AU2007338627B2 - Surgical applications for BMP binding protein - Google Patents
Surgical applications for BMP binding protein Download PDFInfo
- Publication number
- AU2007338627B2 AU2007338627B2 AU2007338627A AU2007338627A AU2007338627B2 AU 2007338627 B2 AU2007338627 B2 AU 2007338627B2 AU 2007338627 A AU2007338627 A AU 2007338627A AU 2007338627 A AU2007338627 A AU 2007338627A AU 2007338627 B2 AU2007338627 B2 AU 2007338627B2
- Authority
- AU
- Australia
- Prior art keywords
- bbp
- bmp
- bone
- peptide
- growth factor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 102000029877 BMP binding proteins Human genes 0.000 title description 2
- 108091014778 BMP binding proteins Proteins 0.000 title description 2
- 210000000988 bone and bone Anatomy 0.000 claims abstract description 64
- 239000003102 growth factor Substances 0.000 claims abstract description 50
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 69
- 230000004927 fusion Effects 0.000 claims description 68
- 238000000034 method Methods 0.000 claims description 67
- 230000011164 ossification Effects 0.000 claims description 66
- 108010049931 Bone Morphogenetic Protein 2 Proteins 0.000 claims description 64
- 102100024506 Bone morphogenetic protein 2 Human genes 0.000 claims description 64
- 230000000694 effects Effects 0.000 claims description 44
- 230000008468 bone growth Effects 0.000 claims description 40
- 239000000203 mixture Substances 0.000 claims description 25
- 150000007523 nucleic acids Chemical class 0.000 claims description 24
- 230000001939 inductive effect Effects 0.000 claims description 18
- 210000002805 bone matrix Anatomy 0.000 claims description 11
- 108010049870 Bone Morphogenetic Protein 7 Proteins 0.000 claims description 9
- 102100022544 Bone morphogenetic protein 7 Human genes 0.000 claims description 9
- 239000003814 drug Substances 0.000 claims description 8
- 108010049955 Bone Morphogenetic Protein 4 Proteins 0.000 claims description 7
- 102100024505 Bone morphogenetic protein 4 Human genes 0.000 claims description 7
- 108020004707 nucleic acids Proteins 0.000 claims description 7
- 102000039446 nucleic acids Human genes 0.000 claims description 7
- 102100022545 Bone morphogenetic protein 8B Human genes 0.000 claims description 4
- 108010090290 Growth Differentiation Factor 2 Proteins 0.000 claims description 4
- 102100040892 Growth/differentiation factor 2 Human genes 0.000 claims description 4
- 238000004519 manufacturing process Methods 0.000 claims description 4
- 108010049974 Bone Morphogenetic Protein 6 Proteins 0.000 claims description 3
- 102100022525 Bone morphogenetic protein 6 Human genes 0.000 claims description 3
- 101000899368 Homo sapiens Bone morphogenetic protein 8B Proteins 0.000 claims description 3
- 108010049951 Bone Morphogenetic Protein 3 Proteins 0.000 claims description 2
- 108010049976 Bone Morphogenetic Protein 5 Proteins 0.000 claims description 2
- 102100024504 Bone morphogenetic protein 3 Human genes 0.000 claims description 2
- 102100022526 Bone morphogenetic protein 5 Human genes 0.000 claims description 2
- 102100035379 Growth/differentiation factor 5 Human genes 0.000 claims description 2
- 101001023988 Homo sapiens Growth/differentiation factor 5 Proteins 0.000 claims description 2
- 238000002513 implantation Methods 0.000 abstract description 17
- 230000035876 healing Effects 0.000 abstract description 6
- 238000001356 surgical procedure Methods 0.000 abstract description 6
- 230000000399 orthopedic effect Effects 0.000 abstract description 3
- 208000029725 Metabolic bone disease Diseases 0.000 abstract 1
- 206010049088 Osteopenia Diseases 0.000 abstract 1
- 150000001413 amino acids Chemical class 0.000 description 35
- 210000004027 cell Anatomy 0.000 description 26
- 239000003795 chemical substances by application Substances 0.000 description 23
- 230000002308 calcification Effects 0.000 description 22
- 241000700159 Rattus Species 0.000 description 21
- 235000001014 amino acid Nutrition 0.000 description 20
- 239000007943 implant Substances 0.000 description 19
- 241000283690 Bos taurus Species 0.000 description 18
- 229940024606 amino acid Drugs 0.000 description 18
- 241000282414 Homo sapiens Species 0.000 description 17
- 241001465754 Metazoa Species 0.000 description 17
- 230000027455 binding Effects 0.000 description 17
- 230000002188 osteogenic effect Effects 0.000 description 17
- 102000004169 proteins and genes Human genes 0.000 description 17
- 108090000623 proteins and genes Proteins 0.000 description 17
- 238000006467 substitution reaction Methods 0.000 description 17
- 238000011282 treatment Methods 0.000 description 17
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 16
- 235000018102 proteins Nutrition 0.000 description 16
- 241000699666 Mus <mouse, genus> Species 0.000 description 15
- 102000005962 receptors Human genes 0.000 description 15
- 108020003175 receptors Proteins 0.000 description 15
- 102000007350 Bone Morphogenetic Proteins Human genes 0.000 description 14
- 108010007726 Bone Morphogenetic Proteins Proteins 0.000 description 14
- 108091028043 Nucleic acid sequence Proteins 0.000 description 14
- 229940112869 bone morphogenetic protein Drugs 0.000 description 14
- 238000002559 palpation Methods 0.000 description 14
- 238000001727 in vivo Methods 0.000 description 13
- 108010035532 Collagen Proteins 0.000 description 12
- 102000008186 Collagen Human genes 0.000 description 12
- 229920001436 collagen Polymers 0.000 description 12
- 230000008439 repair process Effects 0.000 description 12
- 101000864761 Homo sapiens Splicing factor 1 Proteins 0.000 description 11
- 101000638018 Homo sapiens TM2 domain-containing protein 1 Proteins 0.000 description 11
- 102000050581 human TM2D1 Human genes 0.000 description 11
- 210000001519 tissue Anatomy 0.000 description 11
- 230000002648 chondrogenic effect Effects 0.000 description 10
- 230000001965 increasing effect Effects 0.000 description 10
- 239000000463 material Substances 0.000 description 10
- 239000002243 precursor Substances 0.000 description 10
- 102000004196 processed proteins & peptides Human genes 0.000 description 10
- 206010017076 Fracture Diseases 0.000 description 9
- 102100030277 Secreted phosphoprotein 24 Human genes 0.000 description 9
- 230000008569 process Effects 0.000 description 9
- 108010079711 secreted phosphoprotein 24 Proteins 0.000 description 9
- 108060002885 fetuin Proteins 0.000 description 8
- 102000013361 fetuin Human genes 0.000 description 8
- 230000014759 maintenance of location Effects 0.000 description 8
- 210000003205 muscle Anatomy 0.000 description 8
- 208000010392 Bone Fractures Diseases 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 7
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 7
- 238000004458 analytical method Methods 0.000 description 7
- 108010045569 atelocollagen Proteins 0.000 description 7
- 230000002708 enhancing effect Effects 0.000 description 7
- 239000012634 fragment Substances 0.000 description 7
- 230000003993 interaction Effects 0.000 description 7
- 241000894007 species Species 0.000 description 7
- 210000000130 stem cell Anatomy 0.000 description 7
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 6
- 101000762366 Homo sapiens Bone morphogenetic protein 2 Proteins 0.000 description 6
- 101710084629 Major non-capsid protein Proteins 0.000 description 6
- 239000002552 dosage form Substances 0.000 description 6
- 102000045896 human BMP2 Human genes 0.000 description 6
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 6
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 6
- 229920001184 polypeptide Polymers 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 239000013598 vector Substances 0.000 description 6
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 5
- 102000015833 Cystatin Human genes 0.000 description 5
- 101000864759 Mus musculus Splicing factor 1 Proteins 0.000 description 5
- 210000000845 cartilage Anatomy 0.000 description 5
- 239000000515 collagen sponge Substances 0.000 description 5
- 108050004038 cystatin Proteins 0.000 description 5
- 230000001582 osteoblastic effect Effects 0.000 description 5
- 239000000758 substrate Substances 0.000 description 5
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 5
- 101000702287 Bos taurus Secreted phosphoprotein 24 Proteins 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 4
- 102000013275 Somatomedins Human genes 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- -1 blutamine Chemical compound 0.000 description 4
- 210000004271 bone marrow stromal cell Anatomy 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 230000013632 homeostatic process Effects 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 210000000963 osteoblast Anatomy 0.000 description 4
- 238000002864 sequence alignment Methods 0.000 description 4
- PUZPDOWCWNUUKD-UHFFFAOYSA-M sodium fluoride Chemical compound [F-].[Na+] PUZPDOWCWNUUKD-UHFFFAOYSA-M 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 208000006386 Bone Resorption Diseases 0.000 description 3
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 3
- 206010052273 Dystrophic calcification Diseases 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 206010061363 Skeletal injury Diseases 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 230000037182 bone density Effects 0.000 description 3
- 230000024279 bone resorption Effects 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 229910052791 calcium Inorganic materials 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 238000004587 chromatography analysis Methods 0.000 description 3
- 230000001054 cortical effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 230000035194 endochondral ossification Effects 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 229910052500 inorganic mineral Inorganic materials 0.000 description 3
- 238000011694 lewis rat Methods 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 238000000816 matrix-assisted laser desorption--ionisation Methods 0.000 description 3
- 239000011707 mineral Substances 0.000 description 3
- 235000010755 mineral Nutrition 0.000 description 3
- 210000005009 osteogenic cell Anatomy 0.000 description 3
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 239000013641 positive control Substances 0.000 description 3
- 230000002980 postoperative effect Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 101150061927 BMP2 gene Proteins 0.000 description 2
- 229940122361 Bisphosphonate Drugs 0.000 description 2
- 102000055006 Calcitonin Human genes 0.000 description 2
- 108060001064 Calcitonin Proteins 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 241000287828 Gallus gallus Species 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 2
- 208000001132 Osteoporosis Diseases 0.000 description 2
- 108090000445 Parathyroid hormone Proteins 0.000 description 2
- 108010089430 Phosphoproteins Proteins 0.000 description 2
- 102000007982 Phosphoproteins Human genes 0.000 description 2
- 239000004792 Prolene Substances 0.000 description 2
- 108010049264 Teriparatide Proteins 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 229930003316 Vitamin D Natural products 0.000 description 2
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 150000004663 bisphosphonates Chemical class 0.000 description 2
- 230000004097 bone metabolism Effects 0.000 description 2
- 230000010072 bone remodeling Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 2
- 229960004015 calcitonin Drugs 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 230000024245 cell differentiation Effects 0.000 description 2
- 210000001612 chondrocyte Anatomy 0.000 description 2
- 230000007012 clinical effect Effects 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 238000009547 dual-energy X-ray absorptiometry Methods 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 210000003195 fascia Anatomy 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 238000010562 histological examination Methods 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 210000002901 mesenchymal stem cell Anatomy 0.000 description 2
