AU2008310902A1 - Trimeric IL-1Ra - Google Patents
Trimeric IL-1Ra Download PDFInfo
- Publication number
- AU2008310902A1 AU2008310902A1 AU2008310902A AU2008310902A AU2008310902A1 AU 2008310902 A1 AU2008310902 A1 AU 2008310902A1 AU 2008310902 A AU2008310902 A AU 2008310902A AU 2008310902 A AU2008310902 A AU 2008310902A AU 2008310902 A1 AU2008310902 A1 AU 2008310902A1
- Authority
- AU
- Australia
- Prior art keywords
- seq
- fusion protein
- protein
- ira
- tript
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 101000599048 Homo sapiens Interleukin-6 receptor subunit alpha Proteins 0.000 title claims description 40
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 title claims description 39
- 102000037865 fusion proteins Human genes 0.000 claims description 102
- 108020001507 fusion proteins Proteins 0.000 claims description 102
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 51
- 102000000589 Interleukin-1 Human genes 0.000 claims description 50
- 108010002352 Interleukin-1 Proteins 0.000 claims description 50
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 44
- 238000000034 method Methods 0.000 claims description 40
- 229920001184 polypeptide Polymers 0.000 claims description 40
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 32
- 201000010099 disease Diseases 0.000 claims description 30
- 229920001223 polyethylene glycol Polymers 0.000 claims description 23
- 108010013645 tetranectin Proteins 0.000 claims description 18
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 17
- 102100024554 Tetranectin Human genes 0.000 claims description 14
- 239000008194 pharmaceutical composition Substances 0.000 claims description 14
- 230000001404 mediated effect Effects 0.000 claims description 12
- 206010012601 diabetes mellitus Diseases 0.000 claims description 10
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 9
- 208000027866 inflammatory disease Diseases 0.000 claims description 8
- 239000013598 vector Substances 0.000 claims description 8
- 230000000694 effects Effects 0.000 claims description 7
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 7
- 239000002202 Polyethylene glycol Substances 0.000 claims description 6
- 229940121363 anti-inflammatory agent Drugs 0.000 claims description 6
- 239000002260 anti-inflammatory agent Substances 0.000 claims description 6
- 108091033319 polynucleotide Proteins 0.000 claims description 4
- 102000040430 polynucleotide Human genes 0.000 claims description 4
- 239000002157 polynucleotide Substances 0.000 claims description 4
- 102200058457 rs121434643 Human genes 0.000 claims description 3
- 102200081636 rs587776926 Human genes 0.000 claims description 3
- 238000006467 substitution reaction Methods 0.000 claims description 3
- 230000035772 mutation Effects 0.000 claims description 2
- 108090000623 proteins and genes Proteins 0.000 description 81
- 102000004169 proteins and genes Human genes 0.000 description 75
- 235000018102 proteins Nutrition 0.000 description 72
- 238000011282 treatment Methods 0.000 description 68
- 102000051628 Interleukin-1 receptor antagonist Human genes 0.000 description 37
- 108700021006 Interleukin-1 receptor antagonist Proteins 0.000 description 37
- 229940054136 kineret Drugs 0.000 description 37
- -1 T48 Chemical compound 0.000 description 34
- 150000003839 salts Chemical class 0.000 description 29
- 235000001014 amino acid Nutrition 0.000 description 28
- 239000000872 buffer Substances 0.000 description 28
- 229940024606 amino acid Drugs 0.000 description 26
- 239000000203 mixture Substances 0.000 description 26
- 210000004027 cell Anatomy 0.000 description 25
- 150000002148 esters Chemical class 0.000 description 25
- 229940002612 prodrug Drugs 0.000 description 25
- 239000000651 prodrug Chemical class 0.000 description 25
- 150000001413 amino acids Chemical class 0.000 description 24
- 230000027455 binding Effects 0.000 description 21
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 20
- 150000001875 compounds Chemical class 0.000 description 18
- 238000005829 trimerization reaction Methods 0.000 description 18
- 238000009472 formulation Methods 0.000 description 17
- 239000003981 vehicle Substances 0.000 description 16
- 239000003814 drug Substances 0.000 description 15
- 230000014509 gene expression Effects 0.000 description 15
- 241001465754 Metazoa Species 0.000 description 14
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 14
- 230000003110 anti-inflammatory effect Effects 0.000 description 14
- 239000002953 phosphate buffered saline Substances 0.000 description 14
- 229920005862 polyol Polymers 0.000 description 14
- 150000003077 polyols Chemical class 0.000 description 14
- 241000700159 Rattus Species 0.000 description 13
- 230000000202 analgesic effect Effects 0.000 description 13
- 239000000243 solution Substances 0.000 description 13
- 210000004369 blood Anatomy 0.000 description 12
- 239000008280 blood Substances 0.000 description 12
- 230000002354 daily effect Effects 0.000 description 12
- 230000004927 fusion Effects 0.000 description 12
- 125000005647 linker group Chemical group 0.000 description 12
- 229920000642 polymer Polymers 0.000 description 12
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 11
- 125000000539 amino acid group Chemical group 0.000 description 11
- 239000011780 sodium chloride Substances 0.000 description 11
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 10
- 206010003246 arthritis Diseases 0.000 description 10
- 238000003776 cleavage reaction Methods 0.000 description 10
- 238000007912 intraperitoneal administration Methods 0.000 description 10
- 238000000746 purification Methods 0.000 description 10
- 230000007017 scission Effects 0.000 description 9
- 102000001398 Granzyme Human genes 0.000 description 8
- 108060005986 Granzyme Proteins 0.000 description 8
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 8
- 210000003000 inclusion body Anatomy 0.000 description 8
- 238000002347 injection Methods 0.000 description 8
- 239000007924 injection Substances 0.000 description 8
- 238000004519 manufacturing process Methods 0.000 description 8
- 238000002360 preparation method Methods 0.000 description 8
- 102000005962 receptors Human genes 0.000 description 8
- 108020003175 receptors Proteins 0.000 description 8
- 238000007920 subcutaneous administration Methods 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- 238000004458 analytical method Methods 0.000 description 7
- 239000004202 carbamide Substances 0.000 description 7
- 208000037765 diseases and disorders Diseases 0.000 description 7
- 229940079593 drug Drugs 0.000 description 7
- ZWJINEZUASEZBH-UHFFFAOYSA-N fenamic acid Chemical class OC(=O)C1=CC=CC=C1NC1=CC=CC=C1 ZWJINEZUASEZBH-UHFFFAOYSA-N 0.000 description 7
- 239000008103 glucose Substances 0.000 description 7
- 230000006698 induction Effects 0.000 description 7
- 102000014909 interleukin-1 receptor activity proteins Human genes 0.000 description 7
- 108040006732 interleukin-1 receptor activity proteins Proteins 0.000 description 7
- 238000001990 intravenous administration Methods 0.000 description 7
- 230000006320 pegylation Effects 0.000 description 7
- 229940124597 therapeutic agent Drugs 0.000 description 7
- 229920002684 Sepharose Polymers 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 125000000217 alkyl group Chemical group 0.000 description 6
- 210000003423 ankle Anatomy 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 230000037396 body weight Effects 0.000 description 6
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 6
- 238000005119 centrifugation Methods 0.000 description 6
- 125000003636 chemical group Chemical group 0.000 description 6
- 238000000502 dialysis Methods 0.000 description 6
- 239000012634 fragment Substances 0.000 description 6
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 6
- 239000003112 inhibitor Substances 0.000 description 6
- 239000008188 pellet Substances 0.000 description 6
- 239000008363 phosphate buffer Substances 0.000 description 6
- 150000005599 propionic acid derivatives Chemical class 0.000 description 6
- 230000009467 reduction Effects 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 229940046728 tumor necrosis factor alpha inhibitor Drugs 0.000 description 6
- 239000002451 tumor necrosis factor inhibitor Substances 0.000 description 6
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 5
- 102000004127 Cytokines Human genes 0.000 description 5
- 108090000695 Cytokines Proteins 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Natural products NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- 101001009603 Homo sapiens Granzyme B Proteins 0.000 description 5
- 108090001007 Interleukin-8 Proteins 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 5
- 102000001708 Protein Isoforms Human genes 0.000 description 5
- 108010029485 Protein Isoforms Proteins 0.000 description 5
- 108020004511 Recombinant DNA Proteins 0.000 description 5
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 5
- 150000001242 acetic acid derivatives Chemical class 0.000 description 5
- 239000003435 antirheumatic agent Substances 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 239000003937 drug carrier Substances 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 238000011694 lewis rat Methods 0.000 description 5
- 210000002540 macrophage Anatomy 0.000 description 5
- 210000001616 monocyte Anatomy 0.000 description 5
- 201000008482 osteoarthritis Diseases 0.000 description 5
- 150000003872 salicylic acid derivatives Chemical class 0.000 description 5
- 229960001052 streptozocin Drugs 0.000 description 5
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 5
- 238000012384 transportation and delivery Methods 0.000 description 5
- 239000013638 trimer Substances 0.000 description 5
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- 108091035707 Consensus sequence Proteins 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 208000009329 Graft vs Host Disease Diseases 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- 108010076504 Protein Sorting Signals Proteins 0.000 description 4
- 102100040247 Tumor necrosis factor Human genes 0.000 description 4
- 208000038016 acute inflammation Diseases 0.000 description 4
- 230000006022 acute inflammation Effects 0.000 description 4
- 229940111133 antiinflammatory and antirheumatic drug oxicams Drugs 0.000 description 4
- 229940111131 antiinflammatory and antirheumatic product propionic acid derivative Drugs 0.000 description 4
- 150000004648 butanoic acid derivatives Chemical class 0.000 description 4
- 210000004899 c-terminal region Anatomy 0.000 description 4
- 239000000969 carrier Substances 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 208000037976 chronic inflammation Diseases 0.000 description 4
- 230000006020 chronic inflammation Effects 0.000 description 4
- 239000003246 corticosteroid Substances 0.000 description 4
- 229960001334 corticosteroids Drugs 0.000 description 4
- 229940111134 coxibs Drugs 0.000 description 4
- 208000022993 cryopyrin-associated periodic syndrome Diseases 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 208000024908 graft versus host disease Diseases 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 238000010253 intravenous injection Methods 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 239000012139 lysis buffer Substances 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 229920001451 polypropylene glycol Polymers 0.000 description 4
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 4
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 4
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 150000003217 pyrazoles Chemical class 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 229940058287 salicylic acid derivative anticestodals Drugs 0.000 description 4
- 239000011734 sodium Substances 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 230000002103 transcriptional effect Effects 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 102000000503 Collagen Type II Human genes 0.000 description 3
- 108010041390 Collagen Type II Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 3
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 102000007562 Serum Albumin Human genes 0.000 description 3
- 108010071390 Serum Albumin Proteins 0.000 description 3
- 239000004098 Tetracycline Chemical class 0.000 description 3
- 239000007983 Tris buffer Substances 0.000 description 3
- 229940051880 analgesics and antipyretics pyrazolones Drugs 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 239000003255 cyclooxygenase 2 inhibitor Substances 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 239000003405 delayed action preparation Substances 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 239000002988 disease modifying antirheumatic drug Substances 0.000 description 3
- 230000002349 favourable effect Effects 0.000 description 3
- 210000002683 foot Anatomy 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 229960000890 hydrocortisone Drugs 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 201000006417 multiple sclerosis Diseases 0.000 description 3
- 210000000440 neutrophil Anatomy 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 229960005205 prednisolone Drugs 0.000 description 3
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 3
- JEXVQSWXXUJEMA-UHFFFAOYSA-N pyrazol-3-one Chemical class O=C1C=CN=N1 JEXVQSWXXUJEMA-UHFFFAOYSA-N 0.000 description 3
- 229940044551 receptor antagonist Drugs 0.000 description 3
- 239000002464 receptor antagonist Substances 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- 229940124530 sulfonamide Drugs 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 235000019364 tetracycline Nutrition 0.000 description 3
- 150000003522 tetracyclines Chemical class 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 3
- 210000003462 vein Anatomy 0.000 description 3
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 2
- WXTMDXOMEHJXQO-UHFFFAOYSA-N 2,5-dihydroxybenzoic acid Chemical compound OC(=O)C1=CC(O)=CC=C1O WXTMDXOMEHJXQO-UHFFFAOYSA-N 0.000 description 2
- LVYLCBNXHHHPSB-UHFFFAOYSA-N 2-hydroxyethyl salicylate Chemical compound OCCOC(=O)C1=CC=CC=C1O LVYLCBNXHHHPSB-UHFFFAOYSA-N 0.000 description 2
- UULGWGARYDGVBM-UHFFFAOYSA-N 4-[4-(2,4-dihydroxy-3,6-dimethylbenzoyl)oxy-2-methoxy-3,5,6-trimethylbenzoyl]oxy-2-methoxy-3,5,6-trimethylbenzoic acid Chemical compound CC1=C(C(O)=O)C(OC)=C(C)C(OC(=O)C=2C(=C(C)C(OC(=O)C=3C(=C(C)C(O)=CC=3C)O)=C(C)C=2C)OC)=C1C UULGWGARYDGVBM-UHFFFAOYSA-N 0.000 description 2
- WZRJTRPJURQBRM-UHFFFAOYSA-N 4-amino-n-(5-methyl-1,2-oxazol-3-yl)benzenesulfonamide;5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine Chemical compound O1C(C)=CC(NS(=O)(=O)C=2C=CC(N)=CC=2)=N1.COC1=C(OC)C(OC)=CC(CC=2C(=NC(N)=NC=2)N)=C1 WZRJTRPJURQBRM-UHFFFAOYSA-N 0.000 description 2
- FXUBHWHRMVGJOG-UHFFFAOYSA-N 4-benzoyl-2,3-dihydro-1h-indene-1-carboxylic acid Chemical compound OC(=O)C1CCC2=C1C=CC=C2C(=O)C1=CC=CC=C1 FXUBHWHRMVGJOG-UHFFFAOYSA-N 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 229930186147 Cephalosporin Chemical class 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 108090000909 Collectins Proteins 0.000 description 2
- 102000004405 Collectins Human genes 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 108010008165 Etanercept Proteins 0.000 description 2
- 208000009386 Experimental Arthritis Diseases 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 208000032843 Hemorrhage Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 102100026018 Interleukin-1 receptor antagonist protein Human genes 0.000 description 2
- 101710144554 Interleukin-1 receptor antagonist protein Proteins 0.000 description 2
- 208000003456 Juvenile Arthritis Diseases 0.000 description 2
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- 208000019693 Lung disease Diseases 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 102000016943 Muramidase Human genes 0.000 description 2
- 108010014251 Muramidase Proteins 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- MITFXPHMIHQXPI-UHFFFAOYSA-N Oraflex Chemical compound N=1C2=CC(C(C(O)=O)C)=CC=C2OC=1C1=CC=C(Cl)C=C1 MITFXPHMIHQXPI-UHFFFAOYSA-N 0.000 description 2
- 208000001132 Osteoporosis Diseases 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Natural products OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 108010040201 Polymyxins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 208000025747 Rheumatic disease Diseases 0.000 description 2
- 229930189077 Rifamycin Chemical class 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- FPHLBGOJWPEVME-UHFFFAOYSA-N alminoprofen Chemical compound OC(=O)C(C)C1=CC=C(NCC(C)=C)C=C1 FPHLBGOJWPEVME-UHFFFAOYSA-N 0.000 description 2
- 229940126575 aminoglycoside Drugs 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 239000004599 antimicrobial Substances 0.000 description 2
- NWGGKKGAFZIVBJ-UHFFFAOYSA-N antrafenine Chemical compound FC(F)(F)C1=CC=CC(N2CCN(CCOC(=O)C=3C(=CC=CC=3)NC=3C4=CC=C(C=C4N=CC=3)C(F)(F)F)CC2)=C1 NWGGKKGAFZIVBJ-UHFFFAOYSA-N 0.000 description 2
- 229960001671 azapropazone Drugs 0.000 description 2
- WOIIIUDZSOLAIW-NSHDSACASA-N azapropazone Chemical compound C1=C(C)C=C2N3C(=O)[C@H](CC=C)C(=O)N3C(N(C)C)=NC2=C1 WOIIIUDZSOLAIW-NSHDSACASA-N 0.000 description 2
- 150000003851 azoles Chemical class 0.000 description 2
- CNBGNNVCVSKAQZ-UHFFFAOYSA-N benzydamine Chemical compound C12=CC=CC=C2C(OCCCN(C)C)=NN1CC1=CC=CC=C1 CNBGNNVCVSKAQZ-UHFFFAOYSA-N 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 210000000845 cartilage Anatomy 0.000 description 2
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 2
- 238000005341 cation exchange Methods 0.000 description 2
- 229960000590 celecoxib Drugs 0.000 description 2
- RZEKVGVHFLEQIL-UHFFFAOYSA-N celecoxib Chemical compound C1=CC(C)=CC=C1C1=CC(C(F)(F)F)=NN1C1=CC=C(S(N)(=O)=O)C=C1 RZEKVGVHFLEQIL-UHFFFAOYSA-N 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 235000010980 cellulose Nutrition 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 229940124587 cephalosporin Drugs 0.000 description 2
- 150000001780 cephalosporins Chemical class 0.000 description 2
- 239000013522 chelant Substances 0.000 description 2
- MYSWGUAQZAJSOK-UHFFFAOYSA-N ciprofloxacin Chemical compound C12=CC(N3CCNCC3)=C(F)C=C2C(=O)C(C(=O)O)=CN1C1CC1 MYSWGUAQZAJSOK-UHFFFAOYSA-N 0.000 description 2
- CBGUOGMQLZIXBE-XGQKBEPLSA-N clobetasol propionate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CCl)(OC(=O)CC)[C@@]1(C)C[C@@H]2O CBGUOGMQLZIXBE-XGQKBEPLSA-N 0.000 description 2
- 229940047766 co-trimoxazole Drugs 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 229960000616 diflunisal Drugs 0.000 description 2
- HUPFGZXOMWLGNK-UHFFFAOYSA-N diflunisal Chemical compound C1=C(O)C(C(=O)O)=CC(C=2C(=CC(F)=CC=2)F)=C1 HUPFGZXOMWLGNK-UHFFFAOYSA-N 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N ethylene glycol Natural products OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 238000000855 fermentation Methods 0.000 description 2
- 230000004151 fermentation Effects 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 210000003494 hepatocyte Anatomy 0.000 description 2
- 210000000548 hind-foot Anatomy 0.000 description 2
- 238000000265 homogenisation Methods 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- CGIGDMFJXJATDK-UHFFFAOYSA-N indomethacin Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 CGIGDMFJXJATDK-UHFFFAOYSA-N 0.000 description 2
- 230000004968 inflammatory condition Effects 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 208000014674 injury Diseases 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 210000002510 keratinocyte Anatomy 0.000 description 2
- 239000000787 lecithin Substances 0.000 description 2
- 235000010445 lecithin Nutrition 0.000 description 2
- 229940067606 lecithin Drugs 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 2
- 229940041028 lincosamides Drugs 0.000 description 2
- 239000004325 lysozyme Substances 0.000 description 2
- 235000010335 lysozyme Nutrition 0.000 description 2
- 229960000274 lysozyme Drugs 0.000 description 2
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 2
- 239000003120 macrolide antibiotic agent Chemical class 0.000 description 2
- 229940041033 macrolides Drugs 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 239000003094 microcapsule Substances 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 229960000965 nimesulide Drugs 0.000 description 2
- HYWYRSMBCFDLJT-UHFFFAOYSA-N nimesulide Chemical compound CS(=O)(=O)NC1=CC=C([N+]([O-])=O)C=C1OC1=CC=CC=C1 HYWYRSMBCFDLJT-UHFFFAOYSA-N 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 230000007170 pathology Effects 0.000 description 2
- 150000002960 penicillins Chemical class 0.000 description 2
- AQIXEPGDORPWBJ-UHFFFAOYSA-N pentan-3-ol Chemical compound CCC(O)CC AQIXEPGDORPWBJ-UHFFFAOYSA-N 0.000 description 2
- XKFIQZCHJUUSBA-UHFFFAOYSA-N perisoxal Chemical compound C1=C(C=2C=CC=CC=2)ON=C1C(O)CN1CCCCC1 XKFIQZCHJUUSBA-UHFFFAOYSA-N 0.000 description 2
- 229950005491 perisoxal Drugs 0.000 description 2
- ZQBAKBUEJOMQEX-UHFFFAOYSA-N phenyl salicylate Chemical compound OC1=CC=CC=C1C(=O)OC1=CC=CC=C1 ZQBAKBUEJOMQEX-UHFFFAOYSA-N 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 229920000233 poly(alkylene oxides) Polymers 0.000 description 2
- 229940041153 polymyxins Drugs 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 238000002203 pretreatment Methods 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 230000009465 prokaryotic expression Effects 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 235000019833 protease Nutrition 0.000 description 2
- 230000006337 proteolytic cleavage Effects 0.000 description 2
- 150000007660 quinolones Chemical class 0.000 description 2
- 108700015048 receptor decoy activity proteins Proteins 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- GHMLBKRAJCXXBS-UHFFFAOYSA-N resorcinol Chemical compound OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- BTVYFIMKUHNOBZ-QXMMDKDBSA-N rifamycin s Chemical class O=C1C(C(O)=C2C)=C3C(=O)C=C1NC(=O)\C(C)=C/C=C\C(C)C(O)C(C)C(O)C(C)C(OC(C)=O)C(C)C(OC)\C=C/OC1(C)OC2=C3C1=O BTVYFIMKUHNOBZ-QXMMDKDBSA-N 0.000 description 2
- 229940081192 rifamycins Drugs 0.000 description 2
- WVYADZUPLLSGPU-UHFFFAOYSA-N salsalate Chemical compound OC(=O)C1=CC=CC=C1OC(=O)C1=CC=CC=C1O WVYADZUPLLSGPU-UHFFFAOYSA-N 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 229940083542 sodium Drugs 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 239000007929 subcutaneous injection Substances 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000005846 sugar alcohols Polymers 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 150000003456 sulfonamides Chemical class 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 229940040944 tetracyclines Drugs 0.000 description 2
- 229960004659 ticarcillin Drugs 0.000 description 2
- OHKOGUYZJXTSFX-KZFFXBSXSA-N ticarcillin Chemical compound C=1([C@@H](C(O)=O)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)C=CSC=1 OHKOGUYZJXTSFX-KZFFXBSXSA-N 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 230000014621 translational initiation Effects 0.000 description 2
- 230000008733 trauma Effects 0.000 description 2
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 230000003442 weekly effect Effects 0.000 description 2
- 238000009736 wetting Methods 0.000 description 2
- 150000003952 β-lactams Chemical class 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- SOOXXPIIPHUERK-UHFFFAOYSA-N (2-propan-2-yl-1h-indol-3-yl)-pyridin-3-ylmethanone Chemical compound CC(C)C=1NC2=CC=CC=C2C=1C(=O)C1=CC=CN=C1 SOOXXPIIPHUERK-UHFFFAOYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- RJMIEHBSYVWVIN-LLVKDONJSA-N (2r)-2-[4-(3-oxo-1h-isoindol-2-yl)phenyl]propanoic acid Chemical compound C1=CC([C@H](C(O)=O)C)=CC=C1N1C(=O)C2=CC=CC=C2C1 RJMIEHBSYVWVIN-LLVKDONJSA-N 0.000 description 1
- RDJGLLICXDHJDY-NSHDSACASA-N (2s)-2-(3-phenoxyphenyl)propanoic acid Chemical compound OC(=O)[C@@H](C)C1=CC=CC(OC=2C=CC=CC=2)=C1 RDJGLLICXDHJDY-NSHDSACASA-N 0.000 description 1
- GUHPRPJDBZHYCJ-SECBINFHSA-N (2s)-2-(5-benzoylthiophen-2-yl)propanoic acid Chemical compound S1C([C@H](C(O)=O)C)=CC=C1C(=O)C1=CC=CC=C1 GUHPRPJDBZHYCJ-SECBINFHSA-N 0.000 description 1
- KRDCGZGYWRCHNN-NAWJVIAPSA-N (2s)-2-(6-methoxynaphthalen-2-yl)propanoic acid;piperazine Chemical compound C1CNCCN1.C1=C([C@H](C)C(O)=O)C=CC2=CC(OC)=CC=C21.C1=C([C@H](C)C(O)=O)C=CC2=CC(OC)=CC=C21 KRDCGZGYWRCHNN-NAWJVIAPSA-N 0.000 description 1
- VUAFHZCUKUDDBC-SCSAIBSYSA-N (2s)-2-[(2-methyl-2-sulfanylpropanoyl)amino]-3-sulfanylpropanoic acid Chemical compound CC(C)(S)C(=O)N[C@H](CS)C(O)=O VUAFHZCUKUDDBC-SCSAIBSYSA-N 0.000 description 1
- RJMIEHBSYVWVIN-NSHDSACASA-N (2s)-2-[4-(3-oxo-1h-isoindol-2-yl)phenyl]propanoic acid Chemical compound C1=CC([C@@H](C(O)=O)C)=CC=C1N1C(=O)C2=CC=CC=C2C1 RJMIEHBSYVWVIN-NSHDSACASA-N 0.000 description 1
- MDKGKXOCJGEUJW-VIFPVBQESA-N (2s)-2-[4-(thiophene-2-carbonyl)phenyl]propanoic acid Chemical compound C1=CC([C@@H](C(O)=O)C)=CC=C1C(=O)C1=CC=CS1 MDKGKXOCJGEUJW-VIFPVBQESA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- BAPRUDZDYCKSOQ-RITPCOANSA-N (2s,4r)-1-acetyl-4-hydroxypyrrolidine-2-carboxylic acid Chemical compound CC(=O)N1C[C@H](O)C[C@H]1C(O)=O BAPRUDZDYCKSOQ-RITPCOANSA-N 0.000 description 1
- XYRIRLDHOQSNLW-UHFFFAOYSA-N (3-oxo-1h-2-benzofuran-1-yl) 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methylindol-3-yl]acetate Chemical compound CC1=C(CC(=O)OC2C3=CC=CC=C3C(=O)O2)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 XYRIRLDHOQSNLW-UHFFFAOYSA-N 0.000 description 1
- XIYOPDCBBDCGOE-IWVLMIASSA-N (4s,4ar,5s,5ar,12ar)-4-(dimethylamino)-1,5,10,11,12a-pentahydroxy-6-methylidene-3,12-dioxo-4,4a,5,5a-tetrahydrotetracene-2-carboxamide Chemical compound C=C1C2=CC=CC(O)=C2C(O)=C2[C@@H]1[C@H](O)[C@H]1[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]1(O)C2=O XIYOPDCBBDCGOE-IWVLMIASSA-N 0.000 description 1
- RNIADBXQDMCFEN-IWVLMIASSA-N (4s,4ar,5s,5ar,12ar)-7-chloro-4-(dimethylamino)-1,5,10,11,12a-pentahydroxy-6-methylidene-3,12-dioxo-4,4a,5,5a-tetrahydrotetracene-2-carboxamide Chemical compound C=C1C2=C(Cl)C=CC(O)=C2C(O)=C2[C@@H]1[C@H](O)[C@H]1[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]1(O)C2=O RNIADBXQDMCFEN-IWVLMIASSA-N 0.000 description 1
- FFTVPQUHLQBXQZ-KVUCHLLUSA-N (4s,4as,5ar,12ar)-4,7-bis(dimethylamino)-1,10,11,12a-tetrahydroxy-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1C2=C(N(C)C)C=CC(O)=C2C(O)=C2[C@@H]1C[C@H]1[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]1(O)C2=O FFTVPQUHLQBXQZ-KVUCHLLUSA-N 0.000 description 1
- MTCQOMXDZUULRV-ADOAZJKMSA-N (4s,4as,5ar,12ar)-4-(dimethylamino)-1,10,11,12a-tetrahydroxy-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1C2=CC=CC(O)=C2C(O)=C2[C@@H]1C[C@H]1[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]1(O)C2=O MTCQOMXDZUULRV-ADOAZJKMSA-N 0.000 description 1
- GUXHBMASAHGULD-SEYHBJAFSA-N (4s,4as,5as,6s,12ar)-7-chloro-4-(dimethylamino)-1,6,10,11,12a-pentahydroxy-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1([C@H]2O)=C(Cl)C=CC(O)=C1C(O)=C1[C@@H]2C[C@H]2[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]2(O)C1=O GUXHBMASAHGULD-SEYHBJAFSA-N 0.000 description 1
- FAMUIRDLAWWMCQ-AQFAATAFSA-N (4s,4as,5as,6s,12ar)-n-[[4-[n-(diaminomethylidene)carbamimidoyl]piperazin-1-yl]methyl]-4-(dimethylamino)-1,6,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4,4a,5,5a-tetrahydrotetracene-2-carboxamide Chemical compound OC([C@@]1(O)C(=O)C=2[C@@H]([C@](C3=CC=CC(O)=C3C=2O)(C)O)C[C@H]1[C@@H](C1=O)N(C)C)=C1C(=O)NCN1CCN(C(=N)N=C(N)N)CC1 FAMUIRDLAWWMCQ-AQFAATAFSA-N 0.000 description 1
- QKDHBVNJCZBTMR-LLVKDONJSA-N (R)-temafloxacin Chemical compound C1CN[C@H](C)CN1C(C(=C1)F)=CC2=C1C(=O)C(C(O)=O)=CN2C1=CC=C(F)C=C1F QKDHBVNJCZBTMR-LLVKDONJSA-N 0.000 description 1
- WHTVZRBIWZFKQO-AWEZNQCLSA-N (S)-chloroquine Chemical compound ClC1=CC=C2C(N[C@@H](C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-AWEZNQCLSA-N 0.000 description 1
- HRKBEOWSWBHJNM-UHFFFAOYSA-N 1,1-dioxo-2h-1$l^{6},2-benzothiazin-4-ol Chemical compound C1=CC=C2C(O)=CNS(=O)(=O)C2=C1 HRKBEOWSWBHJNM-UHFFFAOYSA-N 0.000 description 1
- XOZLRRYPUKAKMU-UHFFFAOYSA-N 1,5-dimethyl-2-phenyl-4-(propan-2-ylamino)-3-pyrazolone Chemical compound O=C1C(NC(C)C)=C(C)N(C)N1C1=CC=CC=C1 XOZLRRYPUKAKMU-UHFFFAOYSA-N 0.000 description 1
- VAFNJIFAZJWWNI-UHFFFAOYSA-N 1-(cyclopropylmethyl)-6-methoxy-4-phenylquinazolin-2-one Chemical compound O=C1N=C(C=2C=CC=CC=2)C2=CC(OC)=CC=C2N1CC1CC1 VAFNJIFAZJWWNI-UHFFFAOYSA-N 0.000 description 1
- FMBVHKPWDJQLNO-UHFFFAOYSA-N 1-[(3-fluorophenyl)methyl]-5-nitroindazole Chemical compound N1=CC2=CC([N+](=O)[O-])=CC=C2N1CC1=CC=CC(F)=C1 FMBVHKPWDJQLNO-UHFFFAOYSA-N 0.000 description 1
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 1
- IDINUJSAMVOPCM-UHFFFAOYSA-N 15-Deoxyspergualin Natural products NCCCNCCCCNC(=O)C(O)NC(=O)CCCCCCN=C(N)N IDINUJSAMVOPCM-UHFFFAOYSA-N 0.000 description 1
- MPDGHEJMBKOTSU-YKLVYJNSSA-N 18beta-glycyrrhetic acid Chemical compound C([C@H]1C2=CC(=O)[C@H]34)[C@@](C)(C(O)=O)CC[C@]1(C)CC[C@@]2(C)[C@]4(C)CC[C@@H]1[C@]3(C)CC[C@H](O)C1(C)C MPDGHEJMBKOTSU-YKLVYJNSSA-N 0.000 description 1
- JNCSKMUPCTYDLO-UHFFFAOYSA-N 1h-imidazole;1h-pyridin-2-one Chemical class C1=CNC=N1.OC1=CC=CC=N1 JNCSKMUPCTYDLO-UHFFFAOYSA-N 0.000 description 1
- IHPYMWDTONKSCO-UHFFFAOYSA-N 2,2'-piperazine-1,4-diylbisethanesulfonic acid Chemical compound OS(=O)(=O)CCN1CCN(CCS(O)(=O)=O)CC1 IHPYMWDTONKSCO-UHFFFAOYSA-N 0.000 description 1
- SMQXDOVGKKMUIZ-UHFFFAOYSA-N 2,2,2-trichloroethyl n-(4-phenyl-1,3-thiazol-2-yl)carbamate Chemical compound S1C(NC(=O)OCC(Cl)(Cl)Cl)=NC(C=2C=CC=CC=2)=C1 SMQXDOVGKKMUIZ-UHFFFAOYSA-N 0.000 description 1
- DHCNAWNKZMNTIS-UHFFFAOYSA-N 2,4,6-trimethyl-1,4-dihydropyridine-3,5-dicarboxylic acid O3-methyl ester O5-[2-(phenylthio)ethyl] ester Chemical compound CC1C(C(=O)OC)=C(C)NC(C)=C1C(=O)OCCSC1=CC=CC=C1 DHCNAWNKZMNTIS-UHFFFAOYSA-N 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- AZCOEIZFVQEQCU-UHFFFAOYSA-N 2-(1-benzoyl-2-methylindol-3-yl)acetic acid Chemical compound CC1=C(CC(O)=O)C2=CC=CC=C2N1C(=O)C1=CC=CC=C1 AZCOEIZFVQEQCU-UHFFFAOYSA-N 0.000 description 1
