AU2004245174A1 - Extracellular Aspergillus polypeptides - Google Patents
Extracellular Aspergillus polypeptides Download PDFInfo
- Publication number
- AU2004245174A1 AU2004245174A1 AU2004245174A AU2004245174A AU2004245174A1 AU 2004245174 A1 AU2004245174 A1 AU 2004245174A1 AU 2004245174 A AU2004245174 A AU 2004245174A AU 2004245174 A AU2004245174 A AU 2004245174A AU 2004245174 A1 AU2004245174 A1 AU 2004245174A1
- Authority
- AU
- Australia
- Prior art keywords
- seq
- less
- polypeptide
- antibody
- amino
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims description 441
- 102000004196 processed proteins & peptides Human genes 0.000 title claims description 423
- 229920001184 polypeptide Polymers 0.000 title claims description 394
- 241000228212 Aspergillus Species 0.000 title claims description 44
- 239000012634 fragment Substances 0.000 claims description 278
- 238000000034 method Methods 0.000 claims description 125
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 75
- 241001225321 Aspergillus fumigatus Species 0.000 claims description 73
- 150000001875 compounds Chemical class 0.000 claims description 50
- 239000000203 mixture Substances 0.000 claims description 49
- 125000000539 amino acid group Chemical group 0.000 claims description 46
- 241000282414 Homo sapiens Species 0.000 claims description 43
- KPULXFNPTWGJQH-UHFFFAOYSA-N 3-hydroxy-4-oxo-4-propan-2-yloxybutanoic acid Chemical compound CC(C)OC(=O)C(O)CC(O)=O KPULXFNPTWGJQH-UHFFFAOYSA-N 0.000 claims description 37
- 101710088194 Dehydrogenase Proteins 0.000 claims description 37
- 229940091771 aspergillus fumigatus Drugs 0.000 claims description 36
- 238000011282 treatment Methods 0.000 claims description 34
- 239000003814 drug Substances 0.000 claims description 32
- 239000003112 inhibitor Substances 0.000 claims description 32
- 238000003556 assay Methods 0.000 claims description 28
- 102000016938 Catalase Human genes 0.000 claims description 26
- 108010053835 Catalase Proteins 0.000 claims description 26
- 230000000694 effects Effects 0.000 claims description 26
- 208000036641 Aspergillus infections Diseases 0.000 claims description 22
- 101710091977 Hydrophobin Proteins 0.000 claims description 22
- 238000002649 immunization Methods 0.000 claims description 22
- 239000008194 pharmaceutical composition Substances 0.000 claims description 22
- 102000040430 polynucleotide Human genes 0.000 claims description 21
- 108091033319 polynucleotide Proteins 0.000 claims description 21
- 239000002157 polynucleotide Substances 0.000 claims description 21
- 241001465754 Metazoa Species 0.000 claims description 20
- 201000002909 Aspergillosis Diseases 0.000 claims description 19
- 230000002538 fungal effect Effects 0.000 claims description 18
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 claims description 18
- 238000004519 manufacturing process Methods 0.000 claims description 18
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 claims description 17
- 229940121375 antifungal agent Drugs 0.000 claims description 17
- 108010022181 Phosphopyruvate Hydratase Proteins 0.000 claims description 16
- 230000012010 growth Effects 0.000 claims description 16
- 230000002829 reductive effect Effects 0.000 claims description 16
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 claims description 15
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 claims description 15
- 208000031888 Mycoses Diseases 0.000 claims description 15
- 102000012288 Phosphopyruvate Hydratase Human genes 0.000 claims description 15
- 208000015181 infectious disease Diseases 0.000 claims description 15
- 241000222122 Candida albicans Species 0.000 claims description 14
- 230000035784 germination Effects 0.000 claims description 14
- 239000000523 sample Substances 0.000 claims description 14
- 206010017533 Fungal infection Diseases 0.000 claims description 13
- 230000000843 anti-fungal effect Effects 0.000 claims description 13
- 229940095731 candida albicans Drugs 0.000 claims description 13
- 239000000463 material Substances 0.000 claims description 12
- 241001522757 Coccidioides posadasii Species 0.000 claims description 11
- 239000003937 drug carrier Substances 0.000 claims description 11
- 210000004072 lung Anatomy 0.000 claims description 11