- 210000002997 osteoclast Anatomy 0.000 description 2
- 230000001599 osteoclastic effect Effects 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000002601 radiography Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000008929 regeneration Effects 0.000 description 2
- 238000011069 regeneration method Methods 0.000 description 2
- 239000012146 running buffer Substances 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000011775 sodium fluoride Substances 0.000 description 2
- 235000013024 sodium fluoride Nutrition 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 210000004872 soft tissue Anatomy 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 230000009469 supplementation Effects 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- OGBMKVWORPGQRR-UMXFMPSGSA-N teriparatide Chemical compound C([C@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)C(C)C)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CNC=N1 OGBMKVWORPGQRR-UMXFMPSGSA-N 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- 235000019166 vitamin D Nutrition 0.000 description 2
- 239000011710 vitamin D Substances 0.000 description 2
- 150000003710 vitamin D derivatives Chemical class 0.000 description 2
- 229940046008 vitamin d Drugs 0.000 description 2
- VZQHRKZCAZCACO-PYJNHQTQSA-N (2s)-2-[[(2s)-2-[2-[[(2s)-2-[[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]propanoyl]amino]prop-2-enoylamino]-3-methylbutanoyl]amino]propanoic acid Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)C(=C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(N)=N VZQHRKZCAZCACO-PYJNHQTQSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 101150072730 Bmp6 gene Proteins 0.000 description 1
- 208000020084 Bone disease Diseases 0.000 description 1
- 101000822695 Clostridium perfringens (strain 13 / Type A) Small, acid-soluble spore protein C1 Proteins 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 102000001189 Cyclic Peptides Human genes 0.000 description 1
- 108010069514 Cyclic Peptides Proteins 0.000 description 1
- 101710120060 Cystatin-like protein Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 238000000729 Fisher's exact test Methods 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 101710167839 Morphogenetic protein Proteins 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 102000004067 Osteocalcin Human genes 0.000 description 1
- 108090000573 Osteocalcin Proteins 0.000 description 1
- 208000006735 Periostitis Diseases 0.000 description 1
- 101000576807 Protobothrops flavoviridis Small serum protein 2 Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000277331 Salmonidae Species 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000000061 acid fraction Substances 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 210000001909 alveolar process Anatomy 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 208000037873 arthrodesis Diseases 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000003416 augmentation Effects 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- PXXJHWLDUBFPOL-UHFFFAOYSA-N benzamidine Chemical compound NC(=N)C1=CC=CC=C1 PXXJHWLDUBFPOL-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033558 biomineral tissue development Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000000919 ceramic Substances 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 238000002591 computed tomography Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 239000002852 cysteine proteinase inhibitor Substances 0.000 description 1
- 239000000430 cytokine receptor antagonist Substances 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 238000000326 densiometry Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 238000002224 dissection Methods 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 230000004821 effect on bone Effects 0.000 description 1
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 1
- 239000002834 estrogen receptor modulator Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 229940053641 forteo Drugs 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- JEGUKCSWCFPDGT-UHFFFAOYSA-N h2o hydrate Chemical compound O.O JEGUKCSWCFPDGT-UHFFFAOYSA-N 0.000 description 1
- 230000003284 homeostatic effect Effects 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 238000010191 image analysis Methods 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 229940060367 inert ingredients Drugs 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 229960002725 isoflurane Drugs 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 210000003127 knee Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000001906 matrix-assisted laser desorption--ionisation mass spectrometry Methods 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 230000000921 morphogenic effect Effects 0.000 description 1
- 238000002887 multiple sequence alignment Methods 0.000 description 1
- 210000000107 myocyte Anatomy 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 210000005155 neural progenitor cell Anatomy 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000002138 osteoinductive effect Effects 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 206010033675 panniculitis Diseases 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000003239 periodontal effect Effects 0.000 description 1
- 201000001245 periodontitis Diseases 0.000 description 1
- 210000003460 periosteum Anatomy 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 230000008092 positive effect Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 210000003314 quadriceps muscle Anatomy 0.000 description 1
- 238000013139 quantization Methods 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 238000011552 rat model Methods 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000002278 reconstructive surgery Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000007634 remodeling Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000000333 selective estrogen receptor modulator Substances 0.000 description 1
- 229940095743 selective estrogen receptor modulator Drugs 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 210000004304 subcutaneous tissue Anatomy 0.000 description 1
- 150000005846 sugar alcohols Chemical class 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000008399 tap water Substances 0.000 description 1
- 235000020679 tap water Nutrition 0.000 description 1
- 229960005460 teriparatide Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 238000001269 time-of-flight mass spectrometry Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 210000000689 upper leg Anatomy 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/10—Peptides having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1841—Transforming growth factor [TGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1875—Bone morphogenic factor; Osteogenins; Osteogenic factor; Bone-inducing factor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/02—Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/51—Bone morphogenetic factor; Osteogenins; Osteogenic factor; Bone-inducing factor
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Physical Education & Sports Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Rheumatology (AREA)
- Epidemiology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Materials For Medical Uses (AREA)
Abstract
The present invention relates to the clinical application of BBP, alone or in combination with other growth factors, for use in bone healing applications, such as spinal surgery. Additional applications include use in orthopedic implantable prostheses and implantation into other surgical sites (e.g., surgical reconstruction, regional osteopenia, etc.) where bone is desired.
Description
SURGICAL APPLICATIONS FOR BMP BINDING PROTEIN PRIORITY CLAIM [0001] This application claims priority from US Provisional Patent Application 60/876,821 filed December 22, 2006, and to US Patent Application 11/985,745 filed November 16, 2007. BACKGROUND OF THE INVENTION. [0002] Growth factors are substances, including peptides, which affect the growth and differentiation of defined cell populations in vivo or in vitro. Normal bone formation occurs during development, bone remodeling occurs in adult life, and bone repair occurs in order to preserve the integrity of the skeleton. Bone formation, remodeling and repair involve bone resorption by osteoclasts and bone formation by osteoblasts. Cell differentiation and the activity of osteoblasts and osteoclasts are regulated by growth factors. Thus, any interference between the balance in cell differentiation and resorption can affect bone homeostasis, bone formation and repair. [0003] Osteoblasts are derived from a pool of marrow stromal cells (also known as mesenchymal stem cells). MSC are present in a variety of tissues and are prevalent in bone marrow stroma. MSC are pluripotent and can differentiate into chondrogenic or osteogenic cells including osteoblasts, chondrocytes, fibroblasts, myocytes, and adipocytes. [0004] The induction of ectopic bone formation by demineralized bone matrix (DBM) has been described. (Urist, M. R.: Bone: Formation by autoinduction. Science 150:893-899, 1965; Urist, et al., Purification of bovine morphogenetic protein by hydroxyapatite chromatography. Proc. Natl. Acad. Sci. USA 81:371-375, 1984; Urist, M. R. Emerging concepts of bone morphogenetic protein. In Fundamentals of Bone Growth: Methodology and Applications, Boston C.R.C. Press, pp. 189-198, 1991.) Further, the properties of the partially purified protein fraction, bone morphogenic protein/non-collagenous protein ("BMP/NCP" or "BMP"s) have been described. (Urist, et al. Methods of Preparation and Bioassay of Bone Morphogenetic Protein and Polypeptide Fragments. In Methods in Enzymology. Vol. 146. New York, Academic Press, pp. 294-312, 1987; Urist, et al., Hydroxyapatite affinity, electroelution, and radioimmunoassay for 1 WO 2008/079400 PCT/US2007/026315 identification of human and bovine bone morphogenetic proteins and polypeptides. In Development and Diseases of Cartilage and Bone Matrix. New York, Alan R, Liss, Inc., pp. 149-176, 1987.) [0005] BMP/NCP was never purified to homogeneity, but other investigators have used similar starting materials to clone a number of recombinant "BMPs." However several of these molecules have little or no osteogenic activity. "BMPs" and other osteogenic factors have been studied for use in clinical applications. However, the cost of using minimally effective dosages of BMP-7 (also known as OP-1), for example has been a limiting factor in clinical use. Therefore, effective and affordable compositions and methods are desired for clinical applications relating to bone. [0006] Adjuvant therapeutics to enhance bone healing are important in many aspects of orthopedics, but are especially important for spinal fusion where prompt and thorough osteogenesis is critical. The most useful agents currently available include bone growth factors, such as bone morphogenetic proteins (BMPs). These proteins induce the recapitulation of endochondral bone formation among undifferentiated mesodermal cells. However, their usefulness is limited by expense and by local adverse effects such as unwanted ectopic bone formation and inflammatory responses associated with doses currently used for spinal fusion procedures. [0007] Furthermore, potential systemic adverse effects of high dose BMPs when to be used for longer fusions has not been fully determined. Therefore, a number of strategies are being developed to provide safer, less expensive and more efficacious adjuvant agents. [0008] The use of BMP-2 as a bone generator for spinal fusion is gaining increased popularity. Recent studies have shown that it may be used effectively for both anterior and posterior fusion procedures through the whole spinal column. However, its high expense