in silico E. coli model to discover the feasibility for 1-propanol production from ethanol as a carbon source. Table 19 details exemplary EC numbers and enzymes names for a feasible route from dihydroxyacetone phosphate, a well-known metabolic intermediate which is made naturally from acetyl-CoA by the organisms via gluconeogenesis. Fig. 11 illustrates the pathway. The theoretical yield of 1- propanol from ethanol using this biochemical reaction set was calculated to be 0.56 (wt/wt). To enable production of 1-propanol, genes listed in Table 19 are heterologously expressed in E. coli. Techniques related to heterologous expression of multiple genes under a variety of promoters in a single E. coli cell is well understood (as is demonstrated herein in Examples 6-11) for the synthesis of various products from ethanol as a carbon source.
Table 19. Exemplary EC numbers and enzyme names participating in the synthesis of 1-propanol from ethanol.
EC Number Enzyme Name
1.1.1.8 Dihydroxyacetone reductase
3.1.3.21 Glycerol-3-phosphatase
4.2.1.30 Glycerol dehydratase
1.1.1.21 2-Hydroxypropylaldehyde reductase
4.2.1.28 1,2-Propanediol hydrolase
1.1.1.202 Propanal oxidoreductase
Example 19. Production of Adipic Acid From Ethanol as a Carbon Source in Recombinant Escherichia coli
[0213] This example describes production of adipic acid from ethanol as a carbon source.
[0214] An E. coli biochemical network model as described in the specification above was supplemented with biochemical reactions suitable for the incorporation of ethanol. Utilization of ethanol by Escherichia coli is enabled through the heterologous expression of genes leading to enzymes suitable for the task, as shown in Examples 4-11.
[0215] Routes for the production of adipic acid were added to the in silico E. coli model to discover the feasibility for adipic acid production from ethanol as a carbon source. Table 20 details exemplary EC numbers and enzymes names for a feasible route from acetyl-CoA and succinyl-CoA (the organisms naturally convert between acetyl-CoA and succinyl-CoA). Fig. 12 illustrates this pathway. The theoretical yield of adipic acid from ethanol using this biochemical reaction set was calculated to be 1.06 (wt/wt). To enable production of adipic acid, genes listed in Table 20 are heterologously expressed in E. coli. Techniques related to
heterologous expression of multiple genes under a variety of promoters in a single E. coli cell is well understood (as is demonstrated herein in Examples 6-11) for the synthesis of various products from ethanol as a carbon source.
Table 20. Exemplary EC numbers and enzyme names participating in the synthesis of adipic acid from ethanol.
EC Number Enzyme Name
2.3.1.174 Oxoadipyl-Coenzyme A synthase
1.1.1.35 Oxoadipyl-Coenzyme A dehydrogenase
4.2.1.17 3-Hydroxyadipate dehydratase
1.3.1.44 2-Enoyl-CoA reductase
2.8.3.- Coenzyme A transferase
Example 20. Production of 3-Hydroxypropionic Acid From Ethanol as a Carbon Source in Recombinant Escherichia coli
[0216] This example describes production of 3-hydroxypropionic acid (3HP) from ethanol as a carbon source.
[0217] An E. coli biochemical network model as described in the specification above was supplemented with biochemical reactions suitable for the incorporation of ethanol. Utilization of ethanol by Escherichia coli is enabled through the heterologous expression of genes leading to enzymes suitable for the task, as shown in Examples 4-11.
[0218] Routes for the production of 3HP were added to the in silico E. coli model to discover the feasibility for 3 HP production from ethanol as a carbon source. Table 21 details exemplary EC numbers and enzymes names for a feasible route from acetyl-CoA, a well-known metabolic intermediate. The theoretical yield of 3HP from ethanol using this biochemical reaction set was calculated to be 1.09 (wt/wt). To enable production of 3HP, genes listed in Table 21 are heterologously expressed in E. coli. Techniques related to heterologous expression of multiple genes under a variety of promoters in a single E. coli cell is well understood (as is demonstrated herein in Examples 6-11) for the synthesis of various products from ethanol as a carbon source.
Table 21. Exemplary EC numbers and enzyme names participating in the synthesis of 3-hydroxypropionic acid from ethanol.
EC Numbers Enzyme Name
6.4.1.2 Acetyl-CoA carboxylase
1.2.1.75 Malonyl-CoA reductase
1.1.1.59 Malonyl semialdehyde reductase
Example 21. Replacing the Ethanol Feedstock with Xylose
[0219] This example demonstrates polyhydroxyalkanoate (PHA) homopolymer and copolymer production from xylose as a carbon source in recombinant E. coli cells. The PHA homopolymer and copolymer produced in this example include
poly-3-hydroxybutyrate (P3HB), poly-3-hydroxypropionate (P3HP), poly-4- hydroxybutryrate (P4HB), poly-5-hydroxyvalerate (P5HV), poly-3- hydroxybutyrate-co-4-hydroxybutyrate (P(3HB-co-4HB)), and poly-3- hydroxybutyrate-co-5-hydroxyvalerate (P(3HB-co-5HV)).
[0220] To demonstrate production of PHAs from xylose, the precursor strains engineered to produce the various homopolymers and copolymers from ethanol as a carbon source in the previous examples were used. All precursor strains possess the same genotype as the ethanol utilizing strains with the exception that they lack the broad host-range plasmid expressing the Ptet-ACIAD2015-ACIAD2018 operon which enables ethanol utilization. These strains include MBX1335, the precursor strain of MBX4900 as described in Example 6 for P3HB production, MBX51 16, the precursor strain of MBX4978 as described in Example 7 for P4HB production, MBX5115, the precursor strain of MBX4938 as described in Example 8 for P3HP production, MBX4081, the precursor strain of MBX4994 as described in Example 9 for P5HV production, MBX4996, the precursor strain of MBX4998 as described in Example 10 for P(3HB-co-4HB) production, and MBX4083, the precursor strain of MBX4995 as described in Example 11 for P(3HB-co-5HV) production.
[0221] All strains were cultured overnight in sterile tubes containing 3 mL of LB supplemented with the appropriate antibiotics to ensure plasmid maintenance. From this, 25 μΕ was used to inoculate Duetz deep-well shake plate wells in triplicates containing 475 μϋ of lx E2 medium supplemented with 10 g/L or 20 g/L xylose, appropriate antibiotics and IPTG where necessary. The final concentration of antibiotics used were 100 μg/mL ampicillin, 25 μg/mL chloramphenicol, 100 μg/mL ampicillin and 30 μg/mL gentamycin. The final IPTG concentration used was 0.1 mM. Both E2 medium and trace elements are described in Example01. The cells were grown for 6h at 37°C followed by 48 or 66h at 30°C with shaking at 250 rpm. At the end of the growth phase, the biomass titer, PHA titer and composition were determined as described in Examples 6 to 11. The strain, growth condition and polymer production for each PHA homopolymer and copolymer are listed in Table 22.
Table 22. PHA polymer and copolymer production from xylose.
Biomass PHA 3HB
PHA Strain Growth condition (g/L) (% dew) (%PHA)
MBX13 2.99±0.
P3HB 35 lOg/L xylose, 72h 06 8.36±0.16 -
MBX51 20g/L xylose, O.lmM 2.40±0.
0.53±0.16
P3HP 15 IPTG, 54h 12 -
MBX51 2.50±0.
1.70±0.41
P4HB 16 20g/L xylose, 54h 17 -
MBX40 lOg/L xylose, O.lmM 2.83±0.
4.15±0.13
P5HV 81 IPTG, 72h 06 -
P(3HB-co- MBX49 2.66±0. 94.73±0.1
4HB) 96 lOg/L xylose, 72h 23 7.11±0.70 7
P(3HB-co- MBX40 20g/L xylose, O. lmM 5.54±0. 48.89±0.6 87.08±0.1
5HV) 83 IPTG, 72h 1 1 8 6
[0222] These results demonstrate that PHAs can be produced from xylose as a sole carbon source in recombinant E. coli cells. For the copolymers, the
corresponding co-monomer 4HB or 5HV makes up the remaining fraction of the composition.
[0223] Other than in the examples herein, or unless otherwise expressly specified, all of the numerical ranges, amounts, values and percentages, such as those for amounts of materials, elemental contents, times and temperatures of reaction, ratios of amounts, and others, in the following portion of the specification and attached claims may be read as if prefaced by the word "about" even though the term "about" may not expressly appear with the value, amount, or range.
Accordingly, unless indicated to the contrary, the numerical parameters set forth in the following specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained by the present invention. At the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques.