- 241000351920 Aspergillus nidulans Species 0.000 claims description 10
- 241000228245 Aspergillus niger Species 0.000 claims description 10
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 10
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 claims description 10
- 230000002265 prevention Effects 0.000 claims description 10
- 241000123365 Cryptococcus neoformans var. neoformans Species 0.000 claims description 9
- 208000006778 allergic bronchopulmonary aspergillosis Diseases 0.000 claims description 9
- 239000000872 buffer Substances 0.000 claims description 9
- 238000001514 detection method Methods 0.000 claims description 9
- 230000035945 sensitivity Effects 0.000 claims description 8
- 241000223205 Coccidioides immitis Species 0.000 claims description 7
- 241000228404 Histoplasma capsulatum Species 0.000 claims description 7
- 241000124008 Mammalia Species 0.000 claims description 7
- 241000221961 Neurospora crassa Species 0.000 claims description 7
- 206010006474 Bronchopulmonary aspergillosis allergic Diseases 0.000 claims description 6
- 239000013604 expression vector Substances 0.000 claims description 6
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 claims description 5
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 claims description 5
- 241000222120 Candida <Saccharomycetales> Species 0.000 claims description 5
- 101710116789 Catalase B Proteins 0.000 claims description 5
- 241001337994 Cryptococcus <scale insect> Species 0.000 claims description 5
- 206010003487 Aspergilloma Diseases 0.000 claims description 4
- 241000223203 Coccidioides Species 0.000 claims description 4
- 241000223218 Fusarium Species 0.000 claims description 4
- 241000228143 Penicillium Species 0.000 claims description 4
- 241000233870 Pneumocystis Species 0.000 claims description 4
- 238000000099 in vitro assay Methods 0.000 claims description 4
- 239000003153 chemical reaction reagent Substances 0.000 claims description 2
- 238000010494 dissociation reaction Methods 0.000 claims description 2
- 230000005593 dissociations Effects 0.000 claims description 2
- 239000012472 biological sample Substances 0.000 claims 1
- 230000001737 promoting effect Effects 0.000 claims 1
- 230000009261 transgenic effect Effects 0.000 claims 1
- 108090000623 proteins and genes Proteins 0.000 description 147
- 210000004027 cell Anatomy 0.000 description 118
- 102000004169 proteins and genes Human genes 0.000 description 114
- 235000018102 proteins Nutrition 0.000 description 108
- 101000945659 Aspergillus niger 3-isopropylmalate dehydrogenase B Proteins 0.000 description 43
- 229940024606 amino acid Drugs 0.000 description 34
- 235000001014 amino acid Nutrition 0.000 description 34
- 150000001413 amino acids Chemical class 0.000 description 33
- 238000004458 analytical method Methods 0.000 description 33
- 239000000243 solution Substances 0.000 description 32
- 230000014509 gene expression Effects 0.000 description 23
- 241000233866 Fungi Species 0.000 description 18
- 210000002421 cell wall Anatomy 0.000 description 18
- 239000002953 phosphate buffered saline Substances 0.000 description 18
- 230000001225 therapeutic effect Effects 0.000 description 18
- 238000002360 preparation method Methods 0.000 description 17
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 15
- 230000006870 function Effects 0.000 description 15
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 15
- 241000283973 Oryctolagus cuniculus Species 0.000 description 14
- 239000006228 supernatant Substances 0.000 description 14
- 210000000170 cell membrane Anatomy 0.000 description 13
- 239000000499 gel Substances 0.000 description 13
- 241000894007 species Species 0.000 description 13
- 102000004190 Enzymes Human genes 0.000 description 12
- 108090000790 Enzymes Proteins 0.000 description 12
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 12
- 239000002253 acid Substances 0.000 description 12
- 239000002671 adjuvant Substances 0.000 description 12
- 229940088598 enzyme Drugs 0.000 description 12
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 12
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 12
- 238000012360 testing method Methods 0.000 description 12