as well as the reported local side effects such as unwanted bone formation and dangerous swelling at the neck after the anterior cervical fusion procedure has prevented its extensive use for spinal procedures. Focus has now shifted to increase the effectiveness of BMP-2 while decreasing its dose and controlling the side effects. The main limitation is the need for better delivery systems that provide a sustained, 2 WO 2008/079400 PCT/US2007/026315 biologically appropriate concentration of BMP-2 at the side of fusion bed. Delivery needs to be sustained, because BMPs have exceedingly short biological half-lives, usually the order of minutes or hours, rather than the days or weeks needed to stimulate a complete osteogenic response. For example, rBMP-2 has been described as having a half-life of only a few hours. BRIEF SUMMARY OF INVENTION [0009] The inventions are related to a cyclic peptide designated BMP Binding Peptide (BBP) that avidly binds growth factors, such as rhBMP-2. BBP increases the rate and degree to which rhBMP-2 induces bone formation. BBP may accomplish this by increasing the residency rates of other bone growth factors. However, BBP alone induces calcification of chondrogenic, osteogenic and osteoblastic cells. Compositions and substrates including BBP, antibodies to BBP and methods of using BBP are useful in applications relating to bone. [0010] In one embodiment, the invention may include a method of treatment with agents for maintaining bone homeostasis, enhancing bone formation and/or enhancing bone repair. [0011] In one embodiment, the invention includes methods and devices for increasing the residency times of bone inducing substances, such as BMP. In one embodiment, the invention includes methods and devices for increasing the rate and overall osteogenic activity of bone inducing substances, such as BMP. Further, in one embodiment, the invention includes methods and devices for reducing time required for the effect of osteogenesis and calcification of bone inducing substances. [0012] In one application of the invention, the method may be applied to induce the local repair of bone or to treat bone related disorders, such as osteoporosis. In one embodiment of the invention, BBP may be used to induce the effects of other bone growth factors on bone fusion in membraneous bone (such as spinal fusion) or in endochondral bone. [00131 In one embodiment, the invention may include implants having agents or seeded with pluripotential or differentiated cells for inducing bone formation or repair. The invention may also include the application of 3 substances or differentiated cells at a site where bone formation or bone repair is desired. [0014]This invention is advantageous at least in that BBP alone or in combination with other growth factors enhances calcification of chondrogenic or osteogenic precursor cells. Further, this invention is advantageous at least in that BBP enhances osteogenesis to occur faster to a greater extent, which may improve the clinical rate and effectiveness of treatment with BMP, and reduce doses and therefore the costs and side effects of BMP treatment alone. [0014a] Definitions of the specific embodiments of the invention as claimed herein follow. [0014b] According to a first embodiment of the invention, there is provided an isolated peptide, wherein the peptide comprises the sequence: C-R-S-T-V-K-V-S-Xaa-Q-Q-V-Q-G-V-H-A-R-C wherein Xaa is A or V, and wherein the peptide has one or more of bone growth, bone formation or bone fusion activity when it is used in combination with a bone growth factor. [0014c] According to a second embodiment of the invention, there is provided a composition comprising the isolated peptide of the first embodiment. (0014d] According to a third embodiment of the invention, there is provided an isolated nucleic acid encoding the peptide of the first embodiment. [0014e] According to a fourth embodiment of the invention, there is provided a method of inducing bone growth, the method comprising administering to a subject the peptide of the first embodiment or the composition of the second embodiment, and at least one bone growth factor, wherein the bone growth factor is administered before, with or after the peptide or the composition. [0014f] According to a fifth embodiment of the invention, there is provided a method of inducing bone formation, the method comprising administering to a subject the peptide of the first embodiment or the composition of the second embodiment, and at least one bone growth factor, wherein the bone growth factor is administered before, with or after the peptide or the composition. [0014g] According to a sixth embodiment of the invention, there is provided a method of inducing bone fusion, the method comprising administering to a subject the peptide 4 of the first embodiment or the composition of the second embodiment, and at least one bone growth factor, wherein the bone growth factor is administered before, with or after the peptide or the composition. [0014h] According to a seventh embodiment of the present invention, there is provided a use of the peptide of the first embodiment in the manufacture of a medicament for inducing one or more of bone growth, bone formation or bone fusion, wherein the medicament is formulated for administration with a bone growth factor. [0015]These, as well as other objects, features and benefits will now become clear from a review of the following detailed description of illustrative embodiments and the accompanying drawings. BRIEF DESCRIPTION OF DRAWINGS [0016] FIG. 1A are BBP bovine (1) amino acid and (2) nucleic acid sequences, respectively; FIG. 1 B is a partial amino acid sequence of the bovine BMP binding protein ("BBP") showing the cystatin homology region, the BMP-2 homology region, and the TGF-P receptor 11 homology domain. [0017] FIG. 2 is an amino acid sequence alignment of human BMP-2 and the BMP-2 homology region in bovine SPP-24; (i, identical; c, conservative substitution; sc, semi conservative substitution). [0018] FIG. 3 is an amino acid sequence alignment of bovine fetuin and human TGF-p receptor 11 (above) and of human TGF-P receptor 11 and the TGF-p receptor II homology domain of bovine SPP-24 (corresponding to BBP) (bottom); (i, identical; c, conservative substitution; sc, semi-conservative substitution). [0019] FIG. 4 is a radiogram of mouse hind quarters 21 days after implantation of 500 pg of BBP in atelocollagen (top) or atelocollagen alone (bottom). [0020] FIG. 5 is a histological section of mouse muscle 21 days after implantation of 500 pg of BBP in atelocollagen. (H & E stain. Original magnification 100 X.) [Text continues on page 5.] 4a [0021] FIG. 6 are radiograms of mouse hind quarters 21 days after implantation of 5 pig of rhBMP-2 (left) or 5 ptg of rhBMP-2 plus 500 mg of BBP (right). [0022] FIG. 7 are radiograms of mouse hind quarters 9 (top) and 12 (bottom) days after implantation of 5 pg of rhBMP-2 (left) or 5 pg of rhBMP-2 plus 500 mg of BBP (right). [0023] FIG. 8 are histological sections of mouse hind quarters 9 days after implantation of 5 pg of rhBMP-2 alone (A) or 5 ptg of rhBMP-2 plus 500 pg of BBP (B). [0024] FIG. 9 is a surface plasmon resonance sensogram for the interaction of rhBMP 2 (affixed to the chip) and cyclized BBP at concentrations ranging from 1 x 10-5 M 1 x 10-4 M. [0025] FIG. 10 is a bar graph depicting the percentage of rhBMP-2 retention over 1, 3 and 7 days in the presence or absence of BBP. [0026] FIG. 11 includes amino acid sequences against which specific SSP-24/BBP antibodies have been generated. [0027] FIGS. 12 A & B depict flowcharts of exemplary methods of the invention. [0028] FIGS. 13 A & B are schematic depictions of two embodiments of the invention. [0029] FIG. 14 A is a chart showing the amino acid sequences for BPP in various species (SEQ ID NOS 11, 1, 13, 15, 17, 19, 21, 23, 25 and 27, respectively, in order of appearance). FIG. 14 B is a list of the nucleic acid sequences for BPP in various species (SEQ ID NOS 12, 14, 16, 18, 20, 22, 24, 26 and 28, respectively, in order of appearance). [0030] FIG. 15 is an anterior-posterior radiograph of a rat spine fused at L4-L5 with the application of BBP high dose (1000pg) + rhBMP-2 low dose (1 pg) 8 weeks after treatment. [0031]FIG. 16 is an anterior-posterior radiograph of a rat spine showing pseudoarthritis at right anno fusion at left L4-L5 with the application of rhBMP-2 (1 pg) treatment. 5 [0032] FIG. 17 is a histological section of rat spinal region 8 weeks after treatment of a combination of BBP and rhBMP-2. (H & E stain. Original magnification 8.4 X.) [0033] FIG. 18 is a histological section of rat spinal region 8 weeks after treatment with low dose rhBMP-2 (1 ptg). (H & E stain. Original magnification 8.4 X.) DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS [0034] One embodiment of the invention comprises a peptide having the amino acid sequence of SEQ ID No: 1. The bovine derived amino acid SEQ ID No: 1 has been designated BBP, and SEQ ID No: 2 corresponds to the bovine nucleic acid sequence encoding BBP. [0035] One embodiment of the invention comprises a peptide having the amino acid sequence of SEQ ID No. 13, which is the sequence of human BBP. SEQ ID No. 14 corresponds to the human nucleic acid sequence encoding human BBP. [0036] BBP is a 19 amino acid, 2.1kD peptide, derived from a 18.5 kD fragment of a known 24 kD secreted phosphoprotein ("SPP-24"). SPP-24 is illustrated by SEQ ID No: 2. Notably, SPP-24 inhibits BMP-2 induced bone formation. BBP contains the cystatin-like domain of SPP-24. BBP is expressed at least in the liver and bone (including at least demineralized cortical bone and periosteum). [0037]The BBP amino acid sequence is similar to the TGF-p/BMP-binding region of fetuin, a member of the cystatin family of protease inhibitors. BBP avidly binds rhBMP 2 (recombinant human BMP-2) with a KD of x 10-5 M. BBP may also bind other molecules having similar binding domains to BMP-2, such as other TGF-p proteins (including but not limited to BMP-4, BMP-7 (OP-1), BMP-6, BMP-8 (OP-2), BMP-9 and TGF-P) and affect their retention rates and/or activity as well. There is a high degree of sequence similarity (about 90%) between BMP-4 and BMP-2, for example. Additionally, the various ostroinductive BMPs (BMP-2, BMP-4, BMP-6, BMP-7 and BMP-9) have been demonstrated to bind to the same receptors (with some variation in affinities). Therefore, given the sequence and binding similarities, binding with these 6 WO 2008/079400 PCT/US2007/026315 additional BMPs is expected. Additional growth factors useful in this invention may include: GDF5, and other BMPs such as, BMP-3, BMP-4, BMP-5, BMP 6, BMP-7, BMP-8, BMP-9. [0038] BBP alone induces calcification of vertebrate chondrogenic and osteogenic precursor cells. BBP increases the increases the rate and degree to which rhBMP-2 induces bone formation. Surprisingly, BBP combined with BMP-2 in vivo causes osteogenesis to occur faster and to a greater extent and with smaller amounts of rhBMP-2, than compared with the effect of BMP 2 alone. This result was unexpected given the role of SSP-2 which inhibits bone formation by BMP-2, as discussed above. [0039] For example, when implanted alone in mouse muscle, the BBP induces dystrophic calcification. The process of bone formation in repair or ectopic bone formation the "mouse hindquarter" or "muscle pouch" model recapitulates endochondral bone formation. The first step involves the production of cartilage, which is replaced by bone. This same process that occurs during endochondral bone formation in development, while some membraneous bone formation occurs directly without a cartilage intermediary. [0040] In one embodiment of the invention, a peptide comprising a fragment of BBP may be useful, if the fragment similarly increases degree or rate of osteogenesis by BMP-2 in mammalian cells, or increases degree or rate of calcification in vertebrate cells, or specifically mammalian chondrogenic or osteogenic progenitor cells. [0041] Forms of BBP having modifications of the amino acid SEQ. ID No. 1 may also be useful in this invention. For example, the conserved amino acid sequences of BBP between species, deletional or insertional modifications, conservative or semi-conservative substitutional modifications are intended to be encompassed in the claimed BBP, to the extent that the modified amino acid sequences increase the residency time and or activity of BMP-2 or other TGF-p homologous molecules. BBP is a P-pleated sheet-turn-sheet pleated sheet molecular motif ("B-T-B"). It is currently believed that growth factor binding amino acids reside in the T-section. Therefore, amino acid substitutions in the T-section may affect activity of BBP to a greater extent than substitutions in the B regions. 