[0224] Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth
in the specific examples are reported as precisely as possible. Any numerical value, however, inherently contains error necessarily resulting from the standard deviation found in its underlying respective testing measurements. Furthermore, when numerical ranges are set forth herein, these ranges are inclusive of the recited range end points (/'. e. , end points may be used). When percentages by weight are used herein, the numerical values reported are relative to the total weight.
[0225] Also, it should be understood that any numerical range recited herein is intended to include all sub-ranges subsumed therein. For example, a range of "1 to 10" is intended to include all sub-ranges between (and including) the recited minimum value of 1 and the recited maximum value of 10, that is, having a minimum value equal to or greater than 1 and a maximum value of equal to or less than 10. The terms "one," "a," or "an" as used herein are intended to include "at least one" or "one or more," unless otherwise indicated.
[0226] Any patent, publication, or other disclosure material, in whole or in part, that is said to be incorporated by reference herein is incorporated herein only to the extent that the incorporated material does not conflict with existing definitions, statements, or other disclosure material set forth in this disclosure. As such, and to the extent necessary, the disclosure as explicitly set forth herein supersedes any conflicting material incorporated herein by reference. Any material, or portion thereof, that is said to be incorporated by reference herein, but which conflicts with existing definitions, statements, or other disclosure material set forth herein will only be incorporated to the extent that no conflict arises between that incorporated material and the existing disclosure material.
[0227] While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.
Appendix
Annotated DNA sequence of the cloned ACIAD2015 and ACIAD2018 genes in pZZIO pl5A origin of replication
6601 TCTAGATTTCAGTGCAATTTATCTCTTCAAATGTAGCACCTGAAGTCAGCCCCATACGAT
AGATCTAAAGTCACGTTAAATAGAGAAGTTTACATCGTGGACTTCAGTCGGGGTATGCTA
Predicted -35 box of Ptet
6661 ATAAGTTGTAATTCTCATGTTTGACAGCTTATCATCGATAAGCTTTAATGCGGTAGTTTA
TATTCAACATTAAGAGTACAAACTGTCGAATAGTAGCTATTCGAAATTACGCCATCAAAT
Predicted -10 box of Ptet
6721 TCACAGTTAAATTGCTAACGCAGTCAGGCACCGTGTATGAAATCTAACAATGCGCTCATC
AGTGTCAATTTAACGATTGCGTCAGTCCGTGGCACATACTTTAGATTGTTACGCGAGTAG
6781 GTCATCCTCGGCACCGTCACCCTGGATGCTGTAGGCATAGGCTTGGTTATGCCGGTACTG
CAGTAGGAGCCGTGGCAGTGGGACCTACGACATCCGTATCCGAACCAATACGGCCATGAC
6841 CCGGGCCTCTTGCGGGATGTCGTGGAATGCCTTCGAATTCAGCACCTGCACATGGGACGT
GGCCCGGAGAACGCCCTACAGCACCTTACGGAAGCTTAAGTCGTGGACGTGTACCCTGCA SEQ ID No: 14
SEQ ID NO: 15
RBS ACIAD2015---»
M A F K N I A D Q T N G F Y I P
C ·
1 CAGAGGTTTTTATGGCTTTTAAAAATATTGCTGACCAAACAAACGGTTTTTATATCCCTT
GTCTCCAAAAATACCGAAAATTTTTATAACGACTGGTTTGTTTGCCAAAAATATAGGGAA
• V S L F G P G C A K E I G T K A Q N L G ·
61 GTGTCTCCCTTTTTGGCCCTGGTTGTGCCAAAGAAATTGGTACCAAAGCACAAAATTTAG
CACAGAGGGAAAAACCGGGACCAACACGGTTTCTTTAACCATGGTTTCGTGTTTTAAATC
• A K K A L I V T D A G L F K F G V A D T ·
121 GTGCAAAAAAAGCACTCATCGTGACTGATGCTGGTTTATTTAAATTTGGTGTAGCTGACA
CACGTTTTTTTCGTGAGTAGCACTGACTACGACCAAATAAATTTAAACCACATCGACTGT
• I A A Y L K E A G V D S H I F P G A E P ·
181 CTATCGCAGCATACCTTAAAGAAGCTGGCGTAGACAGTCATATTTTCCCAGGCGCTGAAC
GATAGCGTCGTATGGAATTTCTTCGACCGCATCTGTCAGTATAAAAGGGTCCGCGACTTG
■ N P T D K N V H N G V D A Y N T N G C D ·
241 CCAATCCGACAGATAAAAACGTACATAATGGCGTTGATGCATATAATACCAATGGATGTG
GGTTAGGCTGTCTATTTTTGCATGTATTACCGCAACTACGTATATTATGGTTACCTACAC
• F I V S L G G G S S H D C A K G I G L V ·
301 ACTTTATTGTATCGCTCGGTGGTGGATCATCTCACGACTGTGCAAAAGGTATTGGATTAG
TGAAATAACATAGCGAGCCACCACCTAGTAGAGTGCTGACACGTTTTCCATAACCTAATC
• T A G G G H I R D Y E G I D K S T V P M ·
361 TTACCGCAGGCGGTGGTC ACATTCGTGATTACGAAGGAATTGATAAAAGTACTGTTCCAA
AATGGCGTCCGCCACCAGTGTAAGCACTAATGCTTCCTTAACTATTTTCATGACAAGGTT
• T P L I A V N T T A G T A S E T R F C ·
421 TGACGCCGTTAATTGCAGTCAATACCACTGCAGGCACAGCATCTGAAATGACACGTTTCT
ACTGCGGCAATTAACGTCAGTTATGGTGACGTCCGTGTCGTAGACTTTACTGTGCAAAGA
I I T N T D T H V K M A I V D W R C T
P ·
481 GTATTATTACCAATACAGATACACATGTAAAAATGGCGATTGTAGATTGGCGTTGTACCC
CATAATAATGGTTATGTCTATGTGTACATTTTTACCGCTAACATCTAACCGCAACATGGG
L I A I D D P K L M I A K P A S L T A
A ·
541 CACTGATTGCCATTGATGACCCTAAGCTCATGATTGCTAAGCCTGCAAGCCTGACTGCTG
GTGACTAACGGTAACTACTGGGATTCGAGTACTAACGATTCGGACGTTCGGACTGACGAC
T G M D A L T H A V E A Y V S T A A N
P ·
601 CGACTGGTATGGATGCGCTGAC ACATGCTGTCGAAGCTTATGTATCTACTGCTGCGAACC
GCTGACCATACCTACGCGACTGTGTACGACAGCTTCGAATACATAGATGACGACGCTTGG
• I T D A C A E K A I S M I S E W L S P A ■
661 CAATCACAGACGCCTGTGCCGAAAAAGCAATCAGCATGATCAGTGAATGGCTCAGCCCAG
GTTAGTGTCTGCGGACACGGCTTTTTCGTTAGTCGTACTAGTCACTTACCGAGTCGGGTC