- OCOCFNMFLNFNIA-ZSCHJXSPSA-N 2-(1-benzylindazol-3-yl)oxyacetic acid;(2s)-2,6-diaminohexanoic acid Chemical compound [NH3+]CCCC[C@H]([NH3+])C([O-])=O.C12=CC=CC=C2C(OCC(=O)[O-])=NN1CC1=CC=CC=C1 OCOCFNMFLNFNIA-ZSCHJXSPSA-N 0.000 description 1
- KLIVRBFRQSOGQI-UHFFFAOYSA-N 2-(11-oxo-6h-benzo[c][1]benzothiepin-3-yl)acetic acid Chemical compound S1CC2=CC=CC=C2C(=O)C2=CC=C(CC(=O)O)C=C12 KLIVRBFRQSOGQI-UHFFFAOYSA-N 0.000 description 1
- ZAVJTSLIGAGALR-UHFFFAOYSA-N 2-(2,2,2-trifluoroacetyl)cyclooctan-1-one Chemical compound FC(F)(F)C(=O)C1CCCCCCC1=O ZAVJTSLIGAGALR-UHFFFAOYSA-N 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- MYQXHLQMZLTSDB-UHFFFAOYSA-N 2-(2-ethyl-2,3-dihydro-1-benzofuran-5-yl)acetic acid Chemical compound OC(=O)CC1=CC=C2OC(CC)CC2=C1 MYQXHLQMZLTSDB-UHFFFAOYSA-N 0.000 description 1
- RYDUZJFCKYTEHX-UHFFFAOYSA-N 2-(2-propan-2-yl-2,3-dihydro-1h-inden-5-yl)propanoic acid Chemical compound C1=C(C(C)C(O)=O)C=C2CC(C(C)C)CC2=C1 RYDUZJFCKYTEHX-UHFFFAOYSA-N 0.000 description 1
- BHNQPLPANNDEGL-UHFFFAOYSA-N 2-(4-octylphenoxy)ethanol Chemical compound CCCCCCCCC1=CC=C(OCCO)C=C1 BHNQPLPANNDEGL-UHFFFAOYSA-N 0.000 description 1
- KWGCXQZMMAVJTB-UHFFFAOYSA-N 2-(8-chlorodibenzofuran-3-yl)propanoic acid Chemical compound C1=C(Cl)C=C2C3=CC=C(C(C(O)=O)C)C=C3OC2=C1 KWGCXQZMMAVJTB-UHFFFAOYSA-N 0.000 description 1
- TXUGZLRUFAAHAO-LFIBNONCSA-N 2-(dimethylamino)ethyl 2-[(e)-1-(4-chlorophenyl)ethylideneamino]oxyacetate Chemical compound CN(C)CCOC(=O)CO\N=C(/C)C1=CC=C(Cl)C=C1 TXUGZLRUFAAHAO-LFIBNONCSA-N 0.000 description 1
- ACTOXUHEUCPTEW-BWHGAVFKSA-N 2-[(4r,5s,6s,7r,9r,10r,11e,13e,16r)-6-[(2s,3r,4r,5s,6r)-5-[(2s,4r,5s,6s)-4,5-dihydroxy-4,6-dimethyloxan-2-yl]oxy-4-(dimethylamino)-3-hydroxy-6-methyloxan-2-yl]oxy-10-[(2s,5s,6r)-5-(dimethylamino)-6-methyloxan-2-yl]oxy-4-hydroxy-5-methoxy-9,16-dimethyl-2-o Chemical compound O([C@H]1/C=C/C=C/C[C@@H](C)OC(=O)C[C@@H](O)[C@@H]([C@H]([C@@H](CC=O)C[C@H]1C)O[C@H]1[C@@H]([C@H]([C@H](O[C@@H]2O[C@@H](C)[C@H](O)[C@](C)(O)C2)[C@@H](C)O1)N(C)C)O)OC)[C@@H]1CC[C@H](N(C)C)[C@@H](C)O1 ACTOXUHEUCPTEW-BWHGAVFKSA-N 0.000 description 1
- DCXHLPGLBYHNMU-UHFFFAOYSA-N 2-[1-(4-azidobenzoyl)-5-methoxy-2-methylindol-3-yl]acetic acid Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(N=[N+]=[N-])C=C1 DCXHLPGLBYHNMU-UHFFFAOYSA-N 0.000 description 1
- XLVXAUNDHWERBM-IVGWJTKZSA-N 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methylindol-3-yl]-n-[(2r,3r,4s,5r)-3,4,5,6-tetrahydroxy-1-oxohexan-2-yl]acetamide Chemical compound CC1=C(CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 XLVXAUNDHWERBM-IVGWJTKZSA-N 0.000 description 1
- JBJASTVVFKIZBG-UHFFFAOYSA-N 2-[2-(2-methylpropyl)-4,5-diphenylpyrazol-3-yl]acetic acid Chemical compound OC(=O)CC=1N(CC(C)C)N=C(C=2C=CC=CC=2)C=1C1=CC=CC=C1 JBJASTVVFKIZBG-UHFFFAOYSA-N 0.000 description 1
- APBSKHYXXKHJFK-UHFFFAOYSA-N 2-[2-(4-chlorophenyl)-1,3-thiazol-4-yl]acetic acid Chemical compound OC(=O)CC1=CSC(C=2C=CC(Cl)=CC=2)=N1 APBSKHYXXKHJFK-UHFFFAOYSA-N 0.000 description 1
- ANMLJLFWUCQGKZ-UHFFFAOYSA-N 2-[3-(trifluoromethyl)anilino]-3-pyridinecarboxylic acid (3-oxo-1H-isobenzofuran-1-yl) ester Chemical compound FC(F)(F)C1=CC=CC(NC=2C(=CC=CN=2)C(=O)OC2C3=CC=CC=C3C(=O)O2)=C1 ANMLJLFWUCQGKZ-UHFFFAOYSA-N 0.000 description 1
- XILVEPYQJIOVNB-UHFFFAOYSA-N 2-[3-(trifluoromethyl)anilino]benzoic acid 2-(2-hydroxyethoxy)ethyl ester Chemical compound OCCOCCOC(=O)C1=CC=CC=C1NC1=CC=CC(C(F)(F)F)=C1 XILVEPYQJIOVNB-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- TYCOFFBAZNSQOJ-UHFFFAOYSA-N 2-[4-(3-fluorophenyl)phenyl]propanoic acid Chemical compound C1=CC(C(C(O)=O)C)=CC=C1C1=CC=CC(F)=C1 TYCOFFBAZNSQOJ-UHFFFAOYSA-N 0.000 description 1
- YAMFWQIVVMITPG-UHFFFAOYSA-N 2-[4-(4-chlorophenyl)-1-(4-fluorophenyl)pyrazol-3-yl]acetic acid Chemical compound OC(=O)CC1=NN(C=2C=CC(F)=CC=2)C=C1C1=CC=C(Cl)C=C1 YAMFWQIVVMITPG-UHFFFAOYSA-N 0.000 description 1
- JIEKMACRVQTPRC-UHFFFAOYSA-N 2-[4-(4-chlorophenyl)-2-phenyl-5-thiazolyl]acetic acid Chemical compound OC(=O)CC=1SC(C=2C=CC=CC=2)=NC=1C1=CC=C(Cl)C=C1 JIEKMACRVQTPRC-UHFFFAOYSA-N 0.000 description 1
- XUDSQIDNHJMBBW-FOWTUZBSSA-N 2-[4-[(e)-n-hydroxy-c-methylcarbonimidoyl]phenoxy]-1-piperidin-1-ylethanone Chemical compound C1=CC(C(=N/O)/C)=CC=C1OCC(=O)N1CCCCC1 XUDSQIDNHJMBBW-FOWTUZBSSA-N 0.000 description 1
- WGDADRBTCPGSDG-UHFFFAOYSA-N 2-[[4,5-bis(4-chlorophenyl)-1,3-oxazol-2-yl]sulfanyl]propanoic acid Chemical compound O1C(SC(C)C(O)=O)=NC(C=2C=CC(Cl)=CC=2)=C1C1=CC=C(Cl)C=C1 WGDADRBTCPGSDG-UHFFFAOYSA-N 0.000 description 1
- XKSAJZSJKURQRX-UHFFFAOYSA-N 2-acetyloxy-5-(4-fluorophenyl)benzoic acid Chemical compound C1=C(C(O)=O)C(OC(=O)C)=CC=C1C1=CC=C(F)C=C1 XKSAJZSJKURQRX-UHFFFAOYSA-N 0.000 description 1
- JJBCTCGUOQYZHK-UHFFFAOYSA-N 2-acetyloxybenzoate;(5-amino-1-carboxypentyl)azanium Chemical compound OC(=O)C(N)CCCC[NH3+].CC(=O)OC1=CC=CC=C1C([O-])=O JJBCTCGUOQYZHK-UHFFFAOYSA-N 0.000 description 1
- MSWZFWKMSRAUBD-IVMDWMLBSA-N 2-amino-2-deoxy-D-glucopyranose Chemical compound N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-IVMDWMLBSA-N 0.000 description 1
- XCHHJFVNQPPLJK-UHFFFAOYSA-N 2-carboxyphenolate;1h-imidazol-1-ium Chemical compound C1=CNC=N1.OC(=O)C1=CC=CC=C1O XCHHJFVNQPPLJK-UHFFFAOYSA-N 0.000 description 1
- MECVOSKQBMPUFG-UHFFFAOYSA-N 2-carboxyphenolate;morpholin-4-ium Chemical compound C1COCCN1.OC(=O)C1=CC=CC=C1O MECVOSKQBMPUFG-UHFFFAOYSA-N 0.000 description 1
- GXEUNRBWEAIPCN-UHFFFAOYSA-N 2-chloro-2-(3-chloro-4-cyclohexylphenyl)acetic acid Chemical compound ClC1=CC(C(Cl)C(=O)O)=CC=C1C1CCCCC1 GXEUNRBWEAIPCN-UHFFFAOYSA-N 0.000 description 1
- KZMAWJRXKGLWGS-UHFFFAOYSA-N 2-chloro-n-[4-(4-methoxyphenyl)-1,3-thiazol-2-yl]-n-(3-methoxypropyl)acetamide Chemical compound S1C(N(C(=O)CCl)CCCOC)=NC(C=2C=CC(OC)=CC=2)=C1 KZMAWJRXKGLWGS-UHFFFAOYSA-N 0.000 description 1
- SQVNITZYWXMWOG-UHFFFAOYSA-N 2-cyclohexyl-1-(2-methylquinolin-4-yl)-3-(1,3-thiazol-2-yl)guanidine Chemical compound C=12C=CC=CC2=NC(C)=CC=1NC(=NC1CCCCC1)NC1=NC=CS1 SQVNITZYWXMWOG-UHFFFAOYSA-N 0.000 description 1
- XOCZGIFMFBFPGQ-UHFFFAOYSA-N 2-methyl-n-[2-[(2-methylbenzoyl)amino]-1,2-dipyridin-4-ylethyl]benzamide Chemical compound CC1=CC=CC=C1C(=O)NC(C=1C=CN=CC=1)C(C=1C=CN=CC=1)NC(=O)C1=CC=CC=C1C XOCZGIFMFBFPGQ-UHFFFAOYSA-N 0.000 description 1
- FFKUDWZICMJVPA-UHFFFAOYSA-N 2-phosphonooxybenzoic acid Chemical compound OC(=O)C1=CC=CC=C1OP(O)(O)=O FFKUDWZICMJVPA-UHFFFAOYSA-N 0.000 description 1
- ZGUHNWLPPVJTOG-UHFFFAOYSA-N 2-propyl-2h-phenazin-1-one Chemical compound C1=CC=C2N=C(C(C(CCC)C=C3)=O)C3=NC2=C1 ZGUHNWLPPVJTOG-UHFFFAOYSA-N 0.000 description 1
- PYSICVOJSJMFKP-UHFFFAOYSA-N 3,5-dibromo-2-chloropyridine Chemical compound ClC1=NC=C(Br)C=C1Br PYSICVOJSJMFKP-UHFFFAOYSA-N 0.000 description 1
- VPMZGRVNLHDREW-UHFFFAOYSA-N 3-(2-benzylindazol-3-yl)sulfanyl-n,n-dimethylpropan-1-amine Chemical compound N1=C2C=CC=CC2=C(SCCCN(C)C)N1CC1=CC=CC=C1 VPMZGRVNLHDREW-UHFFFAOYSA-N 0.000 description 1
- PLZMRGRLCWCLFW-UHFFFAOYSA-N 3-[5-(3-bromophenyl)tetrazol-2-yl]-1-piperidin-1-ylpropan-1-one Chemical compound BrC1=CC=CC(C2=NN(CCC(=O)N3CCCCC3)N=N2)=C1 PLZMRGRLCWCLFW-UHFFFAOYSA-N 0.000 description 1
- YLJRTDTWWRXOFG-UHFFFAOYSA-N 3-[5-(4-chlorophenyl)furan-2-yl]-3-hydroxypropanoic acid Chemical compound O1C(C(CC(O)=O)O)=CC=C1C1=CC=C(Cl)C=C1 YLJRTDTWWRXOFG-UHFFFAOYSA-N 0.000 description 1
- FXFBGEDPBBRUFN-UHFFFAOYSA-N 3-chloro-6,6a-dihydro-1ah-indeno[1,2-b]oxirene Chemical compound C12=CC(Cl)=CC=C2CC2C1O2 FXFBGEDPBBRUFN-UHFFFAOYSA-N 0.000 description 1
- XUOAKFNMJMYKBY-UHFFFAOYSA-N 4,5-bis(4-fluorophenyl)-2-(1,1,2,2-tetrafluoroethylsulfonyl)-1h-imidazole Chemical compound N1C(S(=O)(=O)C(F)(F)C(F)F)=NC(C=2C=CC(F)=CC=2)=C1C1=CC=C(F)C=C1 XUOAKFNMJMYKBY-UHFFFAOYSA-N 0.000 description 1
- TYNLGDBUJLVSMA-UHFFFAOYSA-N 4,5-diacetyloxy-9,10-dioxo-2-anthracenecarboxylic acid Chemical compound O=C1C2=CC(C(O)=O)=CC(OC(C)=O)=C2C(=O)C2=C1C=CC=C2OC(=O)C TYNLGDBUJLVSMA-UHFFFAOYSA-N 0.000 description 1
- MBKWNJVQSFBLQI-UHFFFAOYSA-N 4-(4-chlorophenyl)-5-methyl-1h-imidazole Chemical compound N1C=NC(C=2C=CC(Cl)=CC=2)=C1C MBKWNJVQSFBLQI-UHFFFAOYSA-N 0.000 description 1
- WOVTUUKKGNHVFZ-UHFFFAOYSA-N 4-(fluoren-9-ylidenemethyl)benzenecarboximidamide Chemical compound C1=CC(C(=N)N)=CC=C1C=C1C2=CC=CC=C2C2=CC=CC=C21 WOVTUUKKGNHVFZ-UHFFFAOYSA-N 0.000 description 1
- IEZSLVKNOOIGQP-UHFFFAOYSA-N 4-[2-(6-chloropyridin-2-yl)sulfanylethyl]morpholine Chemical compound ClC1=CC=CC(SCCN2CCOCC2)=N1 IEZSLVKNOOIGQP-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- KNKRHSVKIORZQB-UHFFFAOYSA-N 4-bromo-2-(hydroxymethyl)phenol Chemical compound OCC1=CC(Br)=CC=C1O KNKRHSVKIORZQB-UHFFFAOYSA-N 0.000 description 1
- IMKNHLPRDSWAHW-UHFFFAOYSA-N 4-butyl-1,2-diphenylpyrazolidine-3,5-dione;4,5-dihydro-1,3-thiazol-2-amine Chemical compound NC1=NCCS1.O=C1C(CCCC)C(=O)N(C=2C=CC=CC=2)N1C1=CC=CC=C1 IMKNHLPRDSWAHW-UHFFFAOYSA-N 0.000 description 1
- SYCHUQUJURZQMO-UHFFFAOYSA-N 4-hydroxy-2-methyl-1,1-dioxo-n-(1,3-thiazol-2-yl)-1$l^{6},2-benzothiazine-3-carboxamide Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC1=NC=CS1 SYCHUQUJURZQMO-UHFFFAOYSA-N 0.000 description 1
- PJJGZPJJTHBVMX-UHFFFAOYSA-N 5,7-Dihydroxyisoflavone Chemical compound C=1C(O)=CC(O)=C(C2=O)C=1OC=C2C1=CC=CC=C1 PJJGZPJJTHBVMX-UHFFFAOYSA-N 0.000 description 1
- DVEQCIBLXRSYPH-UHFFFAOYSA-N 5-butyl-1-cyclohexylbarbituric acid Chemical compound O=C1C(CCCC)C(=O)NC(=O)N1C1CCCCC1 DVEQCIBLXRSYPH-UHFFFAOYSA-N 0.000 description 1
- MJZJYWCQPMNPRM-UHFFFAOYSA-N 6,6-dimethyl-1-[3-(2,4,5-trichlorophenoxy)propoxy]-1,6-dihydro-1,3,5-triazine-2,4-diamine Chemical compound CC1(C)N=C(N)N=C(N)N1OCCCOC1=CC(Cl)=C(Cl)C=C1Cl MJZJYWCQPMNPRM-UHFFFAOYSA-N 0.000 description 1
- MYYIMZRZXIQBGI-HVIRSNARSA-N 6alpha-Fluoroprednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3C[C@H](F)C2=C1 MYYIMZRZXIQBGI-HVIRSNARSA-N 0.000 description 1
- ANOGOQXCGBMIJV-UHFFFAOYSA-N 7-chloro-n-(3,4-dichlorophenyl)-5-hydroxy-1,1-dioxo-2,3-dihydro-1$l^{6}-benzothiepine-4-carboxamide Chemical compound C1CS(=O)(=O)C2=CC=C(Cl)C=C2C(O)=C1C(=O)NC1=CC=C(Cl)C(Cl)=C1 ANOGOQXCGBMIJV-UHFFFAOYSA-N 0.000 description 1
- JAJIPIAHCFBEPI-UHFFFAOYSA-N 9,10-dioxoanthracene-1-sulfonic acid Chemical compound O=C1C2=CC=CC=C2C(=O)C2=C1C=CC=C2S(=O)(=O)O JAJIPIAHCFBEPI-UHFFFAOYSA-N 0.000 description 1
- GSDSWSVVBLHKDQ-UHFFFAOYSA-N 9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid Chemical compound FC1=CC(C(C(C(O)=O)=C2)=O)=C3N2C(C)COC3=C1N1CCN(C)CC1 GSDSWSVVBLHKDQ-UHFFFAOYSA-N 0.000 description 1
- 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 108010011170 Ala-Trp-Arg-His-Pro-Gln-Phe-Gly-Gly Proteins 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 208000031873 Animal Disease Models Diseases 0.000 description 1
- WZPBZJONDBGPKJ-UHFFFAOYSA-N Antibiotic SQ 26917 Natural products O=C1N(S(O)(=O)=O)C(C)C1NC(=O)C(=NOC(C)(C)C(O)=O)C1=CSC(N)=N1 WZPBZJONDBGPKJ-UHFFFAOYSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 200000000007 Arterial disease Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- XHVAWZZCDCWGBK-WYRLRVFGSA-M Aurothioglucose Chemical compound OC[C@H]1O[C@H](S[Au])[C@H](O)[C@@H](O)[C@@H]1O XHVAWZZCDCWGBK-WYRLRVFGSA-M 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 201000006474 Brain Ischemia Diseases 0.000 description 1
- VOVIALXJUBGFJZ-KWVAZRHASA-N Budesonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3OC(CCC)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O VOVIALXJUBGFJZ-KWVAZRHASA-N 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- QWOJMRHUQHTCJG-UHFFFAOYSA-N CC([CH2-])=O Chemical compound CC([CH2-])=O QWOJMRHUQHTCJG-UHFFFAOYSA-N 0.000 description 1
- 201000003274 CINCA syndrome Diseases 0.000 description 1
- 206010006895 Cachexia Diseases 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical class [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 102000000584 Calmodulin Human genes 0.000 description 1
- 108010041952 Calmodulin Proteins 0.000 description 1
- 241000904011 Carcharhinus perezii Species 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 206010007710 Cartilage injury Diseases 0.000 description 1
- UQLLWWBDSUHNEB-CZUORRHYSA-N Cefaprin Chemical compound N([C@H]1[C@@H]2N(C1=O)C(=C(CS2)COC(=O)C)C(O)=O)C(=O)CSC1=CC=NC=C1 UQLLWWBDSUHNEB-CZUORRHYSA-N 0.000 description 1
- GNWUOVJNSFPWDD-XMZRARIVSA-M Cefoxitin sodium Chemical compound [Na+].N([C@]1(OC)C(N2C(=C(COC(N)=O)CS[C@@H]21)C([O-])=O)=O)C(=O)CC1=CC=CS1 GNWUOVJNSFPWDD-XMZRARIVSA-M 0.000 description 1
- 206010008120 Cerebral ischaemia Diseases 0.000 description 1
- 229920002101 Chitin Polymers 0.000 description 1
- 239000004099 Chlortetracycline Substances 0.000 description 1
- UDKCHVLMFQVBAA-UHFFFAOYSA-M Choline salicylate Chemical compound C[N+](C)(C)CCO.OC1=CC=CC=C1C([O-])=O UDKCHVLMFQVBAA-UHFFFAOYSA-M 0.000 description 1
- 206010008874 Chronic Fatigue Syndrome Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- HZZVJAQRINQKSD-UHFFFAOYSA-N Clavulanic acid Natural products OC(=O)C1C(=CCO)OC2CC(=O)N21 HZZVJAQRINQKSD-UHFFFAOYSA-N 0.000 description 1
- OIRAEJWYWSAQNG-UHFFFAOYSA-N Clidanac Chemical compound ClC=1C=C2C(C(=O)O)CCC2=CC=1C1CCCCC1 OIRAEJWYWSAQNG-UHFFFAOYSA-N 0.000 description 1
- FBRAWBYQGRLCEK-AVVSTMBFSA-N Clobetasone butyrate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CCl)(OC(=O)CCC)[C@@]1(C)CC2=O FBRAWBYQGRLCEK-AVVSTMBFSA-N 0.000 description 1
- 108010078777 Colistin Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- OMFXVFTZEKFJBZ-UHFFFAOYSA-N Corticosterone Natural products O=C1CCC2(C)C3C(O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 OMFXVFTZEKFJBZ-UHFFFAOYSA-N 0.000 description 1
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 1
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 229930105110 Cyclosporin A Natural products 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- VVNCNSJFMMFHPL-VKHMYHEASA-N D-penicillamine Chemical compound CC(C)(S)[C@@H](N)C(O)=O VVNCNSJFMMFHPL-VKHMYHEASA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- MQJKPEGWNLWLTK-UHFFFAOYSA-N Dapsone Chemical compound C1=CC(N)=CC=C1S(=O)(=O)C1=CC=C(N)C=C1 MQJKPEGWNLWLTK-UHFFFAOYSA-N 0.000 description 1
- FMTDIUIBLCQGJB-UHFFFAOYSA-N Demethylchlortetracyclin Natural products C1C2C(O)C3=C(Cl)C=CC(O)=C3C(=O)C2=C(O)C2(O)C1C(N(C)C)C(O)=C(C(N)=O)C2=O FMTDIUIBLCQGJB-UHFFFAOYSA-N 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- HHJIUUAMYGBVSD-YTFFSALGSA-N Diflucortolone valerate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)COC(=O)CCCC)[C@@]2(C)C[C@@H]1O HHJIUUAMYGBVSD-YTFFSALGSA-N 0.000 description 1
- WYQPLTPSGFELIB-JTQPXKBDSA-N Difluprednate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2CC[C@@](C(=O)COC(C)=O)(OC(=O)CCC)[C@@]2(C)C[C@@H]1O WYQPLTPSGFELIB-JTQPXKBDSA-N 0.000 description 1
- JWCSIUVGFCSJCK-CAVRMKNVSA-N Disodium Moxalactam Chemical compound N([C@]1(OC)C(N2C(=C(CSC=3N(N=NN=3)C)CO[C@@H]21)C(O)=O)=O)C(=O)C(C(O)=O)C1=CC=C(O)C=C1 JWCSIUVGFCSJCK-CAVRMKNVSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102000016942 Elastin Human genes 0.000 description 1
- 108010014258 Elastin Proteins 0.000 description 1
- URJQOOISAKEBKW-UHFFFAOYSA-N Emorfazone Chemical compound C1=NN(C)C(=O)C(OCC)=C1N1CCOCC1 URJQOOISAKEBKW-UHFFFAOYSA-N 0.000 description 1
- RHAXSHUQNIEUEY-UHFFFAOYSA-N Epirizole Chemical compound COC1=CC(C)=NN1C1=NC(C)=CC(OC)=N1 RHAXSHUQNIEUEY-UHFFFAOYSA-N 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 208000035690 Familial cold urticaria Diseases 0.000 description 1
- RBBWCVQDXDFISW-UHFFFAOYSA-N Feprazone Chemical compound O=C1C(CC=C(C)C)C(=O)N(C=2C=CC=CC=2)N1C1=CC=CC=C1 RBBWCVQDXDFISW-UHFFFAOYSA-N 0.000 description 1
- APQPGQGAWABJLN-UHFFFAOYSA-N Floctafenine Chemical compound OCC(O)COC(=O)C1=CC=CC=C1NC1=CC=NC2=C(C(F)(F)F)C=CC=C12 APQPGQGAWABJLN-UHFFFAOYSA-N 0.000 description 1
- UIOFUWFRIANQPC-JKIFEVAISA-N Floxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=C(F)C=CC=C1Cl UIOFUWFRIANQPC-JKIFEVAISA-N 0.000 description 1
- WJOHZNCJWYWUJD-IUGZLZTKSA-N Fluocinonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)COC(=O)C)[C@@]2(C)C[C@@H]1O WJOHZNCJWYWUJD-IUGZLZTKSA-N 0.000 description 1
- WHZRCUIISKRTJL-YTZKRAOUSA-N Fluocortolone caproate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)COC(=O)CCCCC)[C@@]2(C)C[C@@H]1O WHZRCUIISKRTJL-YTZKRAOUSA-N 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- MPDGHEJMBKOTSU-UHFFFAOYSA-N Glycyrrhetinsaeure Natural products C12C(=O)C=C3C4CC(C)(C(O)=O)CCC4(C)CCC3(C)C1(C)CCC1C2(C)CCC(O)C1(C)C MPDGHEJMBKOTSU-UHFFFAOYSA-N 0.000 description 1
- 201000005569 Gout Diseases 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- MUQNGPZZQDCDFT-JNQJZLCISA-N Halcinonide Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)CCl)[C@@]1(C)C[C@@H]2O MUQNGPZZQDCDFT-JNQJZLCISA-N 0.000 description 1
- YCISZOVUHXIOFY-HKXOFBAYSA-N Halopredone acetate Chemical compound C1([C@H](F)C2)=CC(=O)C(Br)=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2CC[C@](OC(C)=O)(C(=O)COC(=O)C)[C@@]2(C)C[C@@H]1O YCISZOVUHXIOFY-HKXOFBAYSA-N 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 101001076418 Homo sapiens Interleukin-1 receptor type 1 Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- HHZQLQREDATOBM-CODXZCKSSA-M Hydrocortisone Sodium Succinate Chemical compound [Na+].O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)COC(=O)CCC([O-])=O)[C@@H]4[C@@H]3CCC2=C1 HHZQLQREDATOBM-CODXZCKSSA-M 0.000 description 1
- BGSOJVFOEQLVMH-UHFFFAOYSA-N Hydrocortisone phosphate Natural products O=C1CCC2(C)C3C(O)CC(C)(C(CC4)(O)C(=O)COP(O)(O)=O)C4C3CCC2=C1 BGSOJVFOEQLVMH-UHFFFAOYSA-N 0.000 description 1
- FNFPHNZQOKBKHN-UHFFFAOYSA-N Hydrocortisone tebutate Natural products C1CC2=CC(=O)CCC2(C)C2C1C1CCC(C(=O)COC(=O)CC(C)(C)C)(O)C1(C)CC2O FNFPHNZQOKBKHN-UHFFFAOYSA-N 0.000 description 1
- 208000004454 Hyperalgesia Diseases 0.000 description 1
- 208000035154 Hyperesthesia Diseases 0.000 description 1
- 102000039996 IL-1 family Human genes 0.000 description 1
- 108091069196 IL-1 family Proteins 0.000 description 1
- HEFNNWSXXWATRW-UHFFFAOYSA-N Ibuprofen Chemical compound CC(C)CC1=CC=C(C(C)C(O)=O)C=C1 HEFNNWSXXWATRW-UHFFFAOYSA-N 0.000 description 1
- ACEWLPOYLGNNHV-UHFFFAOYSA-N Ibuprofen piconol Chemical compound C1=CC(CC(C)C)=CC=C1C(C)C(=O)OCC1=CC=CC=N1 ACEWLPOYLGNNHV-UHFFFAOYSA-N 0.000 description 1
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 229940119178 Interleukin 1 receptor antagonist Drugs 0.000 description 1
- 102000003777 Interleukin-1 beta Human genes 0.000 description 1
- 108090000193 Interleukin-1 beta Proteins 0.000 description 1
- 102000019223 Interleukin-1 receptor Human genes 0.000 description 1
- 108050006617 Interleukin-1 receptor Proteins 0.000 description 1
- 102100039880 Interleukin-1 receptor accessory protein Human genes 0.000 description 1
- 101710180389 Interleukin-1 receptor accessory protein Proteins 0.000 description 1
- 102100026016 Interleukin-1 receptor type 1 Human genes 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010038501 Interleukin-6 Receptors Proteins 0.000 description 1
- 102000010781 Interleukin-6 Receptors Human genes 0.000 description 1
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 1
- UETNIIAIRMUTSM-UHFFFAOYSA-N Jacareubin Natural products CC1(C)OC2=CC3Oc4c(O)c(O)ccc4C(=O)C3C(=C2C=C1)O UETNIIAIRMUTSM-UHFFFAOYSA-N 0.000 description 1
- 208000012659 Joint disease Diseases 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- 238000011050 LAL assay Methods 0.000 description 1
- 102100023981 Lamina-associated polypeptide 2, isoform alpha Human genes 0.000 description 1
- 101710163560 Lamina-associated polypeptide 2, isoform alpha Proteins 0.000 description 1
- 101710189385 Lamina-associated polypeptide 2, isoforms beta/gamma Proteins 0.000 description 1
- VKIHKZMKDNVEIK-PKLMIRHRSA-N Lefetamine hydrochloride Chemical compound [Cl-].C([C@@H]([NH+](C)C)C=1C=CC=CC=1)C1=CC=CC=C1 VKIHKZMKDNVEIK-PKLMIRHRSA-N 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- HLFSDGLLUJUHTE-SNVBAGLBSA-N Levamisole Chemical compound C1([C@H]2CN3CCSC3=N2)=CC=CC=C1 HLFSDGLLUJUHTE-SNVBAGLBSA-N 0.000 description 1
- 206010024453 Ligament sprain Diseases 0.000 description 1
- OJMMVQQUTAEWLP-UHFFFAOYSA-N Lincomycin Natural products CN1CC(CCC)CC1C(=O)NC(C(C)O)C1C(O)C(O)C(O)C(SC)O1 OJMMVQQUTAEWLP-UHFFFAOYSA-N 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- MQHWFIOJQSCFNM-UHFFFAOYSA-L Magnesium salicylate Chemical compound [Mg+2].OC1=CC=CC=C1C([O-])=O.OC1=CC=CC=C1C([O-])=O MQHWFIOJQSCFNM-UHFFFAOYSA-L 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- SBDNJUWAMKYJOX-UHFFFAOYSA-N Meclofenamic Acid Chemical compound CC1=CC=C(Cl)C(NC=2C(=CC=CC=2)C(O)=O)=C1Cl SBDNJUWAMKYJOX-UHFFFAOYSA-N 0.000 description 1
- GZENKSODFLBBHQ-ILSZZQPISA-N Medrysone Chemical compound C([C@@]12C)CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@H](C(C)=O)CC[C@H]21 GZENKSODFLBBHQ-ILSZZQPISA-N 0.000 description 1
- 108010036176 Melitten Proteins 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 description 1
- FQISKWAFAHGMGT-SGJOWKDISA-M Methylprednisolone sodium succinate Chemical compound [Na+].C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(=O)CCC([O-])=O)CC[C@H]21 FQISKWAFAHGMGT-SGJOWKDISA-M 0.000 description 1
- HZQDCMWJEBCWBR-UUOKFMHZSA-N Mizoribine Chemical compound OC1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 HZQDCMWJEBCWBR-UUOKFMHZSA-N 0.000 description 1
- 101710159910 Movement protein Proteins 0.000 description 1
- 201000002795 Muckle-Wells syndrome Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 102000008934 Muscle Proteins Human genes 0.000 description 1
- 108010074084 Muscle Proteins Proteins 0.000 description 1
- 208000021642 Muscular disease Diseases 0.000 description 1
- 201000009623 Myopathy Diseases 0.000 description 1
- BLXXJMDCKKHMKV-UHFFFAOYSA-N Nabumetone Chemical compound C1=C(CCC(C)=O)C=CC2=CC(OC)=CC=C21 BLXXJMDCKKHMKV-UHFFFAOYSA-N 0.000 description 1
- CMWTZPSULFXXJA-UHFFFAOYSA-N Naproxen Natural products C1=C(C(C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-UHFFFAOYSA-N 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- JZFPYUNJRRFVQU-UHFFFAOYSA-N Niflumic acid Chemical compound OC(=O)C1=CC=CN=C1NC1=CC=CC(C(F)(F)F)=C1 JZFPYUNJRRFVQU-UHFFFAOYSA-N 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 239000004100 Oxytetracycline Substances 0.000 description 1
- 108091006006 PEGylated Proteins Proteins 0.000 description 1
- 239000007990 PIPES buffer Substances 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- MKPDWECBUAZOHP-AFYJWTTESA-N Paramethasone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]2(C)C[C@@H]1O MKPDWECBUAZOHP-AFYJWTTESA-N 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 229930195708 Penicillin V Natural products 0.000 description 1
- 108010071384 Peptide T Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 108010020346 Polyglutamic Acid Proteins 0.000 description 1
- 108010093965 Polymyxin B Proteins 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- TVQZAMVBTVNYLA-UHFFFAOYSA-N Pranoprofen Chemical compound C1=CC=C2CC3=CC(C(C(O)=O)C)=CC=C3OC2=N1 TVQZAMVBTVNYLA-UHFFFAOYSA-N 0.000 description 1
- HUMXXHTVHHLNRO-KAJVQRHHSA-N Prednisolone tebutate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)CC(C)(C)C)(O)[C@@]1(C)C[C@@H]2O HUMXXHTVHHLNRO-KAJVQRHHSA-N 0.000 description 1
- 208000006399 Premature Obstetric Labor Diseases 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102000007327 Protamines Human genes 0.000 description 1
- 108010007568 Protamines Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102100024147 Protein phosphatase 1 regulatory subunit 14A Human genes 0.000 description 1
- VSQMKHNDXWGCDB-UHFFFAOYSA-N Protizinic acid Chemical compound OC(=O)C(C)C1=CC=C2SC3=CC(OC)=CC=C3N(C)C2=C1 VSQMKHNDXWGCDB-UHFFFAOYSA-N 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 239000012564 Q sepharose fast flow resin Substances 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- MEFKEPWMEQBLKI-AIRLBKTGSA-N S-adenosyl-L-methioninate Chemical compound O[C@@H]1[C@H](O)[C@@H](C[S+](CC[C@H](N)C([O-])=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 MEFKEPWMEQBLKI-AIRLBKTGSA-N 0.000 description 1
- CDMGBJANTYXAIV-UHFFFAOYSA-N SB 203580 Chemical compound C1=CC(S(=O)C)=CC=C1C1=NC(C=2C=CC(F)=CC=2)=C(C=2C=CN=CC=2)N1 CDMGBJANTYXAIV-UHFFFAOYSA-N 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- SKZKKFZAGNVIMN-UHFFFAOYSA-N Salicilamide Chemical compound NC(=O)C1=CC=CC=C1O SKZKKFZAGNVIMN-UHFFFAOYSA-N 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- ABBQHOQBGMUPJH-UHFFFAOYSA-M Sodium salicylate Chemical compound [Na+].OC1=CC=CC=C1C([O-])=O ABBQHOQBGMUPJH-UHFFFAOYSA-M 0.000 description 1
- 239000004187 Spiramycin Substances 0.000 description 1
- 208000010040 Sprains and Strains Diseases 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- NHUHCSRWZMLRLA-UHFFFAOYSA-N Sulfisoxazole Chemical compound CC1=NOC(NS(=O)(=O)C=2C=CC(N)=CC=2)=C1C NHUHCSRWZMLRLA-UHFFFAOYSA-N 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- WKDDRNSBRWANNC-UHFFFAOYSA-N Thienamycin Natural products C1C(SCCN)=C(C(O)=O)N2C(=O)C(C(O)C)C21 WKDDRNSBRWANNC-UHFFFAOYSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 239000000898 Thymopoietin Substances 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- TZIZWYVVGLXXFV-FLRHRWPCSA-N Triamcinolone hexacetonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)COC(=O)CC(C)(C)C)[C@@]1(C)C[C@@H]2O TZIZWYVVGLXXFV-FLRHRWPCSA-N 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 206010054094 Tumour necrosis Diseases 0.000 description 1
- 102000044159 Ubiquitin Human genes 0.000 description 1
- 108090000848 Ubiquitin Proteins 0.000 description 1
- JDLSRXWHEBFHNC-UHFFFAOYSA-N Ufenamate Chemical compound CCCCOC(=O)C1=CC=CC=C1NC1=CC=CC(C(F)(F)F)=C1 JDLSRXWHEBFHNC-UHFFFAOYSA-N 0.000 description 1
- 238000005411 Van der Waals force Methods 0.000 description 1
- GDODKYPBSZCPOO-XFMGTHRKSA-N [(3r)-1-[(2r,3r,4r,5s,6r)-2-[[(2r,3s,4r,5r,6r)-3-hydroxy-4-[(3r)-3-hydroxydecoxy]-5-(3-oxotetradecanoylamino)-6-phosphonooxyoxan-2-yl]methoxy]-6-(methoxymethyl)-3-(3-oxotetradecanoylamino)-5-phosphonooxyoxan-4-yl]oxydecan-3-yl] (z)-dodec-5-enoate Chemical compound O[C@H]1[C@H](OCC[C@H](O)CCCCCCC)[C@@H](NC(=O)CC(=O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O[C@@H]1CO[C@H]1[C@H](NC(=O)CC(=O)CCCCCCCCCCC)[C@@H](OCC[C@@H](CCCCCCC)OC(=O)CCC\C=C/CCCCCC)[C@H](OP(O)(O)=O)[C@@H](COC)O1 GDODKYPBSZCPOO-XFMGTHRKSA-N 0.000 description 1
- FBRAWBYQGRLCEK-UHFFFAOYSA-N [17-(2-chloroacetyl)-9-fluoro-10,13,16-trimethyl-3,11-dioxo-7,8,12,14,15,16-hexahydro-6h-cyclopenta[a]phenanthren-17-yl] butanoate Chemical compound C1CC2=CC(=O)C=CC2(C)C2(F)C1C1CC(C)C(C(=O)CCl)(OC(=O)CCC)C1(C)CC2=O FBRAWBYQGRLCEK-UHFFFAOYSA-N 0.000 description 1
- IFXNTPMREPCLFJ-SLPNHVECSA-N [2-[(8s,9s,10r,11s,13s,14s,17r)-11,17-dihydroxy-10,13-dimethyl-16-methylidene-3-oxo-6,7,8,9,11,12,14,15-octahydrocyclopenta[a]phenanthren-17-yl]-2-oxoethyl] 2-(diethylamino)acetate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC(=C)[C@@](C(=O)COC(=O)CN(CC)CC)(O)[C@@]1(C)C[C@@H]2O IFXNTPMREPCLFJ-SLPNHVECSA-N 0.000 description 1
- FNFPHNZQOKBKHN-KAJVQRHHSA-N [2-[(8s,9s,10r,11s,13s,14s,17r)-11,17-dihydroxy-10,13-dimethyl-3-oxo-2,6,7,8,9,11,12,14,15,16-decahydro-1h-cyclopenta[a]phenanthren-17-yl]-2-oxoethyl] 3,3-dimethylbutanoate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)CC(C)(C)C)(O)[C@@]1(C)C[C@@H]2O FNFPHNZQOKBKHN-KAJVQRHHSA-N 0.000 description 1
- 229960003697 abatacept Drugs 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 229960004892 acemetacin Drugs 0.000 description 1
- FSQKKOOTNAMONP-UHFFFAOYSA-N acemetacin Chemical compound CC1=C(CC(=O)OCC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 FSQKKOOTNAMONP-UHFFFAOYSA-N 0.000 description 1
- TWIIVLKQFJBFPW-UHFFFAOYSA-N acetaminosalol Chemical compound C1=CC(NC(=O)C)=CC=C1OC(=O)C1=CC=CC=C1O TWIIVLKQFJBFPW-UHFFFAOYSA-N 0.000 description 1
- 229950007008 acetaminosalol Drugs 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- WDSCBUNMANHPFH-UHFFFAOYSA-N acexamic acid Chemical compound CC(=O)NCCCCCC(O)=O WDSCBUNMANHPFH-UHFFFAOYSA-N 0.000 description 1
- 229940119059 actemra Drugs 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 210000005006 adaptive immune system Anatomy 0.000 description 1
- 229960001570 ademetionine Drugs 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 201000000028 adult respiratory distress syndrome Diseases 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 229960005142 alclofenac Drugs 0.000 description 1
- ARHWPKZXBHOEEE-UHFFFAOYSA-N alclofenac Chemical compound OC(=O)CC1=CC=C(OCC=C)C(Cl)=C1 ARHWPKZXBHOEEE-UHFFFAOYSA-N 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 229960001900 algestone Drugs 0.000 description 1
- CXDWHYOBSJTRJU-SRWWVFQWSA-N algestone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@@H](O)[C@@](C(=O)C)(O)[C@@]1(C)CC2 CXDWHYOBSJTRJU-SRWWVFQWSA-N 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 229950000907 allocupreide sodium Drugs 0.000 description 1
- 229960004663 alminoprofen Drugs 0.000 description 1
- 229960004685 aloxiprin Drugs 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- PNEYBMLMFCGWSK-UHFFFAOYSA-N aluminium oxide Inorganic materials [O-2].[O-2].[O-2].[Al+3].[Al+3] PNEYBMLMFCGWSK-UHFFFAOYSA-N 0.000 description 1
- CEGOLXSVJUTHNZ-UHFFFAOYSA-K aluminium tristearate Chemical compound [Al+3].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CEGOLXSVJUTHNZ-UHFFFAOYSA-K 0.000 description 1
- 229940063655 aluminum stearate Drugs 0.000 description 1
- 229960003099 amcinonide Drugs 0.000 description 1
- ILKJAFIWWBXGDU-MOGDOJJUSA-N amcinonide Chemical compound O([C@@]1([C@H](O2)C[C@@H]3[C@@]1(C[C@H](O)[C@]1(F)[C@@]4(C)C=CC(=O)C=C4CC[C@H]13)C)C(=O)COC(=O)C)C12CCCC1 ILKJAFIWWBXGDU-MOGDOJJUSA-N 0.000 description 1
- 229940024554 amdinocillin Drugs 0.000 description 1
- SOYCMDCMZDHQFP-UHFFFAOYSA-N amfenac Chemical compound NC1=C(CC(O)=O)C=CC=C1C(=O)C1=CC=CC=C1 SOYCMDCMZDHQFP-UHFFFAOYSA-N 0.000 description 1
- 229950008930 amfenac Drugs 0.000 description 1
- 229960004821 amikacin Drugs 0.000 description 1