7 [0042]As above, BPP is believed to increase the effect of growth factors, like BMP-2 by increasing the amount of time ("residency time") that a growth factor remains at the site of implantation, and/or the overall activity of BMP-2 or other TGF-p homologous molecules. BMP alone, for example, is rapidly removed from implantation sites, while implantation of BMP with BBP has been shown to increase residence time. The increase in residency time may be attributed to, for example: 1) BPP's ability to increase the half-life of growth factors (such as by reducing the rate of proteolysis), and/or 2) decrease the diffusion rate of growth factors from an application site. [0043] One embodiment of the invention comprises a peptide having the sequence of SEQ ID No. 11: C-R-S-T-V-X-Z-S-X-X-X-V-X-X-V-X-Z-Z-C, which is the mammalian consensus sequence for BBP. Figure 14A shows the homology in amino acid sequence across bovine (SEQ ID No. 1; nucleic acid sequence set forth at SEQ ID No. 2), human (SEQ ID No. 13; nucleic acid sequence set forth at SEQ ID No. 14 (position 9 is either A or V), porcine (SEQ ID No. 15; nucleic acid sequence set forth at SEQ ID No. 16), ovine (SEQ ID No. 17; nucleic acid sequence set forth at SEQ ID No. 18), rat (SEQ ID No. 19; nucleic acid sequence set forth at SEQ ID No. 20), and mouse (SEQ ID No. 21; nucleic acid sequence set forth at SEQ ID No. 22) BBP. Figure 14A also shows highly conserved regions in chicken (SEQ ID No. 23; nucleic acid sequence set forth at SEQ ID No. 24), salmon (SEQ ID No. 25; nucleic acid sequence set forth at SEQ ID No. 26) and trout (SEQ ID No. 27; nucleic acid sequence set forth at SEQ ID No. 28). [0044] In Fig. 14 A, "X" and "Z" are used to denote amino acid substitutions that are understood to be semi-conservative or conservative, respectively. Conservative substitutions include amino acids selected from the same group, and semi conservative substitutions include substitutions that are not believed to affect the BMP 2 binding domain or the function of the BBP. For example, the substitution at position 6 is conservative between human, rat and ovine, but semi-conservative with some other species because the amino acids reported at that position in different species are: Q and E (Q in porcine, rat, and mouse BBP, and E in chicken). Although K and R are both classified as basic amino acids, Q is classified as an uncharged polar amino acid, therefore 8 WO 2008/079400 PCT/US2007/026315 the substitution is not conservative. The substitution is semi-conservative, however, because the function of BBP is believed to be unaffected. Semi conservative substitutions are also found at positions 9, 10, 11, and 16. At position 9, the amino acids A is found in bovine, human, porcine and ovine BBP, compared to K in rat and mouse BBP. At position 10, the amino acid E is reported for bovine, porcine, and ovine BBP, human BBP contains Q at that position, and rat and mouse BBP contain the amino acid G. At position 11, the amino acid Q is found in bovine, human, rat and mouse, whereas K, is reported for porcine BBP and R for ovine BBP. At position 16, W is found in bovine, porcine, ovine, rat and mouse BBP, whereas human BBP contains an H. There are also semi-conservative substitutions at positions 13 and 14 between rat/human, as opposed to other species. [0045] An example of a conservative substation is found at position 7. At this position, different hydrophobic amino acids are observed in different species, namely, M in bovine, ovine, rat, and mouse BBP, compared to V in human and I in porcine BBP. This substitution is considered conservative because M, V, and I are all hydrophobic amino acids. Other conservative substitutions occur at positions 17 and 18. Two hydrophobic amino acids, A and V, are found at position 17. At position 18, two basic amino acids, R and H, are found. [0046] One embodiment of the invention may be a composition including BBP which increases degree or rate of calcification in vertebrate cells, or more specifically mammalian chondrogenic or osteogenic precursor cells. Further, the invention may be including BBP which increases degree or rate of osteogenesis by BMP-2, and one of BMP-2 or demineralized bone matrix. Further, the composition may additionally or alternatively include other TGF-p family members, including but not limited to BMP-4 or BMP-7 separately or mixtures thereof. [0047] In one embodiment, the invention may include a medicament for use in inducing the rate or degree of osteogenesis in a vertebrate including a therapeutically effective dosage of BBP alone or in combination with a growth factor, such as BMP or DBM. The invention may further include, a 9 WO 2008/079400 PCT/US2007/026315 medicament for use in inducing the rate or degree of calcification in a vertebrate including a peptide comprising BBP. [0048] In one embodiment, BBP or the combination of BPP and one or more other growth factors may be placed on or in a substrate or carrier, such as a collagen sponge or orthopedic implant or prosthesis, for implantation at a site where bone formation and/or implant integration is desired. [0049] Applications for BBP. A number of applications for BBP are suggested from its pharmacological (biological activity) properties. For example, BBP alone or in combination with other TGF-family members such as BMP-2, BMP-4 and BMP-7, or demineralized bone matrix may be used in clinical or research methods for inducing bone formation, maintaining bone homeostasis and/or enhancing bone repair. BBP may be used alone or in combination to treat developmental or homeostatic bone disorders (such as osteoporosis), bone injury (such as fracture healing flat (e.g., membranous) and long (e.g., endochondral) bones, non-union fractures and reconstructive surgery. The invention may also be used in treating periodontitis, periodontal regeneration, alveolar ridge augmentation for tooth implant reconstruction, treatment of non-union fractures, sites of knee/hip/joint repair or replacement surgery. [0050] By way of example, BMP has been demonstrated to be effective in providing spinal fusion, but has limitations to widespread use due to adverse side effects, such as causing inflammation and ectopic bone formation, particularly in the cervical spine. In one embodiment BBP may be used in conjunction with lower doses of BMP to preserve its efficacy, an increase its retention at the application site. As discussed herein, BBP has been demonstrated to bind BMP, including recombinant human BMP-2 enabling a two fold retention of rhBMP-2 for up to seven days in vitro and in vivo. [0051] Clinical indices of a method or compounds ability to maintain bone homeostasis is evidenced by improvements in bone density at different sites through out the body as assessed, at least by DEXA scanning. Enhanced bone formation in a healing fracture is routinely assessed by regular X-ray of the fracture site at selected time intervals. More advanced techniques for determining the above indices, such as quantitative CT scanning or 10 WO 2008/079400 PCT/US2007/026315 quantitative histological methods (e.g., tissue is processed, stained, and microscopically examined and bone defined an measured with image analysis) may be used. Further, measures of bone density, bone area, bone mineral content, formation of ectopic bone, and increases in the opacity of tissue upon X-ray examination, expression of alkaline phosphatase activity, calcium incorporation, mineralization or expression of osteocalcin mRNA may be used to observe the effects of BBP calcification and/or osteogenesis [0052] The invention may also include the use of agents which inhibit osteoclastic bone resorption. Agents which may be useful in this invention to effect osteoclastic bone resorption include, but are not limited to, bisphosphonates, the selective estrogen receptor modulators, calcitonin, and vitamin D/calcium supplementation. The invention may also include the use of agents which induce osteoblastic bone formation. Agents which may be useful in this invention include, but are not limited to PTH, sodium fluoride and growth factors, such as insulin-like growth factors I and II. [0053] The in vivo models used to show the calcification effects of BBP alone or osteogenic effects in combination with BMP have been used previously in demonstrating similar behaviors of other compounds. In particular, in vivo models have also previously been able to successfully predict the in vivo osteogenic effects of compounds such as BMP and insulin like growth factors (IGF). Specifically, it has been demonstrated that the osteogenic effects of BBP in an animal model using rat femur, ectopic bone formation model. Therefore it is anticipated that, based on these similar findings, BBP will have osteogenic effects in vivo in humans. Demonstration of osteogenic effects of a compound in these in vivo models are necessary prior to trials that would demonstrate their effects in vivo humans. [0054] Therapeutically effective dose. A therapeutically effective dose of BBP or a TGF-p family member useful in this invention is one which has a positive clinical effect on a patient or desired effect in cells as measured by the ability of the agent to enhance calcification or osteogenesis, as described above. The therapeutically effective dose of each agent can be modulated to achieve the desired clinical effect, while minimizing negative side effects. The dosage of the agent may be selected for an individual patient depending upon 11 WO 2008/079400 PCT/US2007/026315 the route of administration, severity of the disease, age and weight of the patient, other medications the patient is taking and other factors normally considered by an attending physician, when determining an individual regimen and dose level appropriate for a particular patient. [0055] This invention is advantageous and unexpected us in at least the dosage of BMP-2 required to induce a given rate or degree of osteogenesis may be reduced when BMP-2 is combined with BBP. This is advantageous at least in reducing the cost of treatment, as BMP can be costly for some applications. Further, reducing treatment levels of BMP (or other bone growth factors) by treating in combination with BMP may also reduce side effects which are related to the amount of BMP used, including for example, inflammation within the soft tissue of the neck or ectopic bone formation. Thus, the use of BBP as a bone growth factor binding agent to increase exogenous growth factor retention, can aid in overcoming negative aspects of growth factor use by reducing the amount of growth factor needed to achieve healing. [0056] Dosage Form. The therapeutically effective dose of an agent included in the dosage form may be selected by considering the type of agent selected and the route of administration. The dosage form may include a agent in combination with other inert ingredients, including adjutants and pharmaceutically acceptable carriers for the facilitation of dosage to the patient, as is known to those skilled in the pharmaceutical arts. [0057] Therapeutic