- 108090000631 Trypsin Proteins 0.000 description 11
- 102000004142 Trypsin Human genes 0.000 description 11
- 238000011534 incubation Methods 0.000 description 11
- 238000001802 infusion Methods 0.000 description 11
- 230000007918 pathogenicity Effects 0.000 description 11
- 150000003839 salts Chemical class 0.000 description 11
- 239000012588 trypsin Substances 0.000 description 11
- 230000035899 viability Effects 0.000 description 11
- 230000001413 cellular effect Effects 0.000 description 10
- 239000003795 chemical substances by application Substances 0.000 description 10
- 201000010099 disease Diseases 0.000 description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 10
- 229940079593 drug Drugs 0.000 description 10
- 239000002502 liposome Substances 0.000 description 10
- 239000000047 product Substances 0.000 description 10
- 238000002255 vaccination Methods 0.000 description 10
- 230000001018 virulence Effects 0.000 description 10
- 238000005406 washing Methods 0.000 description 10
- 230000000890 antigenic effect Effects 0.000 description 9
- 238000005119 centrifugation Methods 0.000 description 9
- 238000003745 diagnosis Methods 0.000 description 9
- 230000028993 immune response Effects 0.000 description 9
- 238000004949 mass spectrometry Methods 0.000 description 9
- 238000000746 purification Methods 0.000 description 9
- 229920005989 resin Polymers 0.000 description 9
- 239000011347 resin Substances 0.000 description 9
- APKFDSVGJQXUKY-KKGHZKTASA-N Amphotericin-B Natural products O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1C=CC=CC=CC=CC=CC=CC=C[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-KKGHZKTASA-N 0.000 description 8
- 108060003951 Immunoglobulin Proteins 0.000 description 8
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 8
- 229960003942 amphotericin b Drugs 0.000 description 8
- 238000013459 approach Methods 0.000 description 8
- 102000018358 immunoglobulin Human genes 0.000 description 8
- 230000009545 invasion Effects 0.000 description 8
- 230000004807 localization Effects 0.000 description 8
- 239000012528 membrane Substances 0.000 description 8
- 230000035772 mutation Effects 0.000 description 8
- 230000003389 potentiating effect Effects 0.000 description 8
- -1 3-10 amino acids Chemical class 0.000 description 7
- 239000000427 antigen Substances 0.000 description 7
- 108091007433 antigens Proteins 0.000 description 7
- 102000036639 antigens Human genes 0.000 description 7
- 208000006673 asthma Diseases 0.000 description 7
- 230000029087 digestion Effects 0.000 description 7
- 238000002474 experimental method Methods 0.000 description 7
- 239000000284 extract Substances 0.000 description 7
- 238000002347 injection Methods 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- 239000006166 lysate Substances 0.000 description 7
- 210000000056 organ Anatomy 0.000 description 7
- 238000012216 screening Methods 0.000 description 7
- 210000002966 serum Anatomy 0.000 description 7
- 238000002560 therapeutic procedure Methods 0.000 description 7
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 6
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 6
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 6
- 101710137787 Glyceraldehyde-3-phosphate dehydrogenase A Proteins 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 6
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 6
- 229920002684 Sepharose Polymers 0.000 description 6
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 6
- 230000001580 bacterial effect Effects 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 238000011161 development Methods 0.000 description 6
- 230000018109 developmental process Effects 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 244000053095 fungal pathogen Species 0.000 description 6
- 210000004408 hybridoma Anatomy 0.000 description 6
- 201000009085 invasive aspergillosis Diseases 0.000 description 6
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 6
- 229910052759 nickel Inorganic materials 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- VHVPQPYKVGDNFY-DFMJLFEVSA-N 2-[(2r)-butan-2-yl]-4-[4-[4-[4-[[(2r,4s)-2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]piperazin-1-yl]phenyl]-1,2,4-triazol-3-one Chemical compound O=C1N([C@H](C)CC)N=CN1C1=CC=C(N2CCN(CC2)C=2C=CC(OC[C@@H]3O[C@](CN4N=CN=C4)(OC3)C=3C(=CC(Cl)=CC=3)Cl)=CC=2)C=C1 VHVPQPYKVGDNFY-DFMJLFEVSA-N 0.000 description 5