• V A N G E N L E A R D A M S Y A Q Y L A ■
721 CTGTTGCCAATGGTGAAAACCTTGAAGCACGTGATGCAATGAGCTATGCCCAATATCTTG
GACAACGGTTACCACTTTTGGAACTTCGTGCACTACGTTACTCGATACGGGTTATAGAAC
• G M A F N N A S L G Y V H A M A H Q L G ■
781 CAGGTATGGCATTTAACAATGCGTCATTAGGTTATGTTCATGCCATGGCGCACCAACTTG
GTCCATACCGTAAATTGTTACGCAGTAATCCAATACAAGTACGGTACCGCGTGGTTGAAC
• G F Y N L P H G V C N A V L L P H V C E ·
841 GCGGTTTCTACAATCTGCCACACGGCGTATGTAATGCGGTATTGTTGCCACACGTTTGTG
CGCCAAAGATGTTAGACGGTGTGCCGCATACATTACGCCATAACAACGGTGTGCAAACAC
• F N L I A C P E R Y A R I A E L M G V N ·
901 AGTTCAACCTGATTGCTTGCCCAGAGCGTTATGCACGTATCGCAGAATTAATGGGCGTAA
TCAAGTTGGACTAACGAACGGGTCTCGCAATACGTGCATAGCGTCTTAATTACCCGCATT
■ T H G L T V T E A . Y A A I D A I R T L ·
961 ATAC AC ACGGCCTTACGGTGACTGAAGCTGCATATGCTGCAATCGATGCAATTCGTACAT
TATGTGTGCCGGAATGCCACTGACTTCGACGTATACGACGTTAGCTACGTTAAGCATGTA
• S K S I G I P S G L T E L G V K T E D L ·
TATCAAAATCAATTGGTATCCCATCTGGCTTGACCGAGCTTGGTGTAAAAACTGAAGATC ATAGTTTTAGTTAACCATAGGGTAGACCGAACTGGCTCGAACCACAT TTTGACTTCTAG
• A V M A E N A Q K D A C M L T N P R K A ·
TGCAGTAATGGCCGAAAATGCACAAAAAGACGCGTGTATGTTGACTAATCCACGCAAAG AACGTCATTACCGGCTTTTACGTGTTTTTCTGCGCACATACAACTGATTAGGTGCGTTTC
End of ACZAD2015 RBS
• N H A Q V V D I F T A A L * SEQ ID NO: 16 CAAATCACGCTCAAGTTGTAGATATTTTCACAGCAGCATTGTAAACCTAGAAGGAGGTTT GTTTAGTGCGAGTTCAACATCTATAAAAGTGTCGTCGTAACATTTGGATCTTCCTCCAAA SEQ ID NO: 17
SEQ ID NO: 18
ACIAD2018 -
M R Y I D P N Q P G S K V Q F A Q Y
E ·
TTATGCGTTATATCGATCCTAATCAACCTGGCTCTAAGGTTCAATTTAAAGCACAATATG AATACGCAATATAGCTAGGATTAGTTGGACCGAGATTCCAAGTTAAATTTCGTGTTATAC
• N F I G G Q W V P P V G E Y F G N S S ·
AAAACTTTATTGGCGGTCAGTGGGTTCCTCCTGTAAAAGGAGAATACTTCGGAAATAGCT TTTTGAAATAACCGCCAGTCACCCAAGGAGGACATTTTCCTCTTATGAAGCCTTTATCGA
• P V D G K V F T Q I P R S S V E D I E L ■
CTCCTGTCGATGGCAAAGTATTTACTCAAATTCCTCGCTCAAGCGTCGAAGATATTGAAC GAGGACAGCTACCGTTTCATAAATGAGTTTAAGGAGCGAGTTCGCAGCTTCTATAACTTG
• A L D A A H K A K A D W N K A S P T V R ·
TAGCACTTGATGCAGCGCACAAAGCGAAAGCTGATTGGAATAAAGCATCACCTACAGTTC ATCGTGAACTACGTCGCGTGTTTCGCTTTCGACTAACCTTATTTCGTAGTGGATGTCAAG
S N V L L K I A D R L E E N L E L L A
V ·
GTTCAAATGTTTTACTTAAAATTGCAGATCGTCTGGAAGAAAACCTAGAGCTACTTGCTG CAAGTTTACAAAATGAATTTTAACGTCTAGCAGACCTTCTTTTGGATCTCGATGAACGAC
■ A E T W E N G K P I R E T L A A D I P L ·
TAGCAGAAACATGGGAAAATGGTAAACCTATCCGCGAAACACTCGCAGCAGATATCCCAC ATCGTCTTTGTACCCTTTTACCATTTGGATAGGCGCTTTGTGAGCGTCGTCTATAGGGTG
• A I D H F R Y F A G C I R A Q E G G I S ·
TTGCAATTGACCATTTCCGCTATTTCGCAGGCTGTATACGTGCACAAGAAGGTGGTATTT AACGTTAACTGGTAAAGGCGATAAAGCGTCCGACATATGCACGTGTTCTTCCACCATAAA
• E I D E D T I A Y H F H E P L G V V G Q ·
CAGAAATTGATGAGGATACCATTGCTTATCATTTCCATGAACCGCTTGGTGTTGTAGGCC
GTCTTTAACTACTCCTATGGTAACGAATAGTAAAGGTACTTGGCGAACCACAACATCCGG
• I I P W N F P I L M A A W K L A P A L A ·
AGATCATTCCATGGAACTTTCCAATTTTGATGGCTGCATGGAAATTGGCACCAGCACTGG TCTAGTAAGGTACCTTGAAAGGTTAAAACTACCGACGTACCTTTAACCGTGGTCGTGACC
• A G N C I V L P A E Q T P S S I L V L ·
CAGCAGGTAACTGTATTGTTCTTAAACCAGCAGAGCAAACACCGTCAAGTATTCTAGTTC GTCGTCCATTGACATAACAAGAATTTGGTCGTCTCGTTTGTGGCAGTTCATAAGATCAAG
• A E L I Q D L L P P G V L N I V N G Y G ·
TGGCTGAATTGATTCAGGACCTCCTTCCACCTGGCGTACTTAATATCGTCAATGGATACG ACCGAC TAACTAAGTCCTGGAGGAAGGTGGACCGCATGAATTATAGCAGTTACCTATGC
■ A E V G R P L A T N P R I S K I A F T G ·
GTGCTGAGGTTGGTCGTCCTTTAGCGACAAATCCAAGAATTTCAAAAATTGCATTCACTG CACGACTCCAACCAGCAGGAAATCGCTGTTTAGGTTCTTAAAGTTTTTAACGTAAGTGAC
• S T K V G Q M I M Q Y A T E N I I P V T ·
GTTCAACCAAAGTTGGACAAATGATCATGCAATATGCCACTGAAAATATCATTCCTGTAA CAAGTTGGTTTCAACCTGTTTACTAGTACGTTATACGGTGACTTTTATAGTAAGGACATT
■ L E L G G S P N I F F E D I L D K E D ·
CGCTAGAACTTGGTGGTAAATCTCCAAATATCTTTTTTGAAGACATCTTAGATAAAGAAG GCGATCTTGAACCACCATTTAGAGGTTTATAGAAAAAACTTCTGTAGAATCTATTTCTTC
■ D Y L E K T L E G F A M F A L N Q G E V ■
ATGATTATTTGGAAAAAACACTTGAAGGTTTTGCCATGTTTGCCTTGAACCAGGGTGAAG TACTAATAAACCTTTTTTGTGAACTTCCAAAACGGTACAAACGGAACTTGGTCCCACTTC
• C T C P S R A L V Q E S I A D K F L E M ·
TATGTACCTGCCCTTCACGTGCACTTGTTCAGGAAAGTATTGCTGACAAATTCCTTGAAA ATACATGGACGGGAAGTGCACGTGAACAAGTCCTTTCATAACGACTGTTTAAGGAACTTT
• A V E R V K R I T G H P L D T E T M I ·
TGGCTGTAGAGCGTGTCAAACGCATCAAGACGGGTCATCCACTTGATACAGAAACCATGA ACCGACATCTCGCACAGTTTGCGTAGTTCTGCCCAGTAGGTGAACTATGTCTTTGGTACT
• G A Q A S K Q Q F D K I L G C I D T G R ·
TTGGCGCACAAGCCTCTAAGCAACAGTTTGATAAAATTTTAGGCTGTATTGATACAGGTC AACCGCGTGTTCGGAGATTCGTTGTCAAACTATTTTAAAATCCGACATAACTATGTCCAG
• N E G A Q L L T G G D A R H D V D G G F ·
GTAATGAAGGTGCACAACTTTTAACTGGTGGTGATGCACGTCACGATGTAGATGGTGGTT CATTACTTCCACGTGTTGAAAATTGACCACCACTACGTGCAGTGCTACATCTACCACCAA
• Y I E P T I F K G N N S M K I F Q E E I ■
2341 TTTATATTGAACCAACGATTTTCAAAGGCAATAACAGTATGAAAATCTTCCAAGAAGAAA
AAATATAACTTGGTTGCTAAAAGTTTCCGTTATTGTCATACTTTTAGAAGGTTCTTCTTT
• F G P V L S V T T P K D F D D A M R I A ·
2 01 TTTTTGGACCAGTACTTTCAGTAACGACATTTAAAGATTTTGACGATGCAATGCGTATTG