formulations of BBP (when claimed is intended to include modifications or fragments thereof), may be prepared for storage by mixing the BBP having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers, in the form of lyophilized cake or aqueous solutions. Acceptable carriers, excipients or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; anti-oxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin or immunoglobulins. Other components can include glycine, blutamine, asparagine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including 12 WO 2008/079400 PCT/US2007/026315 glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as Tween, Pluronics or poly(ethylene glycol) (PEG). [0058] The dosage form may be provided in preparations for subcutaneous (such as in a slow-release capsule), intravenous, intraparitoneal, intramuscular, peri- or intraskeletal for example. Any one or a combination of agents may be included in a dosage form. Alternatively, a combination of agents may be administered to a patient in separate dosage forms. A combination of agents may be administered concurrent in time such that the patient is exposed to at least two agents for treatment. [0059] Additional Agents. The invention may include treatment with an additional agent which acts independently or synergistically with BBP to enhance calcification osteogenesis. For example, BBP may be combined with BMP, bisphosphonates, hormone therapy treatments, such as estrogen receptor modulators, calcitonin, and vitamin D/calcium supplementation, PTH (such as Forteo or teriparatide, Eli Lilly), sodium fluoride and growth factors that have a positive effect on bone, such as insulin-like growth factors I and 11 and TGF-p. Those skilled in the art would be able to determine the accepted dosages for each of the therapies using standard therapeutic dosage parameters, or reduced dosages where the effects of BBP are synergistic with the secondary agent, such as BMPs. [0060] BBP is currently thought to act upon BMP-2 at least by increasing its residency time with a substrate. One embodiment of the invention is a method of detecting the ability of BBP to enhance the residency time of a TGF-p homologous molecule including applying an amount of the TGF-p homologous molecule at a first and second selected location. Further, applying a selected amount of BBP at the first selected location, and finally detecting the amount of the TGF-p homologous molecule at the first and second location after a selected time period; and calculating the difference between the amount of the TGF-p homologous molecule at the first and second location. 13 WO 2008/079400 PCT/US2007/026315 [0061] In one embodiment, the invention may include a method of enhancing the rate or degree of osteogenesis in vertebrate tissue including application of BBP which increases degree or rate of osteogenesis by BMP-2 in mammalian cells and one of a TGF-p family member, such as BMP-2 or demineralized bone matrix. [0062] In one embodiment, the invention may include a method of inducing calcification of vertebrate tissue, or more specifically vertebrate chondrogenic or osteogenic precursor cells, including application of BBP. [0063] In one embodiment, the invention may include a method of enhancing the rate or degree of osteogenesis in vertebrate tissue including administering chondrogenic or osteogenic precursor cells to the patient at a location proximate to the desired location of osteogenesis; further, administering BBP, and administering one of a TGF-p family member, such as BMP-2 or demineralized bone matrix. [0064] In one embodiment, the invention may include a method of enhancing the rate or degree of calcification in vertebrate tissue including administering osteogenic cells to the patient at a location proximate to the desired location of calcification and further, administering BBP. [0065] In one embodiment, the invention may include method of enhancing the rate or degree of osteogenesis in a vertebrate including treating vertebrate undifferentiated mesynchymal stem cells with one of a TGF-p family member, such as BMP-2 or demineralized bone matrix to induce osteogenesis of the cells. Further, treating the vertebrate mesynchymal stem cells with BBP; and administering the vertebrate mesynchymal stem cells to the patient at a location proximate to the desired location of osteogenesis. [0066] For example, mammalian cells, such as mesenchymal stem cells can be harvested, from the patient or a cell donor. The cells may be injected in a location where bone formation or repair is desired (such as a fracture site or implant site where bone growth is needed), or first treated with BBP and/or BMP. The cells may then be re-administered to the patient, either systemically or at a selected site at which osteogenesis of calcification is desired. Additionally, the patient may by treated locally or systemically with at least one additional agent which effects osteogenesis or calcification. 14 WO 2008/079400 PCT/US2007/026315 [0067] FIG. 12A and B depict flowcharts of exemplary methods of the invention, the steps of which may be performed in any order. [0068] One embodiment of the invention may include an article of manufacture comprising BBP immobilized on a solid support. The solid support may further include a TGF-P family member, such as BMP-2 or demineralized bone matrix. [0069] One embodiment of the invention may include an implant for use in vivo including, a substrate where at least the surface of the implant includes BBP. The implant may further include MSC, chondrocytic or osteoblastic progenitor cells. Further, the implant may be formed into the shape of a pin, screw, plate, or prosthetic joint, for example. [0070] For example, FIGS. 13A & B depict two embodiments of the present invention. In FIG. 13A, the invention may include implants or grafts (200) for use in the body comprising, a substrate having a surface (201), wherein at least the surface of the implant includes BBP (203) in an amount sufficient to induce, calcification or osteogenesis in the surrounding tissue. The implant may include mesynchymal stem cell, chondrogenic or osteogenic cells expressing BBP, and/or BMP-2, demineralized bone matrix, or collagen cultures. The implant may be in the form of, but are not limited to pins, screws, plates or prosthetic joints which may be placed in the proximity of or in contact with a bone (202) that are used to immobilize a fracture, enhance bone formation, or stabilize a prosthetic implant by stimulating formation or repair of a site of bone removal, fracture or other bone injury (204). [0071] As shown in FIG. 13B, the invention may also include the in vitro (such as on cultures of collagen or chondrocytes) or in vivo application of at a least BBP containing composition or BBP expressing cells (206) in the proximity of or in contact with a bone (202), an implant (200) at a site of bone removal, fracture or other bone injury (204) where osteogenesis and/or calcification is desired. The BBP composition may be applied in combination with other agents such as BMP-2, demineralized bone matrix, or collagen cultures. [0072] For example, the use of stem cells for treating bone related disorders in humans has also been examined. Infusion of osteoblastic progenitor stem 15 WO 2008/079400 PCT/US2007/026315 cells from a healthy individual into a diseased individual has been shown to improve bone density in these patients. Cells may be pretreated with BMP and BPP, or applied concurrently therewith. [0073] In one embodiment, the invention may include a monoclonal or polyclonal antibody having selective binding to any portion of BBP, or the BBP portion of the BBP precursor, SSP-24. [0074] BBP or fragments thereof may be fused (for example by recombinant expression or in vitro covalent methods) to an immunogenic polypeptide and this, in turn, may be used to immunize an animal in order to raise antibodies against BBP. Antibodies are recoverable from the serum of immunized animals. Alternatively, monoclonal antibodies may be prepared from cells from the immunized animal in conventional fashion. Immobilized antibodies may be useful particularly in the detection or purification of BBP. [0075] Two examples of specific peptide sequences against which rabbit polyclonal antibodies have been generated include: (1) An antibody against the peptide sequence "IQETTCRRESEADPATCDFQRGYHVPVAVCRSTVRMSAEQV" (FIG. 11 SEQ. ID No. 3) that reacts with both bovine and human SSP-24, the BBP precursor. This antibody was generated in rabbits immunized with the synthetic peptide indicated above. Further, (2) An antibody directed against the sequence "CGEPLYEPSREMRRN" (FIG. 11-SEQ. ID No. 4) that was also produced in rabbits immunized with a synthetic peptide corresponding to the indicated sequence. This second antibody reacts with bovine SSP-24. The N-terminal cysteine is not a part of the native SSP-24 sequence; but is preferably included to allow the peptide to be conjugated to chromatographic resins for affinity chromatography. Additional peptide sequences may be identified for specific binding to BBP, and sequences may be selected so as to create an antibody having selective binding with BBP, but so as to not interfere with BBP binding, such as the region of BBP which binds with BMP-2 (including SEQ ID No. 3 and 4) or other TGF-P family members. These specific peptide sequences can be used to generate monoclonal antibodies, which preparation methods are known in the art. 16 WO 2008/079400 PCT/US2007/026315 [00761 Antibodies against the sequences above, corresponding sequences in the mouse, human, and rat genome, or any derivatives of the immunogenic sequences are also useful in this invention. These antibodies are useful in at least to the extent that they recognize the BBP amino acid sequence with high specificity. Such antibodies may also be useful in inhibiting protein specific interactions of BBP with other molecules where the antibody binds to a location on the peptide which interacts with other molecules. The inhibition of BBP activity in situations where the rate or degree of chondogenesis or osteogenesis may be modified. [0077] In one embodiment the invention, antibodies specific for BBP may be useful in decreasing the degree or rate of osteogenesis by BMP-2 in vertebrate cells or decreasing degree or rate of calcification in vertebrate cells, or more specifically in mammalian chondrogenic or osteoblastic precursor cells. [0078] One embodiment of the invention may also include a method of using BBP selective antibodies to detect the presence of SSP-24/BBP in sample (including but not limited to a cell culture, tissue sample, peptide fraction, Western blot) including exposing the sample to the BBP selective antibody and visualizing the complex of SSP-24/BBP and BBP antibody. [0079] In one embodiment of the invention, BBP antibodies may be used for the affinity purification of the BBP from recombinant cell culture or natural sources. BBP antibodies that do not detectably cross-react with other growth factors can be used to purify BBP from these other family members. [0080] In one embodiment, the invention may include a nucleic acid construct comprising a DNA or RNA nucleic acid sequence encoding BBP, or modified sequences corresponding to the modified amino sequences described above. [0081] The invention may also include, an expression vector operatively linked to a nucleic acid sequence encoding BBP, or precursor SSP-24 Further, a transformant may be obtained by introducing the nucleic acid construct encoding for BBP, or its precursor SSP-24 into a host cell. [0082] Practice of this invention may include the use of an oligonucleotide construct comprising a sequence coding for BBP and for a promoter 17 WO 2008/079400 PCT/US2007/026315 sequence operatively linked in a mammalian or a viral expression vector. Expression and cloning vectors contain a nucleotide sequence that enables the vector