- LKCWBDHBTVXHDL-RMDFUYIESA-N amikacin Chemical compound O([C@@H]1[C@@H](N)C[C@H]([C@@H]([C@H]1O)O[C@@H]1[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O1)O)NC(=O)[C@@H](O)CCN)[C@H]1O[C@H](CN)[C@@H](O)[C@H](O)[C@H]1O LKCWBDHBTVXHDL-RMDFUYIESA-N 0.000 description 1
- ISRODTBNJUAWEJ-UHFFFAOYSA-N amixetrine Chemical compound C=1C=CC=CC=1C(OCCC(C)C)CN1CCCC1 ISRODTBNJUAWEJ-UHFFFAOYSA-N 0.000 description 1
- 229950001993 amixetrine Drugs 0.000 description 1
- 229960003022 amoxicillin Drugs 0.000 description 1
- LSQZJLSUYDQPKJ-NJBDSQKTSA-N amoxicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=C(O)C=C1 LSQZJLSUYDQPKJ-NJBDSQKTSA-N 0.000 description 1
- 229940038195 amoxicillin / clavulanate Drugs 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229940043312 ampicillin / sulbactam Drugs 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000011558 animal model by disease Methods 0.000 description 1
- 238000005349 anion exchange Methods 0.000 description 1
- HDNJXZZJFPCFHG-UHFFFAOYSA-N anitrazafen Chemical compound C1=CC(OC)=CC=C1C1=NN=C(C)N=C1C1=CC=C(OC)C=C1 HDNJXZZJFPCFHG-UHFFFAOYSA-N 0.000 description 1
- 229950002412 anitrazafen Drugs 0.000 description 1
- 208000022531 anorexia Diseases 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 229940124599 anti-inflammatory drug Drugs 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 229950004064 antrafenine Drugs 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- MDJRZSNPHZEMJH-MTMZYOSNSA-N artisone acetate Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)COC(=O)C)[C@@]1(C)CC2 MDJRZSNPHZEMJH-MTMZYOSNSA-N 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 208000006673 asthma Diseases 0.000 description 1
- AUJRCFUBUPVWSZ-XTZHGVARSA-M auranofin Chemical compound CCP(CC)(CC)=[Au]S[C@@H]1O[C@H](COC(C)=O)[C@@H](OC(C)=O)[C@H](OC(C)=O)[C@H]1OC(C)=O AUJRCFUBUPVWSZ-XTZHGVARSA-M 0.000 description 1
- 229960005207 auranofin Drugs 0.000 description 1
- 229960001799 aurothioglucose Drugs 0.000 description 1
- 229950002878 aurothioglycanide Drugs 0.000 description 1
- ODENGJOFMCVWCT-UHFFFAOYSA-M aurothioglycanide Chemical compound [Au+].[S-]CC(=O)NC1=CC=CC=C1 ODENGJOFMCVWCT-UHFFFAOYSA-M 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- SZQROHUSUMVIKO-UHFFFAOYSA-N azidocyclopentane hydrochloride Chemical compound Cl.[N-]=[N+]=NC1CCCC1 SZQROHUSUMVIKO-UHFFFAOYSA-N 0.000 description 1
- 229960004099 azithromycin Drugs 0.000 description 1
- MQTOSJVFKKJCRP-BICOPXKESA-N azithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)N(C)C[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 MQTOSJVFKKJCRP-BICOPXKESA-N 0.000 description 1
- 229960003623 azlocillin Drugs 0.000 description 1
- JTWOMNBEOCYFNV-NFFDBFGFSA-N azlocillin Chemical compound N([C@@H](C(=O)N[C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C=1C=CC=CC=1)C(=O)N1CCNC1=O JTWOMNBEOCYFNV-NFFDBFGFSA-N 0.000 description 1
- WZPBZJONDBGPKJ-VEHQQRBSSA-N aztreonam Chemical compound O=C1N(S([O-])(=O)=O)[C@@H](C)[C@@H]1NC(=O)C(=N/OC(C)(C)C(O)=O)\C1=CSC([NH3+])=N1 WZPBZJONDBGPKJ-VEHQQRBSSA-N 0.000 description 1
- 229960003644 aztreonam Drugs 0.000 description 1
- PFOLLRNADZZWEX-FFGRCDKISA-N bacampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)[C@H](C(S3)(C)C)C(=O)OC(C)OC(=O)OCC)=CC=CC=C1 PFOLLRNADZZWEX-FFGRCDKISA-N 0.000 description 1
- 229960002699 bacampicillin Drugs 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 229940092705 beclomethasone Drugs 0.000 description 1
- NBMKJKDGKREAPL-DVTGEIKXSA-N beclomethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(Cl)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O NBMKJKDGKREAPL-DVTGEIKXSA-N 0.000 description 1
- 229960005149 bendazac Drugs 0.000 description 1
- BYFMCKSPFYVMOU-UHFFFAOYSA-N bendazac Chemical compound C12=CC=CC=C2C(OCC(=O)O)=NN1CC1=CC=CC=C1 BYFMCKSPFYVMOU-UHFFFAOYSA-N 0.000 description 1
- FEJKLNWAOXSSNR-UHFFFAOYSA-N benorilate Chemical compound C1=CC(NC(=O)C)=CC=C1OC(=O)C1=CC=CC=C1OC(C)=O FEJKLNWAOXSSNR-UHFFFAOYSA-N 0.000 description 1
- 229960004277 benorilate Drugs 0.000 description 1
- 229960005430 benoxaprofen Drugs 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- KMGARVOVYXNAOF-UHFFFAOYSA-N benzpiperylone Chemical compound C1CN(C)CCC1N1C(=O)C(CC=2C=CC=CC=2)=C(C=2C=CC=CC=2)N1 KMGARVOVYXNAOF-UHFFFAOYSA-N 0.000 description 1
- 229950007647 benzpiperylone Drugs 0.000 description 1
- 229960000333 benzydamine Drugs 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 1
- 229960002537 betamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-DVTGEIKXSA-N betamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-DVTGEIKXSA-N 0.000 description 1
- 229960004311 betamethasone valerate Drugs 0.000 description 1
- SNHRLVCMMWUAJD-SUYDQAKGSA-N betamethasone valerate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(OC(=O)CCCC)[C@@]1(C)C[C@@H]2O SNHRLVCMMWUAJD-SUYDQAKGSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 229920001222 biopolymer Polymers 0.000 description 1
- QRZAKQDHEVVFRX-UHFFFAOYSA-N biphenyl-4-ylacetic acid Chemical compound C1=CC(CC(=O)O)=CC=C1C1=CC=CC=C1 QRZAKQDHEVVFRX-UHFFFAOYSA-N 0.000 description 1
- HUTDDBSSHVOYJR-UHFFFAOYSA-H bis[(2-oxo-1,3,2$l^{5},4$l^{2}-dioxaphosphaplumbetan-2-yl)oxy]lead Chemical compound [Pb+2].[Pb+2].[Pb+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O HUTDDBSSHVOYJR-UHFFFAOYSA-H 0.000 description 1
- UIDLJTHRRPMIQP-UHFFFAOYSA-L bis[2-[4-(2-methylpropyl)phenyl]propanoyloxy]aluminum;hydrate Chemical compound O.C1=CC(CC(C)C)=CC=C1C(C)C(=O)O[Al]OC(=O)C(C)C1=CC=C(CC(C)C)C=C1 UIDLJTHRRPMIQP-UHFFFAOYSA-L 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 239000003114 blood coagulation factor Substances 0.000 description 1
- 238000010241 blood sampling Methods 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 238000010322 bone marrow transplantation Methods 0.000 description 1
- 208000029028 brain injury Diseases 0.000 description 1
- PZOHOALJQOFNTB-UHFFFAOYSA-M brequinar sodium Chemical compound [Na+].N1=C2C=CC(F)=CC2=C(C([O-])=O)C(C)=C1C(C=C1)=CC=C1C1=CC=CC=C1F PZOHOALJQOFNTB-UHFFFAOYSA-M 0.000 description 1
- 229950011622 broperamole Drugs 0.000 description 1
- 229960004272 bucillamine Drugs 0.000 description 1
- IJTPQQVCKPZIMV-UHFFFAOYSA-N bucloxic acid Chemical compound ClC1=CC(C(=O)CCC(=O)O)=CC=C1C1CCCCC1 IJTPQQVCKPZIMV-UHFFFAOYSA-N 0.000 description 1
- 229950005608 bucloxic acid Drugs 0.000 description 1
- 229950003872 bucolome Drugs 0.000 description 1
- 229960004436 budesonide Drugs 0.000 description 1
- 229960000962 bufexamac Drugs 0.000 description 1
- MXJWRABVEGLYDG-UHFFFAOYSA-N bufexamac Chemical compound CCCCOC1=CC=C(CC(=O)NO)C=C1 MXJWRABVEGLYDG-UHFFFAOYSA-N 0.000 description 1
- 229950009075 bufezolac Drugs 0.000 description 1
- 229960003354 bumadizone Drugs 0.000 description 1
- FLWFHHFTIRLFPV-UHFFFAOYSA-N bumadizone Chemical compound C=1C=CC=CC=1N(C(=O)C(C(O)=O)CCCC)NC1=CC=CC=C1 FLWFHHFTIRLFPV-UHFFFAOYSA-N 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 229960002973 butibufen Drugs 0.000 description 1
- UULSXYSSHHRCQK-UHFFFAOYSA-N butibufen Chemical compound CCC(C(O)=O)C1=CC=C(CC(C)C)C=C1 UULSXYSSHHRCQK-UHFFFAOYSA-N 0.000 description 1
- LRHPLDYGYMQRHN-UHFFFAOYSA-N butyl alcohol Substances CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 229960005069 calcium Drugs 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- ZZZFLYPYUYPLOF-UHFFFAOYSA-J calcium;gold(1+);2-sulfidoacetate Chemical compound [Ca+2].[Au+].[Au+].[O-]C(=O)C[S-].[O-]C(=O)C[S-] ZZZFLYPYUYPLOF-UHFFFAOYSA-J 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 229960003669 carbenicillin Drugs 0.000 description 1
- FPPNZSSZRUTDAP-UWFZAAFLSA-N carbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(O)=O)C1=CC=CC=C1 FPPNZSSZRUTDAP-UWFZAAFLSA-N 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 229960000717 carindacillin Drugs 0.000 description 1
- JIRBAUWICKGBFE-MNRDOXJOSA-N carindacillin Chemical group N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(=O)OC=1C=C2CCCC2=CC=1)C1=CC=CC=C1 JIRBAUWICKGBFE-MNRDOXJOSA-N 0.000 description 1
- 229960003184 carprofen Drugs 0.000 description 1
- IVUMCTKHWDRRMH-UHFFFAOYSA-N carprofen Chemical compound C1=CC(Cl)=C[C]2C3=CC=C(C(C(O)=O)C)C=C3N=C21 IVUMCTKHWDRRMH-UHFFFAOYSA-N 0.000 description 1
- QYIYFLOTGYLRGG-GPCCPHFNSA-N cefaclor Chemical compound C1([C@H](C(=O)N[C@@H]2C(N3C(=C(Cl)CS[C@@H]32)C(O)=O)=O)N)=CC=CC=C1 QYIYFLOTGYLRGG-GPCCPHFNSA-N 0.000 description 1
- 229960005361 cefaclor Drugs 0.000 description 1
- 229960004841 cefadroxil Drugs 0.000 description 1
- NBFNMSULHIODTC-CYJZLJNKSA-N cefadroxil monohydrate Chemical compound O.C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=C(O)C=C1 NBFNMSULHIODTC-CYJZLJNKSA-N 0.000 description 1
- 229960000603 cefalotin Drugs 0.000 description 1
- OLVCFLKTBJRLHI-AXAPSJFSSA-N cefamandole Chemical compound CN1N=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)[C@H](O)C=3C=CC=CC=3)[C@H]2SC1 OLVCFLKTBJRLHI-AXAPSJFSSA-N 0.000 description 1
- 229960003012 cefamandole Drugs 0.000 description 1
- 229960004350 cefapirin Drugs 0.000 description 1
- 229960001139 cefazolin Drugs 0.000 description 1
- MLYYVTUWGNIJIB-BXKDBHETSA-N cefazolin Chemical compound S1C(C)=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CN3N=NN=C3)[C@H]2SC1 MLYYVTUWGNIJIB-BXKDBHETSA-N 0.000 description 1
- 229960002129 cefixime Drugs 0.000 description 1
- OKBVVJOGVLARMR-QSWIMTSFSA-N cefixime Chemical compound S1C(N)=NC(C(=N\OCC(O)=O)\C(=O)N[C@@H]2C(N3C(=C(C=C)CS[C@@H]32)C(O)=O)=O)=C1 OKBVVJOGVLARMR-QSWIMTSFSA-N 0.000 description 1
- DYAIAHUQIPBDIP-AXAPSJFSSA-N cefonicid Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)[C@H](O)C=2C=CC=CC=2)CC=1CSC1=NN=NN1CS(O)(=O)=O DYAIAHUQIPBDIP-AXAPSJFSSA-N 0.000 description 1
- 229960004489 cefonicid Drugs 0.000 description 1
- 229960004261 cefotaxime Drugs 0.000 description 1
- AZZMGZXNTDTSME-JUZDKLSSSA-M cefotaxime sodium Chemical compound [Na+].N([C@@H]1C(N2C(=C(COC(C)=O)CS[C@@H]21)C([O-])=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 AZZMGZXNTDTSME-JUZDKLSSSA-M 0.000 description 1
- SRZNHPXWXCNNDU-RHBCBLIFSA-N cefotetan Chemical compound N([C@]1(OC)C(N2C(=C(CSC=3N(N=NN=3)C)CS[C@@H]21)C(O)=O)=O)C(=O)C1SC(=C(C(N)=O)C(O)=O)S1 SRZNHPXWXCNNDU-RHBCBLIFSA-N 0.000 description 1
- 229960005495 cefotetan Drugs 0.000 description 1
- 229960002682 cefoxitin Drugs 0.000 description 1
- 229960002588 cefradine Drugs 0.000 description 1
- 229960000484 ceftazidime Drugs 0.000 description 1
- ORFOPKXBNMVMKC-DWVKKRMSSA-N ceftazidime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC(C)(C)C(O)=O)C=2N=C(N)SC=2)CC=1C[N+]1=CC=CC=C1 ORFOPKXBNMVMKC-DWVKKRMSSA-N 0.000 description 1
- 229960001991 ceftizoxime Drugs 0.000 description 1
- NNULBSISHYWZJU-LLKWHZGFSA-N ceftizoxime Chemical compound N([C@@H]1C(N2C(=CCS[C@@H]21)C(O)=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 NNULBSISHYWZJU-LLKWHZGFSA-N 0.000 description 1
- 230000010307 cell transformation Effects 0.000 description 1
- 208000015114 central nervous system disease Diseases 0.000 description 1
- 208000025222 central nervous system infectious disease Diseases 0.000 description 1
- 229940106164 cephalexin Drugs 0.000 description 1
- ZAIPMKNFIOOWCQ-UEKVPHQBSA-N cephalexin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=CC=C1 ZAIPMKNFIOOWCQ-UEKVPHQBSA-N 0.000 description 1
- VUFGUVLLDPOSBC-XRZFDKQNSA-M cephalothin sodium Chemical compound [Na+].N([C@H]1[C@@H]2N(C1=O)C(=C(CS2)COC(=O)C)C([O-])=O)C(=O)CC1=CC=CS1 VUFGUVLLDPOSBC-XRZFDKQNSA-M 0.000 description 1
- RDLPVSKMFDYCOR-UEKVPHQBSA-N cephradine Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CCC=CC1 RDLPVSKMFDYCOR-UEKVPHQBSA-N 0.000 description 1
- 206010008118 cerebral infarction Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- BWWVAEOLVKTZFQ-ISVUSNJMSA-N chembl530 Chemical compound N(/[C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)=C\N1CCCCCC1 BWWVAEOLVKTZFQ-ISVUSNJMSA-N 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- 229950006229 chloroprednisone Drugs 0.000 description 1
- NPSLCOWKFFNQKK-ZPSUVKRCSA-N chloroprednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3C[C@H](Cl)C2=C1 NPSLCOWKFFNQKK-ZPSUVKRCSA-N 0.000 description 1
- 229960003677 chloroquine Drugs 0.000 description 1
- WHTVZRBIWZFKQO-UHFFFAOYSA-N chloroquine Natural products ClC1=CC=C2C(NC(C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-UHFFFAOYSA-N 0.000 description 1
- CYDMQBQPVICBEU-UHFFFAOYSA-N chlorotetracycline Natural products C1=CC(Cl)=C2C(O)(C)C3CC4C(N(C)C)C(O)=C(C(N)=O)C(=O)C4(O)C(O)=C3C(=O)C2=C1O CYDMQBQPVICBEU-UHFFFAOYSA-N 0.000 description 1
- 229960004475 chlortetracycline Drugs 0.000 description 1
- CYDMQBQPVICBEU-XRNKAMNCSA-N chlortetracycline Chemical compound C1=CC(Cl)=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(O)=C(C(N)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O CYDMQBQPVICBEU-XRNKAMNCSA-N 0.000 description 1
- 235000019365 chlortetracycline Nutrition 0.000 description 1
- 229960002688 choline salicylate Drugs 0.000 description 1
- 208000019069 chronic childhood arthritis Diseases 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 229950011171 cinmetacin Drugs 0.000 description 1
- NKPPORKKCMYYTO-DHZHZOJOSA-N cinmetacin Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)\C=C\C1=CC=CC=C1 NKPPORKKCMYYTO-DHZHZOJOSA-N 0.000 description 1
- 229960003405 ciprofloxacin Drugs 0.000 description 1
- 229950002234 ciproquazone Drugs 0.000 description 1
- 229940090805 clavulanate Drugs 0.000 description 1
- HZZVJAQRINQKSD-PBFISZAISA-N clavulanic acid Chemical compound OC(=O)[C@H]1C(=C/CO)/O[C@@H]2CC(=O)N21 HZZVJAQRINQKSD-PBFISZAISA-N 0.000 description 1
- 229950010886 clidanac Drugs 0.000 description 1
- 229960002227 clindamycin Drugs 0.000 description 1
- KDLRVYVGXIQJDK-AWPVFWJPSA-N clindamycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@H](C)Cl)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 KDLRVYVGXIQJDK-AWPVFWJPSA-N 0.000 description 1
- 229960002842 clobetasol Drugs 0.000 description 1
- 229960004703 clobetasol propionate Drugs 0.000 description 1
- 229960001146 clobetasone Drugs 0.000 description 1
- 229960005465 clobetasone butyrate Drugs 0.000 description 1
- UGOFYAXVVVXMQT-UHFFFAOYSA-N clobuzarit Chemical compound C1=CC(COC(C)(C)C(O)=O)=CC=C1C1=CC=C(Cl)C=C1 UGOFYAXVVVXMQT-UHFFFAOYSA-N 0.000 description 1
- 229950007550 clobuzarit Drugs 0.000 description 1
- 229960004299 clocortolone Drugs 0.000 description 1
- YMTMADLUXIRMGX-RFPWEZLHSA-N clocortolone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(Cl)[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)CO)[C@@]2(C)C[C@@H]1O YMTMADLUXIRMGX-RFPWEZLHSA-N 0.000 description 1
- 229960004094 clomocycline Drugs 0.000 description 1
- BXVOHUQQUBSHLD-XCTBDMBQSA-N clomocycline Chemical compound C1=CC(Cl)=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(=O)C(=C(/O)NCO)/C(=O)[C@@]4(O)C(=O)C3=C(O)C2=C1O BXVOHUQQUBSHLD-XCTBDMBQSA-N 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- SJCRQMUYEQHNTC-UHFFFAOYSA-N clopirac Chemical compound CC1=CC(CC(O)=O)=C(C)N1C1=CC=C(Cl)C=C1 SJCRQMUYEQHNTC-UHFFFAOYSA-N 0.000 description 1
- 229950009185 clopirac Drugs 0.000 description 1
- 229960002219 cloprednol Drugs 0.000 description 1
- YTJIBEDMAQUYSZ-FDNPDPBUSA-N cloprednol Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3C=C(Cl)C2=C1 YTJIBEDMAQUYSZ-FDNPDPBUSA-N 0.000 description 1
- 229960003326 cloxacillin Drugs 0.000 description 1
- LQOLIRLGBULYKD-JKIFEVAISA-N cloxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1Cl LQOLIRLGBULYKD-JKIFEVAISA-N 0.000 description 1
- 229950011057 cloximate Drugs 0.000 description 1
- 229960003346 colistin Drugs 0.000 description 1
- 239000008119 colloidal silica Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- NHRTVBMNRNCBLQ-UHFFFAOYSA-L copper;5,7-disulfoquinolin-8-olate;n-ethylethanamine Chemical compound [Cu+2].CCNCC.CCNCC.CCNCC.CCNCC.C1=CC=NC2=C([O-])C(S(=O)(=O)O)=CC(S(O)(=O)=O)=C21.C1=CC=NC2=C([O-])C(S(=O)(=O)O)=CC(S(O)(=O)=O)=C21 NHRTVBMNRNCBLQ-UHFFFAOYSA-L 0.000 description 1
- OMFXVFTZEKFJBZ-HJTSIMOOSA-N corticosterone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@H](CC4)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OMFXVFTZEKFJBZ-HJTSIMOOSA-N 0.000 description 1
- BMCQMVFGOVHVNG-TUFAYURCSA-N cortisol 17-butyrate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)CO)(OC(=O)CCC)[C@@]1(C)C[C@@H]2O BMCQMVFGOVHVNG-TUFAYURCSA-N 0.000 description 1
- ALEXXDVDDISNDU-JZYPGELDSA-N cortisol 21-acetate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)C)(O)[C@@]1(C)C[C@@H]2O ALEXXDVDDISNDU-JZYPGELDSA-N 0.000 description 1
- BGSOJVFOEQLVMH-VWUMJDOOSA-N cortisol phosphate Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)COP(O)(O)=O)[C@@H]4[C@@H]3CCC2=C1 BGSOJVFOEQLVMH-VWUMJDOOSA-N 0.000 description 1
- 229960004544 cortisone Drugs 0.000 description 1
- 229960003840 cortivazol Drugs 0.000 description 1
- RKHQGWMMUURILY-UHRZLXHJSA-N cortivazol Chemical compound C([C@H]1[C@@H]2C[C@H]([C@]([C@@]2(C)C[C@H](O)[C@@H]1[C@@]1(C)C2)(O)C(=O)COC(C)=O)C)=C(C)C1=CC1=C2C=NN1C1=CC=CC=C1 RKHQGWMMUURILY-UHRZLXHJSA-N 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 229950009004 cuproxoline Drugs 0.000 description 1
- 229960004244 cyclacillin Drugs 0.000 description 1
- HGBLNBBNRORJKI-WCABBAIRSA-N cyclacillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C1(N)CCCCC1 HGBLNBBNRORJKI-WCABBAIRSA-N 0.000 description 1
- HPXRVTGHNJAIIH-UHFFFAOYSA-N cyclohexanol Chemical compound OC1CCCCC1 HPXRVTGHNJAIIH-UHFFFAOYSA-N 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 229960000860 dapsone Drugs 0.000 description 1
- 229950011349 dazidamine Drugs 0.000 description 1
- 229950000059 deboxamet Drugs 0.000 description 1
- 206010061428 decreased appetite Diseases 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 229950001116 delmetacin Drugs 0.000 description 1
- 229960002398 demeclocycline Drugs 0.000 description 1
- 239000013578 denaturing buffer Substances 0.000 description 1
- 229940009976 deoxycholate Drugs 0.000 description 1
- KXGVEGMKQFWNSR-LLQZFEROSA-M deoxycholate Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 KXGVEGMKQFWNSR-LLQZFEROSA-M 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 229960003662 desonide Drugs 0.000 description 1
- WBGKWQHBNHJJPZ-LECWWXJVSA-N desonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O WBGKWQHBNHJJPZ-LECWWXJVSA-N 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 229960001894 detomidine Drugs 0.000 description 1
- JXMXDKHEZLKQPB-UHFFFAOYSA-N detomidine Chemical compound CC1=CC=CC(CC=2[N]C=NC=2)=C1C JXMXDKHEZLKQPB-UHFFFAOYSA-N 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229950007331 dexindoprofen Drugs 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 229960004590 diacerein Drugs 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- MXCPYJZDGPQDRA-UHFFFAOYSA-N dialuminum;2-acetyloxybenzoic acid;oxygen(2-) Chemical compound [O-2].[O-2].[O-2].[Al+3].[Al+3].CC(=O)OC1=CC=CC=C1C(O)=O MXCPYJZDGPQDRA-UHFFFAOYSA-N 0.000 description 1
- 229960004515 diclofenac potassium Drugs 0.000 description 1
- KXZOIWWTXOCYKR-UHFFFAOYSA-M diclofenac potassium Chemical compound [K+].[O-]C(=O)CC1=CC=CC=C1NC1=C(Cl)C=CC=C1Cl KXZOIWWTXOCYKR-UHFFFAOYSA-M 0.000 description 1
- 229960001193 diclofenac sodium Drugs 0.000 description 1
- YFAGHNZHGGCZAX-JKIFEVAISA-N dicloxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=C(Cl)C=CC=C1Cl YFAGHNZHGGCZAX-JKIFEVAISA-N 0.000 description 1
- 229960001585 dicloxacillin Drugs 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- PCXMKBOWWVXEDT-UHFFFAOYSA-N difenamizole Chemical compound CN(C)C(C)C(=O)NC1=CC(C=2C=CC=CC=2)=NN1C1=CC=CC=C1 PCXMKBOWWVXEDT-UHFFFAOYSA-N 0.000 description 1
- 229950000061 difenamizole Drugs 0.000 description 1
- 229960001536 difenpiramide Drugs 0.000 description 1
- PWHROYKAGRUWDQ-UHFFFAOYSA-N difenpiramide Chemical compound C=1C=CC=NC=1NC(=O)CC(C=C1)=CC=C1C1=CC=CC=C1 PWHROYKAGRUWDQ-UHFFFAOYSA-N 0.000 description 1
- 229960004154 diflorasone Drugs 0.000 description 1
- WXURHACBFYSXBI-XHIJKXOTSA-N diflorasone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H](C)[C@@](C(=O)CO)(O)[C@@]2(C)C[C@@H]1O WXURHACBFYSXBI-XHIJKXOTSA-N 0.000 description 1
- 229960004091 diflucortolone Drugs 0.000 description 1
- OGPWIDANBSLJPC-RFPWEZLHSA-N diflucortolone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)CO)[C@@]2(C)C[C@@H]1O OGPWIDANBSLJPC-RFPWEZLHSA-N 0.000 description 1
- 229960003970 diflucortolone valerate Drugs 0.000 description 1
- 229960004875 difluprednate Drugs 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- GXGAKHNRMVGRPK-UHFFFAOYSA-N dimagnesium;dioxido-bis[[oxido(oxo)silyl]oxy]silane Chemical compound [Mg+2].[Mg+2].[O-][Si](=O)O[Si]([O-])([O-])O[Si]([O-])=O GXGAKHNRMVGRPK-UHFFFAOYSA-N 0.000 description 1
- 230000000447 dimerizing effect Effects 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 235000019797 dipotassium phosphate Nutrition 0.000 description 1
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- NWOYIVRVSJDTLK-YSDBFZIDSA-L disodium;(2s,5r,6r)-6-[[(2r)-2-amino-2-phenylacetyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylate;(1r,4s)-3,3-dimethyl-2,2,6-trioxo-2$l^{6}-thiabicyclo[3.2.0]heptane-4-carboxylate Chemical compound [Na+].[Na+].O=S1(=O)C(C)(C)[C@H](C([O-])=O)C2C(=O)C[C@H]21.C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C([O-])=O)(C)C)=CC=CC=C1 NWOYIVRVSJDTLK-YSDBFZIDSA-L 0.000 description 1
- UUCMDZWCRNZCOY-UHFFFAOYSA-N ditazole Chemical compound O1C(N(CCO)CCO)=NC(C=2C=CC=CC=2)=C1C1=CC=CC=C1 UUCMDZWCRNZCOY-UHFFFAOYSA-N 0.000 description 1
- 229960005067 ditazole Drugs 0.000 description 1
- OEHFRZLKGRKFAS-UHFFFAOYSA-N droxicam Chemical compound C12=CC=CC=C2S(=O)(=O)N(C)C(C2=O)=C1OC(=O)N2C1=CC=CC=N1 OEHFRZLKGRKFAS-UHFFFAOYSA-N 0.000 description 1
- 229960001850 droxicam Drugs 0.000 description 1
- 229920002549 elastin Polymers 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 229950010243 emorfazone Drugs 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 229940073621 enbrel Drugs 0.000 description 1
- 229950010996 enfenamic acid Drugs 0.000 description 1
- HLNLBEFKHHCAMV-UHFFFAOYSA-N enfenamic acid Chemical compound OC(=O)C1=CC=CC=C1NCCC1=CC=CC=C1 HLNLBEFKHHCAMV-UHFFFAOYSA-N 0.000 description 1
- 229950002107 enolicam Drugs 0.000 description 1
- 229960002549 enoxacin Drugs 0.000 description 1
- IDYZIJYBMGIQMJ-UHFFFAOYSA-N enoxacin Chemical compound N1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCNCC1 IDYZIJYBMGIQMJ-UHFFFAOYSA-N 0.000 description 1
- 229960003720 enoxolone Drugs 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 206010015037 epilepsy Diseases 0.000 description 1
- 229950003801 epirizole Drugs 0.000 description 1
- 229960000403 etanercept Drugs 0.000 description 1
- PXBFSRVXEKCBFP-UHFFFAOYSA-N etersalate Chemical compound C1=CC(NC(=O)C)=CC=C1OCCOC(=O)C1=CC=CC=C1OC(C)=O PXBFSRVXEKCBFP-UHFFFAOYSA-N 0.000 description 1
- 229950006159 etersalate Drugs 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- FRQSLQPWXFAJFO-UHFFFAOYSA-N ethoxymethyl 2-(2,6-dichloro-3-methylanilino)benzoate Chemical compound CCOCOC(=O)C1=CC=CC=C1NC1=C(Cl)C=CC(C)=C1Cl FRQSLQPWXFAJFO-UHFFFAOYSA-N 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 229960005293 etodolac Drugs 0.000 description 1
- XFBVBWWRPKNWHW-UHFFFAOYSA-N etodolac Chemical compound C1COC(CC)(CC(O)=O)C2=N[C]3C(CC)=CC=CC3=C21 XFBVBWWRPKNWHW-UHFFFAOYSA-N 0.000 description 1
- 229960001493 etofenamate Drugs 0.000 description 1
- 229960004945 etoricoxib Drugs 0.000 description 1
- MNJVRJDLRVPLFE-UHFFFAOYSA-N etoricoxib Chemical compound C1=NC(C)=CC=C1C1=NC=C(Cl)C=C1C1=CC=C(S(C)(=O)=O)C=C1 MNJVRJDLRVPLFE-UHFFFAOYSA-N 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 206010064570 familial cold autoinflammatory syndrome Diseases 0.000 description 1
- 206010016256 fatigue Diseases 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 229960000192 felbinac Drugs 0.000 description 1
- 229960001395 fenbufen Drugs 0.000 description 1
- ZPAKPRAICRBAOD-UHFFFAOYSA-N fenbufen Chemical compound C1=CC(C(=O)CCC(=O)O)=CC=C1C1=CC=CC=C1 ZPAKPRAICRBAOD-UHFFFAOYSA-N 0.000 description 1
- IDKAXRLETRCXKS-UHFFFAOYSA-N fenclofenac Chemical compound OC(=O)CC1=CC=CC=C1OC1=CC=C(Cl)C=C1Cl IDKAXRLETRCXKS-UHFFFAOYSA-N 0.000 description 1
- 229950006236 fenclofenac Drugs 0.000 description 1
- 229950003537 fenclorac Drugs 0.000 description 1
- 229950011481 fenclozic acid Drugs 0.000 description 1
- HAWWPSYXSLJRBO-UHFFFAOYSA-N fendosal Chemical compound C1=C(O)C(C(=O)O)=CC(N2C(=CC=3C4=CC=CC=C4CCC=32)C=2C=CC=CC=2)=C1 HAWWPSYXSLJRBO-UHFFFAOYSA-N 0.000 description 1
- 229950005416 fendosal Drugs 0.000 description 1
- ITFWPRPSIAYKMV-UHFFFAOYSA-N fenflumizol Chemical compound C1=CC(OC)=CC=C1C1=C(C=2C=CC(OC)=CC=2)NC(C=2C(=CC(F)=CC=2)F)=N1 ITFWPRPSIAYKMV-UHFFFAOYSA-N 0.000 description 1
- 229960001419 fenoprofen Drugs 0.000 description 1
- 229960002679 fentiazac Drugs 0.000 description 1
- 229960000489 feprazone Drugs 0.000 description 1
- 230000003176 fibrotic effect Effects 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 229960003240 floctafenine Drugs 0.000 description 1
- 229960004273 floxacillin Drugs 0.000 description 1
- 229950002335 fluazacort Drugs 0.000 description 1
- BYZCJOHDXLROEC-RBWIMXSLSA-N fluazacort Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H]3OC(C)=N[C@@]3(C(=O)COC(=O)C)[C@@]1(C)C[C@@H]2O BYZCJOHDXLROEC-RBWIMXSLSA-N 0.000 description 1
- NJNWEGFJCGYWQT-VSXGLTOVSA-N fluclorolone acetonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(Cl)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1Cl NJNWEGFJCGYWQT-VSXGLTOVSA-N 0.000 description 1
- 229940094766 flucloronide Drugs 0.000 description 1
- RFHAOTPXVQNOHP-UHFFFAOYSA-N fluconazole Chemical compound C1=NC=NN1CC(C=1C(=CC(F)=CC=1)F)(O)CN1C=NC=N1 RFHAOTPXVQNOHP-UHFFFAOYSA-N 0.000 description 1
- 229960004884 fluconazole Drugs 0.000 description 1
- 229960004369 flufenamic acid Drugs 0.000 description 1
- LPEPZBJOKDYZAD-UHFFFAOYSA-N flufenamic acid Chemical compound OC(=O)C1=CC=CC=C1NC1=CC=CC(C(F)(F)F)=C1 LPEPZBJOKDYZAD-UHFFFAOYSA-N 0.000 description 1
- 229950007979 flufenisal Drugs 0.000 description 1
- 229960003469 flumetasone Drugs 0.000 description 1
- WXURHACBFYSXBI-GQKYHHCASA-N flumethasone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]2(C)C[C@@H]1O WXURHACBFYSXBI-GQKYHHCASA-N 0.000 description 1
- 229940042902 flumethasone pivalate Drugs 0.000 description 1
- JWRMHDSINXPDHB-OJAGFMMFSA-N flumethasone pivalate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)COC(=O)C(C)(C)C)(O)[C@@]2(C)C[C@@H]1O JWRMHDSINXPDHB-OJAGFMMFSA-N 0.000 description 1
- OPYFPDBMMYUPME-UHFFFAOYSA-N flumizole Chemical compound C1=CC(OC)=CC=C1C1=C(C=2C=CC(OC)=CC=2)NC(C(F)(F)F)=N1 OPYFPDBMMYUPME-UHFFFAOYSA-N 0.000 description 1
- 229950005288 flumizole Drugs 0.000 description 1
- 229960000676 flunisolide Drugs 0.000 description 1
- NOOCSNJCXJYGPE-UHFFFAOYSA-N flunixin Chemical compound C1=CC=C(C(F)(F)F)C(C)=C1NC1=NC=CC=C1C(O)=O NOOCSNJCXJYGPE-UHFFFAOYSA-N 0.000 description 1
- 229960000588 flunixin Drugs 0.000 description 1
- 229960001321 flunoxaprofen Drugs 0.000 description 1
- ARPYQKTVRGFPIS-VIFPVBQESA-N flunoxaprofen Chemical compound N=1C2=CC([C@@H](C(O)=O)C)=CC=C2OC=1C1=CC=C(F)C=C1 ARPYQKTVRGFPIS-VIFPVBQESA-N 0.000 description 1
- FEBLZLNTKCEFIT-VSXGLTOVSA-N fluocinolone acetonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O FEBLZLNTKCEFIT-VSXGLTOVSA-N 0.000 description 1
- 229960000785 fluocinonide Drugs 0.000 description 1
- XWTIDFOGTCVGQB-FHIVUSPVSA-N fluocortin butyl Chemical group C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)C(=O)OCCCC)[C@@]2(C)C[C@@H]1O XWTIDFOGTCVGQB-FHIVUSPVSA-N 0.000 description 1
- 229950008509 fluocortin butyl Drugs 0.000 description 1
- 229960003973 fluocortolone Drugs 0.000 description 1
- GAKMQHDJQHZUTJ-ULHLPKEOSA-N fluocortolone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)CO)[C@@]2(C)C[C@@H]1O GAKMQHDJQHZUTJ-ULHLPKEOSA-N 0.000 description 1
- 229960001048 fluorometholone Drugs 0.000 description 1
- FAOZLTXFLGPHNG-KNAQIMQKSA-N fluorometholone Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@]2(F)[C@@H](O)C[C@]2(C)[C@@](O)(C(C)=O)CC[C@H]21 FAOZLTXFLGPHNG-KNAQIMQKSA-N 0.000 description 1
- 229960003590 fluperolone Drugs 0.000 description 1
- HHPZZKDXAFJLOH-QZIXMDIESA-N fluperolone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1CC[C@@](C(=O)[C@@H](OC(C)=O)C)(O)[C@@]1(C)C[C@@H]2O HHPZZKDXAFJLOH-QZIXMDIESA-N 0.000 description 1
- 229960002650 fluprednidene acetate Drugs 0.000 description 1
- DEFOZIFYUBUHHU-IYQKUMFPSA-N fluprednidene acetate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1CC(=C)[C@@](C(=O)COC(=O)C)(O)[C@@]1(C)C[C@@H]2O DEFOZIFYUBUHHU-IYQKUMFPSA-N 0.000 description 1
- 229960000618 fluprednisolone Drugs 0.000 description 1
- 229950001284 fluprofen Drugs 0.000 description 1
- ZWOUXWWGKJBAHQ-UHFFFAOYSA-N fluproquazone Chemical compound N=1C(=O)N(C(C)C)C2=CC(C)=CC=C2C=1C1=CC=C(F)C=C1 ZWOUXWWGKJBAHQ-UHFFFAOYSA-N 0.000 description 1
- 229950004250 fluproquazone Drugs 0.000 description 1
- 229960002390 flurbiprofen Drugs 0.000 description 1
- SYTBZMRGLBWNTM-UHFFFAOYSA-N flurbiprofen Chemical compound FC1=CC(C(C(O)=O)C)=CC=C1C1=CC=CC=C1 SYTBZMRGLBWNTM-UHFFFAOYSA-N 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 229950001822 fopirtoline Drugs 0.000 description 1
- 229960000671 formocortal Drugs 0.000 description 1
- QNXUUBBKHBYRFW-QWAPGEGQSA-N formocortal Chemical compound C1C(C=O)=C2C=C(OCCCl)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)COC(=O)C)[C@@]1(C)C[C@@H]2O QNXUUBBKHBYRFW-QWAPGEGQSA-N 0.000 description 1
- 229950010892 fosfosal Drugs 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 229950010951 furcloprofen Drugs 0.000 description 1
- 229950010931 furofenac Drugs 0.000 description 1
- 229920000370 gamma-poly(glutamate) polymer Polymers 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 229960005219 gentisic acid Drugs 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229960004410 glucametacin Drugs 0.000 description 1
- 229960002442 glucosamine Drugs 0.000 description 1