AAAAACCTGGTCATGAAAGTCATTGCTGTAAATTTCTAAAACTGCTACGTTACGCATAAC
• N D T I Y G L G A G V W S R S A H T S Y ·
2461 CCAACGACACGATTTATGGCTTGGGTGCTGGTGTATGGTCACGTTCTGCACATACCTCAT
GGTTGCTGTGCTAAATACCGAACCCACGACCACATACCAGTGCAAGACGTGTATGGAGTA
• R A G R A I E A G R V W T N C Y H L Y P ·
2521 ACCGTGCTGGTCGTGCGATTGAAGCCGGTCGTGTGTGGACAAACTGTTATCACCTTTATC
TGGCACGACCAGCACGCTAACTTCGGCCAGCACACACCTGTTTGACAATAGTGGAAATAG
■ A H A A F G G Y K Q S G I G R E N H R M ·
2581 CAGCGCATGCTGCATTTGGTGGTTACAAACAGTCAGGTATTGGTCGTGAAAACCACAGAA
GTCGCGTACGACGTAAACCACCAATGTTTGTCAGTCCATAACCAGCACTTTTGGTGTCTT
• M L D H Y Q Q T K N L L V S Y S T K P M ·
2641 TGATGCTAGATCATTATC ACAAACCAAAAACTTGTTGGTGAGTTATTCAACAAAACCAA
ACTACGATCTAGTAATAGTTGTTTGGTTTTTGAACAACCACTCAATAAGTTGTTTTGGTT
End of ACIAD2018
• G F F * SEQ ID NO: 19
2701 TGGGCTTCTTCTAACCCGGGCCCTATATATGGATCCAATTGCAATGATCATCATGACAGA
ACCCGAAGAAGATTGGGCCCGGGATATATACCTAGGTTAACGTTACTAGTAGTACTGTCT
2761 TCTGCGCGCGATCGATATCAGCGCTTTAAATTTGCGCATGCTAGCTATAGTTCTAGAGGT
AGACGCGCGCTAGCTATAGTCGCGAAATTTAAACGCGTACGATCGATATCAAGATCTCCA
2821 ACCGGTTGTTAACGTTAGCCGGCTACGTATACTCCGGAATATTAATAGGCCTAGGATGCA
TGGCCAACAATTGCAATCGGCCGATGCATATGAGGCCTTATAATTATCCGGATCCTACGT
2881 TATGGCGGCCGCCTGCAGCTGGCGCCATCGATACGCGTACGTCGCGACCGCGGACATGTA
ATACCGCCGGCGGACGTCGACCGCGGTAGCTATGCGCATGCAGCGCTGGCGCCTGTACAT
2941 CAGAGCTCGAGAAGTACTAGTGGCCACGTGGGCCGTGCACCTTAAGCTTGGCTGTTTTGG
GTCTCGAGCTCTTCATGATCACCGGTGCACCCGGCACGTGGAATTCGAACCGACAAAACC
3001 CGGATGAGAGAAGATTTTCAGCCTGA ACAGATTAAATCAGAACGCAGAAGCGGTCTGAT
GCCTACTCTCTTCTAAAAGTCGGACTATGTCTAATTTAGTCTTGCGTCTTCGCCAGACTA
3061 AAAACAGAATTTGCCTGGCGGCAGTAGCGCGGTGGTCCCACCTGACCCCATGCCGAACTC
TTTTGTCTTAAACGGACCGCCGTCATCGCGCCACCAGGGTGGACTGGGGTACGGCTTGAG
3121 AGAAGTGAAACGCCGTAGCGCCGATGGTAGTGTGGGGTCTCCCCATGCGAGAGTAGGGAA
TCTTCACTTTGCGGCATCGCGGCTACCATCACACCCCAGAGGGGTACGCTCTCATCCCTT
rrnB T2 terminator
3181 CTGCCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGACTGGGCCTTTCGTTTTATCT
GACGGTCCGTAGTTTATTTTGCTTTCCGAGTCAGCTTTCTGACCCGGAAAGCAAAATAGA
3241 GTTGTTTGTCGGTGAACGCTCTCCTGAGTAGGACAAATCCGCCGGGAGCGGATTTGAACG
CAACAAACAGCCACTTGCGAGAGGACTCATCCTGTTTAGGCGGCCCTCGCCTAAACTTGC
3301 TTGCGAAGCAACGGCCCGGAGGGTGGCGGGCAGGACGCCCGCCATAAACTGCCAGGCATC
AACGCTTCGTTGCCGGGCC CCCACCGCCCGTCCTGCGGGCGGTATTTGACGGTCCGTAG
rrnB T2 terminator
3361 AAATTAAGCAGAAGGCCATCCTGACGGATGGCCTTTTCACCGACGCGAGGCTGGATGGCC
TTTAATTCGTCTTCCGGTAGGACTGCCTACCGGAAAAGTGGCTGCGCTCCGACCTACCGG
3 21 TTCCCCATTATGATTCTTCTCGCTTCCGGCGGCATCGGGATGCCCGCGTTGCAGGCCATG
AAGGGG AA AC AAG AGAGCGAAGGCCGCCG AGCCC ACGGGCGCAACGTCCGG AC SEQ ID NO: 20
SEQ ID NO: 21
Gene ID 001 Nucleotide Sequence: Chloroflexus aurantiacus malonyl-CoA reductase mcr*
ATGTCTGGTACTGGTCGACTGGCAGGTAAAATTGCACTGATCACTGGCGGTGCTGGCAATA TTGGTTCCGAGCTGACCCGCCGTTTCCTGGCCGAGGGCGCGACCGTCATCATCTCTGGTCG TAACCGCGCCAAACTGACCGCACTGGCAGAGCGTATGCAAGCAGAGGCTGGTGTGCCGGCT AAGCGTATTGATCTGGAAGTCATGGACGGTAGCGATCCAGTCGCTGTGCGCGCTGGTATTG AAGCGATTGTGGCTCGCCATGGTCAGATTGATATTCTGGTTAACAATGCTGGTTCCGCGGG TGCACAGCGTCGCCTGGCCGAAATTCCGCTGACCGAGGCCGAACTGGGTCCGGGCGCTGAG GAAACTCTGCACGCGTCCATCGCAAATCTGCTGGGTATGGGCTGGCACCTGATGCGCATTG CGGCTCCACACATGCCGGTTGGTTCCGCAGTTATCAACGTTTCCACCATTTTCAGCCGCGC TGAATACTATGGTCGTATTCCGTACGTTACGCCGAAAGCCGCTCTGAACGCGCTGTCCCAG CTGGCGGCACGCGAGCTGGGCGCTCGTGGTATTCGTGTCAACACTATCTTCCCGGGTCCGA TCGAGTCCGACCGTATCCGTACTGTCTTTCAACGCATGGACCAGCTGAAAGGTCGCCCTGA GGGCGACACCGCTCATCACTTCCTGAACACCATGCGTCTGTGCCGTGCGAACGATCAGGGC GCTCTGGAACGTCGCTTCCCGTCCGTGGGTGATGTGGCGGACGCGGCTGTGTTCCTGGCGT CTGCCGAATCTGCGGCACTGTCTGGTGAGACTATTGAAGTGACTCACGGCATGGAGCTGCC GGCGTGCTCTGAGACTAGCCTGCTGGCTCGTACGGATCTGCGCACCATCGACGCTAGCGGT CGCACCACCCTGATCTGTGCGGGCGACCAGATTGAAGAAGTGATGGCGCTGACCGGTATGC TGCGTACCTGCGGCTCTGAAGTTATTATCGGCTTCCGCTCCGCAGCAGCGCTGGCCCAGTT TGAACAGGCGGTCAACGAAAGCCGTCGTCTGGCAGGTGCTGATTTTACTCCACCAATCGCC CTGCGGCTGGACCCGCGTGATCCGGCAACTATCGATGCTGTGTTTGACTGGGGCGCAGGTG AAAACACCGGCGGCATCCACGCTGCTGTTATCCTGCCGGCAACCTCTCATGAGCCAGCCCC TTGTGTGATCGAGGTTGATGACGAGCGTGTTCTGAACTTCCTGGCTGACGAGATTACCGGC ACGATCGTTATCGCGTCTCGTCTGGCTCGCTACTGGCAGTCTCAGCGCCTGACCCCTGGTG CACGTGCCCGTGGCCCTCGTGTTATCTTTCTGTCCAATGGCGCGGATCAGAACGGTAACGT CTATGGCCGTATCCAATCTGCTGCTATCGGCCAACTGATTCGTGTTTGGCGTCACGAAGCT GAGCTGGATTACCAGCGTGCATCCGCAGCTGGCGATCACGTGCTGCCGCCTGTCTGGGCCA ACCAAATCGTTCGCTTCGCTAACCGCTCTCTGGAGGGCCTGGAGTTTGCATGCGCCTGGAC GGCCCAGCTGCTGCACTCTCAGCGTCATATCAATGAAATCACTCTGAACATCCCTGCGAAC ATTAGCGCTACTACCGGTGCTCGTTCTGCTTCTGTCGGTTGGGCGGAATCTCTGATCGGTC