to replicate in one or more selected host cells. Generally, in cloning vectors this sequence is one that enables the vector to replicate independently of the host chromosomes, and includes origins of replication or autonomously replicating sequences. Such cloning vectors are well known to those of skill in the art. Expression vectors, unlike cloning vectors, may contain an inducible or constitutive promoter which is recognized by the host organism and is operably linked to the BBP nucleic acid. The nucleic acid may be operably linked when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a pre-sequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a pre-protein which participates in the secretion of the polypeptide. [0083] One embodiment of the invention may also include a method of using DNA or RNA nucleic acid sequences complimentary and having specific binding for the DNA or RNA sequences encoding BBP to detect the presence of BBP DNA or RNA in a sample, respectively (including but not limited to a cell culture, tissue sample, nucleic acid fraction, or Southern or Northern blot) including exposing the sample to the complimentary BBP DNA or RNA sequences and visualizing the complex of hybrids. [0084] Example 1: EXTRACTION AND SEPARATION OF NON COLLAGENOUS BONE PROTEINS (NPCs). [0085] Methods: NCPs were extracted from defatted, demineralized human cortical bone powder with 4 M GuHCI, 0.5 M CaC12, 2 mM N-ethylmalemide, 0.1 mM benzamidine HCI, and 2 mM NaN 3 for 18 hr at 60 C. Residual collagen and citrate-soluble NCPs were extracted by dialysis against 250 mM citrate, pH 3.1 for 24 hours at 60 C. The residue was pelleted by centrifugation (10,000 x g at 60 C for 30 min), defatted with 1:1 (v/v) chloroform: methanol for 24 hr at 230 C, collected by filtration and dried at 220 C. The material was resuspended in 4 M GuHCI, dialyzed against 4 M GuHCI, 0.2% (v/v) Triton X-100, 100 mM Tris-HCI, pH 7.2 for 24 hr at 6* C, then dialyzed against water, and centrifuged at 10,000 x g for 30 min at 60 C. The pellet was lyophilized and subsequently separated by hydroxyapatite chromatorgraphy. 18 WO 2008/079400 PCT/US2007/026315 [0086] Chromatography was conducted using a BioLogic chromatography workstation with a CHT-10 ceramic hydroxyapatite column (BioRad, Hercules, CA). Bovine BMP/NCP was solublized in 6 M urea, 10 mM sodium phosphate, pH 7.4. The sample was loaded onto the hydroxyapatite column and the unbound fraction was collected. Bound proteins were eluted with increasing concentration of sodium phosphate to 300 mM over a linear gradient of five column volumes. Five ml fractions were collected during the course of the run. The fraction which separated at 180 mM phosphate was separated further by SDS-PAGE electrophoresis. A band corresponding to a Mr of 18.5 was excised and submitted for sequence analysis by matrix assisted laser desorption ionization/time of flight mass spectroscopy (MALDI/TOF MS). [0087] Results: Sequence Identification and Analysis: The fraction of bBMP/NCP which eluted from hydroxyapatite at 180 mM phosphate was separated by SDS-PAGE electrophoresis and the material with a Mr Of 18.5 kD was submitted for MALDI/TOF MS analysis. The major protein component of this material was determined to be a fragment of SPP-24 on the basis of six peptides with sequences identical to regions of that protein. (Hu, et al., Isolation and molecular cloning of a novel bone phosphoprotein related in sequence to the cystatin family of thiol protease inhibitors. J. Biol. Chem. 270:431-436, 1995.) The sequences of these peptides are shown in Table 1. [0088] Table 1. Identification of the 18.5 kD protein by MALDI/TOF mass spectroscopy and peptide fingerprinting. Expected Mass a Observed Mass a Peptide Sequence SEQ ID NO: 1526.574 1526.53 ESEADPATCDFQR * 29 1411.600 1411.71 VNSQSLSPYLFR 30 1291.406 1291.41 SRGEPLYEPSR 31 1249.409 1249.48 NSYLLGLTPDR 32 1158.363 1158.27 GYHVPVAVCR * 33 * modified cystein; a = peptide masses are expressed as [M + H+] [0089] Analysis of this sequence with the SWISS-PROT data base revealed the cystatin-like domain which had been previously described, but no other sequence similarities of relevance to bone metabolism. (Hu, et al.) However, 19 WO 2008/079400 PCT/US2007/026315 it is known from other work that other cystatin-like proteins interact with proteins having a role in bone metabolism. Specially, members of the cystatin family have TGF-P and BMP-2 binding properties based on similarities to the TGF-P receptor. (Brown, et al., Friends and relations of the cystatin superfamily- new members and their evolution.: Protein Sci. 6:5-12, 1997; Demetriou, et al., Fetuin/a2-HS glycoprotein is a transforming growth factor-p type i receptor mimic and cytokine antagonist. J. Biol. Chem. 271:12755 12761, 1996.) However, fetuin antagonizes BMP activity. (Hu, et al.) Therefore, a manual comparison was made of the cystatin-like region of SPP 24 and the cystatin-like domain of fetuin. [0090] FIG. 1 B is a partial amino acid sequence of the bovine SSP-24, the BMP-2 homology region, and the TGF-P receptor 11 homology domain. Underlined amino acids have been confirmed to be present by mass spectroscopy. (GenBank Accession Number U08018; Hu, et al.) [0091] Two regions of interest were identified in the cystatin-like region of SPP-24. One region had some sequence similarity to BMP-2, whereas the other region had sequence similarity to the TGF-p receptor 11 homology domain of fetuin. That part of the sequence of SPP-24 which contains these two regions is shown in FIG 1B. [0092] Comparisons of the two regions of interest to human BMP-2 and human TGF-p receptor |1 are shown in FIGS. 2 and 3. FIG. 2 is an amino acid sequence alignment of human BMP-2 and the BMP-2 homology region in bovine SPP-24. FIG. 3 is an amino acid sequence alignment of bovine fetuin and human TGF-p receptor II (top) and of human TGF-p receptor Il and the TGF-p receptor 11 homology domain of bovine SPP-24 (corresponding to BBP)(bottom). Alignment of the SPP-24, fetuin, human BMP-2, and human TGF-p receptor |1 sequences was accomplished using the T-Coffee program. (Notredame, et al, T-Coffee: A novel method for multiple sequence alignments. J. Molecular Biol. 302:205-217, 2000.) Synthetic peptides corresponding to these two regions were obtained and subjected to chemical and in vivo analysis as described below. [0093] Example 2: IN WVO ACTIVITY OF BBP 20 WO 2008/079400 PCT/US2007/026315 [0094] Methods: The osteogenic activity of material was tested using male Swiss-Weber mice aged 8 to 10 weeks were used (Taconic Farms, Germantown, NY). Prior to the assay, the BBP was solublized and lyophilized into 2 mg of atelocollagen. The dried material was placed in a #5 gelatin capsule and sterilized by exposure to chloroform vapor. To conduct the assay, mice were anesthetized using 1% isoflurane delivered in oxygen at 2 1/min through a small animal anesthesia machine (VetEquip, Pleasanton, CA). Animals were affixed to a surgery board and the fur over the hindquarters shaved. The skin was cleaned with 70% ethanol and a midline incision made over the spine adjacent to the hindquarters. Blunt dissection with scissors was used to expose the quadriceps muscle on one side. A small pouch was made in the muscle using the point of scissors and the #5 capsule containing the test material was inserted into the pouch. The skin was then closed with three 11 mm Michel surgical clips and the animal returned to its cage for monitoring. [0095] After 21 days the animals were killed and the hindquarter removed. Radiological examination of the specimens was accomplished using a small parts X-Ray cabinet (Faxitron, Wheeling, IL). For quantization of bone formation, bone area and the bone mineral content (BMC) of an area of interest encompassing the site of ectopic bone formation was determined using a PIXImus2 small animal densitometer (GE Lunar, Madison, WI). Specimens were then placed in buffered formalin and submitted for routine processing for histological examination. [0096] Various amounts of rhBMP-2 and BBP were combined and prepared for implantation. All possible combinations of the following amounts were used in pilot studies, rhBMP-2: 0 pig, 0.05 pag, 0.5 pg, 5 gg, and 50 gg; BBP: 0 jug, 50 ptg, and pg 500 mg. Samples of 5 jig of rhBMP-2 were used in more extensive subsequent studies because that amount consistently produced an amount of ectopic bone that was neither too large nor too small for reliable analysis. [0097] Results: BBP was tested alone and in combination with rhBMP-2. 21 WO 2008/079400 PCT/US2007/026315 [0098] FIG. 4 is a radiogram of mouse hind quarters 21 days after implantation of 500 ptg of BBP in atelocollagen (top) or atelocollagen alone (bottom). When implanted alone with carrier, BBP induced calcification. [0099] FIG. 5 is a histological section of mouse muscle 21 days after implantation of 500 ptg of BBP in atelocollagen. Note the dystrophic calcification primarily associated with intramuscular adipose tissue. (H & E stain. Original magnification 100 X.) [00100] When 500 pg of BBP with sequence similarity to the TGF-p receptor Il was implanted with 5 pg of rhBMP-2 the amount of ectopic bone formed, as measured by densitometry, was consistently greater than the amount of bone formed in animals into which identical amounts of the rhBMP-2 alone were implanted. [00101] FIG. 6 are radiograms of mouse hind quarters 21 days after implantation of 5 pLg of rhBMP-2 (left) or 5 ig of rhBMP-2 plus 500 mg of BBP (right). Note the increased opacity associated with the samples containing both rhBMP-2 and BBP. [00102] Furthermore, implants that contained both the peptide and rhBMP-2 produced detectable cartilage and bone earlier than implants of BMP-2 alone. [00103] FIG. 7 are radiograms of mouse hind quarters 9 (above) and 12 (below) days after implantation of 5 jig of rhBMP-2 (left) or 5 jig of rhBMP-2 plus 500 mg of BBP (right). Note the appearance of calcification in the sample from the day 9 sample containing both rhBMP-2 and BBP but not the sample containing BMP-2 alone. [00104] FIG. 8 are histological sections of mouse hind quarters 9 days after implantation of 5 pg of rhBMP-2 alone (A) or 5 pig of rhBMP-2 plus 500 Ig of BBP (B). Note the abundant cartilage in the BMP + BBP specimen whereas the BMP alone specimen shows the earlier stages of inflammation and mesodermal cell proliferation. [00105] Table 2. Densitometric quantitation of ectopic bone formation with various amounts of BBP implanted with 5 jig of rhBMP-2. Mean, SE (n). BBP(jag) 1 0 50 500 Bone Area 0.089 ± 0.0336 0.159 ± 0.0606 0.226 ± 0.0270 22 WO 2008/079400 PCT/US2007/026315 (cm) (12)* (8) (12)* Bone 0.00189 ± 0.00084 0.00388 ± 0.0017 0.00528 ± 0.00068 Mineral (12)** (8) (12)** Content (g) * p = 0.0044; ** p = 0.0049 [00106] Example 3: SURFACE PLASMON RESONANCE TO DETERMINE THE INTERACTION OF BMP-2 AND THE SYNTHETIC PEPTIDE [00107] Methods: The binding interaction between rhBMP-2 and BBP was characterized using surface plasmon resonance employing a Biacom X instrument (Biacore, Piscataway, NJ). Buffers and chips for the procedure were obtained from Biacore. RhBMP-2 was dialyzed into 10 mM sodium acetate, pH 5.5 at a concentration of 1 mg/mL. This material was then attached to a CM-5 sensor chip using reagents and procedures supplied by the manufacturer. Running buffer was 10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% Surfactant P20. The peptide was dissolved in running buffer at concentrations ranging from 1 x 10~5 to 1 x 104 M. Flow rates from 5 to 50 1d/min and injection volumes of 20 to 100 ptl were employed. The regeneration solution was 10 pM glycine-HCI, pH 2.0. [00108] Results: Results of the surface plasmon resonance studies to determine the interaction between rhBMP-2 and BBP are shown in FIG 9. [00109] FIG. 9 is a surface plasmon resonance sensogram for the interaction of rhBMP-2 (affixed to the chip) and cyclized BBP at concentrations ranging from 1 x 10-5 M 1 x 104 M. The estimated dissociation constant (Ko) for the interaction was 3 x 10~5 M. When the BBP was decyclized by prior reduction with p-mercaptoethanol, no significant binding occurred. [00110] Example 4: RESIDENCE TIME STUDY: BBP and rhBMP-2 [00111] Methods: Labeled rhBMP-2 was mixed with BBP or vehicle and applied to collagen sponges. The sponges were implanted into muscle pouches in rodents. At specified times (1, 3 and 7 days), the implants were removed and the amount of BMP remaining determined. Four animals were used in each group. 