- 229960002989 glutamic acid Drugs 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 229960002449 glycine Drugs 0.000 description 1
- 229960002389 glycol salicylate Drugs 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 150000002343 gold Chemical class 0.000 description 1
- 229940015045 gold sodium thiomalate Drugs 0.000 description 1
- 229940083577 gold sodium thiosulfate Drugs 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- PSVDIHULUCLEJE-UHFFFAOYSA-N guaimesal Chemical compound COC1=CC=CC=C1OC1(C)OC2=CC=CC=C2C(=O)O1 PSVDIHULUCLEJE-UHFFFAOYSA-N 0.000 description 1
- 229950006160 guaimesal Drugs 0.000 description 1
- 229950007488 guamecycline Drugs 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 229960002383 halcinonide Drugs 0.000 description 1
- 229960002475 halometasone Drugs 0.000 description 1
- GGXMRPUKBWXVHE-MIHLVHIWSA-N halometasone Chemical compound C1([C@@H](F)C2)=CC(=O)C(Cl)=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]2(C)C[C@@H]1O GGXMRPUKBWXVHE-MIHLVHIWSA-N 0.000 description 1
- 229950004611 halopredone acetate Drugs 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960003884 hetacillin Drugs 0.000 description 1
- DXVUYOAEDJXBPY-NFFDBFGFSA-N hetacillin Chemical compound C1([C@@H]2C(=O)N(C(N2)(C)C)[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 DXVUYOAEDJXBPY-NFFDBFGFSA-N 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 229920001519 homopolymer Polymers 0.000 description 1
- 229940048921 humira Drugs 0.000 description 1
- 229950000208 hydrocortamate Drugs 0.000 description 1
- FWFVLWGEFDIZMJ-FOMYWIRZSA-N hydrocortamate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)CN(CC)CC)(O)[C@@]1(C)C[C@@H]2O FWFVLWGEFDIZMJ-FOMYWIRZSA-N 0.000 description 1
- 229960001067 hydrocortisone acetate Drugs 0.000 description 1
- 229960001524 hydrocortisone butyrate Drugs 0.000 description 1
- 229950000785 hydrocortisone phosphate Drugs 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- MSYBLBLAMDYKKZ-UHFFFAOYSA-N hydron;pyridine-3-carbonyl chloride;chloride Chemical compound Cl.ClC(=O)C1=CC=CN=C1 MSYBLBLAMDYKKZ-UHFFFAOYSA-N 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 229960004171 hydroxychloroquine Drugs 0.000 description 1
- XXSMGPRMXLTPCZ-UHFFFAOYSA-N hydroxychloroquine Chemical compound ClC1=CC=C2C(NC(C)CCCN(CCO)CC)=CC=NC2=C1 XXSMGPRMXLTPCZ-UHFFFAOYSA-N 0.000 description 1
- 229960002927 hydroxychloroquine sulfate Drugs 0.000 description 1
- CYWFCPPBTWOZSF-UHFFFAOYSA-N ibufenac Chemical compound CC(C)CC1=CC=C(CC(O)=O)C=C1 CYWFCPPBTWOZSF-UHFFFAOYSA-N 0.000 description 1
- 229950009183 ibufenac Drugs 0.000 description 1
- 229960001680 ibuprofen Drugs 0.000 description 1
- 229950005954 ibuprofen piconol Drugs 0.000 description 1
- 229960002595 ibuproxam Drugs 0.000 description 1
- BYPIURIATSUHDW-UHFFFAOYSA-N ibuproxam Chemical compound CC(C)CC1=CC=C(C(C)C(=O)NO)C=C1 BYPIURIATSUHDW-UHFFFAOYSA-N 0.000 description 1
- 229960004769 imidazole salicylate Drugs 0.000 description 1
- 229960002182 imipenem Drugs 0.000 description 1
- ZSKVGTPCRGIANV-ZXFLCMHBSA-N imipenem Chemical compound C1C(SCC\N=C\N)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 ZSKVGTPCRGIANV-ZXFLCMHBSA-N 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 231100000619 immunotoxicology Toxicity 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 229960000905 indomethacin Drugs 0.000 description 1
- 229960004187 indoprofen Drugs 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 239000002198 insoluble material Substances 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000021995 interleukin-8 production Effects 0.000 description 1
- 230000009878 intermolecular interaction Effects 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 208000037906 ischaemic injury Diseases 0.000 description 1
- 229950004425 isofezolac Drugs 0.000 description 1
- LZRDDINFIHUVCX-UHFFFAOYSA-N isofezolac Chemical compound OC(=O)CC1=C(C=2C=CC=CC=2)C(C=2C=CC=CC=2)=NN1C1=CC=CC=C1 LZRDDINFIHUVCX-UHFFFAOYSA-N 0.000 description 1
- 229960002725 isoflurane Drugs 0.000 description 1
- 229950000248 isonixin Drugs 0.000 description 1
- WJDDCFNFNAHLAF-UHFFFAOYSA-N isonixin Chemical compound CC1=CC=CC(C)=C1NC(=O)C1=CC=CNC1=O WJDDCFNFNAHLAF-UHFFFAOYSA-N 0.000 description 1
- 229950000704 isoprofen Drugs 0.000 description 1
- QFGMXJOBTNZHEL-UHFFFAOYSA-N isoxepac Chemical compound O1CC2=CC=CC=C2C(=O)C2=CC(CC(=O)O)=CC=C21 QFGMXJOBTNZHEL-UHFFFAOYSA-N 0.000 description 1
- 229950011455 isoxepac Drugs 0.000 description 1
- YYUAYBYLJSNDCX-UHFFFAOYSA-N isoxicam Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC=1C=C(C)ON=1 YYUAYBYLJSNDCX-UHFFFAOYSA-N 0.000 description 1
- 229950002252 isoxicam Drugs 0.000 description 1
- 210000001503 joint Anatomy 0.000 description 1
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- LGYTZKPVOAIUKX-UHFFFAOYSA-N kebuzone Chemical compound O=C1C(CCC(=O)C)C(=O)N(C=2C=CC=CC=2)N1C1=CC=CC=C1 LGYTZKPVOAIUKX-UHFFFAOYSA-N 0.000 description 1
- 229960000194 kebuzone Drugs 0.000 description 1
- DKYWVDODHFEZIM-UHFFFAOYSA-N ketoprofen Chemical compound OC(=O)C(C)C1=CC=CC(C(=O)C=2C=CC=CC=2)=C1 DKYWVDODHFEZIM-UHFFFAOYSA-N 0.000 description 1
- 229960000991 ketoprofen Drugs 0.000 description 1
- 229960004752 ketorolac Drugs 0.000 description 1
- OZWKMVRBQXNZKK-UHFFFAOYSA-N ketorolac Chemical compound OC(=O)C1CCN2C1=CC=C2C(=O)C1=CC=CC=C1 OZWKMVRBQXNZKK-UHFFFAOYSA-N 0.000 description 1
- BWHLPLXXIDYSNW-UHFFFAOYSA-N ketorolac tromethamine Chemical compound OCC(N)(CO)CO.OC(=O)C1CCN2C1=CC=C2C(=O)C1=CC=CC=C1 BWHLPLXXIDYSNW-UHFFFAOYSA-N 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 208000017169 kidney disease Diseases 0.000 description 1
- 229960000433 latamoxef Drugs 0.000 description 1
- 229950008279 lefetamine Drugs 0.000 description 1
- 229960000681 leflunomide Drugs 0.000 description 1
- VHOGYURTWQBHIL-UHFFFAOYSA-N leflunomide Chemical compound O1N=CC(C(=O)NC=2C=CC(=CC=2)C(F)(F)F)=C1C VHOGYURTWQBHIL-UHFFFAOYSA-N 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 229960001614 levamisole Drugs 0.000 description 1
- 229950003488 licofelone Drugs 0.000 description 1
- UAWXGRJVZSAUSZ-UHFFFAOYSA-N licofelone Chemical compound OC(=O)CC=1N2CC(C)(C)CC2=C(C=2C=CC=CC=2)C=1C1=CC=C(Cl)C=C1 UAWXGRJVZSAUSZ-UHFFFAOYSA-N 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- OJMMVQQUTAEWLP-KIDUDLJLSA-N lincomycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@@H](C)O)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 OJMMVQQUTAEWLP-KIDUDLJLSA-N 0.000 description 1
- 229960005287 lincomycin Drugs 0.000 description 1
- 239000008297 liquid dosage form Substances 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- UGDPYGKWIHHBMB-UHFFFAOYSA-N lobenzarit Chemical compound OC(=O)C1=CC=CC=C1NC1=CC(Cl)=CC=C1C(O)=O UGDPYGKWIHHBMB-UHFFFAOYSA-N 0.000 description 1
- 229950005662 lobenzarit Drugs 0.000 description 1
- 229950005965 lofemizole Drugs 0.000 description 1
- 229960003768 lonazolac Drugs 0.000 description 1
- XVUQHFRQHBLHQD-UHFFFAOYSA-N lonazolac Chemical compound OC(=O)CC1=CN(C=2C=CC=CC=2)N=C1C1=CC=C(Cl)C=C1 XVUQHFRQHBLHQD-UHFFFAOYSA-N 0.000 description 1
- 229950005508 lotifazole Drugs 0.000 description 1
- 229960002373 loxoprofen Drugs 0.000 description 1
- BAZQYVYVKYOAGO-UHFFFAOYSA-M loxoprofen sodium hydrate Chemical compound O.O.[Na+].C1=CC(C(C([O-])=O)C)=CC=C1CC1C(=O)CCC1 BAZQYVYVKYOAGO-UHFFFAOYSA-M 0.000 description 1
- 229960000994 lumiracoxib Drugs 0.000 description 1
- KHPKQFYUPIUARC-UHFFFAOYSA-N lumiracoxib Chemical compound OC(=O)CC1=CC(C)=CC=C1NC1=C(F)C=CC=C1Cl KHPKQFYUPIUARC-UHFFFAOYSA-N 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 229960004196 lymecycline Drugs 0.000 description 1
- AHEVKYYGXVEWNO-UEPZRUIBSA-N lymecycline Chemical compound C1=CC=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(O)=C(C(=O)NCNCCCC[C@H](N)C(O)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O AHEVKYYGXVEWNO-UEPZRUIBSA-N 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 229940072082 magnesium salicylate Drugs 0.000 description 1
- 239000000391 magnesium silicate Substances 0.000 description 1
- 235000019793 magnesium trisilicate Nutrition 0.000 description 1
- 229940099273 magnesium trisilicate Drugs 0.000 description 1
- 229910000386 magnesium trisilicate Inorganic materials 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 229950002555 mazipredone Drugs 0.000 description 1
- CZBOZZDZNVIXFC-VRRJBYJJSA-N mazipredone Chemical compound C1CN(C)CCN1CC(=O)[C@]1(O)[C@@]2(C)C[C@H](O)[C@@H]3[C@@]4(C)C=CC(=O)C=C4CC[C@H]3[C@@H]2CC1 CZBOZZDZNVIXFC-VRRJBYJJSA-N 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical class ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- 229960000826 meclocycline Drugs 0.000 description 1
- 229960003803 meclofenamic acid Drugs 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 229960001011 medrysone Drugs 0.000 description 1
- 229960003464 mefenamic acid Drugs 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- VDXZNPDIRNWWCW-JFTDCZMZSA-N melittin Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(N)=O)CC1=CNC2=CC=CC=C12 VDXZNPDIRNWWCW-JFTDCZMZSA-N 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229960001810 meprednisone Drugs 0.000 description 1
- PIDANAQULIKBQS-RNUIGHNZSA-N meprednisone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)CC2=O PIDANAQULIKBQS-RNUIGHNZSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- KBOPZPXVLCULAV-UHFFFAOYSA-N mesalamine Chemical compound NC1=CC=C(O)C(C(O)=O)=C1 KBOPZPXVLCULAV-UHFFFAOYSA-N 0.000 description 1
- 229960004963 mesalazine Drugs 0.000 description 1
- 229950000701 meseclazone Drugs 0.000 description 1
- OJGJQQNLRVNIKE-UHFFFAOYSA-N meseclazone Chemical compound O1C2=CC=C(Cl)C=C2C(=O)N2C1CC(C)O2 OJGJQQNLRVNIKE-UHFFFAOYSA-N 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 229940042016 methacycline Drugs 0.000 description 1
- FHXKFCNUYSGNFV-UHFFFAOYSA-N methanesulfonic acid;4-phenyl-n-(2-phenylethyl)-1,3-thiazol-2-amine Chemical compound CS(O)(=O)=O.N=1C(C=2C=CC=CC=2)=CSC=1NCCC1=CC=CC=C1 FHXKFCNUYSGNFV-UHFFFAOYSA-N 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- LMINNBXUMGNKMM-UHFFFAOYSA-N metiazinic acid Chemical compound C1=C(CC(O)=O)C=C2N(C)C3=CC=CC=C3SC2=C1 LMINNBXUMGNKMM-UHFFFAOYSA-N 0.000 description 1
- 229950005798 metiazinic acid Drugs 0.000 description 1
- 229960003085 meticillin Drugs 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 229960004023 minocycline Drugs 0.000 description 1
- OJGQFYYLKNCIJD-UHFFFAOYSA-N miroprofen Chemical compound C1=CC(C(C(O)=O)C)=CC=C1C1=CN(C=CC=C2)C2=N1 OJGQFYYLKNCIJD-UHFFFAOYSA-N 0.000 description 1
- 229950006616 miroprofen Drugs 0.000 description 1
- 229950000844 mizoribine Drugs 0.000 description 1
- 229960005285 mofebutazone Drugs 0.000 description 1
- REOJLIXKJWXUGB-UHFFFAOYSA-N mofebutazone Chemical compound O=C1C(CCCC)C(=O)NN1C1=CC=CC=C1 REOJLIXKJWXUGB-UHFFFAOYSA-N 0.000 description 1
- 229960002744 mometasone furoate Drugs 0.000 description 1
- WOFMFGQZHJDGCX-ZULDAHANSA-N mometasone furoate Chemical compound O([C@]1([C@@]2(C)C[C@H](O)[C@]3(Cl)[C@@]4(C)C=CC(=O)C=C4CC[C@H]3[C@@H]2C[C@H]1C)C(=O)CCl)C(=O)C1=CC=CO1 WOFMFGQZHJDGCX-ZULDAHANSA-N 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- OOGNFQMTGRZRAB-UHFFFAOYSA-N morazone Chemical compound CC1C(C=2C=CC=CC=2)OCCN1CC(C1=O)=C(C)N(C)N1C1=CC=CC=C1 OOGNFQMTGRZRAB-UHFFFAOYSA-N 0.000 description 1
- 229960004610 morazone Drugs 0.000 description 1
- 229960002186 morpholine salicylate Drugs 0.000 description 1
- 208000029766 myalgic encephalomeyelitis/chronic fatigue syndrome Diseases 0.000 description 1
- RTGDFNSFWBGLEC-SYZQJQIISA-N mycophenolate mofetil Chemical compound COC1=C(C)C=2COC(=O)C=2C(O)=C1C\C=C(/C)CCC(=O)OCCN1CCOCC1 RTGDFNSFWBGLEC-SYZQJQIISA-N 0.000 description 1
- 229960004866 mycophenolate mofetil Drugs 0.000 description 1
- BLUYEPLOXLPVCJ-INIZCTEOSA-N n-[(1s)-2-[4-(3-aminopropylamino)butylamino]-1-hydroxyethyl]-7-(diaminomethylideneamino)heptanamide Chemical compound NCCCNCCCCNC[C@H](O)NC(=O)CCCCCCNC(N)=N BLUYEPLOXLPVCJ-INIZCTEOSA-N 0.000 description 1
- JORAUNFTUVJTNG-BSTBCYLQSA-N n-[(2s)-4-amino-1-[[(2s,3r)-1-[[(2s)-4-amino-1-oxo-1-[[(3s,6s,9s,12s,15r,18s,21s)-6,9,18-tris(2-aminoethyl)-3-[(1r)-1-hydroxyethyl]-12,15-bis(2-methylpropyl)-2,5,8,11,14,17,20-heptaoxo-1,4,7,10,13,16,19-heptazacyclotricos-21-yl]amino]butan-2-yl]amino]-3-h Chemical compound CC(C)CCCCC(=O)N[C@@H](CCN)C(=O)N[C@H]([C@@H](C)O)CN[C@@H](CCN)C(=O)N[C@H]1CCNC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCN)NC(=O)[C@H](CCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CCN)NC1=O.CCC(C)CCCCC(=O)N[C@@H](CCN)C(=O)N[C@H]([C@@H](C)O)CN[C@@H](CCN)C(=O)N[C@H]1CCNC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCN)NC(=O)[C@H](CCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CCN)NC1=O JORAUNFTUVJTNG-BSTBCYLQSA-N 0.000 description 1
- VXMGLMHPFWGAJO-UHFFFAOYSA-N n-hydroxy-2-(5-methoxy-2-methyl-1h-indol-3-yl)acetamide Chemical compound COC1=CC=C2NC(C)=C(CC(=O)NO)C2=C1 VXMGLMHPFWGAJO-UHFFFAOYSA-N 0.000 description 1
- 229960004270 nabumetone Drugs 0.000 description 1
- GPXLMGHLHQJAGZ-JTDSTZFVSA-N nafcillin Chemical compound C1=CC=CC2=C(C(=O)N[C@@H]3C(N4[C@H](C(C)(C)S[C@@H]43)C(O)=O)=O)C(OCC)=CC=C21 GPXLMGHLHQJAGZ-JTDSTZFVSA-N 0.000 description 1
- 229960000515 nafcillin Drugs 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- CVRCFLFEGNKMEC-UHFFFAOYSA-N naphthalen-1-yl 2-hydroxybenzoate Chemical compound OC1=CC=CC=C1C(=O)OC1=CC=CC2=CC=CC=C12 CVRCFLFEGNKMEC-UHFFFAOYSA-N 0.000 description 1
- 229960002009 naproxen Drugs 0.000 description 1
- CDBRNDSHEYLDJV-FVGYRXGTSA-M naproxen sodium Chemical compound [Na+].C1=C([C@H](C)C([O-])=O)C=CC2=CC(OC)=CC=C21 CDBRNDSHEYLDJV-FVGYRXGTSA-M 0.000 description 1
- 229960003940 naproxen sodium Drugs 0.000 description 1
- CMWTZPSULFXXJA-VIFPVBQESA-M naproxen(1-) Chemical compound C1=C([C@H](C)C([O-])=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-VIFPVBQESA-M 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 229960000808 netilmicin Drugs 0.000 description 1
- ZBGPYVZLYBDXKO-HILBYHGXSA-N netilmycin Chemical compound O([C@@H]1[C@@H](N)C[C@H]([C@@H]([C@H]1O)O[C@@H]1[C@]([C@H](NC)[C@@H](O)CO1)(C)O)NCC)[C@H]1OC(CN)=CC[C@H]1N ZBGPYVZLYBDXKO-HILBYHGXSA-N 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 229950000474 nictindole Drugs 0.000 description 1
- 229960000916 niflumic acid Drugs 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 229960001180 norfloxacin Drugs 0.000 description 1
- OGJPXUAPXNRGGI-UHFFFAOYSA-N norfloxacin Chemical compound C1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCNCC1 OGJPXUAPXNRGGI-UHFFFAOYSA-N 0.000 description 1
- 229960001699 ofloxacin Drugs 0.000 description 1
- QQBDLJCYGRGAKP-FOCLMDBBSA-N olsalazine Chemical compound C1=C(O)C(C(=O)O)=CC(\N=N\C=2C=C(C(O)=CC=2)C(O)=O)=C1 QQBDLJCYGRGAKP-FOCLMDBBSA-N 0.000 description 1
- 229960004110 olsalazine Drugs 0.000 description 1
- 229940035567 orencia Drugs 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 229960004534 orgotein Drugs 0.000 description 1
- 108010070915 orgotein Proteins 0.000 description 1
- 229950003655 orpanoxin Drugs 0.000 description 1
- 230000000399 orthopedic effect Effects 0.000 description 1
- 238000012261 overproduction Methods 0.000 description 1
- 229960005113 oxaceprol Drugs 0.000 description 1
- UWYHMGVUTGAWSP-JKIFEVAISA-N oxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1 UWYHMGVUTGAWSP-JKIFEVAISA-N 0.000 description 1
- 229960001019 oxacillin Drugs 0.000 description 1
- 229960000273 oxametacin Drugs 0.000 description 1
- AJRNYCDWNITGHF-UHFFFAOYSA-N oxametacin Chemical compound CC1=C(CC(=O)NO)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 AJRNYCDWNITGHF-UHFFFAOYSA-N 0.000 description 1
- 229950004426 oxapadol Drugs 0.000 description 1
- 229960002739 oxaprozin Drugs 0.000 description 1
- OFPXSFXSNFPTHF-UHFFFAOYSA-N oxaprozin Chemical compound O1C(CCC(=O)O)=NC(C=2C=CC=CC=2)=C1C1=CC=CC=C1 OFPXSFXSNFPTHF-UHFFFAOYSA-N 0.000 description 1
- 229960000649 oxyphenbutazone Drugs 0.000 description 1
- HFHZKZSRXITVMK-UHFFFAOYSA-N oxyphenbutazone Chemical compound O=C1C(CCCC)C(=O)N(C=2C=CC=CC=2)N1C1=CC=C(O)C=C1 HFHZKZSRXITVMK-UHFFFAOYSA-N 0.000 description 1
- 229960000625 oxytetracycline Drugs 0.000 description 1
- IWVCMVBTMGNXQD-PXOLEDIWSA-N oxytetracycline Chemical compound C1=CC=C2[C@](O)(C)[C@H]3[C@H](O)[C@H]4[C@H](N(C)C)C(O)=C(C(N)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O IWVCMVBTMGNXQD-PXOLEDIWSA-N 0.000 description 1
- 235000019366 oxytetracycline Nutrition 0.000 description 1
- LSQZJLSUYDQPKJ-UHFFFAOYSA-N p-Hydroxyampicillin Natural products O=C1N2C(C(O)=O)C(C)(C)SC2C1NC(=O)C(N)C1=CC=C(O)C=C1 LSQZJLSUYDQPKJ-UHFFFAOYSA-N 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N p-hydroxybenzoic acid methyl ester Natural products COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 102000002574 p38 Mitogen-Activated Protein Kinases Human genes 0.000 description 1
- 108010068338 p38 Mitogen-Activated Protein Kinases Proteins 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 229960002858 paramethasone Drugs 0.000 description 1
- DXHYQIJBUNRPJT-UHFFFAOYSA-N parsalmide Chemical compound CCCCNC(=O)C1=CC(N)=CC=C1OCC#C DXHYQIJBUNRPJT-UHFFFAOYSA-N 0.000 description 1
- 229950001060 parsalmide Drugs 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- 229940056360 penicillin g Drugs 0.000 description 1
- 229940056367 penicillin v Drugs 0.000 description 1
- MEGKRPMNPGTIIG-VNYBMUHKSA-N penimepicycline Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)COC1=CC=CC=C1.O=C([C@@]1(O)C(O)=C2[C@@H]([C@](C3=CC=CC(O)=C3C2=O)(C)O)C[C@H]1[C@@H](C=1O)N(C)C)C=1C(=O)NCN1CCN(CCO)CC1 MEGKRPMNPGTIIG-VNYBMUHKSA-N 0.000 description 1
- 229960003187 penimepicycline Drugs 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- DDBREPKUVSBGFI-UHFFFAOYSA-N phenobarbital Chemical compound C=1C=CC=CC=1C1(CC)C(=O)NC(=O)NC1=O DDBREPKUVSBGFI-UHFFFAOYSA-N 0.000 description 1
- BPLBGHOLXOTWMN-MBNYWOFBSA-N phenoxymethylpenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)COC1=CC=CC=C1 BPLBGHOLXOTWMN-MBNYWOFBSA-N 0.000 description 1
- PSBAIJVSCTZDDB-UHFFFAOYSA-N phenyl acetylsalicylate Chemical compound CC(=O)OC1=CC=CC=C1C(=O)OC1=CC=CC=C1 PSBAIJVSCTZDDB-UHFFFAOYSA-N 0.000 description 1
- 229950009058 phenyl acetylsalicylate Drugs 0.000 description 1
- 229960000969 phenyl salicylate Drugs 0.000 description 1
- 229960002895 phenylbutazone Drugs 0.000 description 1
- VYMDGNCVAMGZFE-UHFFFAOYSA-N phenylbutazonum Chemical compound O=C1C(CCCC)C(=O)N(C=2C=CC=CC=2)N1C1=CC=CC=C1 VYMDGNCVAMGZFE-UHFFFAOYSA-N 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 229950006452 pifoxime Drugs 0.000 description 1
- ASFKKFRSMGBFRO-UHFFFAOYSA-N piketoprofen Chemical compound C=1C=CC(C(=O)C=2C=CC=CC=2)=CC=1C(C)C(=O)NC1=CC(C)=CC=N1 ASFKKFRSMGBFRO-UHFFFAOYSA-N 0.000 description 1
- 229960001503 piketoprofen Drugs 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229950008681 pimetacin Drugs 0.000 description 1
- XATZHCXBMKRRDO-REHNUXHNSA-N pipacycline Chemical compound O=C([C@@]1(O)C(O)=C2[C@@H]([C@](C3=CC=CC(O)=C3C2=O)(C)O)C[C@H]1[C@@H](C=1O)N(C)C)C=1C(=O)NCN1CCN(CCO)CC1 XATZHCXBMKRRDO-REHNUXHNSA-N 0.000 description 1
- 229950001465 pipacycline Drugs 0.000 description 1
- XGNKHIPCARGLGS-UHFFFAOYSA-N pipebuzone Chemical compound O=C1N(C=2C=CC=CC=2)N(C=2C=CC=CC=2)C(=O)C1(CCCC)CN1CCN(C)CC1 XGNKHIPCARGLGS-UHFFFAOYSA-N 0.000 description 1
- 229950004769 pipebuzone Drugs 0.000 description 1
- IVBHGBMCVLDMKU-GXNBUGAJSA-N piperacillin Chemical compound O=C1C(=O)N(CC)CCN1C(=O)N[C@H](C=1C=CC=CC=1)C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 IVBHGBMCVLDMKU-GXNBUGAJSA-N 0.000 description 1
- 229950007914 pirazolac Drugs 0.000 description 1
- ISWRGOKTTBVCFA-UHFFFAOYSA-N pirfenidone Chemical compound C1=C(C)C=CC(=O)N1C1=CC=CC=C1 ISWRGOKTTBVCFA-UHFFFAOYSA-N 0.000 description 1
- 229960003073 pirfenidone Drugs 0.000 description 1
- QYSPLQLAKJAUJT-UHFFFAOYSA-N piroxicam Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC1=CC=CC=N1 QYSPLQLAKJAUJT-UHFFFAOYSA-N 0.000 description 1
- 229960002702 piroxicam Drugs 0.000 description 1
- 229960000851 pirprofen Drugs 0.000 description 1
- PIDSZXPFGCURGN-UHFFFAOYSA-N pirprofen Chemical compound ClC1=CC(C(C(O)=O)C)=CC=C1N1CC=CC1 PIDSZXPFGCURGN-UHFFFAOYSA-N 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920002704 polyhistidine Polymers 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 229920000024 polymyxin B Polymers 0.000 description 1
- XDJYMJULXQKGMM-UHFFFAOYSA-N polymyxin E1 Natural products CCC(C)CCCCC(=O)NC(CCN)C(=O)NC(C(C)O)C(=O)NC(CCN)C(=O)NC1CCNC(=O)C(C(C)O)NC(=O)C(CCN)NC(=O)C(CCN)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCN)NC1=O XDJYMJULXQKGMM-UHFFFAOYSA-N 0.000 description 1
- KNIWPHSUTGNZST-UHFFFAOYSA-N polymyxin E2 Natural products CC(C)CCCCC(=O)NC(CCN)C(=O)NC(C(C)O)C(=O)NC(CCN)C(=O)NC1CCNC(=O)C(C(C)O)NC(=O)C(CCN)NC(=O)C(CCN)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCN)NC1=O KNIWPHSUTGNZST-UHFFFAOYSA-N 0.000 description 1
- 229960005266 polymyxin b Drugs 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 150000004804 polysaccharides Chemical class 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 238000011176 pooling Methods 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- 229960003101 pranoprofen Drugs 0.000 description 1
- 229960002794 prednicarbate Drugs 0.000 description 1
- FNPXMHRZILFCKX-KAJVQRHHSA-N prednicarbate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)CC)(OC(=O)OCC)[C@@]1(C)C[C@@H]2O FNPXMHRZILFCKX-KAJVQRHHSA-N 0.000 description 1
- JDOZJEUDSLGTLU-VWUMJDOOSA-N prednisolone phosphate Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)COP(O)(O)=O)[C@@H]4[C@@H]3CCC2=C1 JDOZJEUDSLGTLU-VWUMJDOOSA-N 0.000 description 1
- 229960002943 prednisolone sodium phosphate Drugs 0.000 description 1
- 229960002176 prednisolone sodium succinate Drugs 0.000 description 1
- FKKAEMQFOIDZNY-CODXZCKSSA-M prednisolone sodium succinate Chemical compound [Na+].O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)COC(=O)CCC([O-])=O)[C@@H]4[C@@H]3CCC2=C1 FKKAEMQFOIDZNY-CODXZCKSSA-M 0.000 description 1
- 229960004259 prednisolone tebutate Drugs 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 229950000696 prednival Drugs 0.000 description 1
- BOFKYYWJAOZDPB-FZNHGJLXSA-N prednival Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)CO)(OC(=O)CCCC)[C@@]1(C)C[C@@H]2O BOFKYYWJAOZDPB-FZNHGJLXSA-N 0.000 description 1
- 229960001917 prednylidene Drugs 0.000 description 1
- WSVOMANDJDYYEY-CWNVBEKCSA-N prednylidene Chemical group O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](C(=C)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 WSVOMANDJDYYEY-CWNVBEKCSA-N 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- FYPMFJGVHOHGLL-UHFFFAOYSA-N probucol Chemical compound C=1C(C(C)(C)C)=C(O)C(C(C)(C)C)=CC=1SC(C)(C)SC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 FYPMFJGVHOHGLL-UHFFFAOYSA-N 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 229960000825 proglumetacin Drugs 0.000 description 1
- PTXGHCGBYMQQIG-UHFFFAOYSA-N proglumetacin Chemical compound C=1C=CC=CC=1C(=O)NC(C(=O)N(CCC)CCC)CCC(=O)OCCCN(CC1)CCN1CCOC(=O)CC(C1=CC(OC)=CC=C11)=C(C)N1C(=O)C1=CC=C(Cl)C=C1 PTXGHCGBYMQQIG-UHFFFAOYSA-N 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 229960002466 proquazone Drugs 0.000 description 1
- JTIGKVIOEQASGT-UHFFFAOYSA-N proquazone Chemical compound N=1C(=O)N(C(C)C)C2=CC(C)=CC=C2C=1C1=CC=CC=C1 JTIGKVIOEQASGT-UHFFFAOYSA-N 0.000 description 1
- 150000003180 prostaglandins Chemical class 0.000 description 1
- 229950008679 protamine sulfate Drugs 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 238000000164 protein isolation Methods 0.000 description 1
- 230000022558 protein metabolic process Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 229950001856 protizinic acid Drugs 0.000 description 1
- OLTAWOVKGWWERU-UHFFFAOYSA-N proxazole Chemical compound C=1C=CC=CC=1C(CC)C1=NOC(CCN(CC)CC)=N1 OLTAWOVKGWWERU-UHFFFAOYSA-N 0.000 description 1
- 229960001801 proxazole Drugs 0.000 description 1
- MIXMJCQRHVAJIO-TZHJZOAOSA-N qk4dys664x Chemical compound O.C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O.C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O MIXMJCQRHVAJIO-TZHJZOAOSA-N 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 229950000385 ramifenazone Drugs 0.000 description 1
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- JQXXHWHPUNPDRT-WLSIYKJHSA-N rifampicin Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C([O-])=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N1CC[NH+](C)CC1 JQXXHWHPUNPDRT-WLSIYKJHSA-N 0.000 description 1
- 229960001225 rifampicin Drugs 0.000 description 1
- 229960000371 rofecoxib Drugs 0.000 description 1
- RZJQGNCSTQAWON-UHFFFAOYSA-N rofecoxib Chemical compound C1=CC(S(=O)(=O)C)=CC=C1C1=C(C=2C=CC=CC=2)C(=O)OC1 RZJQGNCSTQAWON-UHFFFAOYSA-N 0.000 description 1
- HJORMJIFDVBMOB-UHFFFAOYSA-N rolipram Chemical compound COC1=CC=C(C2CC(=O)NC2)C=C1OC1CCCC1 HJORMJIFDVBMOB-UHFFFAOYSA-N 0.000 description 1
- 229950005741 rolipram Drugs 0.000 description 1
- 229960005009 rolitetracycline Drugs 0.000 description 1
- HMEYVGGHISAPJR-IAHYZSEUSA-N rolitetracycline Chemical compound O=C([C@@]1(O)C(O)=C2[C@@H]([C@](C3=CC=CC(O)=C3C2=O)(C)O)C[C@H]1[C@@H](C=1O)N(C)C)C=1C(=O)NCN1CCCC1 HMEYVGGHISAPJR-IAHYZSEUSA-N 0.000 description 1
- GVHKSMYWAFEEBI-UHFFFAOYSA-N s-(pyridin-3-ylmethyl) 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methylindol-3-yl]ethanethioate Chemical compound CC1=C(CC(=O)SCC=2C=NC=CC=2)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 GVHKSMYWAFEEBI-UHFFFAOYSA-N 0.000 description 1
- LCXASZQUGJCXBG-SUMWQHHRSA-N s057 Chemical compound C1([C@]23OC[C@@H](O3)CN3C4=CC=CC=C4N=C23)=CC=CC=C1 LCXASZQUGJCXBG-SUMWQHHRSA-N 0.000 description 1
- JZWFDVDETGFGFC-UHFFFAOYSA-N salacetamide Chemical compound CC(=O)NC(=O)C1=CC=CC=C1O JZWFDVDETGFGFC-UHFFFAOYSA-N 0.000 description 1
- 229950009280 salacetamide Drugs 0.000 description 1
- 229960000581 salicylamide Drugs 0.000 description 1
- 229960000953 salsalate Drugs 0.000 description 1
- 229950000614 sancycline Drugs 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 239000008299 semisolid dosage form Substances 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 1
- 229960002930 sirolimus Drugs 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 239000000661 sodium alginate Substances 0.000 description 1
- 235000010413 sodium alginate Nutrition 0.000 description 1
- 229940005550 sodium alginate Drugs 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 229960004025 sodium salicylate Drugs 0.000 description 1
- RPACBEVZENYWOL-XFULWGLBSA-M sodium;(2r)-2-[6-(4-chlorophenoxy)hexyl]oxirane-2-carboxylate Chemical compound [Na+].C=1C=C(Cl)C=CC=1OCCCCCC[C@]1(C(=O)[O-])CO1 RPACBEVZENYWOL-XFULWGLBSA-M 0.000 description 1
- JGMJQSFLQWGYMQ-UHFFFAOYSA-M sodium;2,6-dichloro-n-phenylaniline;acetate Chemical compound [Na+].CC([O-])=O.ClC1=CC=CC(Cl)=C1NC1=CC=CC=C1 JGMJQSFLQWGYMQ-UHFFFAOYSA-M 0.000 description 1
- RWFZSORKWFPGNE-VDYYWZOJSA-M sodium;3-[2-[(8s,9s,10r,11s,13s,14s,17r)-11,17-dihydroxy-10,13-dimethyl-3-oxo-7,8,9,11,12,14,15,16-octahydro-6h-cyclopenta[a]phenanthren-17-yl]-2-oxoethoxy]carbonylbenzenesulfonate Chemical compound [Na+].O=C([C@@]1(O)CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)[C@@H](O)C[C@@]21C)COC(=O)C1=CC=CC(S([O-])(=O)=O)=C1 RWFZSORKWFPGNE-VDYYWZOJSA-M 0.000 description 1
- QKMGIVQNFXRKEE-UHFFFAOYSA-L sodium;copper(1+);3-[(n-prop-2-enyl-c-sulfidocarbonimidoyl)amino]benzoate Chemical compound [Na+].[Cu+].[O-]C(=O)C1=CC=CC(NC([S-])=NCC=C)=C1 QKMGIVQNFXRKEE-UHFFFAOYSA-L 0.000 description 1
- AGHLUVOCTHWMJV-UHFFFAOYSA-J sodium;gold(3+);2-sulfanylbutanedioate Chemical compound [Na+].[Au+3].[O-]C(=O)CC(S)C([O-])=O.[O-]C(=O)CC(S)C([O-])=O AGHLUVOCTHWMJV-UHFFFAOYSA-J 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 229960004954 sparfloxacin Drugs 0.000 description 1
- DZZWHBIBMUVIIW-DTORHVGOSA-N sparfloxacin Chemical compound C1[C@@H](C)N[C@@H](C)CN1C1=C(F)C(N)=C2C(=O)C(C(O)=O)=CN(C3CC3)C2=C1F DZZWHBIBMUVIIW-DTORHVGOSA-N 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 229960001294 spiramycin Drugs 0.000 description 1
- 235000019372 spiramycin Nutrition 0.000 description 1
- 229930191512 spiramycin Natural products 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 1
- WNIFXKPDILJURQ-UHFFFAOYSA-N stearyl glycyrrhizinate Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C)CCC(C(=O)OCCCCCCCCCCCCCCCCCC)(C)CC5C4=CC(=O)C3C21C WNIFXKPDILJURQ-UHFFFAOYSA-N 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 230000003637 steroidlike Effects 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 239000006190 sub-lingual tablet Substances 0.000 description 1
- 229950005175 sudoxicam Drugs 0.000 description 1
- 229960002673 sulfacetamide Drugs 0.000 description 1
- SKIVFJLNDNKQPD-UHFFFAOYSA-N sulfacetamide Chemical compound CC(=O)NS(=O)(=O)C1=CC=C(N)C=C1 SKIVFJLNDNKQPD-UHFFFAOYSA-N 0.000 description 1
- 229960004306 sulfadiazine Drugs 0.000 description 1
- SEEPANYCNGTZFQ-UHFFFAOYSA-N sulfadiazine Chemical compound C1=CC(N)=CC=C1S(=O)(=O)NC1=NC=CC=N1 SEEPANYCNGTZFQ-UHFFFAOYSA-N 0.000 description 1
- 229960000654 sulfafurazole Drugs 0.000 description 1
- 229960005404 sulfamethoxazole Drugs 0.000 description 1
- FDDDEECHVMSUSB-UHFFFAOYSA-N sulfanilamide Chemical compound NC1=CC=C(S(N)(=O)=O)C=C1 FDDDEECHVMSUSB-UHFFFAOYSA-N 0.000 description 1
- NCEXYHBECQHGNR-QZQOTICOSA-N sulfasalazine Chemical compound C1=C(O)C(C(=O)O)=CC(\N=N\C=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-QZQOTICOSA-N 0.000 description 1
- 229960001940 sulfasalazine Drugs 0.000 description 1
- NCEXYHBECQHGNR-UHFFFAOYSA-N sulfasalazine Natural products C1=C(O)C(C(=O)O)=CC(N=NC=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-UHFFFAOYSA-N 0.000 description 1
- 229960000894 sulindac Drugs 0.000 description 1
- MLKXDPUZXIRXEP-MFOYZWKCSA-N sulindac Chemical compound CC1=C(CC(O)=O)C2=CC(F)=CC=C2\C1=C/C1=CC=C(S(C)=O)C=C1 MLKXDPUZXIRXEP-MFOYZWKCSA-N 0.000 description 1