TGCACCTGGGCAAAGTGGCGCTGATCACCGGTGGCTCTGCGGGCATCGGTGGCCAGATCGG CCGTCTGCTGGCGCTGTCTGGCGCACGCGTGATGCTGGCTGCACGTGACCGTCACAAACTG GAGCAGATGCAGGCAATGATTCAGAGCGAGCTGGCGGAAGTCGGCTACACTGACGTTGAAG ACCGCGTCCACATCGCTCCGGGCTGCGACGTGTCTTCTGAGGCTCAGCTGGCTGATCTGGT CGAACGCACCCTGTCTGCATTCGGTACGGTGGACTACCTGATCAACAATGCGGGCATTGCC GGTGTCGAGGAGATGGTGATCGACATGCCAGTCGAAGGTTGGCGCCACACGCTGTTCGCGA ATCTGATCAGCAATTACAGCCTGATGCGTAAACTGGCGCCGCTGATGAAAAAGCAGGGTTC TGGCTACATCCTGAACGTTTCTTCCTACTTCGGCGGCGAAAAGGATGCGGCCATCCCATAT CCGAACCGCGCAGATTACGCGGTTTCTAAAGCCGGCCAGCGTGCGATGGCAGAAGTGTTCG CCCGCTTCCTGGGTCCGGAGATCCAGATTAACGCGATCGCACCGGGTCCGGTTGAAGGTGA TCGCCTGCGTGGTACGGGTGAACGTCCGGGCCTGTTCGCACGTCGTGCGCGTCTGATCCTG GAAAACAAGCGCCTGAATGAGCTGCACGCGGCCCTGATTGCAGCCGCGCGTACCGACGAAC GTTCTATGCACGAGCTGGTGGAGCTGCTGCTGCCGAACGATGTGGCTGCCCTGGAACAGAA TCCAGCAGCACCGACCGCGCTGCGCGAACTGGCCCGTCGTTTTCGTTCCGAAGGCGATCCG GCTGCATCCTCCTCCAGCGCACTGCTGAACCGTTCTATCGCGGCGAAGCTGCTGGCACGCC TGCACAATGGTGGTTACGTCCTGCCAGCCGACATCTTCGCAAACCTGCCTAACCCACCGGA TCCATTCTTTACCCGCGCTCAGATCGACCGTGAAGCGCGTAAAGTTCGTGATGGTATCATG GGCATGCTGTATCTGCAGCGTATGCCGACGGAGTTCGATGTCGCGATGGCAACCGTCTATT ACCTGGCCGACCGCAACGTGAGCGGCGAAACCTTCCACCCATCCGGTGGCCTGCGCTATGA ACGTACGCCGACCGGTGGTGAGCTGTTCGGCCTGCCGAGCCCGGAACGCCTGGCAGAACTG GTTGGCTCCACCGTGTACCTGATCGGTGAACACCTGACGGAGCACCTGAACCTGCTGGCCC GTGCGTATCTGGAGCGTTATGGCGCACGTCAAGTTGTTATGATCGTGGAAACCGAAACGGG TGCCGAAACTATGCGTCGTCTGCTGCACGACCATGTCGAAGCCGGCCGCCTGATGACGATC GTGGCTGGTGACCAGATCGAAGCAGCCATCGATCAGGCAATTACGCGTTATGGTCGTCCGG GTCCTGTTGTTTGCACTCCATTCCGCCCGCTGCCAACTGTGCCTCTGGTCGGTCGCAAGGA CTCCGATTGGAGCACGGTCCTGTCTGAAGCTGAGTTCGCGGAACTGTGCGAGCATCAGCTG ACTCACCACTTCCGTGTTGCTCGCAAGATCGCACTGTCCGATGGCGCCAGCCTGGCGCTGG TCACCCCAGAGACTACCGCAACTTCTACCACTGAACAATTCGCTCTGGCAAACTTCATTAA AACTACGCTGCACGCTTTCACCGCGACCATCGGCGTTGAGTCCGAACGTACGGCGCAGCGT ATCCTGATCAATCAGGTGGATCTGACTCGTCGTGCGCGCGCCGAAGAACCGCGCGATCCGC ACGAACGCCAGCAGGAACTGGAGCGCTTCATTGAAGCAGTCCTGCTGGTCACTGCGCCTCT GCCACCGGAAGCGGACACGCGCTATGCCGGTCGCATCCATCGCGGCCGTGCCATCACTGTC TGA ( SEQ ID NO : 22 )
Gene ID 001 Protein Sequence: Chloroflexus aurantiacus malonyl-CoA reductase mcr*
MSGTGRLAGKIALITGGAGNIGSELTRRFLAEGATVI I SGRNRAKLTALAERMQAEAGVPA KRIDLE\7MDGSDPVA\/RAGIEAIVARHGQIDILVNNAGSAGAQRRLAEIPLTEAELGPGAE ETLHAS I ANLLGMGWHLMRI AAPHMPVGSAVINVSTI F SRAEYYGRI PYVTPKAALNALSQ LAARELGARGIRVNTIFPGPIESDRIRTVFQRMDQLKGRPEGDTAHHFLNTMRLCRANDQG ALERRFPSVGDVADAAVFLASAESAALSGETIEVTHGMELPACSETSLLARTDLRTIDASG RTTLICAGDQIEEA/MALTGMLRTCGSEVI IGFRSAAALAQFEQAVNESRRLAGADFTPPIA LPLDPRDPATIDAVFDWGAGENTGGIHAAVILPATSHEPAPCVIEWDERVLNFLADEITG TIVIASRLARY QSQRLTPGARARGPRVIFLSNGADQNGNVYGRIQSAAIGQLIRWRHEA ELDYQRASAAGDHVLPP ANQIWFANRSLEGLEFACAWTAQLLHSQRHINEITLNI PAN ISATTGARSASVGWAESLIGLHLGKVALITGGSAGIGGQIGRLLALSGAR\7MLAARDRHKL EQMQAMIQSELAEVGYTDVEDR\7HIAPGCDVSSEAQLADLVERTLSAFGTVDYLINNAGIA GVEEI IDMPVEGWRHTLFANLI SNYSLMRKLAPLMKKQGSGYILNVSSYFGGEKDAAIPY PNRADYAVSKAGQRAMAEVFARFLGPEIQINAIAPGPVEGDRLRGTGERPGLFARRARLIL
ENKRLNELHAALIAAARTDERSMHELVELLLPNDVAALEQNPAAPTALRELARRFRSEGDP AASSSSALLNRSIAAKLLARLHNGGYVLPADIFANLPNPPDPFFTRAQIDREARK DGIM GMLYLQRMPTEFDVAMATWYLADRVSGETFHPSGGLRYERTPTGGELFGLPSPERLAEL VGSTWLIGEHLTEHLNLLARAYLERYGARQAA IVETETGAETMRRLLHDHVEAGRLMTI VAGDQIEAAIDQAITRYGRPGPWCTPFRPLPTVPLVGRKDSDWSTVLSEAEFAELCEHQL THHFRVARKIALSDGASLALVTPETTATSTTEQFALANFIKTTLHAFTATIGVESERTAQR ILINQVDLTRRARAEEPRDPHERQQELERFIEAVLLV APLPPEADTRYAGRIHRGRAITV
(SEQ ID NO: 23)
Claims (92)
1. An organism homologously capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source, wherein the organism is genetically engineered to produce a polyhydroxyalkanoate polymer.
2. The organism of claim 1, wherein the organism produces a
polyhydroxyalkanoate polymer when grown on ethanol as a carbon source.
3. An organism homologously capable of producing a polyhydroxyalkanoate polymer, wherein the organism is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source.
4. The organism of claim 3, wherein the organism produces a
polyhydroxyalkanoate polymer when grown on ethanol as a carbon source.
5. An organism that is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, and genetically engineered to produce a polyhydroxyalkanoate polymer.
6. The organism of claim 5, wherein the organism produces
polyhydroxyalkanoate polymer when grown on ethanol as a carbon source.
7. The organism of claims 1 - 6, wherein the polyhydroxyalkanoate polymer is selected from the group consisting of: polyglycolic acid (PGA), poly-3- hydroxybutyrate (P3HB), poIy-3-hydroxypropionate (P3HP), poly-4- hydroxybutryrate (P4HB), poly-5-hydroxyvalerate (P5HV), poly-3- hydroxybutyrate-co-4-hydroxybutyrate (P(3HB-co-4HB)), poly-3- hydroxybutyrate-co-5-hydroxyvalerate (P(3HB-co-5HV)), and copolymers thereof.
An organism homologously capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source, wherein the organism is genetically engineered to produce a diol.
The organism of claim 8, wherein the organism produces a diol when grown on ethanol as a carbon source.
An organism homologously capable of producing diol, wherein the organism is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source.
11. The organism of claim 10, wherein the organism produces a diol when grown on ethanol as a carbon source.
12. An organism that is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, and genetically engineered to produce a diol.