23 WO 2008/079400 PCT/US2007/026315 [00112] Results: BBP increased retention of rhBMP-2 by a factor of about two. FIG. 10 is a bar graph depicting the percentage of rhBMP-2 retention over 1, 3 and 7 days in the presence or absence of BBP. [00113] Discussion: Increasing the retention of BMP at an implant site may improve the effectiveness of the BMP, and also reduce the amount required for the same therapeutic result. [00114] While the specification describes particular embodiments of the present invention, those of ordinary skill can devise variations of the present invention without departing from the inventive concept. [00115] Example 5: IN VIVO ACTIVITY OF human BBP [00116] Methods: The methods of Example 5 were utilized to test the activity of hBBP in eight mice in the hindquarter ectopic bone formation assay method using 5 pLg rhBMP-2 alone (control) or 5 lag rhBMP-2 plus 0.05 mg human BBP (hBBP). After 4 weeks, the animals were killed and the hindquarter removed. X-ray and DEXA analysis were conducted. [00117] Results: hBBP was tested in combination with rhBMP-2. [00118] When implanted, hBBP with BMP resulted in a greater amount of calcification induction than BMP alone. [00119] Table 3. Densitometric quantitation of ectopic bone formation with various amounts of BBP implanted with 5 ptg of rhBMP-2. Mean, SE (n). Group Mean BMC content (g) rhBMP-2 (5 jig) 0.00775 hBBP (0.05 mg) + rhBMP-2 (5 g) 0.01125 [00120] Example 6: The effect of BBP on spinal fusion as an alternative of adjunct to BMP in a relevant animal model. [00121] The rat posterior spinal fusion model was used to investigate the effect of BBP on fusion. [00122] Methods: Three groups of 6 Lewis rats each underwent posterolateral intertransverse process spinal fusion at vertebrae L4-L5 with the application of collagen sponges containing: BBP (500 gg)(Groupl); BBP (500 jg) plus low-dose rhBMP-2 (1 pag) (Group 2); collagen plus low-dose rhBMP-2 (1 pg) (Group 3). Results were compared to historical controls of decortication only (0% fusion) and high-dose rhBMP-2 (3 Ig)(100% fusion). 24 WO 2008/079400 PCT/US2007/026315 All rats underwent post-operative radiography at 2, 4, 6, and 8 weeks. Manual spinal palpation was performed at 8 weeks, the time of sacrifice. Bone formation was assessed in histological sections stained with H&E. [00123] Results: At week 8, the fusion rates were: 14% in Group 1 (BBP only); 80% in Group 2 (BBP plus low-dose BMP); and 40% in Group 3 (collagen plus low-dose BMP). This compares to 0% for historical negative controls at 100% for historical positive controls. [00124] Table 4: Results of fusion rates by treatment group Groups 1: BBP (500 pg) 2. BBP (500 gg) + 3: collagen plus low collagen plus low- dose rhBMP-2 (1 pg) dose rhBMP-2 (1 jig) Fusion 14% 80% 20% Rates [00125] Discussion: Higher fusion rates in Group 2 (BBP plus low-dose BMP) as opposed to Group 3 (collagen plus low-dose BMP) suggest that BBP has an adjunctive effect on BMP that could permit the use of lower doses of BMP to achieve spinal fusion. Further studies with larger numbers of subjects are required to confirm these promising results. [00126] Example 7: The adjunctive effect of a binding peptide on BMP in an animal spinal fusion model. [00127] To investigate the effects of BBP on spinal fusion as an alternative or an adjunct to BMP in a relevant animal model. [00128] Methods: Five groups of 50 Lewis rats each underwent posterolateral intertransverse process spinal fusion at vertebrae L4-L5 with implanted: BBP (500 jig) (Group1); BBP (1000 jig) (Group 2), collagen plus low dose BMP-2 (1 jg) (Group 3), BBP (500 jg) plus low dose BMP (1 pig) (Group 4) and BBP (1000 gg) plus low dose BMP (1 pg) (Group 5). Control groups included a negative group (decortication) and positive control group (collagen plus 3 jg BMP). [00129] All rats underwent post-operative radiography at 2, 4, 6, and 8 weeks. Manual spinal palpation was performed at 8 weeks, after the time of sacrifice. Bone formation was assessed in histological sections stained with H&E. 25 WO 2008/079400 PCT/US2007/026315 [00130] Results: At week 8, manual palpation of revealed 0% fusion with groups 1 and 2 (low d high dose BBP only), 40% fusion in group 3 and 90% fusion in groups 5 (BBP 1000 jig - low dose BMO). The difference between group 3 and 5 was close to statistical significance (p=0.056). Historical control groups as negative group (only decortation) resulted with a 0% fusion while the fusion rate with the positive control group (full dose BMP) was 100% in all our previous studies. The rate of radiographic fusion was significantly higher in group 5 than in group 3 at the 4th and 6th week (p<0.05) while it was nearly significant at the 8th week (p=0.056). Histological analysis revealed a more mature and thicker bone mass in group 4 and 5 when compared to group 3. [00131] Discussion: Higher fusion rates with BBP plus low-dose BMP than collagen plus low-dose BMP may indicate an adjunctive effect of BBP on BMP possibly enabling the use of lower doses of BMP for spinal fusion in the future. [00132] Example 8. The adjunctive effect of a binding peptide on BMP in an animal spinal fusion model. [00133] A prospective 8 week interventional trial employing a rat model of spinal fusion to test the effect on bone morphogenetic protein binding peptide (BBP) on rhBMP-2 induced bone healing. The objective of this study was to determine if the addition of BBP to the collagen sponges used as a carrier for [00134] rhBMP-2 reduces the amount of rhBMP-2 required to achieve a satisfactory clinical outcome. BBP was effective as an adjunct to increase the effect of BMP-2 and enabled decreasing the dose of the protein necessary to provide fusion. [00135] Methods: Posterolateral intertransverse process spinal fusion at L4 L5 was performed in five treatment groups of Lewis rats each, and collagen sponges (5x5x13 mm) were implanted into the surgical sites. [00136] Each sponge was placed in a sterile microfuge tube and either a suspension of BBP (500 pg or 1000 pg) in water or sterile water alone was applied. The sponges were allowed to air dry in a tissue culture hood overnight and then placed at -70* C for an hour and lyophilized overnight. The tubes (with small holes in the top to allow for lyophilization) were placed 26 WO 2008/079400 PCT/US2007/026315 in autoclave pouches and sealed. The materials were then sterilized by exposure to chloroform vapor for at least 4 hours. Immediately prior to surgery, the pouches were opened and the sponges were removed from the tubes and placed in a second tube containing the designed amount of rhBMP 2 or water. The sponges were able to completely absorb the solution. [00137] The posterolateral intertransverse process spinal fusion at L4-L5 in the rat is a well established procedure in our laboratoryl3-17. Briefly, the animal was anesthetized with isofluane and the surgical site was shaved and prepped with Betadyne and alcohol. A 3 cm longitudinal midline incision was made through the skin and subcutaneous tissue over L4-L5 down to the lumbodorsal fascia. Then, two separate 2 cm longitudinal paramedial incisions were made in the erector spinae muscles on both sides of L4-L5. The transverse processes of L4-L5 were exposed, cleaned of soft tissue, and decorticated with a high-speed burr. The site was irrigated with saline and the therapeutic test material was placed. The lumbodorsal fascia was closed with 4-0 Prolene (Ethicon, Somerville, NJ). The skin was closed with 4-0 Prolene and meticulous post-operative care was provided. [00138] Two doses of BBP (500 pg, and 1000 pg) were tested with or without "low dose" (1 pg) rhBMP-2 and the results were compared to the low dose (1 pg) rhBMP-2. These were compared to control groups. Fusion was evaluated by radiology, histology and manual palpation tests. Animals were sacrificed 8 weeks after surgery. [00139] The results of the surgeries were assessed radiologically, histologically, and by manual palpation. Posteroanterior radiographs were obtained using a small parts X-ray cabinet (Faxitron Corp., Wheeling, IL) on each animal at 2, 4, 6 and 8 weeks. Radiograms were evaluated by three independent observers employing the following standardized scale: 0: no fusion; 1: incomplete fusion with bone formation present; and 2: complete fusion. The scores from the three observes were added and a total of 5 or 6 was regarded as "fused". Manual palpation of the spine was performed at the time of sacrifice at 8 weeks. To simulate the gold standard for determining fusion in humans, exploration and manual palpation of the fusion mass were performed after death. The level fused was manually palpated with Adson 27 WO 2008/079400 PCT/US2007/026315 forceps and compared with the adjacent nonfused levels. Each specimen was graded as fused or non-fused by three independent observers. The spine was designated as "not fused" if any of the three observers graded the spine as not fused. After manual palpation, the specimens were decalcified using standard 10% decalcifying solution HCI (Cal- Ex, Fisher Scientific, Fairlawn, NJ), washed with running tap water, then transferred to 75% ethanol. Sagittal sections were cut carefully at the level of the transverse process. The specimens were imbedded in paraffin and sections of each specimen obtained. These sections were stained with hematoxylin and eosin. They were evaluated by an independent observer as fused and not fused. [00140] The proportions of subjects in each group judged to be "fused" were compared in sequential two group comparisons with Fisher's exact test using SPSS software. A p score of less than or equal to 0.05 was set for statistical significance. [00141] Results: Radiology revealed significant earlier fusion with 1OOOpg BBP + 1 pg BMP-2. combination when compared to low dose BMP-2 (1 pg) only (p<0.05). Manual palpation and histology at 8th week revealed higher rate of fusion with the same combination with a nearly significant difference (p=0.057). [00142] Table 5. Results of radiological examination Week 2nd 4th 6th 8th (%) (%) (%) (%) Group 1: low dose BBP only (500ptg) 0 0 0 0 Group 2: high dose BBP only (1000tg) 0 0 0 0 Group 3: low dose BMP-2 only (1 pg rhBMP-2) 0 20 30 40 Group 4: low dose BBP + low dose BMP-2 0 20 80 80 Group 5: high dose BBP + low dose BMP-2 40 80 90 90 Group 6: decortication only - - - 0 Group 7: high dose BMP-2 only (10 jig rhBMP- - - - 100 2) 28 WO 2008/079400 PCT/US2007/026315 [00143] Table 6. Results of manual palpation and histology at 8th week. Histology (%) Manual Palpation (%) Group 1: low dose BBP only (500 g) 0 0 Group 2: high dose BBP only (1000pg) 0 0 Group 3: low dose BMP-2 only (1 jig rhBMP-2) 40 40 Group 4: low dose BBP + low dose BMP-2 80 80 Group 5: high dose BBP + low dose BMP-2 90 90 Group 6: decortication only - Group 7: high dose BMP-2 only 100 [00144] The results of the radiological examinations are shown in Table 5 which presents the proportion of subjects in each group that had a score of 5 or 6 and was, therefore, judged to be "fused" for each of the four time points (2, 4, 6 and 8 weeks). As can be seen none of the animals in low and high dose BBP groups developed fusion at any time points. Low dose BBP + low dose BMP-2 group had a higher fusion rate than BMP-2 low dose only group at the 6th and 8th weeks and this difference was significant (p<0.