- JLKIGFTWXXRPMT-UHFFFAOYSA-N sulphamethoxazole Chemical compound O1C(C)=CC(NS(=O)(=O)C=2C=CC(N)=CC=2)=N1 JLKIGFTWXXRPMT-UHFFFAOYSA-N 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 229960004492 suprofen Drugs 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 229960003755 suxibuzone Drugs 0.000 description 1
- ONWXNHPOAGOMTG-UHFFFAOYSA-N suxibuzone Chemical compound O=C1C(CCCC)(COC(=O)CCC(O)=O)C(=O)N(C=2C=CC=CC=2)N1C1=CC=CC=C1 ONWXNHPOAGOMTG-UHFFFAOYSA-N 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 229950005100 talmetacin Drugs 0.000 description 1
- 229960005262 talniflumate Drugs 0.000 description 1
- 229960004576 temafloxacin Drugs 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 229960003676 tenidap Drugs 0.000 description 1
- LXIKEPCNDFVJKC-QXMHVHEDSA-N tenidap Chemical compound C12=CC(Cl)=CC=C2N(C(=O)N)C(=O)\C1=C(/O)C1=CC=CS1 LXIKEPCNDFVJKC-QXMHVHEDSA-N 0.000 description 1
- LZNWYQJJBLGYLT-UHFFFAOYSA-N tenoxicam Chemical compound OC=1C=2SC=CC=2S(=O)(=O)N(C)C=1C(=O)NC1=CC=CC=N1 LZNWYQJJBLGYLT-UHFFFAOYSA-N 0.000 description 1
- 229960002871 tenoxicam Drugs 0.000 description 1
- 229950002207 terofenamate Drugs 0.000 description 1
- IWVCMVBTMGNXQD-UHFFFAOYSA-N terramycin dehydrate Natural products C1=CC=C2C(O)(C)C3C(O)C4C(N(C)C)C(O)=C(C(N)=O)C(=O)C4(O)C(O)=C3C(=O)C2=C1O IWVCMVBTMGNXQD-UHFFFAOYSA-N 0.000 description 1
- TUGDLVFMIQZYPA-UHFFFAOYSA-N tetracopper;tetrazinc Chemical compound [Cu+2].[Cu+2].[Cu+2].[Cu+2].[Zn+2].[Zn+2].[Zn+2].[Zn+2] TUGDLVFMIQZYPA-UHFFFAOYSA-N 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 229960003433 thalidomide Drugs 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 229960001312 tiaprofenic acid Drugs 0.000 description 1
- 229950010302 tiaramide Drugs 0.000 description 1
- HTJXMOGUGMSZOG-UHFFFAOYSA-N tiaramide Chemical compound C1CN(CCO)CCN1C(=O)CN1C(=O)SC2=CC=C(Cl)C=C21 HTJXMOGUGMSZOG-UHFFFAOYSA-N 0.000 description 1
- 229950000140 tiflamizole Drugs 0.000 description 1
- 229950006828 timegadine Drugs 0.000 description 1
- 229950010298 tinoridine Drugs 0.000 description 1
- PFENFDGYVLAFBR-UHFFFAOYSA-N tinoridine Chemical compound C1CC=2C(C(=O)OCC)=C(N)SC=2CN1CC1=CC=CC=C1 PFENFDGYVLAFBR-UHFFFAOYSA-N 0.000 description 1
- 229950002345 tiopinac Drugs 0.000 description 1
- 229950006150 tioxaprofen Drugs 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 229960004631 tixocortol Drugs 0.000 description 1
- YWDBSCORAARPPF-VWUMJDOOSA-N tixocortol Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CS)[C@@H]4[C@@H]3CCC2=C1 YWDBSCORAARPPF-VWUMJDOOSA-N 0.000 description 1
- 229960000707 tobramycin Drugs 0.000 description 1
- NLVFBUXFDBBNBW-PBSUHMDJSA-N tobramycin Chemical compound N[C@@H]1C[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N NLVFBUXFDBBNBW-PBSUHMDJSA-N 0.000 description 1
- 229960003989 tocilizumab Drugs 0.000 description 1
- 229960002905 tolfenamic acid Drugs 0.000 description 1
- YEZNLOUZAIOMLT-UHFFFAOYSA-N tolfenamic acid Chemical compound CC1=C(Cl)C=CC=C1NC1=CC=CC=C1C(O)=O YEZNLOUZAIOMLT-UHFFFAOYSA-N 0.000 description 1
- 229960001017 tolmetin Drugs 0.000 description 1
- UPSPUYADGBWSHF-UHFFFAOYSA-N tolmetin Chemical compound C1=CC(C)=CC=C1C(=O)C1=CC=C(CC(O)=O)N1C UPSPUYADGBWSHF-UHFFFAOYSA-N 0.000 description 1
- 229960002044 tolmetin sodium Drugs 0.000 description 1
- QGUALMNFRILWRA-UHFFFAOYSA-M tolmetin sodium Chemical compound [Na+].C1=CC(C)=CC=C1C(=O)C1=CC=C(CC([O-])=O)N1C QGUALMNFRILWRA-UHFFFAOYSA-M 0.000 description 1
- 229950005382 tolpadol Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 229960005294 triamcinolone Drugs 0.000 description 1
- GFNANZIMVAIWHM-OBYCQNJPSA-N triamcinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 1
- 229960002117 triamcinolone acetonide Drugs 0.000 description 1
- YNDXUCZADRHECN-JNQJZLCISA-N triamcinolone acetonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O YNDXUCZADRHECN-JNQJZLCISA-N 0.000 description 1
- 229950006782 triamcinolone benetonide Drugs 0.000 description 1
- GUYPYYARYIIWJZ-CYEPYHPTSA-N triamcinolone benetonide Chemical compound O=C([C@]12[C@H](OC(C)(C)O1)C[C@@H]1[C@@]2(C[C@H](O)[C@]2(F)[C@@]3(C)C=CC(=O)C=C3CC[C@H]21)C)COC(=O)C(C)CNC(=O)C1=CC=CC=C1 GUYPYYARYIIWJZ-CYEPYHPTSA-N 0.000 description 1
- 229960004221 triamcinolone hexacetonide Drugs 0.000 description 1
- FYZXEMANQYHCFX-UHFFFAOYSA-K tripotassium;2-[2-[bis(carboxylatomethyl)amino]ethyl-(carboxymethyl)amino]acetate Chemical compound [K+].[K+].[K+].OC(=O)CN(CC([O-])=O)CCN(CC([O-])=O)CC([O-])=O FYZXEMANQYHCFX-UHFFFAOYSA-K 0.000 description 1
- FQCQGOZEWWPOKI-UHFFFAOYSA-K trisalicylate-choline Chemical compound [Mg+2].C[N+](C)(C)CCO.OC1=CC=CC=C1C([O-])=O.OC1=CC=CC=C1C([O-])=O.OC1=CC=CC=C1C([O-])=O FQCQGOZEWWPOKI-UHFFFAOYSA-K 0.000 description 1
- KZNBHWLDPGWJMM-UHFFFAOYSA-J trisodium;dioxido-oxo-sulfanylidene-$l^{6}-sulfane;gold(1+);dihydrate Chemical compound O.O.[Na+].[Na+].[Na+].[Au+].[O-]S([O-])(=O)=S.[O-]S([O-])(=O)=S KZNBHWLDPGWJMM-UHFFFAOYSA-J 0.000 description 1
- 239000007160 ty medium Substances 0.000 description 1
- 229950010121 ufenamate Drugs 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 229960003824 ustekinumab Drugs 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 229960002004 valdecoxib Drugs 0.000 description 1
- LNPDTQAFDNKSHK-UHFFFAOYSA-N valdecoxib Chemical compound CC=1ON=C(C=2C=CC=CC=2)C=1C1=CC=C(S(N)(=O)=O)C=C1 LNPDTQAFDNKSHK-UHFFFAOYSA-N 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
- 229950005298 xenbucin Drugs 0.000 description 1
- IYEPZNKOJZOGJG-UHFFFAOYSA-N xenbucin Chemical compound C1=CC(C(C(O)=O)CC)=CC=C1C1=CC=CC=C1 IYEPZNKOJZOGJG-UHFFFAOYSA-N 0.000 description 1
- 229950007802 zidometacin Drugs 0.000 description 1
- 229960003414 zomepirac Drugs 0.000 description 1
- ZXVNMYWKKDOREA-UHFFFAOYSA-N zomepirac Chemical compound C1=C(CC(O)=O)N(C)C(C(=O)C=2C=CC(Cl)=CC=2)=C1C ZXVNMYWKKDOREA-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/545—IL-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/06—Antigout agents, e.g. antihyperuricemic or uricosuric agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/04—Centrally acting analgesics, e.g. opioids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4713—Autoimmune diseases, e.g. Insulin-dependent diabetes mellitus, multiple sclerosis, rheumathoid arthritis, systemic lupus erythematosus; Autoantigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4726—Lectins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Biomedical Technology (AREA)
- Genetics & Genomics (AREA)
- Physical Education & Sports Medicine (AREA)
- Neurology (AREA)
- Rheumatology (AREA)
- Neurosurgery (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Zoology (AREA)
- Diabetes (AREA)
- Biochemistry (AREA)
- Hematology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Biophysics (AREA)
- Pulmonology (AREA)
- Pain & Pain Management (AREA)
- Toxicology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Urology & Nephrology (AREA)
- Obesity (AREA)
Description
WO 2009/048961 PCT/US2008/079216 TRIMERIC IL-1Ra Cross-Reference to Related Application [0001] This application claims the benefit of U.S. Provisional Patent Application Serial No. 60/978,254, filed October 8, 2008, which is incorporated by reference herein in its entirety. Field of the Invention [0002] The invention relates to treatment of diseases that are mediated by interleukin 1. More particularly, the invention relates to interleukin 1 receptor antagonists (IL-1 Ra) that are useful for treating such diseases. Background of the Invention [0003] The IL-I family is an important part of the innate immune system, which is a regulator of the adaptive immune system. The balance between IL-I and IL-1Ra in local tissues influences the possible development of inflammatory diseases and resulting structural damage. In the presence of an excess amount of IL-1, inflammatory and autoimmune diseases may develop in the joints, lungs, gastrointestinal tract, central nervous system (CNS), or blood vessels. Treatment of human disease with IL-1Ra has been carried out through injection of recombinant IL-iRa or through gene therapy approaches. Treatment with recombinant IL-1Ra has been approved for rheumatoid arthritis (RA) and phase 2 studies are ongoing for osteoarthritis (OA). [0004] An important pro-inflammatory role for IL-1 in many human diseases has been described over the past 10 years. The balance between IL-I and IL-IRa has been extensively studied in a variety of animal disease models including rheumatoid arthritis (RA), osteoarthritis (OA), inflammatory bowel disease (IBD), granulomatous and fibrotic lung disorders, kidney diseases, diseases of the liver and pancreas, graft-versus-host disease (GVHD), leukemia, cancer, osteoporosis, diabetes, central nervous system diseases, infectious diseases, and arterial diseases. In each of these diseases, local overproduction of IL-1 and/or underproduction of IL-1Ra pre-disposes subjects to disease development. The 1 WO 2009/048961 PCT/US2008/079216 therapeutic administration of IL-IRa has been shown to be efficacious in preventing tissue damage (See W.P. Arend, Cytokine & Growth Factor Reviews, 13 (2002) pp. 323-240). [0005] The IL-I family consists of two agonists, IL-la and IL- IP; the specific receptor antagonist IL-iRa; and three different receptors, IL-iR type I (IL-1RI), IL-1R type II (IL 1RII) and IL-1 receptor accessory protein (IL-IR AcP). IL-1RI is an 80 kDa protein with a long cytoplasmic domain of 215 residues. The biologically inert IL-IRII is a 60 kDa protein with a short cytoplasmic domain of 29 residues. IL-1R AcP is recruited to the complex after binding of IL-la or IL-1p to the single chain IL-1RI. Signal transduction pathways activated by the approximated cytoplasmic domains of IL-1RI and IL-IR AcP include the NF-cB, JNK/AP- 1, and p38 MAP kinase pathways. IL-I RI functions as a decoy receptor, binding IL-I both on the plasma membrane and as a soluble receptor in the fluid phase, thereby preventing IL-1 from interacting with the functional IL-IRL. [0006] The third ligand in the IL-1 family, IL-1Ra, is a structural variant of IL-1 that binds to both IL-1R but fails to activate cells. IL-iRa is a 17 kDa protein with 18% amino acid homology to IL-Ia and 26% homology to IL-1 P. The originally described isoform of IL 1Ra is secreted from monocytes, macrophages, neutrophils, and other cells and is now termed sIL- 1 Ra. Three additional intracellular isoforms of IL-1 Ra have been described to date. An 18 kDa form of IL-iRa, created by an alternative transcriptional splice mechanism from an upstream exon is called icIL-1Ral and is found inside keratinocytes and other epithelial cells, monocytes, tissue macrophages, fibroblasts, and endothelial cells. IL-iRa cDNA cloned from human leukocytes contains an additional 63 bp sequence as an insert in the 5' region of the cDNA. A 15 kDa isoform of IL-1Ra, termed icIL-IRa3, is found in monocytes, macrophages, neutrophils, and hepatocytes, and may be created both by an alternative transcriptional splice as well as by alternative translational initiation. [0007] Both soluble IL-1Ra and icIL-1Ral bind equally well to IL-1R, but icIL-1Ra3 exhibits weak receptor binding. IL-1Ra functions as a specific receptor antagonist by binding to IL-IRI but preventing IL-IR AcP from associating with the IL-IRI, which results failure of initiation of signal transduction pathways. [0008] The decoy receptor IL-1RII binds IL-I both on the plasma membrane and as a soluble receptor in the fluid phase, preventing IL-1 from interacting with the functional IL 2 WO 2009/048961 PCT/US2008/079216 1RI. Therefore, soluble IL-IRII and IL-1Ra can inhibit IL-1 in co-operation. Soluble IL-RI can bind to IL-1 as well as IL-1 Ra, but due to the balance between IL-1 and IL-IRa, soluble IL-1RI seems to act as a pro-inflammatory agent. [0009] KINERET* is an E. coli produced IL-1Ra from Amgen, which has been shown to benefit patients with active rheumatoid arthritis. KINERET* has to be injected subcutaneously once per day. With subcutaneous administration, KINERET* has a half-life ranged from 4 to 6 hours; for i.v. administration the half life is approximately 2% hours. IL 1Ra is cleared by renal clearance. KINERET* is a specific receptor antagonist of IL-I that differs from naturally occurring IL-1 receptor antagonist by the presence of a methionine group. When given alone or in combination with methotrexate, KINERET* has been shown to benefit patients as assessed by improvement in clinical signs and symptoms, decreased radiographic progression and improvement in patient function, pain and fatigue. KINERET* has a favorable safety profile as demonstrated in clinical trials. [0010] Several attempts have been made to improve the poor pharmacokinetics of IL 1 Ra. Antibodies targeting just IL-I beta have been developed. However, in contrast to IL ira, these only block IL-1 beta, but not IL-i la action. [0011] Accordingly, the inventors have identified a need in the art for an improved delivery method for IL1 -Ra, which provides for a longer half-life of the molecule and provides a favorable safety profile. Brief Description of the Drawings [0012] Figure 1 shows alignment of the amino acid sequences of the trimerising structural element of the tetranectin protein family. Amino acid sequences (one letter code) corresponding to residue V17 to K52 comprising exon 2 and the first three residues of exon 3 of human tetranectin (SEQ ID NO: 59); murine tetranectin (SEQ ID NO: 60); tetranectin homologous protein isolated from reefshark cartilage (SEQ ID NO: 61) and tetranectin homologous protein isolated from bovine cartilage (SEQ ID NO: 62. Residues at a and d positions in the heptad repeats are listed in boldface. The listed consensus sequence of the tetranectin protein family trimerising structural element comprise the residues present at a 3 WO 2009/048961 PCT/US2008/079216 and d positions in the heptad repeats shown in the figure in addition to the other conserved residues of the region. "hy" denotes an aliphatic hydrophobic residue. [0013] Figure 2 shows the results of CII-H6-GrB-TripK-IL-lRa refolding by dialysis. [0014] Figure 3 displays the capturing CII-H6-GrB-TripK-IL-1Ra on NiNTA. [0015] Figure 4 is a graph showing the ability of GG-TripV-IL-1Ra (trip V-IL-1Ra), GG TripK-IL-lRa (trip K-IL-iRa), GG-TripT-IL-iRa (trip T-IL-iRa) and GG-TripT-IL-1Ra (trip T-IL-1Ra) to inhibit IL-1 induction of IL-8 in U937 cells. [0016] Figure 5 is a graph showing the ability of pegylated TripT and TripV to inhibit IL 1 induction of IL-8 in U937 cells as compared to non-pegylated forms and KINERET*. [0017] Figure 6 is a graph showing the ability of TripT-IL-iRa, I10-TripT-IL-iRa, V17 TripT-IL-iRa used in the PK study to inhibit IL-1 induction of IL-8 in U937 cells [0018] Figure 7 is a graph showing the blood concentrations of TripT-IL- 1 Ra, I110-TripT IL-iRa, and V17-TripT-IL-1Ra after 100mg/kg i.v. injection in rats. [0019] Figure 8 shows an SDS-PAGE analysis of multiple batches of Met-Il0-TrpT-IL IRa (LM022 and LM023) and GG-VI7-TrpT-IL-1Ra (CFO19 and CF020) protein yields. [0020] Figure 9 shows analytical SEC results of Met-I10-TrpT-IL- 1 Ra and GG-V17 TrpT-IL-1Ra protein yields. [0021] Figure 10 shows the results of the rat CIA study. Ankle diameters of female Lewis rats with type II collagen arthritis were measured following treatment with Vehicle (10 mM phosphate buffer pH 7.4), or equimolar amounts of IL-Ira administering either monomeric IL-ira (100 mg/kg KINERET*), or trimerized ILlra (120 mg/kg Met-IO-TripT ILira, or 120 mg/kg GG-V17-TripT-ILira). [0022] Figure 11 shows study reduction of final paw weight when rats treated with KINERET*, Met-I1O-TripT-ILIra QD, or GG-VI7-TripT-IL1ra QD, as compared to vehicle treated disease control animals. 4 WO 2009/048961 PCT/US2008/079216 [0023] Figure 12 shows reduction of blood glucose levels observed after daily i.p. dosing of either I1 0-TripT-IL1 -Ra or KINERET*. Summary of the Invention [0024] The present invention provides a fusion protein comprising a trimerizing domain and an IL-1Ra polypeptide sequence that inhibits IL-1 activity. In one embodiment, the fusion protein comprises an IL-1Ra sequence that comprises a variant or fragment of SEQ ID NO: 38 that inhibits IL- 1 activity. In an additional embodiment, the fusion protein comprises an IL-1Ra polypeptide sequence that is at least 85% identical to SEQ ID NO: 38. The fusion proteins may include polyethylene glycol. The trimerizing domain of the fusion protein may be derived from tetranectin. [0025] The present invention also provides a trimeric complex comprising three fusion proteins of the invention. In one embodiment, the trimeric complex comprises a trimerizing domain that is a tetranectin trimerizing structural element (TTSE). In one embodiment, the trimeric complex comprises a trimerizing domain is at least 66% identical to SEQ ID NO: 1. In s further embodiment, the trimeric complex comprises at least one of the fusion proteins selected from the group consisting of TripK-IL-lra (SEQ ID NO: 39); TripV-IL-lra (SEQ ID NO: 40); TripT-IL-ira (SEQ ID NO: 41); TripQ-IL-lra (SEQ ID NO: 42); I10-TripK-IL-ira (SEQ ID NO: 43); I10-TripV-IL-ira (SEQ ID NO: 44); 110-TripT-IL-1ra (SEQ ID NO: 45); I10-TripQ-IL-ira (SEQ ID NO: 46); V17-TripT-ILiRa (SEQ ID NO: 55); V17-TripK-IL 1Ra (SEQ ID NO: 56); V17-TripV-IL-1RA (SEQ ID NO: 57); and V17-TripQ-IL1RA (SEQ ID NO: 58). [0026] In a further embodiment, the present invention provides a pharmaceutical composition comprising a trimeric and at least one pharmaceutically acceptable excipient. [0027] Even further, the invention is directed to a method for treating a disease mediated by interleukin 1. The method includes administering to a patient in need thereof of the pharmaceutical composition of the invention. The disease may be an inflammatory disease such as rheumatoid arthritis or diabetes. The method also includes administering to the patient, either simultaneously or sequentially, an anti-inflammatory agent. 5 WO 2009/048961 PCT/US2008/079216 [0028] The invention also provides a fusion protein further comprising an anti inflammatory agent covalently linked to the fusion protein. [0029] These and other aspects of the invention are described in further detail below. Detailed Description of the Invention [0030] The invention is directed to compounds and methods for treating diseases mediated by IL-1. In one aspect, the invention is directed to a fusion protein of an IL-iRa polypeptide sequence fused to a trimerizing or multimerizing domain. Three or more of fusion proteins may trimerize or multimerize to provide compositions providing for greater stability and improved pharmacokinetic properties than IL-i Ra alone, and provide a favorable safety profile. [0031] In an additional aspect the invention provides a nucleic acid which encodes any one of the polypeptides defined above, as well as methods of preparing these polypeptides under conditions that allow for specific expression and recovery. [0032] The polypeptides of the invention may be used for the preparation of pharmaceutical compositions for use in the treatment of a subject having a pathology mediated by IL-1, such as a method of treatment of inflammatory diseases, by administering to the subject an effective amount of pharmaceutical composition. [0033] As used herein, a disease or medical condition is considered to be an "interleukin 1 mediated disease" or "a disease mediated by interleukin-1" if the spontaneous or experimental disease or medical condition is associated with elevated levels of IL-1 in bodily fluids or tissue or if cells or tissues taken from the body produce elevated levels of IL-1 in culture. In many cases, such interleukin-1 mediated diseases are also recognized by the following additional two conditions: (1) pathological findings associated with the disease or medical condition can be mimicked experimentally in animals by the administration of IL-1; and (2) the pathology induced in experimental animal models of the disease or medical condition can be inhibited or abolished by treatment with agents which inhibit the action of IL-1. In most IL-1 mediated diseases at least two of the three conditions are met, and in many IL-1 mediated diseases all three conditions are met. A non-exclusive list of acute and chronic IL-1-mediated inflammatory diseases includes but is not limited to the following: gout, acute 6 WO 2009/048961 PCT/US2008/079216 pancreatitis; ALS; Alzheimer's disease; cachexia/anorexia; asthma; atherosclerosis; chronic fatigue syndrome, fever; diabetes (e.g., insulin diabetes); glomerulonephritis; graft versus host rejection; hemohorragic shock; hyperalgesia, inflammatory bowel disease; inflammatory conditions of a joint, including osteoarthritis, psoriatic arthritis, juvenile arthritis, and rheumatoid arthritis; ischemic injury, including cerebral ischemia (e.g., brain injury as a result of trauma, epilepsy, hemorrhage or stroke, each of which may lead to neurodegeneration); lung diseases (e.g., ARDS); multiple myeloma; multiple sclerosis; myelogenous (e.g., AML and CML) and other leukemias; myopathies (e.g., muscle protein metabolism, esp. in sepsis); osteoporosis; Parkinson's disease; pain; pre-term labor; psoriasis; reperfusion injury; septic shock; side effects from radiation therapy, temporal mandibular joint disease, tumor metastasis; or an inflammatory condition resulting from strain, sprain, cartilage damage, trauma, orthopedic surgery, infection or other disease processes, and Cryopyrin-associated periodic syndromes, including Muckle Wells syndrome, familial cold autoinflammatory syndrome and neonatal-onset multisystem inflammatory disease. [0034] As used herein, the term "multimerizing domain" means an amino acid sequence that comprises the functionality that can associate with two or more other amino acid sequences to form trimers or other multimerized complexes. In one example, the fusion protein contains an amino acid sequence -- a trimerizing domain -- which forms a trimeric complex with two other trimerizing domains. A trimerizing domain can associate with other trimerizing domains of identical amino acid sequence (a homotrimer), or with trimerizing domains of different amino acid sequence (a heterotrimer). Such an interaction may be caused by covalent bonds between the components of the trimerizing domains as well as by hydrogen bond forces, hydrophobic forces, van der Waals forces and salt bridges. In various embodiment so of the invention, the multimerizing domain is a dimerizing, domain, a trimerizing domain, a tetramerizing domain, a pentamerizing domain, etc. These domains are capaple of forming polypeptide complexes of two, three, four, five or more fusion proteins of the invention. [0035] The trimerizing domain of a fusion protein of the invention may be derived from tetranectin as described in U.S. Patent Application Publication No. 2007/0154901 ('901 Application), which is incorporated by reference in its entirety. The full length human tetranectin polypeptide sequence is provided herein as SEQ ID NO: 63. Examples of a 7 WO 2009/048961 PCT/US2008/079216 tetranectin trimerizing domain includes the amino acids 17 to 49, 17 to 50, 17 to 51 and 17 52 of SEQ ID NO: 63, which represent the amino acids encoded by exon 2 of the human tetranectin gene, and optionally the first one, two or three amino acids encoded by exon 3 of the gene. Other examples include amino acids 1 to 49, 1 to 50, 1 to 51 and 1 to 52, which represents all of exons 1 and 2, and optionally the first one, two or three amino acids encoded by exon 3 of the gene. Alternatively, only a part of the amino acid sequence encoded by exon 1 is included in the trimerizing domain. In particular, the N-terminus of the trimerizing domain may begin at any of residues 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 and 17 of SEQ ID NO: 63. In particular embodiments, the N terminus is 110 or V17 and the C terminus is Q47, T48, V49, C(S)50, L51 or K52 (numbering according to SEQ ID NO: 63). [0036] In one aspect of the invention, the trimerizing domain is a tetranectin trimerizing structural element ("TTSE") having a amino acid sequence of SEQ ID NO: 1 which a consensus sequence of the tetranectin family trimerizing structural element as more fully described in US 2007/00154901. As shown in Figure 1, the TTSE embraces variants of a naturally occurring member of the tetranectin family of proteins, and in particular variants that have been modified in the amino acid sequence without adversely affecting, to any substantial degree, the ability of the TTSE to form alpha helical coiled coil trimers. In various aspects of the invention, the trimeric polypeptide according to the invention includes a TTSE as a trimerizing domain having at least 66% amino acid sequence identity to the consensus sequence of SEQ ID NO: 1; for example at least 73%, at least 80%, at least 86% or at least 92% sequence identity to the consensus sequence of SEQ ID NO: 1 (counting only the defined (not Xaa) residues). In other words, at least one, at least two, at least three, at least four, or at least five of the defined amino acids in SEQ ID NO: 1 may be substituted. [0037] In one particular embodiment, the cysteine at position 50 (C50) of SEQ ID NO: 63 can be advantageously be mutagenized to serine, threonine, methionine or to any other amino acid residue in order to avoid formation of an unwanted inter-chain disulphide bridge, which can lead to unwanted multimerization. Other known variants include at least one amino acid residue selected from amino acid residue nos. 6, 21, 22, 24, 25, 27, 28, 31, 32, 35, 39, 41, and 42 (numbering according to SEQ ID NO:63), which may be substituted by any non-helix breaking amino acid residue. These residues have been shown not to be directly involved in the intermolecular interactions that stabilize the trimeric complex between three 8 WO 2009/048961 PCT/US2008/079216 TTSEs of native tetranectin monomers. In one aspect shown in FIG. 1, the TTSE has a repeated heptad having the formula a-b-c-d-e-f-g (N to C), wherein residues a and d (i.e., positions 26, 33, 37, 40, 44, 47, and 51 may be any hydrophobic amino acid (numbering according to claim 63). [0038] In further embodiments, the TTSE trimerization domain may be modified by the incorporation of polyhistidine sequence and/or a protease cleavage site, e.g, Blood Coagulating Factor Xa or Granzyme B (see US 2005/0199251, which is incorporated herein by reference), and by including a C-terminal KG or KGS sequence. Also, to assist in purification, Proline at position 2 may be substituted with Glycine to assist in purification. [0039] Particular non-limiting examples of TTSE truncations and variants are shown in Table 1 below. Table 1 TTSE variants SEQ ID NO: 2 EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLK SEQ ID NO: 3 EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSL SEQ ID NO: 4 EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVS SEQ ID NO: 5 EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTV SEQ ID NO: 6 PPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 7 PTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 8 TQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 9 QKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 10 KPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 11 PKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 12 KKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 13 KIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 14 IVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 15 VNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 16 NAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 17 AKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 18 KKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 19 KDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG 9 WO 2009/048961 PCT/US2008/079216 SEQ ID NO: 20 VVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 21 VVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 22 VVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLK SEQ ID NO: 23 VVNTKMFEELKSRLDTLAQEVALLKEQQALQTV SEQ ID NO: 24 VVNTKMFEELKSRLDTLAQEVALLKEQQALQT SEQ ID NO: 25 VNTKMFEELKSRLDTLAQEVALLKEQQALQ SEQ ID NO: 26 NTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 27 TKMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 28 KMFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 29 MFEELKSRLDTLAQEVALLKEQQALQTVSLKG SEQ ID NO: 30 EGPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLK SEQ ID NO: 31 EGPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTV SEQ ID NO: 32 EGPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQT SEQ ID NO: 33 EGPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQ SEQ ID NO: 34 IVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLK SEQ ID NO: 35 IVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTV SEQ ID NO: 36 IVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQT SEQ ID NO: 37 IVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQ [0040] Another example of a trimerizing domain is disclosed in US 6,190,886 (incorporated herein in its entirety), which describes polypeptides comprising a collectin neck region. Trimers can then be made under appropriate conditions with three polypeptides comprising the collectin neck region amino acid sequence. [0041] Another example of a trimerizing domain is an MBP trimerizing domain, as described in U.S. Provisional Patent Application Serial No. 60/996,288, filed by the assignee of the present application on November 9, 2007, which is incorporated by reference in its entirety. This trimerizing domain can oligomerize even further and create higher order multimeric complexes. [0042] The IL-1 Ra polypeptide of the invention may either be linked to the N- or the C terminal amino acid residue of the trimerization domain. A flexible molecular linker optionally may be interposed between, and covalently join, the polypeptide representing the IL-1 Ra and the trimerization domain. Preferably, the linker is a polypeptide sequence of 10 WO 2009/048961 PCT/US2008/079216 about 1 to 20, 2 to 10, or 3 to 7 amino acid residues. In further embodiments, the linker is non-immunogenic, not prone to proteolytic cleavage, and does not comprise amino acid residues which are known to interact with other residues (e.g. cystein residues). [0043] As used herein "IL-1 Ra" refers to a polypeptide having the amino acid sequence shown below: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKID VVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMV TKFYFQEDE (SEQ ID NO: 38) [0044] Also included in the "IL-iRa" definition are variants and fragments of SEQ ID NO: 38 that provide for IL-1 Ra binding to IL-1 R, and preferably IL-i R inhibitory activity. Such fragments may be truncated at the N-terminus or C-terminus of the IL-i Ra, or may lack internal residues, when compared with the full length native IL-1Ra protein. Certain fragments may lack amino acid residues that are not essential for a desired biological activity of the trimeric IL-1 Ra protein according to the invention. For example, Evans, et al. (J. Biol. Chem. 1995, 19:11477-11483) demonstrated by site directed mutagenesis that only Trp16, Gln2O, Tyr34, Gln36 and Tyr147 are critical for binding to the IL-iR and that other amino acid positions can be altered while still maintaining a functional molecule. Furthermore, affinity of IL-i Ra to its receptor can be improved by mutating amino acids outside the binding region to increase loop interactions of IL-IRa with its receptor as shown by Dahlen, et al, (J. Immunotoxicology 5:189-199 (2008)). This is can be accomplished through mutations of amino acids outside the IL-1Ra receptor binding region, and particularly, for example: D47N, E52R, E90Y, P38Y, H54R, Q129L and M136N. Id. Furthermore, natural IL-1Ra variants exist, any of which may be used. An 18 kDa form of IL-1Ra, created by an alternative transcriptional splice mechanism from an upstream exon is called icIL-1Ral and is found inside keratinocytes and other epithelial cells, monocytes, tissue macrophages, fibroblasts, and endothelial cells. IL-iRa cDNA cloned from human leukocytes contains an additional 63 bp sequence as an insert in the 5' region of the cDNA. A 15 kDa isoform of IL-IRa, termed icIL-1Ra3, is found in monocytes, macrophages, neutrophils, and hepatocytes, and may be created both by an alternative transcriptional splice as well as by alternative translational initiation. 