13. The organism of claim 12, wherein the organism produces a diol when grown on ethanol as a carbon source.
14. The organism of claims 8 - 13, wherein the diol is selected from the group consisting of: 1 ,3-propanediol, 1 ,4-butanediol, 1,5-pentanediol, and 1,6- hexanediol.
15. An organism homologously capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source, wherein the organism is genetically engineered to produce diacid.
The organism of claim 15, wherein the organism produces diacid when grown on ethanol as a carbon source.
An organism homologously capable of producing diacid, wherein the organism is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source.
The organism of claim 17, wherein the organism produces diacid when grown on ethanol as a carbon source.
An organism that is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, and genetically engineered to produce diacid.
The organism of claim 19, wherein the organism produces diacid when grown on ethanol as a carbon source.
The organism of claims 15 - 20, wherein the diacid is selected from the group consisting of: succinic acid, glutaric acid, and adipic acid.
An organism homologously capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source, wherein the organism is genetically engineered to produce higher alcohol.
The organism of claim 22, wherein the organism produces higher alcohol when grown on ethanol as a carbon source.
24. An organism homologously capable of producing higher alcohol, wherein the organism is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source.
25. The organism of claim 24, wherein the organism produces higher alcohol when grown on ethanol as a carbon source.
26. An organism that is genetically engineered to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, and genetically engineered to produce higher alcohol.
27. The organism of claim 26, wherein the organism produces higher alcohol when grown on ethanol as a carbon source.
28. The organism of claims 22 - 27, wherein the higher alcohol is selected from the group consisting of: isopropanol, and 1-propanol.
29. The organism of claims 1 - 28, wherein the organism is selected from the group consisting of: Escherichia coli, Ralstonia eutropha, Acinetobacter baumannii, Acinetobacter baylyi, Acinetobacter aceti, Acinetobacter sp. DR1, Acinetobacter calcoaceticus, Acinetobacter haemolyticus,
Acinetobacter johnsonii, Acinetobacter junii, Acinetobacter Iwoffii,
Acinetobacter radioresistens, Acinetobacter venetianus, Acinetobacter sp. DSM, Zoogloea ramigera, Allochromatium vinosum, Rhodococcus ruber, Delftia acidovorans, Aeromonas caviae, Synechocystis sp. PCC 6803, Synechococcus elongatus PCC 7942, Thiocapsa pfenigii, Bacillus megaterium, Clostridium kluyveri, Methylobacterium extorquens, Nocardia corralina, Nocardia salmonicolor, Pseudomonas fluorescens, Pseudomonas oleovorans, Pseudomonas sp. 6-19, Pseudomonas sp.61-3 and Pseudomonas putida, Rhodobacter sphaeroides, Alcaligenes lotus, Klebsiella oxytoca, Anaerobiospirillum succiniciproducens, Actinobacillus succinogenes, Mannheimia succiniciproducens, Rhizobium etli, Bacillus subtilis,
Corynebacterium glutamicum, Gluconobacter oxydans, Zymomonas mobilis, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, Clostridium acetobutylicum, Saccharomyces cerevisiae,
Schizosaccharomyces pombe, Kluyveromyces lactis, Kluyveromyces marxianus, Aspergillus terreus, Aspergillus niger, Pichia pastoris, Chlorella spp., Chlorella minutissima, Chlorella emersonii, Chlorella sorokiniana, Chlorella ellipsoidea, Chlorella sp., and Chlorella protothecoides.
30. A process for producing a polyhydroxyalkanoate polymer or copolymer, comprising:
providing an organism capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source;
genetically engineering the organism to produce a polyhydroxyalkanoate polymer or copolymer, thereby producing an ethanol-utilizing organism genetically engineered to produce the
polyhydroxyalkanoate polymer or copolymer; and
providing ethanol to the ethanol-utilizing organism genetically engineered to produce the polyhydroxyalkanoate polymer or copolymer;
thereby producing the polyhydroxyalkanoate polymer or copolymer.
31. A process for producing a polyhydroxyalkanoate polymer or copolymer, comprising:
providing an organism capable of producing the polyhydroxyalkanoate polymer or copolymer;
genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing a polyhydroxyalkanoate-producing organism genetically engineered to utilize ethanol; and
providing ethanol to the polyhydroxyalkanoate-producing organism
genetically engineered to utilize ethanol;
thereby producing polyhydroxyalkanoate.
32. A process for producing a polyhydroxyalkanoate polymer or copolymer, comprising:
providing an organism;
genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing an organism genetically engineered to utilize ethanol;
genetically engineering the organism to produce a polyhydroxyalkanoate polymer or copolymer, thereby producing an organism genetically engineered to produce polyhydroxyalkanoate and utilize ethanol; and providing ethanol to the organism genetically engineered to produce the polyhydroxyalkanoate polymer or copolymer and utilize ethanol; thereby producing the polyhydroxyalkanoate polymer or copolymer.
33. The process of claims 30 - 32, wherein the polyhydroxyalkanoate polymer or copolymer is selected from the group consisting of: polyglycolic acid (PGA), poly-3-hydroxybutyrate (P3HB), poly-3-hydroxypropionate (P3HP), poly-4-hydroxybutryrate (P4HB), poly-5 -hydroxy valerate (P5HV), poly-3- hydroxybutyrate-co-4-hydroxybutyrate (P(3HB-co-4HB)), poly-3- hydroxybutyrate-co-5-hydroxyvalerate (P(3HB-co-5HV)), and copolymers thereof.
34. A process for producing diol, comprising:
providing an organism capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source;
genetically engineering the organism to produce a diol, thereby producing an ethanol-utilizing organism genetically engineered to produce a diol; and
providing ethanol to the ethanol-utilizing organism genetically engineered to produce a diol;
thereby producing diol.
35. A process for producing diol, comprising:
providing an organism capable of producing diol;
genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing a diol- producing organism genetically engineered to utilize ethanol; and providing ethanol to the diol-producing organism genetically engineered to utilize ethanol;
thereby producing diol.
36. A process for producing diol, comprising:
providing an organism;
genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing an organism genetically engineered to utilize ethanol;
genetically engineering the organism to produce a diol, thereby producing an organism genetically engineered to produce a diol and utilize ethanol; and
providing ethanol to the organism genetically engineered to produce a diol and utilize ethanol;
thereby producing diol.
37. The process of claims 34 - 36, wherein the diol is selected from the group consisting of: 1,3 -propanediol, 1 ,4-butanediol, 1,5-pentanediol, and 1,6- hexanediol.
38. A process for producing diacid, comprising:
providing an organism capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source;
genetically engineering the organism to produce diacid, thereby producing an ethanol-utilizing organism genetically engineered to produce diacid; and providing ethanol to the ethanol-utilizing organism genetically engineered to produce diacid;
thereby producing diacid.
39. A process for producing diacid, comprising:
providing an organism capable of producing diacid;
genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing a diacid- producing organism genetically engineered to utilize ethanol; and providing ethanol to the diacid-producing organism genetically engineered to utilize ethanol;
thereby producing diacid.
40. A process for producing a diacid, comprising:
providing an organism;
genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing an organism genetically engineered to utilize ethanol;
genetically engineering the organism to produce the diacid, thereby
producing an organism genetically engineered to produce the diacid and utilize ethanol; and
providing ethanol to the organism genetically engineered to produce the diacid and utilize ethanol;
thereby producing the diacid.
41. The process of claims 38 - 40, wherein the diacid is selected from the group consisting of: succinic acid, glutaric acid, and adipic acid.
42. A process for producing a higher alcohol, comprising:
providing an organism capable of converting ethanol to acetyl-CoA when grown on ethanol as a carbon source; genetically engineering the organism to produce the higher alcohol, thereby producing an ethanol-utilizing organism genetically engineered to produce the higher alcohol; and
providing ethanol to the ethanol-utilizing organism genetically engineered to produce the higher alcohol;
thereby producing the higher alcohol.
43. A process for producing higher alcohol, comprising:
providing an organism capable of producing higher alcohol;
genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing a higher alcohol-producing organism genetically engineered to utilize ethanol; and
providing ethanol to the higher alcohol-producing organism genetically
engineered to utilize ethanol;
thereby producing higher alcohol.
44. A process for producing a higher alcohol, comprising:
providing an organism;
genetically engineering the organism to convert ethanol to acetyl-CoA when grown on ethanol as a carbon source, thereby producing an organism genetically engineered to utilize ethanol;
genetically engineering the organism to produce the higher alcohol, thereby producing an organism genetically engineered to produce the higher alcohol and utilize ethanol; and
providing ethanol to the organism genetically engineered to produce the higher alcohol and utilize ethanol;
thereby producing the higher alcohol.