- 101001061389 Escherichia coli O157:H7 Glyceraldehyde-3-phosphate dehydrogenase C Proteins 0.000 description 5
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 5
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 5
- 102000035195 Peptidases Human genes 0.000 description 5
- 108091005804 Peptidases Proteins 0.000 description 5
- 239000004365 Protease Substances 0.000 description 5
- 108010076504 Protein Sorting Signals Proteins 0.000 description 5
- 239000004098 Tetracycline Substances 0.000 description 5
- 239000004480 active ingredient Substances 0.000 description 5
- 239000003429 antifungal agent Substances 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 238000012377 drug delivery Methods 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 210000000987 immune system Anatomy 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 230000003834 intracellular effect Effects 0.000 description 5
- 229960000310 isoleucine Drugs 0.000 description 5
- 229960004130 itraconazole Drugs 0.000 description 5
- 244000005700 microbiome Species 0.000 description 5
- 239000008188 pellet Substances 0.000 description 5
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 229960002180 tetracycline Drugs 0.000 description 5
- 229930101283 tetracycline Natural products 0.000 description 5
- 235000019364 tetracycline Nutrition 0.000 description 5
- 150000003522 tetracyclines Chemical class 0.000 description 5
- 208000030507 AIDS Diseases 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- 241001460678 Napo <wasp> Species 0.000 description 4
- 206010028980 Neoplasm Diseases 0.000 description 4
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 4
- 239000007983 Tris buffer Substances 0.000 description 4
- 150000007513 acids Chemical group 0.000 description 4
- 239000003242 anti bacterial agent Substances 0.000 description 4
- 239000003963 antioxidant agent Substances 0.000 description 4
- 235000006708 antioxidants Nutrition 0.000 description 4
- 150000003851 azoles Chemical class 0.000 description 4
- 238000010322 bone marrow transplantation Methods 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 231100000433 cytotoxic Toxicity 0.000 description 4
- 230000001472 cytotoxic effect Effects 0.000 description 4
- 235000005911 diet Nutrition 0.000 description 4
- 230000037213 diet Effects 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 230000007613 environmental effect Effects 0.000 description 4
- XRECTZIEBJDKEO-UHFFFAOYSA-N flucytosine Chemical compound NC1=NC(=O)NC=C1F XRECTZIEBJDKEO-UHFFFAOYSA-N 0.000 description 4
- 238000002523 gelfiltration Methods 0.000 description 4
- 239000008103 glucose Substances 0.000 description 4
- 210000002216 heart Anatomy 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 230000002452 interceptive effect Effects 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 210000003734 kidney Anatomy 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 238000000386 microscopy Methods 0.000 description 4
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 4
- 230000004481 post-translational protein modification Effects 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 235000019419 proteases Nutrition 0.000 description 4
- 230000001681 protective effect Effects 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 238000012163 sequencing technique Methods 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 238000010561 standard procedure Methods 0.000 description 4
- 238000010254 subcutaneous injection Methods 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 3
- 240000006439 Aspergillus oryzae Species 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 239000012981 Hank's balanced salt solution Substances 0.000 description 3
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- 241000699660 Mus musculus Species 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 3
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 3
- 238000001574 biopsy Methods 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 235000020958 biotin Nutrition 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 230000008499 blood brain barrier function Effects 0.000 description 3