11 WO 2009/048961 PCT/US2008/079216 [0045] IL-iRa peptides that are useful for fusion proteins of the invention include polypeptides that are at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 38. In particular embodiments, the fusion proteins include an IL-1Ra peptide sequence that is 85% identical to SEQ ID NO: 38 and has IL-IR binding activity, and preferably IL-1Ra inhibitory activity. In another particular embodiment, the fusion proteins include an IL-IRa peptide sequence that is 95% identical to SEQ ID NO: 38 and has IL-1R binding activity, and preferably IL-1Ra inhibitory activity. In these embodiment, the polypeptides comprise Trp16, Gln20, Tyr34, Gln36 and Tyr147 according to the numbering of SEQ ID NO: 38 These polypeptides may further include one or more amino acids substitutions D47N, E52R, E90Y, P38Y, H54R, Q129L and M136N (numbering according to SEQ ID NO: 38). Furthermore, variations of the IL-iRa polypeptides can be accomplished by replacing one or more amino acids with another amino acid having similar structural or chemical properties, for example, conservative amino acid substitutions. [0046] In a further embodiment, the fusion protein according to the invention is selected from an IL-1 receptor antagonist selected from the following: TripK-IL-ira EGPTOKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALO TVSLKRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPN VNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNI TDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPV SLTNMPDEGVMVTKFYFQEDE (SEQ ID NO: 39); TripV-IL-lra EGPTOKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQ TVRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNL EEKIDVVPEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLS ENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTN MPDEGVMVTKFYFQEDE (SEQ ID NO: 40); TripT-IL-lra EGPTOKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQ TRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLE EKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLS ENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTN MPDEGVMVTKFYFQEDE (SEQ ID NO: 41) 12 WO 2009/048961 PCT/US2008/079216 TripQ-IL-lra MVRANKRNEALRIESALLNKIAMLGTEKTAEGGSHIHHHHGSIEPDG GEGPTOKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQAL _QRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLE EKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLS ENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTN MPDEGVMVTKFYFQEDE (SEQ ID NO: 42) I10-TripK-IL1ra IVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKRPSG RKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDV VPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQ DKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDE GVMVTKFYFQEDE (SEQ ID NO: 43); I10-TripV-IL-ira IVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVRPSGRKS SKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIE PHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKR FAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVM VTKFYFQEDE (SEQ ID NO: 44); I10-TripT-IL-1ra IVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTRPSGRKSS KMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEP HALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRF AFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMV TKFYFQEDE (SEQ ID NO: 45); I10-TripQ-IL-1ra IVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQRPSGRKSSK MQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPH ALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFA FIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVT KFYFQEDE (SEQ ID NO: 46); wherein the underlined part denotes the trimerization unit, and the bold part denotes the IL 1Ra part. Production of Fusion Proteins [0047] The trimeric IL-1 Ra protein of the invention may be chemically synthesized or expressed in any suitable standard protein expression system. Preferably, the protein expression systems are systems from which the desired protein may readily be isolated and 13 WO 2009/048961 PCT/US2008/079216 refolded in vitro. Prokaryotic expression systems are preferred since high yields of protein can be obtained and efficient purification and refolding strategies are available. Eukaryotic expression systems may also be used. Thus, it is well within the abilities and discretion of the skilled artisan to choose an appropriate expression system. Similarly, once the primary amino acid sequence for the fusion proteins of the present invention is chosen, one of ordinary skill in the art can easily design appropriate recombinant DNA constructs which will encode the desired proteins, taking into consideration such factors as codon biases in the chosen host, the need for secretion signal sequences in the host, the introduction of proteinase cleavage sites within the signal sequence, and the like. These recombinant DNA constructs may be inserted in-frame into any of a number of expression vectors appropriate to the chosen host. Preferably, the expression vector will include a strong promoter to drive expression of the recombinant constructs. [0048] The fusion protein of the invention can be expressed in any suitable standard protein expression system by culturing a host transformed with a vector encoding the fusion protein under such conditions that the fusion protein is expressed. Preferably, the expression system is a system from which the desired protein may readily be isolated and refolded in vitro. As a general matter, prokaryotic expression systems are preferred since high yields of protein can be obtained and efficient purification and refolding strategies are available. Thus, selection of appropriate expression systems (including vectors and cell types) is within the knowledge of one skilled in the art. Similarly, once the primary amino acid sequence for the fusion protein of the present invention is chosen, one of ordinary skill in the art can easily design appropriate recombinant DNA constructs which will encode the desired amino acid sequence, taking into consideration such factors as codon biases in the chosen host, the need for secretion signal sequences in the host, the introduction of proteinase cleavage sites within the signal sequence, and the like. [0049] In one embodiment the isolated polynucleotide encodes a fusion protein of the invention. In other embodiments, an IL-lRa polypeptide and the trimerizing domain are encoded by non-contiguous polynucleotide sequences. Accordingly, in some embodiments an IL-lRa polypeptide and the trimerizing domain are expressed, isolated, and purified as separate polypeptides and fused together to form the fusion protein of the invention. 14 WO 2009/048961 PCT/US2008/079216 [0050] These recombinant DNA constructs may be inserted in-frame into any of a number of expression vectors appropriate to the chosen host. In certain embodiments, the expression vector comprises a strong promoter that controls expression of the recombinant fusion protein constructs. When recombinant expression strategies are used to generate the fusion protein of the invention, the resulting fusion protein can be isolated and purified using suitable standard procedures well known in the art, and optionally subjected to further processing such as e.g. lyophilization. [0051] Standard techniques may be used for recombinant DNA molecule, protein, and fusion protein production, as well as for tissue culture and cell transformation. See, e.g., Sambrook, et al. (below) or Current Protocols in Molecular Biology (Ausubel et al., eds., Green Publishers Inc. and Wiley and Sons 1994). Purification techniques are typically performed according to the manufacturer's specifications or as commonly accomplished in the art using conventional procedures such as those set forth in Sambrook et al. (Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1989), or as described herein. Unless specific definitions are provided, the nomenclature utilized in connection with the laboratory procedures, and techniques relating to molecular biology, biochemistry, analytical chemistry, and pharmaceutical/formulation chemistry described herein are those well known and commonly used in the art. Standard techniques can be used for biochemical syntheses, biochemical analyses, pharmaceutical preparation, formulation, and delivery, and treatment of patients. [0052] It will be appreciated that a flexible molecular linker optionally may be interposed between, and covalently join, the IL-IRa polypeptide and the trimerizing domain. In certain embodiments, the linker is a polypeptide sequence of about I to 20 amino acid residues. The linker may be less than 10 amino acids, most preferably, five, four, three, two, or one amino acid. It may be in certain cases that nine, eight, seven, or six amino acids are suitable. In useful embodiments the linker is essentially non-immunogenic, not prone to proteolytic cleavage and does not comprise amino acid residues which are known to interact with other residues (e.g. cysteine residues). [0053] The description below also relates to methods of producing fusion proteins and trimeric complexes that are covalently attached (hereinafter "conjugated") to one or more chemical groups. Chemical groups suitable for use in such conjugates are preferably not 15 WO 2009/048961 PCT/US2008/079216 significantly toxic or immunogenic. The chemical group is optionally selected to produce a conjugate that can be stored and used under conditions suitable for storage. A variety of exemplary chemical groups that can be conjugated to polypeptides are known in the art and include for example carbohydrates, such as those carbohydrates that occur naturally on glycoproteins, polyglutamate, and non-proteinaceous polymers, such as polyols (see, e.g., U.S. Pat. No. 6,245,901). [0054] A polyol, for example, can be conjugated to fusion proteins of the invention at one or more amino acid residues, including lysine residues, as is disclosed in WO 93/00109, supra. The polyol employed can be any water-soluble poly(alkylene oxide) polymer and can have a linear or branched chain. Suitable polyols include those substituted at one or more hydroxyl positions with a chemical group, such as an alkyl group having between one and four carbons. Typically, the polyol is a poly(alkylene glycol), such as poly(ethylene glycol) (PEG), and thus, for ease of description, the remainder of the discussion relates to an exemplary embodiment wherein the polyol employed is PEG and the process of conjugating the polyol to a polypeptide is termed "pegylation." However, those skilled in the art recognize that other polyols, such as, for example, poly(propylene glycol) and polyethylene polypropylene glycol copolymers, can be employed using the techniques for conjugation described herein for PEG. [0055] The average molecular weight of the PEG employed in the pegylation of IL-lRa can vary, and typically may range from about 500 to about 30,000 daltons (D). Preferably, the average molecular weight of the PEG is from about 1,000 to about 25,000 D, and more preferably from about 1,000 to about 5,000 D. In one embodiment, pegylation is carried out with PEG having an average molecular weight of about 1,000 D. Optionally, the PEG homopolymer is unsubstituted, but it may also be substituted at one end with an alkyl group. Preferably, the alkyl group is a Cl-C4 alkyl group, and most preferably a methyl group. PEG preparations are commercially available, and typically, those PEG preparations suitable for use in the present invention are non-homogeneous preparations sold according to average molecular weight. For example, commercially available PEG(5000) preparations typically contain molecules that vary slightly in molecular weight, usually ±500 D. The fusion protein of the invention can be further modified using techniques known in the art, such as, conjugated to a small molecule compounds (e.g., a chemotherapeutic); conjugated to a signal 16 WO 2009/048961 PCT/US2008/079216 molecule (e.g., a fluorophore); conjugated to a molecule of a specific binding pair (e.g,. biotin/streptavidin, antibody/antigen); or stabilized by glycosylation, PEGylation, or further fusions to a stabilizing domain (e.g., Fc domains). [0056] A variety of methods for pegylating proteins are known in the art. Specific methods of producing proteins conjugated to PEG include the methods described in U.S. Pat. Nos. 4,179,337, 4,935,465 and 5,849,535. Typically the protein is covalently bonded via one or more of the amino acid residues of the protein to a terminal reactive group on the polymer, depending mainly on the reaction conditions, the molecular weight of the polymer, etc. The polymer with the reactive group(s) is designated herein as activated polymer. The reactive group selectively reacts with free amino or other reactive groups on the protein. The PEG polymer can be coupled to the amino or other reactive group on the protein in either a random or a site specific manner. It will be understood, however, that the type and amount of the reactive group chosen, as well as the type of polymer employed, to obtain optimum results, will depend on the particular protein or protein variant employed to avoid having the reactive group react with too many particularly active groups on the protein. As this may not be possible to avoid completely, it is recommended that generally from about 0.1 to 1000 moles, preferably 2 to 200 moles, of activated polymer per mole of protein, depending on protein concentration, is employed. The final amount of activated polymer per mole of protein is a balance to maintain optimum activity, while at the same time optimizing, if possible, the circulatory half-life of the protein. [0057] The term "polyol" when used herein refers broadly to polyhydric alcohol compounds. Polyols can be any water-soluble poly(alkylene oxide) polymer for example, and can have a linear or branched chain. Preferred polyols include those substituted at one or more hydroxyl positions with a chemical group, such as an alkyl group having between one and four carbons. Typically, the polyol is a poly(alkylene glycol), preferably poly(ethylene glycol) (PEG). However, those skilled in the art recognize that other polyols, such as, for example, poly(propylene glycol) and polyethylene-polypropylene glycol copolymers, can be employed using the techniques for conjugation described herein for PEG. The polyols of the invention include those well known in the art and those publicly available, such as from commercially available sources. 17 WO 2009/048961 PCT/US2008/079216 [0058] Furthermore, other half-life extending molecules can be attached to the N-or C terminus of the trimerization domain including serum albumin-binding peptides, FcRn binding peptides or IgG-binding peptides. [0059] In one embodiment, the trimeric IL-I Ra protein of the invention is expressed in a prokaryotic host cell such as E. coli and is additionally linked to a third polypeptide, i.e. a third fusion partner. Thus, it may be that by adding such third fusion partner to the trimeric IL-I Ra protein of the invention, high yields of the trimeric IL-I Ra protein may be obtained. The third fusion partner may be any suitable peptide, oligopeptide, polypeptide or protein, including a di-peptide, a tri-peptide, tetra-peptide, penta-peptide or hexa-peptide. The fusion partner may in certain instances be a single amino acid. It may be selected such that it renders the fusion protein more resistant to proteolytic degradation, facilitates enhanced expression and secretion of the fusion protein, improves solubility, and/or allows for subsequent affinity purification of the fusion protein. [0060] In one embodiment, the junction region between the fusion protein of the invention (i.e. the IL-IRa portion and the trimerization domain) and the third fusion partner such as ubiquitin, comprises a Granzyme B protease cleavage site such as human Granzyme B (E.C. 3.4.21.79) as described in US 2005/0199251. [0061] The third fusion partner may in further embodiments be coupled to an affinity-tag. Such an affmity-tag may be an affinity domain which allows for the purification of the fusion protein on an affinity resin. The affinity-tag may be a polyhistidine-tag such as a hexahis-tag, polyarginine-tag, FLAG-tag, Strep-tag, c-myc-tag, S-tag, calmodulin-binding peptide, cellulose-binding peptide, chitin-binding domain, glutathione S-transferase-tag, or maltose binding protein. [0062] The method of the invention may be in an isolation step for isolating the trimeric IL-1 Ra protein that is formed by the enzymatic cleavage of the fusion protein that has been immobilized by the use of the above mentioned affinity-tag systems. This isolation step can be performed by any suitable means known in the art for protein isolation, including the use of ion exchange and fractionation by size, the choice of which depends on the character of the fusion protein. In one embodiment, the region between the third fusion partner and the region comprising the trimerization domain and IL-1 Ra is contacted with the human seine 18 WO 2009/048961 PCT/US2008/079216 protease Granzyme B to cleave off the fusion protein at a Granzyme B protease cleavage site which yields the fusion protein of the invention. [0063] The present invention also provides plasmids, vectors, transcription or expression cassettes which comprise at least one nucleic acid as described above. Suitable vectors can be chosen or constructed containing appropriate regulatory sequences, including promoter sequences, terminator sequences, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate. Vectors may be plasmids, viral, phage, or phagemid, as appropriate. (Molecular Cloning: a Laboratory Manual: 2nd edition, Sambrook et al., 1989, Cold Spring Harbor Laboratory Press). [0064] The present invention also provides a recombinant host cell which comprises one or more constructs of the invention. Suitable host cells include bacteria, mammalian cells, yeast and baculovirus systems. Mammalian cell lines available for expression of a heterologous polypeptide include Chinese hamster ovary cells, HeLa cells, baby hamster kidney cells, NSO mouse melanoma cells and many others. A preferred bacterial host is E. coli. [0065] Pharmaceutical Compositions [0066] In yet another aspect, the invention relates to a pharmaceutical composition comprising a therapeutically effective amount of the fusion protein of the invention along with a pharmaceutically acceptable carrier or excipient. As used herein, "pharmaceutically acceptable carrier" or "pharmaceutically acceptable excipient" includes any and all solvents, dispersion media, coating, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Examples of pharmaceutically acceptable carriers or excipients include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like as well as combinations thereof. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Pharmaceutically acceptable substances such as wetting or minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the of the antibody or antibody portion also may be included. Optionally, disintegrating agents can be included, such as cross-linked polyvinyl pyrrolidone, 19 WO 2009/048961 PCT/US2008/079216 agar, alginic acid or a salt thereof, such as sodium alginate and the like. In addition to the excipients, the pharmaceutical composition can include one or more of the following, carrier proteins such as serum albumin, buffers, binding agents, sweeteners and other flavoring agents; coloring agents and polyethylene glycol. [0067] The compositions can be in a variety of forms including, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g. injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories. The preferred form will depend on the intended route of administration and therapeutic application. In an embodiment the compositions are in the form of injectable or infusible solutions, such as compositions similar to those used for passive immunization of humans with antibodies. In an embodiment the mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular). In an embodiment, the fusion protein (or trimeric complex) is administered by intravenous infusion or injection. In another embodiment, the fusion protein or trimeric complex is administered by intramuscular or subcutaneous injection. [0068] Other suitable routes of administration for the pharmaceutical composition include, but are not limited to, oral, rectal, transdermal, vaginal, transmucosal or intestinal administration. [0069] Therapeutic compositions are typically sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration. Sterile injectable solutions can be prepared by incorporating the active compound (i.e. fusion protein or trimeric complex) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. The proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the 20 WO 2009/048961 PCT/US2008/079216 required particle size in the case of dispersion and by the use of surfactants. Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin. [0070] An article of manufacture such as a kit containing therapeutic agents useful in the treatment of the disorders described herein comprises at least a container and a label. Suitable containers include, for example, bottles, vials, syringes, and test tubes. The containers may be formed from a variety of materials such as glass or plastic. The label on or associated with the container indicates that the formulation is used for treating the condition of choice. The article of manufacture may further comprise a container comprising a pharmaceutically acceptable buffer, such as phosphate-buffered saline, Ringer's solution, and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use. The article of manufacture may also comprise a container with another active agent as described above. [0071] Typically, an appropriate amount of a pharmaceutically-acceptable salt is used in the formulation to render the formulation isotonic. Examples of pharmaceutically-acceptable carriers include saline, Ringer's solution and dextrose solution. The pH of the formulation is preferably from about 6 to about 9, and more preferably from about 7 to about 7.5. It will be apparent to those persons skilled in the art that certain carriers may be more preferable depending upon, for instance, the route of administration and concentrations of therapeutic agent. [0072] Therapeutic compositions can be prepared by mixing the desired molecules having the appropriate degree of purity with optional pharmaceutically acceptable carriers, excipients, or stabilizers (Remington's Pharmaceutical Sciences, 16th edition, Osol, A. ed. (1980)), in the form of lyophilized formulations, aqueous solutions or aqueous suspensions. Acceptable carriers, excipients, or stabilizers are preferably nontoxic to recipients at the dosages and concentrations employed, and include buffers such as Tris, HEPES, PIPES, phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; 21 WO 2009/048961 PCT/US2008/079216 cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; and/or non-ionic surfactants such as TWEENTM, PLURONICSTM or polyethylene glycol (PEG). [0073] Additional examples of such carriers include ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts, or electrolytes such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, and cellulose-based substances. Carriers for topical or gel-based forms include polysaccharides such as sodium carboxymethylcellulose or methylcellulose, polyvinylpyrrolidone, polyacrylates, polyoxyethylene-polyoxypropylene-block polymers, polyethylene glycol, and wood wax alcohols. For all administrations, conventional depot forms are suitably used. Such forms include, for example, microcapsules, nano-capsules, liposomes, plasters, inhalation forms, nose sprays, sublingual tablets, and sustained-release preparations. [0074] Formulations to be used for in vivo administration should be sterile. This is readily accomplished by filtration through sterile filtration membranes, prior to or following lyophilization and reconstitution. The formulation may be stored in lyophilized form or in solution if administered systemically. If in lyophilized form, it is typically formulated in combination with other ingredients for reconstitution with an appropriate diluent at the time for use. An example of a liquid formulation is a sterile, clear, colorless unpreserved solution filled in a single-dose vial for subcutaneous injection. [0075] Therapeutic formulations generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle. The formulations are preferably administered as repeated intravenous (i.v.), subcutaneous (s.c.), intramuscular (i.m.) injections or infusions, or as 22 WO 2009/048961 PCT/US2008/079216 aerosol formulations suitable for intranasal or intrapulmonary delivery (for intrapulmonary delivery see, e.g., EP 257,956). [0076] The molecules disclosed herein can also be administered in the form of sustained release preparations. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the protein, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (e.g., poly(2-hydroxyethyl methacrylate) as described by Langer et al., J. Biomed. Mater. Res., 15: 167-277 (1981) and Langer, Chem. Tech., 12: 98-105 (1982) or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al., Biopolymers, 22: 547-556 (1983)), non-degradable ethylene-vinyl acetate (Langer et al., supra), degradable lactic acid-glycolic acid copolymers such as the Lupron Depot (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3-hydroxybutyric acid (EP 133,988). [0077] Methods of Treatment [0078] Another aspect the invention relates to a method of treating diseases that are mediated by IL-IRa. The method includes treating a subject suffering from such as disease with a therapeutically effective amount of the pharmaceutical compositions of the invention. [0079] Another aspect of the invention is directed to a combination therapy. Formulations comprising therapeutic agents are also provided by the present invention. It is believed that such formulations will be particularly suitable for storage as well as for therapeutic administration. The formulations may be prepared by known techniques. For instance, the formulations may be prepared by buffer exchange on a gel filtration column. [0080] The pharmaceutical compositions can be administered in accord with known methods, such as intravenous administration as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra articular, intrasynovial, intrathecal, oral, topical, or inhalation routes. Optionally, administration may be performed through mini-pump infusion using various commercially available devices. 