45. The process of claims 42 - 44, wherein the higher alcohol is selected from the group consisting of: isopropanol, and 1-propanol.
46. The process of claims 30 - 45, where the organism is selected from the group consisting of: Escherichia coli, Ralstonia eutropha, Acinetobacter baumannii, Acinetobacter baylyi, Acinetobacter aceti, Acinetobacter sp. DR1 , Acinetobacter calcoaceticus, Acinetobacter haemolyticus,
Acinetobacter johnsonii, Acinetobacter junii, Acinetobacter Iwoffii,
Acinetobacter radioresistens, Acinetobacter venetianus, Acinetobacter sp. DSM, Zoogloea ramigera, Allochromatium vinosum, Rhodococcus ruber, Delftia acidovorans, Aeromonas caviae, Synechocystis sp. PCC 6803, Synechococcus elongatus PCC 7942, Thiocapsa pfenigii, Bacillus megaterium, Clostridium kluyveri, Methylobacterium extorquens, Nocardia corralina, Nocardia salmonicolor, Pseudomonas fluorescens, Pseudomonas oleovorans, Pseudomonas sp. 6-19, Pseudomonas sp.61-3 and Pseudomonas putida, Rhodobacter sphaeroides, Alcaligenes latus, Klebsiella oxytoca, Anaerobio spirillum succiniciproducens, Actinobacillus succinogenes, Mannheimia succiniciproducens, Rhizobium etli, Bacillus subtilis,
Corynebacterium glutamicum, Gluconobacter oxydans, Zymomonas mobilis, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, Clostridium acetobutylicum, Saccharomyces cerevisiae,
Schizosaccharomyces pombe, Kluyveromyces lactis, Kluyveromyces marxianus, Aspergillus terreus, Aspergillus niger, Pichia pastoris, Chlorella spp., Chlorella minutissima, Chlorella emersonii, Chlorella sorokiniana, Chlorella ellipsoidea, Chlorella sp., and Chlorella protothecoides.
47. An organism homologously capable of converting xylose to acetyl-CoA
when grown on xylose as a carbon source, wherein the organism is genetically engineered to produce a polyhydroxyalkanoate polymer.
48. The organism of claim 47, wherein the organism produces
polyhydroxyalkanoate polymer when grown on xylose as a carbon source.
49. An organism homologously capable of producing a polyhydroxyalkanoate polymer, wherein the organism is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source.
50. The organism of claim 49, wherein the organism produces a
polyhydroxyalkanoate polymer when grown on xylose as a carbon source.
51. An organism that is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source, and genetically engineered to produce a polyhydroxyalkanoate polymer.
52. The organism of claim 51 , wherein the organism produces a
polyhydroxyalkanoate polymer when grown on xylose as a carbon source.
53. The organism of claims 47 - 52, wherein the polyhydroxyalkanoate polymer is selected from the group consisting of: polyglycolic acid (PGA), poly-3- hydroxybutyrate (P3HB), poly-3-hydroxypropionate (P3HP), poly-4- hydroxybutryrate (P4HB), poly-5 -hydroxy valerate (P5HV), poly-3- hydroxybutyrate-co-4-hydroxybutyrate (P(3HB-co-4HB)), poly-3- hydroxybutyrate-co-5-hydroxyvalerate (P(3HB-co-5HV)), and copolymers thereof.
54. An organism homologously capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source, wherein the organism is genetically engineered to produce a diol.
55. The organism of claim 54, wherein the organism produces a diol when
grown on xylose as a carbon source.
56. An organism homologously capable of producing diol, wherein the organism is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source.
57. The organism of claim 56, wherein the organism produces a diol when grown on xylose as a carbon source.
58. An organism that is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source, and genetically engineered to produce a diol.
59. The organism of claim 58, wherein the organism produces a diol when grown on xylose as a carbon source.
60. The organism of claims 54 - 59, wherein the diol is selected from the group consisting of: 1,3-propanediol, 1 ,4-butanediol, 1,5-pentanediol, and 1,6- hexanediol.
61. An organism homologously capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source, wherein the organism is genetically engineered to produce a diacid.
62. The organism of claim 61 , wherein the organism produces diacid when grown on xylose as a carbon source.
63. An organism homologously capable of producing diacid, wherein the
organism is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source.
64. The organism of claim 63, wherein the organism produces a diacid when grown on xylose as a carbon source.
65. An organism that is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source, and genetically engineered to produce a diacid.
66. The organism of claim 65, wherein the organism produces a diacid when grown on xylose as a carbon source.
67. The organism of claims 61 - 66, wherein the diacid is selected from the group consisting of: succinic acid, glutaric acid, and adipic acid.
68. An organism homologously capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source, wherein the organism is genetically engineered to produce higher alcohol.
69. The organism of claim 68, wherein the organism produces higher alcohol when grown on xylose as a carbon source.
70. An organism homologously capable of producing higher alcohol, wherein the organism is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source.
71. The organism of claim 70, wherein the organism produces higher alcohol when grown on xylose as a carbon source.
72. An organism that is genetically engineered to convert xylose to acetyl-CoA when grown on xylose as a carbon source, and genetically engineered to produce higher alcohol.
73. The organism of claim 72, wherein the organism produces higher alcohol when grown on xylose as a carbon source.
74. The organism of claims 68 - 73, wherein the higher alcohol is selected from the group consisting of: isopropanol, and 1-propanol.
75. The organism of claims 47 - 74, where the organism is selected from the group consisting of: Escherichia coli, Ralstonia eutropha, Acinetobacter baumannii, Acinetobacter baylyi, Acinetobacter aceti, Acinetobacter sp. DR1 , Acinetobacter calcoaceticus, Acinetobacter haemolyticus,
Acinetobacter johnsonii, Acinetobacter junii, Acinetobacter Iwoffii,
Acinetobacter radioresistens, Acinetobacter venetianus, Acinetobacter sp. DSM, Zoogloea ramigera, Allochromatium vinosum, Rhodococcus ruber, Delftia acidovorans, Aeromonas caviae, Synechocystis sp. PCC 6803, Synechococcus elongatus PCC 7942, Thiocapsa pfenigii, Bacillus megaterium, Clostridium kluyveri, Methylobacterium extorquens, Nocardia corralina, Nocardia salmonicolor, Pseudomonas fluorescens, Pseudomonas oleovorans, Pseudomonas sp. 6-19, Pseudomonas sp.61-3 and Pseudomonas putida, Rhodobacter sphaeroides, Alcaligenes latus, Klebsiella oxytoca, Anaerobiospirillum succiniciproducens, Actinobacillus succinogenes, Mannheimia succiniciproducens, Rhizobium etli, Bacillus subtilis,
Corynebacterium glutamicum, Gluconobacter oxydans, Zymomonas mobilis, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, Clostridium acetobutylicum, Saccharomyces cerevisiae,
Schizosaccharomyces pombe, Kluyveromyces lactis, Kluyveromyces marxianus, Aspergillus terreus, Aspergillus niger, Pichia pastoris, Chlorella spp., Chlorella minutissima, Chlorella emersonii, Chlorella sorokiniana, Chlorella ellipsoidea, Chlorella sp., and Chlorella protothecoides.
76. A process for producing polyhydroxyalkanoate, comprising:
providing an organism capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source; genetically engineering the organism to produce a polyhydroxyalkanoate polymer, thereby producing an xylose-utilizing organism genetically engineered to produce polyhydroxyalkanoate; and
providing xylose to the xylose-utilizing organism genetically engineered to produce polyhydroxyalkanoate;
thereby producing polyhydroxyalkanoate.
77. A process for producing polyhydroxyalkanoate, comprising:
providing an organism capable of producing polyhydroxyalkanoate polymer; genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing a polyhydroxyalkanoate-producing organism genetically engineered to utilize xylose; and
providing xylose to the polyhydroxyalkanoate-producing organism
genetically engineered to utilize xylose;
thereby producing polyhydroxyalkanoate.
78. A process for producing polyhydroxyalkanoate, comprising:
providing an organism;
genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing an organism genetically engineered to utilize xylose;
genetically engineering the organism to produce a polyhydroxyalkanoate polymer, thereby producing an organism genetically engineered to produce polyhydroxyalkanoate and utilize xylose; and providing xylose to the organism genetically engineered to produce
polyhydroxyalkanoate and utilize xylose;
thereby producing polyhydroxyalkanoate.