- 210000001218 blood-brain barrier Anatomy 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- 230000018044 dehydration Effects 0.000 description 3
- 238000006297 dehydration reaction Methods 0.000 description 3
- 239000002552 dosage form Substances 0.000 description 3
- 101150104041 eno2 gene Proteins 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 210000001723 extracellular space Anatomy 0.000 description 3
- 229960004413 flucytosine Drugs 0.000 description 3
- 235000019253 formic acid Nutrition 0.000 description 3
- 108010037896 heparin-binding hemagglutinin Proteins 0.000 description 3
- 229940042743 immune sera Drugs 0.000 description 3
- 230000016784 immunoglobulin production Effects 0.000 description 3
- 239000007943 implant Substances 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 239000000411 inducer Substances 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 238000010253 intravenous injection Methods 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 230000002018 overexpression Effects 0.000 description 3
- 238000007911 parenteral administration Methods 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 238000011533 pre-incubation Methods 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 230000002685 pulmonary effect Effects 0.000 description 3
- 230000009257 reactivity Effects 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 239000007929 subcutaneous injection Substances 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 238000011830 transgenic mouse model Methods 0.000 description 3
- 238000002054 transplantation Methods 0.000 description 3
- 229960005486 vaccine Drugs 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 2
- 101710095463 3-isopropylmalate dehydrogenase B Proteins 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- VVJKKWFAADXIJK-UHFFFAOYSA-N Allylamine Chemical compound NCC=C VVJKKWFAADXIJK-UHFFFAOYSA-N 0.000 description 2
- 102100034613 Annexin A2 Human genes 0.000 description 2
- 108090000668 Annexin A2 Proteins 0.000 description 2
- 108020005544 Antisense RNA Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 241000316927 Aspergillus nidulans FGSC A4 Species 0.000 description 2
- 235000002247 Aspergillus oryzae Nutrition 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 101000743092 Bacillus spizizenii (strain DSM 15029 / JCM 12233 / NBRC 101239 / NRRL B-23049 / TU-B-10) tRNA3(Ser)-specific nuclease WapA Proteins 0.000 description 2
- 101000743093 Bacillus subtilis subsp. natto (strain BEST195) tRNA(Glu)-specific nuclease WapA Proteins 0.000 description 2
- 239000004322 Butylated hydroxytoluene Substances 0.000 description 2
- NLZUEZXRPGMBCV-UHFFFAOYSA-N Butylhydroxytoluene Chemical compound CC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 NLZUEZXRPGMBCV-UHFFFAOYSA-N 0.000 description 2
- 241000282461 Canis lupus Species 0.000 description 2
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 102100035660 Glyceraldehyde-3-phosphate dehydrogenase, testis-specific Human genes 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 2
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 2
- 108091006054 His-tagged proteins Proteins 0.000 description 2
- 206010020751 Hypersensitivity Diseases 0.000 description 2
- 206010061598 Immunodeficiency Diseases 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- 101710084021 Large envelope protein Proteins 0.000 description 2
- 208000019693 Lung disease Diseases 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 102000007079 Peptide Fragments Human genes 0.000 description 2
- 108010033276 Peptide Fragments Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 description 2
- 239000012979 RPMI medium Substances 0.000 description 2
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 2
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 2
- 101001025013 Trichoderma koningii Glyceraldehyde-3-phosphate dehydrogenase 2 Proteins 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 230000029936 alkylation Effects 0.000 description 2
- 238000005804 alkylation reaction Methods 0.000 description 2