23 WO 2009/048961 PCT/US2008/079216 [0081] Effective dosages and schedules for administering the trimeric IL-1Ra may be determined empirically, and making such determinations is within the skill in the art. Single or multiple dosages may be employed. It is presently believed that an effective dosage or amount of the trimeric IL-1Ra used alone may range from about 1 gg/kg to about 100 mg/kg of body weight or more per day. Interspecies scaling of dosages can be performed in a manner known in the art, e.g., as disclosed in Mordenti, et al., Pharmaceut. Res., 8:1351 (1991). [0082] When in vivo administration of the IL-IRa fusion protein is employed, normal dosage amounts may vary from about 10 ng/kg to up to 100 mg/kg of mammal body weight or more per day, preferably about 1 Rg/kg/day to 50 mg/kg/day, depending upon the route of administration. Guidance as to particular dosages and methods of delivery is provided in the literature (see, for example, U.S. Pat. Nos. 4,657,760; 5,206,344; or 5,225,212). One of skill will appreciate that different formulations will be effective for different treatment compounds and different disorders, that administration targeting one organ or tissue, for example, may necessitate delivery in a manner different from that to another organ or tissue. Those skilled in the art will understand that the dosage of the trimeric IL-1Ra that must be administered will vary depending on, for example, the mammal which will receive trimeric IL-1Ra, the route of administration, and other drugs or therapies being administered to the mammal. [0083] The trimeric complexes and other therapeutic agents (and one or more other therapies) may be administered concurrently (simultaneously) or sequentially. In particular embodiments, a fusion protein or trimeric complex and a therapeutic agent are administered concurrently. In another embodiment, a fusion protein or trimeric complex is administered prior to administration of a therapeutic agent. In another embodiment, a therapeutic agent is administered prior to a fusion protein or trimeric complex. Following administration, treated cells in vitro can be analyzed. Where there has been in vivo treatment, a treated mammal can be monitored in various ways well known to the skilled practitioner. For instance, serum cytokine responses can be analyzed. [0084] The IL-1Ra fusion proteins described herein may be used in combination (pre treatment, post-treatment, or concurrent treatment) with any of one or more TNF inhibitors for the treatment or prevention of the diseases and disorders recited herein, such as but not limited to, all forms of soluble TNF receptors including Etanercept (such as ENBREL*), as 24 WO 2009/048961 PCT/US2008/079216 well as all forms of monomeric or multimeric p75 and/or p55 TNF receptor molecules and fragments thereof; anti-human TNF antibodies, such as but not limited to, Infliximab (such as REICADE*), and D2E7 (such as HUMIRA*), and the like. Such TNF inhibitors include compounds and proteins which block in vivo synthesis or extracellular release of TNF. In a specific embodiment, the present invention is directed to the use of an IL-1 7RA IL-1 Ra fusion proteins in combination (pre-treatment, post-treatment, or concurrent treatment) with any of one or more of the following TNF inhibitors: TNF binding proteins (soluble TNF receptor type-I and soluble TNF receptor type-II ("sTNFRs"), as defined herein), anti-TNF antibodies, granulocyte colony stimulating factor; thalidomide; BN 50730; tenidap; E 5531; tiapafant PCA 4248; nimesulide; panavir; rolipram; RP 73401; peptide T; MDL 201,449A; (1R,3S)-Cis-1-[9-(2,6-diaminopurinyl)]-3-hydroxy-4-cyclopentene hydrochloride; (1R,3R) trans-1 -(9-(2,6-diamino)purine]-3-acetoxycyclopentane; (lR,3R)-trans-1-[9-adenyl)-3 azidocyclopentane hydrochloride and (1R,3R)-trans-1-(6-hydroxy-purin-9-yl)-3-azidocyclo pentane. TNF binding proteins are disclosed in the art (EP 308 378, EP 422 339, GB 2 218 101, EP 393 438, WO 90/13575, EP 398 327, EP 412 486, WO 91/03553, EP 418 014, JP 127,800/1991, EP 433 900, U.S. Pat. No. 5,136,021, GB 2 246 569, EP 464 533, WO 92/01002, WO 92/13095, WO 92/16221, EP 512 528, EP 526 905, WO 93/07863, EP 568 928, WO 93/21946, WO 93/19777, EP 417 563, WO 94/06476, and PCT International Application No. PCT/US97/12244). [0085] For example, EP 393 438 and EP 422 339 teach the amino acid and nucleic acid sequences of a soluble TNF receptor type I (also known as "sTNFR-I" or "30 kDa TNF inhibitor") and a soluble TNF receptor type II (also known as "sTNFR-II" or "40 kDa TNF inhibitor"), collectively termed "sTNFRs", as well as modified forms thereof (e.g., fragments, functional derivatives and variants). EP 393 438 and EP 422 339 also disclose methods for isolating the genes responsible for coding the inhibitors, cloning the gene in suitable vectors and cell types and expressing the gene to produce the inhibitors. Additionally, polyvalent forms (i.e., molecules comprising more than one active moiety) of sTNFR-1 and sTNFR-II have also been disclosed. In one embodiment, the polyvalent form may be constructed by chemically coupling at least one TNF inhibitor and another moiety with any clinically acceptable linker, for example polyethylene glycol (WO 92/16221 and WO 95/34326), by a peptide linker (Neve et al. (1996), Cytokine, 8(5):365-370, by chemically coupling to biotin 25 WO 2009/048961 PCT/US2008/079216 and then binding to avidin (WO 91/03553) and, finally, by combining chimeric antibody molecules (U.S. Pat. No. 5,116,964, WO 89/09622, WO 91/16437 and EP 315062. [0086] Anti-TNF antibodies include the MAK 195F Fab antibody (Holler et al. (1993), 1st International Symposium on Cytokines in Bone Marrow Transplantation, 147); CDP 571 anti-TNF monoclonal antibody (Rankin et al. (1995), British Journal of Rheumatology, 34:334-342); BAY X 1351 murine anti-tumor necrosis factor monoclonal antibody (Kieft et al. (1995), 7th European Congress of Clinical Microbiology and Infectious Diseases, page 9); CenTNF cA2 anti-TNF monoclonal antibody (Elliott et aL (1994), Lancet, 344:1125-1127 and Elliott et al. (1994), Lancet, 344:1105-1110). [0087] The IL-1Ra fusion proteins described herein may be used in combination with all forms of IL-17 inhibitors (e.g. anti-IL17 receptor antibody, Amgen; anti-IL-17A, anti IL1 7F), RORc inhibitors. [0088] The IL-iRa fusion proteins described herein may be used in combination with all forms of CD28 inhibitors, such as but not limited to, abatacept (for example ORENCIA*). [0089] The IL-1Ra fusion proteins described herein may be used in combination with all forms of IL-6 and/or IL-6 receptor inhibitors, such as but not limited to, Tocilizumab (for example ACTEMRA*). [0090] The IL-iRa fusion proteins described herein may be used in combination with all forms of anti-IL-1 8 compounds, such as IL-1 8BP or a derivative, an IL-1 8 trap, anti-IL-18, anti-IL-i 8R1, or anti-IL-1 8RAcP. [0091] The IL-1 Ra fusion proteins described herein may be used in combination with all forms of anti-IL22, such as anti-IL22 or anti-IL22R. [0092] The IL-IRa fusion proteins described herein may be used in combination with all forms of anti-IL-23 and or IL-12 such as anti-p19, anti-p40 (Ustekinumab), anti-IL-23R. [0093] The IL-1Ra fusion proteins described herein may be used in combination with all forms of anti-IL21, such as anti-1L21 or anti-IL21R. 26 WO 2009/048961 PCT/US2008/079216 [0094] The IL-IRa fusion proteins described herein may be used in combination with all forms of anti-TGF-beta. [0095] The IL-IRa fusion proteins may be used in combination with one or more cytokines, lymphokines, hematopoietic factor(s), and/or an anti-inflammatory agent. [0096] Treatment of the diseases and disorders recited herein can include the use of first line drugs for control of pain and inflammation in combination (pretreatment, post-treatment, or concurrent treatment) with treatment with one or more of the IL-i Ra fusion proteins provided herein. These drugs are classified as non-steroidal, anti-inflammatory drugs (NSAIDs). Secondary treatments include corticosteroids, slow acting antirheumatic drugs (SAARDs), or disease modifying (DM) drugs. Information regarding the following compounds can be found in The Merck Manual of Diagnosis and Therapy, Sixteenth Edition, Merck, Sharp & Dohme Research Laboratories, Merck & Co., Rahway, N.J. (1992) and in Pharmaprojects, PJB Publications Ltd. [0097] The IL-1Ra fusion proteins described herein may be used in combination with any of one or more NSAIDs for the treatment of the diseases and disorders recited herein. NSAIDs owe their anti-inflammatory action, at least in part, to the inhibition of prostaglandin synthesis (Goodman and Gilman in "The Pharmacological Basis of Therapeutics," MacMillan 7th Edition (1985)). NSAIDs can be characterized into at least nine groups: (1) salicylic acid derivatives; (2) propionic acid derivatives; (3) acetic acid derivatives; (4) fenamic acid derivatives; (5) carboxylic acid derivatives; (6) butyric acid derivatives; (7) oxicams; (8) pyrazoles and (9) pyrazolones. [0098] The IL-iRa fusion proteins described herein may be used in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more salicylic acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof. Such salicylic acid derivatives, prodrug esters and pharmaceutically acceptable salts thereof comprise: acetaminosalol, aloxiprin, aspirin, benorylate, bromosaligenin, calcium acetylsalicylate, choline magnesium trisalicylate, magnesium salicylate, choline salicylate, diflusinal, etersalate, fendosal, gentisic acid, glycol salicylate, imidazole salicylate, lysine acetylsalicylate, mesalamine, morpholine salicylate, 1-naphthyl salicylate, olsalazine, parsalmide, phenyl acetylsalicylate, phenyl salicylate, salacetamide, salicylamide O-acetic 27 WO 2009/048961 PCT/US2008/079216 acid, salsalate, sodium salicylate and sulfasalazine. Structurally related salicylic acid derivatives having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group. [0099] In an additional specific embodiment, the present invention is directed to the use of an IL- IRa fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more propionic acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof. The propionic acid derivatives, prodrug esters, and pharmaceutically acceptable salts thereof comprise: alminoprofen, benoxaprofen, bucloxic acid, carprofen, dexindoprofen, fenoprofen, flunoxaprofen, fluprofen, flurbiprofen, furcloprofen, ibuprofen, ibuprofen aluminum, ibuproxam, indoprofen, isoprofen, ketoprofen, loxoprofen, miroprofen, naproxen, naproxen sodium, oxaprozin, piketoprofen, pimeprofen, pirprofen, pranoprofen, protizinic acid, pyridoxiprofen, suprofen, tiaprofenic acid and tioxaprofen. Structurally related propionic acid derivatives having similar analgesic and anti inflammatory properties are also intended to be encompassed by this group. [00100] In yet another specific embodiment, the present invention is directed to the use of an IL-IRa fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more acetic acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof. The acetic acid derivatives, prodrug esters, and pharmaceutically acceptable salts thereof comprise: acemetacin, alclofenac, amfenac, bufexamac, cinmetacin, clopirac, delmetacin, diclofenac potassium, diclofenac sodium, etodolac, felbinac, fenclofenac, fenclorac, fenclozic acid, fentiazac, furofenac, glucametacin, ibufenac, indomethacin, isofezolac, isoxepac, lonazolac, metiazinic acid, oxametacin, oxpinac, pimetacin, proglumetacin, sulindac, talmetacin, tiaramide, tiopinac, tolmetin, tolmetin sodium, zidometacin and zomepirac. Structurally related acetic acid derivatives having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group. [00101] In another specific embodiment, the present invention is directed to the use of an IL-lRa fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more fenamic acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof. The fenamic acid derivatives, prodrug esters and pharmaceutically acceptable salts thereof comprise: enfenamic acid, etofenamate, flufenamic acid, isonixin, 28 WO 2009/048961 PCT/US2008/079216 meclofenamic acid, meclofenamate sodium, medofenamic acid, mefenamic acid, niflumic acid, talniflumate, terofenamate, tolfenamic acid and ufenamate. Structurally related fenamic acid derivatives having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group. [00102] In an additional specific embodiment, the present invention is directed to the use of an IL- 1 Ra fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more carboxylic acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof. The carboxylic acid derivatives, prodrug esters, and pharmaceutically acceptable salts thereof which can be used comprise: clidanac, diflunisal, flufenisal, inoridine, ketorolac and tinoridine. Structurally related carboxylic acid derivatives having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group. [00103] In yet another specific embodiment, the present invention is directed to the use of an IL-lRa fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more butyric acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof. The butyric acid derivatives, prodrug esters, and pharmaceutically acceptable salts thereof comprise: bumadizon, butibufen, fenbufen and xenbucin. Structurally related butyric acid derivatives having similar analgesic and anti inflammatory properties are also intended to be encompassed by this group. [00104] In another specific embodiment, the present invention is directed to the use of an IL-lRa fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more oxicams, prodrug esters, or pharmaceutically acceptable salts thereof. The oxicams, prodrug esters, and pharmaceutically acceptable salts thereof comprise: droxicam, enolicam, isoxicam, piroxicam, sudoxicam, tenoxicam and 4-hydroxyl-1,2 benzothiazine 1,1-dioxide 4-(N-phenyl)-carboxamide. Structurally related oxicams having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group. [00105] In still another specific embodiment, the present invention is directed to the use of an IL-lRa fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more pyrazoles, prodrug esters, or pharmaceutically acceptable 29 WO 2009/048961 PCT/US2008/079216 salts thereof. The pyrazoles, prodrug esters, and pharmaceutically acceptable salts thereof which may be used comprise: difenamizole and epirizole. Structurally related pyrazoles having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group. [00106] In an additional specific embodiment, the present invention is directed to the use of an IL-1Ra fusion proteins in combination (pretreatment, post-treatment or, concurrent treatment) with any of one or more pyrazolones, prodrug esters, or pharmaceutically acceptable salts thereof. The pyrazolones, prodrug esters and pharmaceutically acceptable salts thereof which may be used comprise: apazone, azapropazone, benzpiperylon, feprazone, mofebutazone, morazone, oxyphenbutazone, phenylbutazone, pipebuzone, propylphenazone, ramifenazone, suxibuzone and thiazolinobutazone. Structurally related pyrazalones having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group. [00107] In another specific embodiment, the present invention is directed to the use of an IL-1Ra fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more of the following NSAIDs: .epsilon.-acetamidocaproic acid, S adenosyl-methionine, 3-amino-4-hydroxybutyric acid, amixetrine, anitrazafen, antrafenine, bendazac, bendazac lysinate, benzydamine, beprozin, broperamole, bucolome, bufezolac, ciproquazone, cloximate, dazidamine, deboxamet, detomidine, difenpiramide, difenpyramide, difisalamine, ditazol, emorfazone, fanetizole mesylate, fenflumizole, floctafenine, flumizole, flunixin, fluproquazone, fopirtoline, fosfosal, guaimesal, guaiazolene, isonixim, lefetamine HCl, leflunomide, lofemizole, lotifazole, lysin clonixinate, meseclazone, nabumetone, nictindole, nimesulide, orgotein, orpanoxin, oxaceprol, oxapadol, paranyline, perisoxal, perisoxal citrate, pifoxime, piproxen, pirazolac, pirfenidone, proquazone, proxazole, thielavin B, tiflamizole, timegadine, tolectin, tolpadol, tryptamid and those designated by company code number such as 480156S, AA861, AD1590, AFP802, AFP860, A177B, AP504, AU8001, BPPC, BW540C, CHINOIN 121, CN100, EB382, EL508, F1044, FK-506, GV3658, ITF182, KCNTEI6090, KME4, LA2851, MR714, MR897, MY309, ON03144, PR823, PV102, PV108, R830, RS2131, SCR152, SH440, SIR133, SPAS510, SQ27239, ST281, SY6001, TA60, TAI-901 (4-benzoyl-1-indancarboxylic acid), TVX2706, U60257, 30 WO 2009/048961 PCT/US2008/079216 UR2301 and WY41770. Structurally related NSAIDs having similar analgesic and anti inflammatory properties to the NSAIDs are also intended to be encompassed by this group. [00108] In still another specific embodiment, the present invention is directed to the use of an IL-1Ra fusion proteins in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more corticosteroids, prodrug esters or pharmaceutically acceptable salts thereof for the treatment of the diseases and disorders recited herein, including acute and chronic inflammation such as rheumatic diseases, graft versus host disease and multiple sclerosis. Corticosteroids, prodrug esters and pharmaceutically acceptable salts thereof include hydrocortisone and compounds which are derived from hydrocortisone, such as 21-acetoxypregnenolone, alclomerasone, algestone, amcinonide, beclomethasone, betamethasone, betamethasone valerate, budesonide, chloroprednisone, clobetasol, clobetasol propionate, clobetasone, clobetasone butyrate, clocortolone, cloprednol, corticosterone, cortisone, cortivazol, deflazacon, desonide, desoximerasone, dexamethasone, diflorasone, diflucortolone, difluprednate, enoxolone, fluazacort, flucloronide, flumethasone, flumethasone pivalate, flucinolone acetonide, flunisolide, fluocinonide, fluorocinolone acetonide, fluocortin butyl, fluocortolone, fluocortolone hexanoate, diflucortolone valerate, fluorometholone, fluperolone acetate, fluprednidene acetate, fluprednisolone, flurandenolide, formocortal, halcinonide, halometasone, halopredone acetate, hydro-cortamate, hydrocortisone, hydrocortisone acetate, hydro cortisone butyrate, hydrocortisone phosphate, hydrocortisone 21-sodium succinate, hydrocortisone tebutate, mazipredone, medrysone, meprednisone, methylprednisolone, mometasone furoate, paramethasone, prednicarbate, prednisolone, prednisolone 21 diedryaminoacetate, prednisolone sodium phosphate, prednisolone sodium succinate, prednisolone sodium 21 -m-sulfobenzoate, prednisolone sodium 21 -stearoglycolate, prednisolone tebutate, prednisolone 21-trimethylacetate, prednisone, prednival, prednylidene, prednylidene 21-diethylaminoacetate, tixocortol, triamcinolone, triamcinolone acetonide, triamcinolone benetonide and triamcinolone hexacetonide. Structurally related corticosteroids having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group. [00109] In another specific embodiment, the present invention is directed to the use of an IL-lRa fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) 31 WO 2009/048961 PCT/US2008/079216 with any of one or more slow-acting antirheumatic drugs (SAARDs) or disease modifying antirheumatic drugs (DMARDS), prodrug esters, or pharmaceutically acceptable salts thereof for the treatment of the diseases and disorders recited herein, including acute and chronic inflammation such as rheumatic diseases, graft versus host disease and multiple sclerosis. SAARDs or DMARDS, prodrug esters and pharmaceutically acceptable salts thereof comprise: allocupreide sodium, auranofin, aurothioglucose, aurothioglycanide, azathioprine, brequinar sodium, bucillamine, calcium 3-aurothio-2-propanol-l-sulfonate, chlorambucil, chloroquine, clobuzarit, cuproxoline, cyclo-phosphamide, cyclosporin, dapsone, 15 deoxyspergualin, diacerein, glucosamine, gold salts (e.g., cycloquine gold salt, gold sodium thiomalate, gold sodium thiosulfate), hydroxychloroquine, hydroxychloroquine sulfate, hydroxyurea, kebuzone, levamisole, lobenzarit, melittin, 6-mercaptopurine, methotrexate, mizoribine, mycophenolate mofetil, myoral, nitrogen mustard, D-penicillamine, pyridinol imidazoles such as SKNF86002 and SB203580, rapamycin, thiols, thymopoietin and vincristine. Structurally related SAARDs or DMARDs having similar analgesic and anti inflammatory properties are also intended to be encompassed by this group. [00110] In another specific embodiment, the present invention is directed to the use of an IL-lRa fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more COX2 inhibitors, prodrug esters or pharmaceutically acceptable salts thereof for the treatment of the diseases and disorders recited herein, including acute and chronic inflammation. Examples of COX2 inhibitors, prodrug esters or pharmaceutically acceptable salts thereof include, for example, celecoxib. Structurally related COX2 inhibitors having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group. Examples of COX-2 selective inhibitors include but not limited to etoricoxib, valdecoxib, celecoxib, licofelone, lumiracoxib, rofecoxib, and the like. [00111] In still another specific embodiment, the present invention is directed to the use of an IL-IRa fusion proteins in combination (pretreatment, post-treatment, or concurrent treatment) with any of one or more antimicrobials, prodrug esters or pharmaceutically acceptable salts thereof for the treatment of the diseases and disorders recited herein, including acute and chronic inflammation. Antimicrobials include, for example, the broad classes of penicillins, cephalosporins and other beta-lactams, aminoglycosides, azoles, quinolones, macrolides, rifamycins, tetracyclines, sulfonamides, lincosamides and 32 WO 2009/048961 PCT/US2008/079216 polymyxins. The penicillins include, but are not limited to penicillin G, penicillin V, methicillin, nafcillin, oxacillin, cloxacillin, dicloxacillin, floxacillin, ampicillin, ampicillin/sulbactam, amoxicillin, amoxicillin/clavulanate, hetacillin, cyclacillin, bacampicillin, carbenicillin, carbenicillin indanyl, ticarcillin, ticarcillin/clavulanate, azlocillin, meziocillin, peperacillin, and mecillinam. The cephalosporins and other beta lactams include, but are not limited to cephalothin, cephapirin, cephalexin, cephradine, cefazolin, cefadroxil, cefaclor, cefamandole, cefotetan, cefoxitin, ceruroxime, cefonicid, ceforadine, cefixime, cefotaxime, moxalactam, ceftizoxime, cetriaxone, cephoperazone, ceftazidime, imipenem and aztreonam. The aminoglycosides include, but are not limited to streptomycin, gentamicin, tobramycin, amikacin, netilmicin, kanamycin and neomycin. The azoles include, but are not limited to fluconazole. The quinolones include, but are not limited to nalldixic acid, norfloxacin, enoxacin, ciprofloxacin, ofloxacin, sparfloxacin and temafloxacin. The macrolides include, but are not limited to erythomycin, spiramycin and azithromycin. The rifamycins include, but are not limited to rifampin. The tetracyclines include, but are not limited to spicycline, chlortetracycline, clomocycline, demeclocycline, deoxycycline, guamecycline, lymecycline, meclocycline, methacycline, minocycline, oxytetracycline, penimepicycline, pipacycline, rolitetracycline, sancycline, senociclin and tetracycline. The sulfonamides include, but are not limited to sulfanilamide, sulfamethoxazole, sulfacetamide, sulfadiazine, sulfisoxazole and co-trimoxazole (trimethoprim/sulfamethoxazole). The lincosamides include, but are not limited to clindamycin and lincomycin. The polymyxins (polypeptides) include, but are not limited to polymyxin B and colistin. [00112] It should be noted that the section headings are used herein for organizational purposes only, and are not to be construed as in any way limiting the subject matter described. All references cited herein are incorporated by reference in their entirety for all purposes. [00113] The Examples that follow are merely illustrative of certain embodiments of the invention, and are not to be taken as limiting the invention, which is defined by the appended claims. [00114] Examples 33 WO 2009/048961 PCT/US2008/079216 [00115] Example 1: Format, production and purification of trimeric IL-IRa [00116] It has been previously been shown that IL-1Ra can be produced as recombinant protein in E. coli. (Steinkasserer et al 1992. FEBS 310:63-65). The protein is very stable and refolds efficiently. Isoforms of IL-iRa with additional amino acids in the N-terminal have been also described (Haskill et al 1991, PNAS 88:3681-3685; Muzio et al 1995, JEM 182, 623-628)). These molecules bind IL-1R as well as the mature secreted form indicating that it is possible to fuse extra peptide to the N-terminal of the antagonist without compromising the binding to the receptor. Crystal structure analysis of IL-iRa interaction with IL-1R also supports that N-terminal alterations do not affect interactions with IL1R (Schreuder et al 1997, Nature 386: 190-194). IL-iRa was cloned from a human cDNA library derived from bone marrow and/or human placenta. [00117] Trimeric IL-iRa was designed as a C-terminal fusion to the Trip-trimerization unit. Eight different fusion proteins were designed, four with full length trimerization units (Trip) and four with a nine amino acid truncation of the trimerization unit (IlOTrip). IL-lra was than fused with either trimerization unit using four different C-terminal fusions. C terminal variations termed Trip V, Trip T, Trip Q and Trip K allow for unique presentation of the CTLD domains on the trimerization domain. The Trip K variant is the longest construct and contains the longest and most flexible linker between the CTLD and the trimerization domain. Trip V, Trip T, Trip Q represent fusions of the CTLD molecule directly onto the trimerization module without any structural flexibility but are turning the CTLD molecule 1/ 3 rd going from Trip V to Trip T and from Trip T to Trip Q. This is due to the fact that each of these amino acids is in an c-helical turn and 3.2 aa are needed for a full turn [00118] The following proteins were produced as the following Granzyme B cleavable fusion proteins in BL21 Al bacteria. The underlined portions denotes the trimerization unit, and the bold part denotes the IL-1Ra part: CII-H6-GrB-GG-TripK-IL-ira: MVRANKRNEALRIESALLNKIAMLGTEKTAEGGSHHHHHHGSIEPDG GEGPTOKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQAL QTVSLKRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGP NVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAV 34 WO 2009/048961 PCT/US2008/079216 NITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQ PVSLTNMPDEGVMVTKFYFQEDE (SEQ ID NO: 47); CII-H6-GrB-GG-TripV-IL-ira: MVRANKRNEALRIESALLNKIAMLGTEKTAEGGSHHHHHGSIEPDG GEGPTOKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQAL QTVRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVN LEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITD LSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSL TNMPDEGVMVTKFYFQEDE (SEQ ID NO: 48); CII-H6-GrB-GG-TripT-IL-1ra: MVRANKRNEALRIESALLNKIAMLGTEKTAEGGSHHHHHGSIEPDG GEGPTOKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQAL QTRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNL EEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDL SENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLT NMPDEGVMVTKFYFQEDE (SEQ ID NO: 49); CII-H6-GrB-GG-TripQ-IL-ira: MVRANKRNEALRIESALLNKIAMLGTEKTAEGGSHHHHHiGSIEPDG GEGPTOKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQAL QRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLE EKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLS ENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTN IPDEGVMVTKFYFQEDE (SEQ ID NO: 50); CII-H6-GrB-I10-TripK-IL-Ira MVRANKRNEALRIESALLNKIAMLGTEKTAEGGSHIIHHiHGSIEPDIV NAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVSLKRPSGR KSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVV PIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEG VMVTKFYFQEDE (SEQ ID NO: 51); CII-H6-GrB-I10-TripV-IL-ira MVRANKRNEALRIESALLNKIAMLGTEKTAEGGSHHHHHHGSIEPDIV NAKKDVVNTKMFEELKSRLDTLAOEVALLKEQQALQTVRPSGRKSS KMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEP HALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRF AFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMV TKFYFQEDE (SEQ ID NO: 52); CII-H6-GrB-I10-TripT-IL-Ira: 35 WO 2009/048961 PCT/US2008/079216 MVRANKRNEALRIESALLNKIAMLGTEKTAEGGSHHHHHHGSIEPDIV NAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTRPSGRKSSK MQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPH ALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFA FIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVT KFYFQEDE (SEQ ID NO: 53); and CII-H6-GrB-I10-TripQ-IL-ira: MVRANKRNEALRIESALLNKIAMLGTEKTAEGGSHHIIHH GSIEPDIV NAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALORPSGRKSSKM QAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHA LFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFI RSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKF YFQEDE (SEQ ID NO: 54) [00119] All constructs were captured on NiNTA Superflow (Qiagen), refolded and further purified on SP-Sepharose FF (GE Heathcare). From expression in shake flask or from a fermentation of the trimeric IL1-Ra, inclusion bodies were purified. Packed cell pellet was homogenized in lysis-buffer (50 mM Tris-HCl, pH 8.0, 25 w/v % Sucrose, 1 mM EDTA ) by sonication (50 g wet cell pellet per 100 mL lysis buffer). Then 100 mg lysozyme per 100 mL lysis-buffer was added and mixed before the sample was left for 15 min at R.T. The sample was then sonicated for 2-5 min with mixing in between. Detergent buffer (0.2 M NaCl, 1 w/v % Deoxycholate, Na salt, 1 w/v % Nonidet P40, 20 mM Tris-HCl, pH 7.5, 2 mM EDTA) was added and the sample is mixed and sonified again. The inclusion bodies were recovered by centrifugation for 25 min at 8.000 rpm, 4'C. The supernatant was stored at 4"C and the pellet resuspended in 100 mL TRITON* X-100 buffer (0,5 w/v % TRITON* X-100, 1 mM EDTA, pH 8) per 50 g original cell pellet. Inclusion bodies were recovered by centrifugation for 25 min at 8.000 rpm, 4'C and the supernatant was stored at 4"C. The TRITON® X-100 buffer wash is repeated once more and the inclusion bodies were recovered by centrifugation for 5 min at 12.000 rpm, 4'C. [00120] The inclusion bodies were re-suspended in 30 