79. The process of claims 76 - 78, wherein the polyhydroxyalkanoate polymer is selected from the group consisting of: polyglycolic acid (PGA), poly-3- hydroxybutyrate (P3HB), poly-3-hydroxypropionate (P3HP), poly-4- hydroxybutryrate (P4HB), poly-5 -hydroxy valerate (P5HV), poly-3- hydroxybutyrate-co-4-hydroxybutyrate (P(3HB-co-4HB)), poly-3- hydroxybutyrate-co-5-hydroxyvalerate (P(3HB-co-5HV)), and copolymers thereof.
A process for producing diol, comprising:
providing an organism capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source;
genetically engineering the organism to produce a diol, thereby producing an xylose-utilizing organism genetically engineered to produce a diol; and
providing xylose to the xylose-utilizing organism genetically engineered to produce a diol;
thereby producing diol.
A process for producing diol, comprising:
providing an organism capable of producing diol;
genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing a diol- producing organism genetically engineered to utilize xylose; and providing xylose to the diol-producing organism genetically engineered to utilize xylose;
thereby producing diol.
A process for producing diol, comprising:
providing an organism;
genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing an organism genetically engineered to utilize xylose; genetically engineering the organism to produce a diol, thereby producing an organism genetically engineered to produce a diol and utilize xylose; and
providing xylose to the organism genetically engineered to produce a diol and utilize xylose;
thereby producing diol.
83. The process of claims 80 - 82, wherein the diol is selected from the group consisting of: 1,3 -propanediol, 1,4-butanediol, 1,5-pentanediol, and 1,6- hexanediol.
84. A process for producing diacid, comprising:
providing an organism capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source;
genetically engineering the organism to produce diacid, thereby producing an xylose-utilizing organism genetically engineered to produce diacid; and
providing xylose to the xylose-utilizing organism genetically engineered to produce diacid;
thereby producing diacid.
85. A process for producing diacid, comprising:
providing an organism capable of producing diacid;
genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing a diacid- producing organism genetically engineered to utilize xylose; and providing xylose to the diacid-producing organism genetically engineered to utilize xylose;
thereby producing diacid.
86. A process for producing diacid, comprising: providing an organism;
genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing an organism genetically engineered to utilize xylose;
genetically engineering the organism to produce diacid, thereby producing an organism genetically engineered to produce diacid and utilize xylose; and
providing xylose to the organism genetically engineered to produce diacid and utilize xylose;
thereby producing diacid.
87. The process of claims 84 - 86, wherein the diacid is selected from the group consisting of: succinic acid, glutaric acid, and adipic acid.
88. A process for producing higher alcohol, comprising:
providing an organism capable of converting xylose to acetyl-CoA when grown on xylose as a carbon source;
genetically engineering the organism to produce higher alcohol, thereby producing an xylose-utilizing organism genetically engineered to produce higher alcohol; and
providing xylose to the xylose-utilizing organism genetically engineered to produce higher alcohol;
thereby producing higher alcohol.
89. A process for producing higher alcohol, comprising:
providing an organism capable of producing higher alcohol;
genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing a higher alcohol-producing organism genetically engineered to utilize xylose; and providing xylose to the higher alcohol-producing organism genetically engineered to utilize xylose;
thereby producing higher alcohol.
90. A process for producing higher alcohol, comprising:
providing an organism;
genetically engineering the organism to convert xylose to acetyl-CoA when grown on xylose as a carbon source, thereby producing an organism genetically engineered to utilize xylose;
genetically engineering the organism to produce higher alcohol, thereby producing an organism genetically engineered to produce higher alcohol and utilize xylose; and
providing xylose to the organism genetically engineered to produce higher alcohol and utilize xylose;
thereby producing higher alcohol.
91. The process of claims 88 - 90, wherein the higher alcohol is selected from the group consisting of: isopropanol, and 1-propanol.
92. The process of claims 76 - 91, where the organism is selected from the group consisting of: Escherichia coli, Ralstonia eutropha, Acinetobacter baumannii, Acinetobacter baylyi, Acinetobacter aceti, Acinetobacter sp. DR1, Acinetobacter calcoaceticus, Acinetobacter haemolyticus,
Acinetobacter johnsonii, Acinetobacter junii, Acinetobacter Iwoffii,
Acinetobacter radioresistens, Acinetobacter venetianus, Acinetobacter sp. DSM, Zoogloea ramigera, Allochromatium vinosum, Rhodococcus ruber, Delftia acidovorans, Aeromonas caviae, Synechocystis sp. PCC 6803, Synechococcus elongatus PCC 7942, Thiocapsa pfenigii, Bacillus megaterium, Clostridium kluyveri, Methylobacterium extorquens, Nocardia corralina, Nocardia salmonicolor, Pseudomonas fluorescens, Pseudomonas oleovorans, Pseudomonas sp. 6-19, Pseudomonas sp.61-3 and Pseudomonas putida, Rhodobacter sphaeroides, Alcaligenes latus, Klebsiella oxytoca, Anaerobiospirillum succiniciproducens, Actinobacillus succinogenes, Mannheimia succiniciproducens, Rhizobium etli, Bacillus subtilis,
Corynebacterium glutamicum, Gluconobacter oxydans, Zymomonas mobilis, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, Clostridium acetobutylicum, Saccharomyces cerevisiae,
Schizosaccharomyces pombe, Kluyveromyces lactis, Kluyveromyces marxianus, Aspergillus terreus, Aspergillus niger, Pichia pastoris, Chlorella spp., Chlorella minutissima, Chlorella emersonii, Chlorella sorokiniana, Chlorella ellipsoidea, Chlorella sp., and Chlorella protothecoides.
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US61/480,870 | 2011-04-29 |
Publications (1)
Publication Number | Publication Date |
---|---|
AU2012249622A1 true AU2012249622A1 (en) | 2013-12-12 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9663791B2 (en) | Green process for producing polyhydroxyalkanoates and chemicals using a renewable feedstock | |
Choi et al. | Microbial polyhydroxyalkanoates and nonnatural polyesters | |
Van Thuoc et al. | Utilization of waste fish oil and glycerol as carbon sources for polyhydroxyalkanoate production by Salinivibrio sp. M318 | |
US9090898B2 (en) | Green process and compositions for producing poly(5HV) and 5 carbon chemicals | |
Madison et al. | Metabolic engineering of poly (3-hydroxyalkanoates): from DNA to plastic | |
Riedel et al. | Lipid and fatty acid metabolism in Ralstonia eutropha: relevance for the biotechnological production of value-added products | |
US10323261B2 (en) | Polyhydroxyalkanoate copolymer compositions and methods of making the same | |
Silva et al. | An integrated process for mixed culture production of 3-hydroxyhexanoate-rich polyhydroxyalkanoates from fruit waste | |
US20130288317A1 (en) | Increased yields of phas from hydrogen feeding and diverse carbon fixation pathways | |
Kutralam-Muniasamy et al. | Genome characteristics dictate poly-R-(3)-hydroxyalkanoate production in Cupriavidus necator H16 | |
Ingram et al. | Anabolism of poly (3-hydroxybutyrate-co-3-hydroxyvalerate) by Cupriavidus necator DSM 545 from spent coffee grounds oil | |
WO1998054329A9 (en) | Production of medium chain length poly-3-hydroxy alkanoates in escherichia coli, and monomers derived therefrom | |
McGregor et al. | Biosynthesis of poly (3HB-co-3HP) with variable monomer composition in recombinant Cupriavidus necator H16 | |
Wang et al. | Production of PHA copolymers consisting of 3-hydroxybutyrate and 3-hydroxyhexanoate (PHBHHx) by recombinant Halomonas bluephagenesis | |
Lee et al. | De novo microbial biosynthesis of a lactate ester platform | |
Rashid et al. | Dual-production of polyhydroxyalkanoate and rhamnolipid by Pseudomonas aeruginosa UMTKB-5 using industrial by-products | |
Diankristanti et al. | Polyhydroxyalkanoates bioproduction from bench to industry: thirty years of development towards sustainability | |
Singh et al. | Biological system as reactor for the production of biodegradable thermoplastics, polyhydroxyalkanoates | |
KR20110033265A (en) | Method for polymerising glycolic acid with microorganisms | |
Thirumala et al. | Production of PHA by recombinant organisms | |
AU2012249622A1 (en) | Green process for producing polyhydroxyalkanoates and chemicals using a renewable feedstock | |
Sharma et al. | Genomics of PHA synthesizing bacteria | |
Giourieva et al. | Polyhydroxyalkanoates: New Browsing the PHA Biosynthesis Insights in Native and Recombinant Strains | |
EP2310518A1 (en) | Method for polymerising glycolic acid with microorganisms | |
Locker | Engineering Cupriavidus necator H16 for 3-hydroxypropionic acid production |