- 230000000172 allergic effect Effects 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 208000010668 atopic eczema Diseases 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 238000010256 biochemical assay Methods 0.000 description 2
- 238000002306 biochemical method Methods 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 235000010354 butylated hydroxytoluene Nutrition 0.000 description 2
- 229940095259 butylated hydroxytoluene Drugs 0.000 description 2
- 229940041514 candida albicans extract Drugs 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 238000000423 cell based assay Methods 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 239000003184 complementary RNA Substances 0.000 description 2
- 230000001010 compromised effect Effects 0.000 description 2
- 238000011109 contamination Methods 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- 239000012153 distilled water Substances 0.000 description 2
- 239000000428 dust Substances 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 238000011067 equilibration Methods 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 201000001155 extrinsic allergic alveolitis Diseases 0.000 description 2
- 210000001508 eye Anatomy 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 239000005090 green fluorescent protein Substances 0.000 description 2
- 230000009036 growth inhibition Effects 0.000 description 2
- 125000001165 hydrophobic group Chemical group 0.000 description 2
- 208000022098 hypersensitivity pneumonitis Diseases 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 210000004201 immune sera Anatomy 0.000 description 2
- 238000010820 immunofluorescence microscopy Methods 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 2
- 230000002147 killing effect Effects 0.000 description 2
- 239000000787 lecithin Substances 0.000 description 2
- 235000010445 lecithin Nutrition 0.000 description 2
- 229940067606 lecithin Drugs 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 210000005265 lung cell Anatomy 0.000 description 2
- 238000000816 matrix-assisted laser desorption--ionisation Methods 0.000 description 2
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 238000001000 micrograph Methods 0.000 description 2
- 238000009448 modified atmosphere packaging Methods 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 230000003571 opsonizing effect Effects 0.000 description 2
- 230000003204 osmotic effect Effects 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 230000000242 pagocytic effect Effects 0.000 description 2
- 239000006072 paste Substances 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 229920005862 polyol Polymers 0.000 description 2
- 150000003077 polyols Chemical class 0.000 description 2
- 230000002516 postimmunization Effects 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 238000011321 prophylaxis Methods 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 239000012857 radioactive material Substances 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 229910052709 silver Inorganic materials 0.000 description 2
- 239000004332 silver Substances 0.000 description 2
- 235000017557 sodium bicarbonate Nutrition 0.000 description 2
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 2
- GEHJYWRUCIMESM-UHFFFAOYSA-L sodium sulfite Chemical compound [Na+].[Na+].[O-]S([O-])=O GEHJYWRUCIMESM-UHFFFAOYSA-L 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 230000004797 therapeutic response Effects 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- 201000008827 tuberculosis Diseases 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 230000003442 weekly effect Effects 0.000 description 2
- 239000012138 yeast extract Substances 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- QIJRTFXNRTXDIP-UHFFFAOYSA-N (1-carboxy-2-sulfanylethyl)azanium;chloride;hydrate Chemical compound O.Cl.SCC(N)C(O)=O QIJRTFXNRTXDIP-UHFFFAOYSA-N 0.000 description 1
- ABJSOROVZZKJGI-OCYUSGCXSA-N (1r,2r,4r)-2-(4-bromophenyl)-n-[(4-chlorophenyl)-(2-fluoropyridin-4-yl)methyl]-4-morpholin-4-ylcyclohexane-1-carboxamide Chemical compound C1=NC(F)=CC(C(NC(=O)[C@H]2[C@@H](C[C@@H](CC2)N2CCOCC2)C=2C=CC(Br)=CC=2)C=2C=CC(Cl)=CC=2)=C1 ABJSOROVZZKJGI-OCYUSGCXSA-N 0.000 description 1