mL denaturing buffer/gram original cell paste (6 M urea, 10 mM EDTA, 20 mM Tris/HCl and 20 mM p-Mercaptoethanol, pH 8.0) at 28*C for 2 h. The suspension was centrifuged at 7500 g for 15 min to remove insoluble material. Following this CaCl2 was added to 20 mM final concentration and the solution was applied to a 100 mL Ni-NTA Superflow column equillibrated in NTA buffer (8 M Urea; 1000 mM NaCl; 50 mM Tris HCl pH 8.0; 5 mM p-Mercaptoethanol) and washed 36 WO 2009/048961 PCT/US2008/079216 until a stable baseline was obtained. A further wash with 250 mL guanidine-HCI, 50 mM Tris-HCl pH 8.0, 5 mM p-Mercaptoethanol followed by wash with 100 mL buffer NTA. [00121] Two refolding methods have been used, dialysis refolding and on-column refolding and both have yielded pure and soluble protein. For dialysis refolding the resuspended inclusion bodies was used directly for dialysis over into 1x PBS containing 3 M urea, 1 mM EDTA, pH 7.2 over night. The day after the dialysis was continued into lx PBS containing 0 M urea, 1 mM EDTA, pH 7.2. [00122] For on-column refolding the washed Ni-NTA Superflow column with protein bound, the resin was washed with 4 CV ml 1 x PBS containing 3 M urea, pH 7.2 before a linear gradient of 10 CV 1 x PBS containing 3 M urea, pH 7.2 and 10 CV 1 x PBS containing 0 M urea, pH 7.2 was run. To recover the refolded trimeric IL-Ira, the column eluted with 1 x PBS, 10 mM EDTA, pH 6.0 and fraction were collected. [00123] Following refolding cleavage with recombinant human Granzyme B was performed by adjusting the pH in the eluate to 7.5 with NaOH before Granzyme B was added at a 1:500 ratio (granzyme/protein) and incubated at 25'C over night. The progress was followed by SDS-PAGE. [00124] Finally, the cleaved protein was purified using SP-Sepharose FF (GE Healthcare) cation exchange step. A -50 mL SP-Sepharose FF was packed and equilibrated in buffer A (1 x PBS, 1 mM EDTA pH 5,5) until stabile basis line was obtained. The cleavage reaction was diluted 1:3 with buffer A and loaded on the column followed by a wash in buffer A until stabile basis line was monitored. A gradient from 10 CV buffer A to 10 CV Buffer B (1 x PBS, 1 mM EDTA + 0,5 M NaCl pH 5,5) was setup and fractions collected in 5 mL. Protein containing fractions were analysed on SDS-PAGE before pooling the protein product. [00125] Alternatively, the supernatant from the above inclusion body preparation were used to purify the protein. The soluble Trimeric IL1-ra in the supernatant was purified on Ni NTA Superflow (Qiagen) column equilibrated in Buffer A (20mM TrisHCL, 50mM NaCl pH 8.0. A pool was made of the washes from the inclusion body purification and it was centrifuged at 10000 rpm for 10min before CaCl 2 was added to 5 mM and Tris-HC1 to 20 mM and the pH adjusted to 6.0 with HCl/NaOH. The pool was loaded on the column and 37 WO 2009/048961 PCT/US2008/079216 washed in buffer A until stabile basis line. Following a wash in buffer A + 1 M NaCl until stabile basis line, the bound protein was eluted with buffer A + 20mM EDTA and fractions were collected. Hereafter the protein pool was cleaved with Granzyme B and polished on a SP-Sepharose FF column as described above. The soluble fraction of CII-H6-GrB-GG TripK-IL-lra from 3L expression culture gave a final yield of 95 mg of TripK-IL-lRa following (~250 mg CII-H6-GrB-TripK-IL-lRa after capture Ni-NTA Superflow (Qiagen). Since the yield and purity of the protein from the soluble fraction was significantly better than doing refolding, this path was chosen following the intial construct testing. [00126] The ability of the refolded protein to bind to IL-1 Receptor 1 was analysed on a Biacore 3000 (Biacore, Uppsala, Sweden) where mouse ILl-RI/Fc was coupled to CM5 sensor chips and binding of soluble TripK-IL-lra to IL-IRI protein was measured. Results of uncleaved CII-H6-GrB-TripK-IL-lra refolding by dialysis are shown in Figure 2 and uncleaved CII-H6-GrB-TripK-IL-lra on-column NiNTA refolding is shown in Figure 3. The cleavage and purification assays produced the trimeric IL-iRa compounds of SEQ ID NOs: 47-54. [00127] Example 2: Trimeric IL-1Ra compounds ability to inhibit IL-1 induction of IL-8 in U937 cells [00128] GG-TripV-IL-lra (trip V-IL1Ra), GG-TripK-IL-lra (trip K-ILlRa), GG-TripT IL-ira (trip T-ILlRa) and CII-H6-GrB-GG-TripT-IL-lra (trip Q-IL1Ra) were further analysed for their ability to inhibit IL-1 induction of IL-8 in U937 cells. Results are shown in Figure 4. [00129] The compounds are essentially equally effective in blocking the response and they appear all to be as effective as KINERET* (when compared on w/w). Due to buffer effects in the assay, at the highest protein concentration used (100 pig/mL) IL-8 production increases instead of further decreasing. Based on several in vitro efficacy assays as well as Biacore assays, it was determined that TripT ILlRa was the best compound based on blocking and binding efficacy as well as production yields. [00130] Example 3: Pegylated trimeric IL-lRa compounds 38 WO 2009/048961 PCT/US2008/079216 [00131] Since the in vivo half life is a crucial parameter in the efficacy of KINERET* (KINERET* has only a half life in humans of 4-6 hours and has therefore, to be applied once daily) the ability to pegylate the TripT ILIRa by N-terminal pegylation was tested. The trimeric IL1 -Ra is pegylated at the N terminus. Trimeric IL1 -Ra antagonist proteins after the final step of the purification procedure described above were used as starting point for pegylations. The proteins were buffer changed into PBS buffer pH 6.0 for the pegylation reaction. The protein concentration in the reaction was between 0.5 and 3.5 mg/mL and a 5 10 molar excess of niPeg5K-Aldehyde or mPeg20K-Aldehyde (Nektar) supplemented with 20 mM cyanoborohydride (NaCNBH3) was used. The reaction was carried out at 20'C for 16 hours. Following the reaction mixture was applied to Source 15S column (GE Healtcare) to purify the monopegylated form. As shown in Figure 5, antagonistic activity of the pegylated version was reduced compared to the unpegylated protein. However, the pegylated protein still has good IL1 blocking efficacy. [00132] Example 4: Pharmacokinetic analysis of trimeric ILlRa proteins in male Lewis rats after i.v. injection [00133] Three of the trimeric ILlRa polypeptides described in the previous examples were chosen for pharmacokinetic analysis. The differences in the constructs were in the N terminus of the trimerization domain: full length (FL), first nine amino acids truncated (110) and the first 16 amino acids truncated (V17). The 110 construct represents a naturally occurring deletion variant of the trimerization domain and lacks the 0-glycosylation site at Thr 4. The V17 derivative represents a deletion of the first exon encoding the trimerization domain and lacks a characterized heparin binding site. This site is also partially removed in the 110 construct. In vitro efficacy of the IL-1 Ra molecules was verified in a U937 cell assay as shown in Figure 6. [00134] The pharmacokinetic profile of these three constructs polypeptides were analysed in Lewis rats after intravenous (i.v.) injections. The profiles obtained were compared to the pharmacokinetic profile of KINERET* in the same experiment. The pharmacokinetic study was conducted using four male Lewis rats per group, and the constructs that were used were FL IL-iRa, I10 IL-iRa, V17 IL-iRa and KINERET*. Single i.v. doses of 100 mg/kg were given to the animals. The test compound was dissolved in vehicle (4.4 mM NaCitrate, pH 39 WO 2009/048961 PCT/US2008/079216 6.5, 93.8 mM NaCl, 0.33 mM EDTA, 0.7 g TWEEN*-80) and administered through the tail vein (vena sacralis media) or the hind paw vein (vena saphena). [00135] Blood was then collected from four animals per time-point at baseline (zero hours) and 0.5, 1, 2, 4, 8, 12, 24, 48, 72 h post dosing. Blood samples of approximately 100 pl were collected from the tip of the tails in MicrotainersTM. Plasma was collected and transferred into polypropylene tubes. Plasma samples were then stored at <-70'C until measurements were performed. Animals were then sacrificed by CO 2 inhalation and the carcasses were discarded without pathological examination. The IL-1Ra compound levels and KINERET* levels in plasma were then determined by ELISA. [00136] The average body weight of each rat was 250 grams. Assuming that the rat average blood volume was 16.5 mL a theoretical maximum initial concentration of the compounds of 1,500,000 ng/mL was calculated after i.v. injection. These concentrations are shown in Figure 7. This starting level was used as starting value for the analysis. No observations of side effects or changes in animal well being were observed. [00137] Following blood sampling at the above indicated time points, an ELISA assay was used to measure the injected protein in the blood samples. Based on these ELISA results, area under the curve (AUC) was used as a measure of drug exposure and the plasma half life were calculated using standard software. The areas under the curve are shown in Table 2 and the plasma half lives of the proteins are shown in Table 3. Table 2 AUC protein/ Protein AUC (ng/mL*h) AUC KINERET* FL ILIRa 809292 1.89 110 IL1Ra 1637866 3.82 V17 IL1Ra 2177781 5.08 KINERET* 428414 1 40 WO 2009/048961 PCT/US2008/079216 Table 3 Half life protein/ Protein Half life (mi.) Half life KINERET* FL ILIRa 20 17 110 ILlRa 54 45 V17 IL1Ra 69 58 KINERET* 1.2 1 [00138] These i.v. data indicate that the trimeric compounds have superior plasma half lives in comparison to KINERET*. The half life of KINERET* is about 1.2 minutes, whereas the half life of the V17 ILIRa trimeric protein after i.v. injection is about 69 minutes. Dependent on the criteria used in the analysis the relative increase in AUC is between two fold for FL IL1Ra trimer and five-fold for V17 IL1Ra trimer, indicating substantially improved drug exposure using the trimerized variants compared to KINERET*. [00139] Example 5: Production of Met-IlO-TripT-ILlra and GG-V17-TripT-ILlra and Rat CIA model [00140] Both molecules were produced by BL21 AI bacteria in 10 L fermentor runs using either 2 x TY medium (Met-I1 0-TripT-IL- Ira ) or chemically defined minimal medium (GG V17-TripT-IL-lra). Cell pellets were obtained by centrifugation at 5887 x g for 20 min, then resuspended in 10 mM Na 2
HPO
4 pH 6. For Met-I-TripT-IL-1ra, the soluble cell fraction containing the protein of interest was obtained by high pressure homogenization (2 x 17.000 psi) followed by 10 min centrifugation at 10.000 x g. The supernatant was diluted with 10 mM Na 2
HPO
4 pH 7.4 and run over a SP-Sepharose FF column (cation exchange, GE Healthcare) followed by Q-Sepharose FF (anion exchange. GE Healthcare) using an AKTA fPLC. In a last step, proteins were run through a Mustang E filter (Pall) to remove endotoxin, followed by buffer exchange into PBS pH 7.4 and concentration to 50 mg/mL. The GG-V17 -TripT-IL-IRa protein was expressed as a fusion protein comprising an N-terminal booster domain, phage CII protein, followed by a human Granzyme B cleavage site. The GG-V17 TripT-IL-IRa was purified from fermentation cell pellets by homogenization in lysis buffer containing lysozyme followed by centrifugation for 25 min at 8000 rpm. The supernatant 41 WO 2009/048961 PCT/US2008/079216 was then run through a Fractogel* EMD Chelate (M) column (EMD Chemicals Inc.), and the eluate was buffer exchanged into 20 mM Tris pH 7.5, 150 mM NaCl. The protein fraction was then digested with recombinant human Granzyme B (made in house, ref to patent). After dilution with PBS pH 6, the proteins were purified using SP Sepharose FF followed by Mustang E filtration and Fractogel* EMD Chelate (M) column in flow through mode to remove the fusion tag and human Granzyme B. Final, the protein was buffer exchanged into PBS pH 7.4 and concentrated to 50 mg/mL. Yields for both Met-I10-TripT-IL-Ira and GG V17-TripT-IL-lra proteins were 3-5 g/L, purity >95% as determined by SDS-PAGE (Figure 8), RP-HPLC and MS. Endotoxin levels were <3EU/mg as determined using a LAL assay (Lonza). Aggregates were <0.5% as determined by analytical SEC (Figure 9) and host cell protein < 6 ng/mL. Two batches (LM022, LM023) of Met-IlO-TripT-IL-1ra and two batches (CF0 19, CF020) of GG-V17-TripT-IL-1ra were tested in above assays. [00141] Female Lewis rats with 4-day established type II collagen arthritis were treated subcutaneously (SC), daily (QD) on arthritis days 1-3 with Vehicle (10 mM phosphate buffer pH 7.4), or equimolar amounts of IL-lra administering either monomeric IL-lra (100 mg/kg KINERET*), or trimerized ILlra (120 mg/kg Met-I10-TripT-IL1ra, or 120 mg/kg GG-V17 TripT-ILlra). In order to have only one set of controls, all rats in the QD groups were dosed with the respective vehicle (10 mM phosphate buffer pH 7.4, or sodium citrate buffer pH 6.5 for KINERET*) at the 2nd and 3rd dosings to keep manipulations constant. Animals were terminated on arthritis day 4. Efficacy evaluation was based on ankle caliper measurements, expressed as area under the curve (AUC), terminal hind paw weights and body weights (Bendele et al 2000, Arthritis + Rheumatism 43:2648-2659). All animals survived to study termination. Rats injected with K1NERET* or its vehicle (CSEP) vocalized during the injection process thus suggesting that subcutaneous irritation was occurring. No vocalization occurred with any other injections. [00142] Animals (8/group for arthritis, 4/group for normal), housed 4/cage, were anesthetized with Isoflurane and received subcutaneous/intradermal (SC/ID) injections with 300 pl of Freund's Incomplete Adjuvant (Difco, Detroit, MI) containing 2 mg/ml bovine type II collagen (Elastin Products, Owensville, Missouri) at the base of the tail and 2 sites on the back on days 0 and 6. Dosing by subcutaneous route (QD at 24 hour intervals) was initiated 42 WO 2009/048961 PCT/US2008/079216 on arthritis day 1 and continued through day 3. Experimental groups were as shown in Table 4 Table 4 QD SC Treatment 2.3 ml/kg, days 1-3, Group N Dose volumes are based on equivalent IL-ira molecules 1 4 Normal controls, vehicle (10 mM phosphate buffer pH 7.4) TID 2 8 Arthritis+ KINERET* QD (100 mg/kg), vehicle (sodium citrate buffer pH 6.5) at other times 3 8 Arthritis+ Met-IlO-TripT-ILira QD (120 mg/kg), vehicle (10 mM phosphate buffer pH 7.4) at other times 4 8 Arthritis+ V1 7-TripT-IL1ra QD (120 mg/kg), vehicle (10 mM phosphate buffer pH 7.4) at other times [00143] Rats were weighed on days 0-4 of arthritis, and caliper measurements of ankles were taken every day beginning on day 0 of arthritis (study day 9). After final body weight measurement, animals were euthanized, and hind paws were transected at the level of the medial and lateral malleolus and weighed (paired). [00144] Significant reduction of ankle diameter was seen in rats treated with 100 mg/kg KINERET* QD (d3-4), 120 mg/kg Met-I10-TripT-ILira QD (d2-4), or 120 mg/kg GG-V17 TripT-ILlra QD (d3-4), as compared to vehicle treated disease control animals. Reduction of ankle diameter AUC was significant for rats treated with 100 mg/kg KINERET* QD (34%), 120 mg/kg Met-IlO-TripT-ILira QD (54%), or 120 mg/kg GG-V17-TripT-ILlra QD (49%), as compared to vehicle treated disease control animals. Met-I1O-TripT-ILIra QD treatment resulted in significantly reduced ankle diameter AUC compared to KINERET* QD treatment (p<0.035 at the end of the study). Also, GG-V17-TripT-IL1ra QD treatment resulted in significantly reduced ande diameter AUC compared to KINERET* QD treatment at the end of the study (p<0.001). (Figure 10) [00145] Reduction of final paw weight was significant for rats treated with 100 mg/kg KINERET* QD (61%), 120 mg/kg Met-IlO-TripT-ILira QD (79%), or 120 mg/kg GG-V17 TripT-ILlra QD (91%), as compared to vehicle treated disease control animals. GG-V17 43 WO 2009/048961 PCT/US2008/079216 TripT-ILlra QD treatment resulted in significantly reduced final paw weights compared to KINERET* QD treatment (p<0.006). (Figure 11) [00146] Change in body weight was significantly increased toward normal for rats treated with 100 mg/kg KINERET* QD (54%), 120 mg/kg Met-IlO-TripT-ILira QD (49%), or 120 mg/kg GG-V17-TripT-ILlra QD (65%), as compared to vehicle treated disease control animals. [00147] Example 6: Streptozocin (STZ)-induced diabetes model [00148] STZ (Sigma Aldrich) was administered once daily for five successive days at 50 mg/kg i.p. to fasted C57BL/6J male mice. The mice gradually developed higher levels of blood glucose from Day I to Day 4. The levels rose from 6.9 nmol/L to 13.1 nmol/L during the STZ induction period. Five days (Day 4) after the last STZ dosing, the mice were randomly distributed into 10 treatment groups each containing 10 mice in good condition. Treatment started on this day, before onset of diabetes and continued beyond the onset. The treatment groups were as shown in Table 5. Table 5 Group Induction of Dose No. Diabetes Test Article mg/kg Administration 1 + Vehicle 0 i.p. once daily (QD) 2 + KINERET* 100 i.p. once daily (QD) 3 + KINERET* 30 i.p. once daily (QD) 4 + I10-TripT-IL1-RA 100 i.p. once daily 110-rip-I~lRA 00 QD) 5 + I10-TripT-IL1-RA 30 i.p. once daily 110-TipT-~l-R 30 QD) 6 + 110-TripT-ILl-RA 100 wekly (QD) [00149] The study period was 28 days and the mice were weighed once weekly during the treatment period. Blood glucose levels were measured every other day during the study period in order to monitor development of diabetes. A droplet of whole blood was collected 44 WO 2009/048961 PCT/US2008/079216 by tail vein bleeding and placed on an Ascensia ELITE* blood glucose test strip and analyzed with an Ascensia ELITE* blood glucose meter (Bayer). The values were recorded, and x-fold increase in any given group compared to levels at treatment initiation was calculated. Clinical symptoms were observed daily or as appropriate in groups where adverse symptoms occurred. [00150] As shown in Figure 12, a marked reduction of blood glucose levels was observed after daily i.p. dosing of either Il0-TripT-ILI-Ra or KINERET* at both 100 and 30 mg/kg. Furthermore, twice weekly dosing of 100 mg/kg 110-TripT-ILlRa was equally effective as daily dosing of 100 mg/kg KINERET*. These data demonstrate that trimerized IL-lRa is an effective treatment of experimentally induced diabetes. [00151] The examples given above are merely illustrative and are not meant to be an exhaustive list of all possible embodiments, applications or modifications of the invention. Thus, various modifications and variations of the described methods and systems of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in molecular biology, immunology, chemistry, biochemistry or in the relevant fields are intended to be within the scope of the appended claims. [00152] It is understood that the invention is not limited to the particular methodology, protocols, and reagents, etc., described herein, as these may vary as the skilled artisan will recognize. It is also to be understood that the terminology used herein is used for the purpose of describing particular embodiments only, and is not intended to limit the scope of the invention. It also is to be noted that, as used herein and in the appended claims, the singular forms a, "an," and "the" include the plural reference unless the context clearly dictates otherwise. Thus, for example, a reference to "a linker" is a reference to one or more linkers and equivalents thereof known to those skilled in the art. [00153] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art to which the 45 WO 2009/048961 PCT/US2008/079216 invention pertains. The embodiments of the invention and the various features and advantageous details thereof are explained more fully with reference to the non-limiting embodiments and/or illustrated in the accompanying drawings and detailed in the following description. It should be noted that the features illustrated in the drawings are not necessarily drawn to scale, and features of one embodiment may be employed with other embodiments as the skilled artisan would recognize, even if not explicitly stated herein. [00154] Any numerical values recited herein include all values from the lower value to the upper value in increments of one unit provided that there is a separation of at least two units between any lower value and any higher value. As an example, if it is stated that the concentration of a component or value of a process variable such as, for example, size, angle size, pressure, time and the like, is, for example, from 1 to 90, specifically from 20 to 80, more specifically from 30 to 70, it is intended that values such as 15 to 85, 22 to 68, 43 to 51, 30 to 32, etc. are expressly enumerated in this specification. For values which are less than one, one unit is considered to be 0.0001, 0.001, 0.01 or 0.1 as appropriate. These are only examples of what is specifically intended and all possible combinations of numerical values between the lowest value and the highest value enumerated are to be considered to be expressly stated in this application in a similar manner. [00155] Particular methods, devices, and materials are described, although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the invention. The disclosures of all references and publications cited above are expressly incorporated by reference in their entireties to the same extent as if each were incorporated by reference individually. 46
Claims (26)
1. A fusion protein comprising a trimerizing domain and an IL-1Ra polypeptide that inhibits IL-1 activity.
2. The fusion protein of claim 1, wherein the IL-1Ra polypeptide is at least 85% identical to SEQ ID NO: 38 as the result of conservative amino acid substitution, and comprises Trp16, Gln2O, Tyr34, Gln36 and Tyr147.
3. The fusion protein of claim 1, wherein the IL-IRa polypeptide is at least 95% identical to SEQ ID NO: 38.
4. The fusion protein of claim 2 further comprising at least one mutation selected from the group consisting of D47N, E52R, E90Y, P38Y, H54R, Q129L and M136N.
5. The fusion protein of claim 1 wherein the trimerizing domain is derived from human tetranectin.
6. The fusion protein of claim 1, wherein the trimerizing domain is a tetranectin trimerizing structural element.
7. The fusion protein of claim 1, wherein the trimerizing domain is at least 66% identical to SEQ ID NO:1.
8. A trimeric complex comprising three fusion proteins of claim 5, wherein the fusion proteins are the same or different.
9. A trimeric complex comprising three fusion proteins of claim 6, wherein the fusion proteins are the same or different.
10. The fusion protein of claim 1, further comprising polyethylene glycol.
11. The fusion protein of claim 1, further comprising a linker between the IL-1 Ra polypeptide and the trimerizing domain.
12. A trimeric complex comprising three fusion proteins, wherein each fusion protein comprises a fusion protein of claim 1, and wherein at least one of the fusion proteins is selected from the group consisting of TripK-IL-1ra (SEQ ID NO: 39); TripV-IL-lra (SEQ ID NO: 40); TripT-IL-ira (SEQ ID NO: 41); TripQ-IL-lra (SEQ 47 WO 2009/048961 PCT/US2008/079216 ID NO: 42); I10-TripK-IL-1ra (SEQ ID NO: 43); I10-TripV-IL-1ra (SEQ ID NO: 44); I10-TripT-IL-1ra (SEQ ID NO: 45); I10-TripQ-IL-lra (SEQ ID NO: 46); V17 TripT-ILIRa (SEQ ID NO: 55); V17-TripK-IL-lRa (SEQ ID NO: 56); V17-TripV IL-IRA (SEQ ID NO: 57); and V17-TripQ-IL1RA (SEQ ID NO: 58).
13. An isolated polynucleotide encoding the polypeptide of claim 1.
14. A vector comprising the polynucleotide of claim 13.
15. A host cell comprising the vector of claim 14.
16. A pharmaceutical composition comprising the fusion protein of claim 1 and at least one pharmaceutically acceptable excipient.
17. A pharmaceutical composition comprising the trimeric complex of claim 7 and least one pharmaceutically acceptable excipient.
18. A method for treating a disease mediated by interleukin 1 comprising administering to a patient in need thereof of the pharmaceutical composition of claim 17.
19. The method of claim 18, wherein the disease is an inflammatory disease.
20. The method of claim 19, wherein the inflammatory disease is rheumatoid arthritis.
21. The method of claim 19, wherein the inflammatory disease is diabetes.
22. The method of claim 19, further comprising administering to the patient, either simultaneously or sequentially, an anti-inflammatory agent.
23. The fusion protein of claim 1 further comprising an anti-inflammatory agent covalently linked to the fusion protein.
24. The method of claim 19 wherein at least one fusion protein is covalently linked to an anti-inflammatory agent.
25. A polypeptide complex comprising at least two fusion proteins of claim 1.
26. The polypeptide complex of claim 25 comprising at least four fusion proteins. 48
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US97825407P | 2007-10-08 | 2007-10-08 | |
US60/978,254 | 2007-10-08 | ||
PCT/US2008/079216 WO2009048961A1 (en) | 2007-10-08 | 2008-10-08 | Trimeric il-1ra |
Publications (1)
Publication Number | Publication Date |
---|---|
AU2008310902A1 true AU2008310902A1 (en) | 2009-04-16 |
Family
ID=40336426
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2008310902A Abandoned AU2008310902A1 (en) | 2007-10-08 | 2008-10-08 | Trimeric IL-1Ra |
Country Status (6)
Country | Link |
---|---|
EP (1) | EP2195337A1 (en) |
JP (1) | JP2010539995A (en) |
CN (1) | CN101889022A (en) |
AU (1) | AU2008310902A1 (en) |
CA (1) | CA2701705A1 (en) |
WO (1) | WO2009048961A1 (en) |
Families Citing this family (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20090143276A1 (en) * | 2007-10-08 | 2009-06-04 | Anaphore, Inc. | Trimeric IL-1Ra |
WO2010042890A2 (en) * | 2008-10-10 | 2010-04-15 | Anaphore, Inc. | Polypeptides that bind trail-ri and trail-r2 |
CN101690801B (en) * | 2009-10-26 | 2012-08-01 | 上海交通大学 | Application of interleukin-1 receptor antagonist and medicinal composition thereof |
US8853150B2 (en) | 2010-07-29 | 2014-10-07 | Eleven Biotherapeutics, Inc. | Chimeric IL-1 receptor type I antagonists |
WO2012028524A2 (en) * | 2010-08-30 | 2012-03-08 | F. Hoffmann-La Roche Ag | Method for producing a lipid particle, the lipid particle itself and its use |
EP2611417A2 (en) * | 2010-08-30 | 2013-07-10 | F.Hoffmann-La Roche Ag | Method for producing a tetranectin-apolipoprotein a-1 particle, the lipid particle obtained therewith and its use |
ES2600616T3 (en) | 2011-03-14 | 2017-02-10 | Phlogo Aps | Interleukin-1 receptor antagonists |
CN103703023A (en) * | 2011-08-25 | 2014-04-02 | 霍夫曼-拉罗奇有限公司 | Shortened tetranectin-apolipoprotein a-i fusion protein, a lipid particle containing it, and uses thereof |
US9745359B2 (en) | 2012-05-18 | 2017-08-29 | Adda Biotech Inc. | Protein and protein conjugate for diabetes treatment, and applications thereof |
AU2014243839B2 (en) | 2013-03-13 | 2019-01-03 | Buzzard Pharmaceuticals AB | Chimeric cytokine formulations for ocular delivery |
CN105367663A (en) * | 2014-08-31 | 2016-03-02 | 复旦大学 | Long-acting interleukin-1 receptor antagonist recombinant fusion protein and a preparation method and application thereof |
CN104587457B (en) * | 2015-01-13 | 2017-03-22 | 广东海大畜牧兽医研究院有限公司 | Method for preparing nanoparticle vaccine by utilizing slightly soluble or insoluble protein/polypeptide antigens |
EP4157860A4 (en) * | 2020-05-25 | 2024-03-06 | Beijing Vdjbio Co Ltd | An interleukin-1 receptor antagonist and a fusion protein containing the same |
CN114457086B (en) * | 2022-03-02 | 2022-11-15 | 上海勉亦生物科技有限公司 | Expression cassette for interleukin 1 receptor antagonist protein and AAV-based gene delivery system |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2002213843B2 (en) * | 2000-11-10 | 2008-02-07 | F. Hoffmann-La Roche Ltd. | Apolipoprotein analogues |
JP2005528107A (en) * | 2002-05-31 | 2005-09-22 | シェジェン ピーティーワイ リミテッド | Self-union or self-aggregation chimeric protein derived from membrane translocation sequence |
EP2311867A1 (en) * | 2002-10-29 | 2011-04-20 | Anaphore, Inc. | Trimeric binding proteins for trimeric cytokines |
BRPI0507949A (en) * | 2004-02-23 | 2007-07-24 | Borean Pharma As | multimerized hiv fusion inhibitors |
CA2589800A1 (en) * | 2004-12-02 | 2006-06-08 | Domantis Limited | Bispecific domain antibodies targeting serum albumin and glp-1 or pyy |
-
2008
- 2008-10-08 CN CN2008801197414A patent/CN101889022A/en active Pending
- 2008-10-08 EP EP08837224A patent/EP2195337A1/en not_active Withdrawn
- 2008-10-08 JP JP2010529006A patent/JP2010539995A/en not_active Withdrawn
- 2008-10-08 WO PCT/US2008/079216 patent/WO2009048961A1/en active Application Filing
- 2008-10-08 AU AU2008310902A patent/AU2008310902A1/en not_active Abandoned
- 2008-10-08 CA CA2701705A patent/CA2701705A1/en not_active Abandoned
Also Published As
Publication number | Publication date |
---|---|
CA2701705A1 (en) | 2009-04-16 |
EP2195337A1 (en) | 2010-06-16 |
CN101889022A (en) | 2010-11-17 |
WO2009048961A1 (en) | 2009-04-16 |
JP2010539995A (en) | 2010-12-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2008310902A1 (en) | Trimeric IL-1Ra | |
US20100028995A1 (en) | Tetranectin Trimerizing Polypeptides | |
US7790674B2 (en) | Methods of treatment using specific binding agents of human angiopoietin-2 | |
US20090143276A1 (en) | Trimeric IL-1Ra | |
CA2715503C (en) | Il-17ra-il-17rb antagonists and uses thereof | |
SK1599A3 (en) | Truncated soluble tumor necrosis factor type-i and type-ii receptors | |
JP6938565B2 (en) | UTI fusion protein | |
WO2013016220A1 (en) | Il-17 receptor a is required for il-17c biology | |
US8460647B2 (en) | Pre-ligand assembly domain of the IL-17 receptor | |
AU2002367152A1 (en) | Il-17 like molecules and uses thereof | |
KR20020073139A (en) | Interleukin-1 receptor antagonist-like molecules and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
MK4 | Application lapsed section 142(2)(d) - no continuation fee paid for the application |