0 5) for the 6th week while not significant at the 8th week (p=O.170). On the other hand BBP high dose + BMP-2 low dose group had a significantly higher fusion rate at the 4, 6 and 8 week time points when compared to BMP-2 low dose only group (p<0.05 for each time point) (FIGS. 15 and 16). [00145] Table 6 shows the proportions of subjects in each group judged to be "fused" by three independent clinical evaluators. The critical comparison was between BMP-2 low dose group versus BBP low dose + BMP-2 low dose and BBP high dose + BMP-2 low dose groups. The fusion rate assessed by manual palpation was higher in both combination groups when compared to BMP-2 low dose group (FIGS. 15 and 16). However, this difference was not significant while it tended towards significance for the comparison of BBP high 29 WO 2008/079400 PCT/US2007/026315 dose + BMP-2 low dose group with BMP-2 low dose group (p=0.057). The thickness of the fusion mass tended to be thicker and the maturity of the bone tended to be more mature in the specimens of the fused combination groups when compared to the specimens of the fused low dose BMP-2 group (FIGS. 17 and 18). FIG. 17 is a histological section of rat spinal region 8 weeks after treatment of a combination of BBP and rhBMP-2 showing thick fusion mass between L4 and L5 transverse process with cortical-matured bone. (H & E stain. Original magnification 8.4 X). FIG. 18 is a histological section of rat spinal region 8 weeks after treatment with low dose rhBMP-2 (1 jg) showing immature bone bridging the cortical matured bridging bony parts. (H & E stain. Original magnification 8.4 X). [00146] Table 6 also shows the proportion of subjects in each group judged to be fused by an independent histologist. The results confirmed the results of both the manual palpation and radiology at the 8th week demonstrating the similar fusion rates. The thickness of the fusion mass tended to be thicker and the maturity of the bone tended to be more mature in the specimens of the fused combination groups when compared to the specimens of the fused low dose BMP-2 group (FIGS. 17 and 18). [00147] Specific growth factor binding agents, such as BBP, can be compounded into carriers used in fusion procedures to decrease the dosage of BMP and possibly decrease the side effects which are most likely dose related. This may also decrease costs and improve clinical outcomes. [00148] The radiographic results demonstrated significantly higher and earlier fusion rates with high dose BBP + low dose BMP-2 combination when compared to the same amount of the protein in its single use. The histology and the manual palpation tests confirmed this higher rate of fusion at the 8th week with a nearly significant difference. It is important to note that this model of spinal fusion is difficult to fuse and requires a material with significant osteoinductive ability to induce a solid arthrodesis. Likewise, use of either 500pg or 10OOpg BBP alone did not provide fusion in the spinal model, while there was ectopic dystrophic calcification formation with 500pg BBP implantation in the muscle pouch model. In the histological examination, we 30 have observed a more mature bone fusion mass with the combination groups when compared with the BMP-2 only group (FIGS. 17 and 18). [00149] The term "comprise" and variants of the term such as "comprises" or "comprising" are used herein to denote the inclusion of a stated integer or stated integers but not to exclude any other integer or any other integers, unless in the context or usage an exclusive interpretation of the term is required. [00150] Any reference to publications cited in this specification is not an admission that the disclosures constitute common general knowledge in Australia. 31
Claims (20)
1. An isolated peptide, wherein the peptide comprises the sequence: C-R-S-T-V-K-V-S-Xaa-Q-Q-V-Q-G-V-H-A-R-C wherein Xaa is A or V, and wherein the peptide has one or more of bone growth, bone formation or bone fusion activity when it is used in combination with a bone growth factor.
2. The peptide of claim 1, wherein Xaa is A.
3. The peptide of claim 1, wherein Xaa is V.
4. The peptide of any one of claims 1 to 3, wherein the bone growth factor is a TGF-p family member.
5. The peptide of claim 4, wherein the TGF-P family member is selected from the group consisting of: TGF-p, BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP-7, BMP-8, BMP-9, GDF5 and demineralized bone matrix.
6. The peptide of any one of claims 1 to 4, wherein the bone growth factor is BMP.
7. The peptide of any one of claims 1 to 6, wherein the peptide has bone growth activity when it is used in combination with the bone growth factor.
8. The peptide of any one of claims 1 to 6, wherein the peptide has bone formation activity when it is used in combination with the bone growth factor.
9. The peptide of any one of claims 1 to 6, wherein the peptide has bone fusion activity when it is used in combination with the bone growth factor.
10. A composition comprising the isolated peptide of any one of claims 1 to 6.
11. The composition of claim 10, further comprising at least one bone growth factor.
12. The composition of claim 11, wherein the bone growth factor is as defined in any one of claims 4 to 6. 32
13. An isolated nucleic acid encoding the peptide defined in any one of claims 1 to 9.
14. A method of inducing bone growth, the method comprising administering to a subject the peptide of claim 7 or the composition of claim 10, and at least one bone growth factor, wherein the bone growth factor is administered before, with or after the peptide or the composition.
15. A method of inducing bone formation, the method comprising administering to a subject the peptide of claim 8 or the composition of claim 10, and at least one bone growth factor, wherein the bone growth factor is administered before, with or after the peptide or the composition.
16. A method of inducing bone fusion, the method comprising administering to a subject the peptide of claim 9 or the composition of claim 10, and at least one bone growth factor, wherein the bone growth factor is administered before, with or after the peptide or the composition.
17. The method of any one of claims 14 to 16, wherein the at least one bone growth factor is as defined in any one of claims 4 to 6.
18. A method of inducing one or more of bone growth, bone formation or bone fusion, the method comprising administering to a subject the composition of claim 11 or 12.
19. Use of the peptide of any one of claims 1 to 9 in the manufacture of a medicament for inducing one or more of bone growth, bone formation or bone fusion, wherein the medicament is formulated for administration with a bone growth factor.
20. The use of claim 19, wherein the bone growth factor is as defined in any one of claims 4 to 6. Date: 20 June 2013 33
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US87682106P | 2006-12-22 | 2006-12-22 | |
US60/876,821 | 2006-12-22 | ||
US11/985,745 | 2007-11-16 | ||
US11/985,745 US8193312B2 (en) | 2004-01-28 | 2007-11-16 | Bone morphogenic protein binding peptide |
PCT/US2007/026315 WO2008079400A2 (en) | 2006-12-22 | 2007-12-26 | Surgical applications for bmp binding protein |
Publications (3)
Publication Number | Publication Date |
---|---|
AU2007338627A1 AU2007338627A1 (en) | 2008-07-03 |
AU2007338627A2 AU2007338627A2 (en) | 2010-01-28 |
AU2007338627B2 true AU2007338627B2 (en) | 2013-08-15 |
Family
ID=39563120
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2007338627A Ceased AU2007338627B2 (en) | 2006-12-22 | 2007-12-26 | Surgical applications for BMP binding protein |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP2115465A4 (en) |
JP (1) | JP5466017B2 (en) |
AU (1) | AU2007338627B2 (en) |
CA (1) | CA2673600A1 (en) |
WO (1) | WO2008079400A2 (en) |
Families Citing this family (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8193312B2 (en) * | 2004-01-28 | 2012-06-05 | The Regents Of The University Of California | Bone morphogenic protein binding peptide |
US8415302B2 (en) | 2004-01-28 | 2013-04-09 | The Regents Of The University Of California | Surgical applications for BMP binding protein |
US8188219B2 (en) | 2004-01-28 | 2012-05-29 | The Regents Of The University Of California | Bone morphogenic protein binding peptide |
CA2589930C (en) | 2004-11-29 | 2016-10-11 | The Regents Of The University Of California | Activating extraction of demineralized bone matrix |
EP2445512B1 (en) | 2009-06-23 | 2018-08-29 | The Regents of The University of California | Enhancement of bmp retention |
WO2017032858A2 (en) * | 2015-08-25 | 2017-03-02 | Histide Ag | Compounds for inducing tissue formation and uses thereof |
CN109715656A (en) * | 2015-08-25 | 2019-05-03 | 伊斯迪德股份公司 | Compounds for inducing tissue formation and uses thereof |
EP3833377B1 (en) * | 2018-08-10 | 2023-11-22 | Alexion Pharmaceuticals, Inc. | Bone healing at implants using alkaline phosphatase |
EP4291224A1 (en) | 2021-02-12 | 2023-12-20 | Alexion Pharmaceuticals, Inc. | Alkaline phosphatase polypeptides and methods of use thereof |
CA3226134A1 (en) * | 2021-07-05 | 2023-01-12 | Universiteit Maastricht | Means and methods for the treatment of calcium crystal deposition diseases |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0409472A1 (en) * | 1989-07-19 | 1991-01-23 | Chiron Corporation | Bone morphogenetic protein |
WO2005072403A2 (en) * | 2004-01-28 | 2005-08-11 | The Regents Of The University Of California | Bone morphogenic protein binding peptide |
WO2006093545A1 (en) * | 2004-11-29 | 2006-09-08 | The Regents Of The University Of California | Activating extraction of demineralized bone matrix |
-
2007
- 2007-12-26 WO PCT/US2007/026315 patent/WO2008079400A2/en active Application Filing
- 2007-12-26 JP JP2009542969A patent/JP5466017B2/en active Active
- 2007-12-26 CA CA002673600A patent/CA2673600A1/en not_active Abandoned
- 2007-12-26 AU AU2007338627A patent/AU2007338627B2/en not_active Ceased
- 2007-12-26 EP EP07868028A patent/EP2115465A4/en not_active Ceased
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0409472A1 (en) * | 1989-07-19 | 1991-01-23 | Chiron Corporation | Bone morphogenetic protein |
WO2005072403A2 (en) * | 2004-01-28 | 2005-08-11 | The Regents Of The University Of California | Bone morphogenic protein binding peptide |
WO2006093545A1 (en) * | 2004-11-29 | 2006-09-08 | The Regents Of The University Of California | Activating extraction of demineralized bone matrix |
Non-Patent Citations (2)
Title |
---|
BEHNAM, K. et al. "BMP binding peptide: a BMP-2 enhancing factor deduced from the sequence of native bovine bone morphogenetic protein/non-collagenous protein." Journal of Orthopaedic Research, 01 January 2005. vol. 23, no. 1, pages 175-180 * |
HU, B. et al. "Isolation and molecular cloning of a novel bone phosphoprotein related in sequence to the cystatin family of thiol protease inhibitors." The Journal of Biological Chemistry, 06 January 1995. vol. 270, no. 1, pages 431-436. * |
Also Published As
Publication number | Publication date |
---|---|
WO2008079400A3 (en) | 2008-08-21 |
JP5466017B2 (en) | 2014-04-09 |
WO2008079400A2 (en) | 2008-07-03 |
JP2010513535A (en) | 2010-04-30 |
AU2007338627A2 (en) | 2010-01-28 |
EP2115465A2 (en) | 2009-11-11 |
EP2115465A4 (en) | 2011-08-10 |
AU2007338627A1 (en) | 2008-07-03 |
CA2673600A1 (en) | 2008-07-03 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9610320B2 (en) | Surgical applications for BMP binding protein | |
AU2007338627B2 (en) | Surgical applications for BMP binding protein | |
US9333237B2 (en) | Bone morphogenic protein binding peptide | |
US9855368B2 (en) | Bone morphogenic protein binding peptide | |
US9694047B2 (en) | Enhancement of bone morphogenic protein (BMP) retention with BMP binding peptide (BBP) | |
AU2005328325B2 (en) | Activating extraction of demineralized bone matrix |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
DA3 | Amendments made section 104 |
Free format text: THE NATURE OF THE AMENDMENT IS AS SHOWN IN THE STATEMENT(S) FILED 14 DEC 2009 |
|
FGA | Letters patent sealed or granted (standard patent) | ||
MK14 | Patent ceased section 143(a) (annual fees not paid) or expired |