- XMAYWYJOQHXEEK-OZXSUGGESA-N (2R,4S)-ketoconazole Chemical compound C1CN(C(=O)C)CCN1C(C=C1)=CC=C1OC[C@@H]1O[C@@](CN2C=NC=C2)(C=2C(=CC(Cl)=CC=2)Cl)OC1 XMAYWYJOQHXEEK-OZXSUGGESA-N 0.000 description 1
- OMDQUFIYNPYJFM-XKDAHURESA-N (2r,3r,4s,5r,6s)-2-(hydroxymethyl)-6-[[(2r,3s,4r,5s,6r)-4,5,6-trihydroxy-3-[(2s,3s,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]methoxy]oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O[C@H]2[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@H](O)[C@H](O)O1 OMDQUFIYNPYJFM-XKDAHURESA-N 0.000 description 1
- BEJKOYIMCGMNRB-GRHHLOCNSA-N (2s)-2-amino-3-(4-hydroxyphenyl)propanoic acid;(2s)-2-amino-3-phenylpropanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1.OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 BEJKOYIMCGMNRB-GRHHLOCNSA-N 0.000 description 1
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- GVJHHUAWPYXKBD-IEOSBIPESA-N (R)-alpha-Tocopherol Natural products OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- UFBJCMHMOXMLKC-UHFFFAOYSA-N 2,4-dinitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O UFBJCMHMOXMLKC-UHFFFAOYSA-N 0.000 description 1
- QEDXSHCYPROEOK-UHFFFAOYSA-N 3-phosphanylpropanoic acid Chemical compound OC(=O)CCP QEDXSHCYPROEOK-UHFFFAOYSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N 4-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 102100031126 6-phosphogluconolactonase Human genes 0.000 description 1
- 108010029731 6-phosphogluconolactonase Proteins 0.000 description 1
- CJIJXIFQYOPWTF-UHFFFAOYSA-N 7-hydroxycoumarin Natural products O1C(=O)C=CC2=CC(O)=CC=C21 CJIJXIFQYOPWTF-UHFFFAOYSA-N 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 241001136782 Alca Species 0.000 description 1
- 239000012103 Alexa Fluor 488 Substances 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102100034044 All-trans-retinol dehydrogenase [NAD(+)] ADH1B Human genes 0.000 description 1
- 101710193111 All-trans-retinol dehydrogenase [NAD(+)] ADH4 Proteins 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 208000035939 Alveolitis allergic Diseases 0.000 description 1
- 108020004491 Antisense DNA Proteins 0.000 description 1
- 241000219194 Arabidopsis Species 0.000 description 1
- 208000002109 Argyria Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 208000014181 Bronchial disease Diseases 0.000 description 1
- 206010006473 Bronchopulmonary aspergillosis Diseases 0.000 description 1
- 101100327917 Caenorhabditis elegans chup-1 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 108010020326 Caspofungin Proteins 0.000 description 1
- 238000008998 Catalase assay kit Methods 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 101710163595 Chaperone protein DnaK Proteins 0.000 description 1
- 108090000317 Chymotrypsin Proteins 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010078015 Complement C3b Proteins 0.000 description 1
- 108010078018 Complement C3d Proteins 0.000 description 1
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 1
- 206010010264 Condition aggravated Diseases 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 206010011409 Cross infection Diseases 0.000 description 1
- 201000003883 Cystic fibrosis Diseases 0.000 description 1
- 102100025621 Cytochrome b-245 heavy chain Human genes 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- XPDXVDYUQZHFPV-UHFFFAOYSA-N Dansyl Chloride Chemical compound C1=CC=C2C(N(C)C)=CC=CC2=C1S(Cl)(=O)=O XPDXVDYUQZHFPV-UHFFFAOYSA-N 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 235000017274 Diospyros sandwicensis Nutrition 0.000 description 1
- 101600100482 Drosophila melanogaster Enolase (isoform B) Proteins 0.000 description 1
- 101100010343 Drosophila melanogaster lobo gene Proteins 0.000 description 1
- 108010049047 Echinocandins Proteins 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 206010014561 Emphysema Diseases 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 208000002633 Febrile Neutropenia Diseases 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 108010058643 Fungal Proteins Proteins 0.000 description 1
- 229920000926 Galactomannan Polymers 0.000 description 1
- 101000766307 Gallus gallus Ovotransferrin Proteins 0.000 description 1
- 208000034826 Genetic Predisposition to Disease Diseases 0.000 description 1
- 108010018962 Glucosephosphate Dehydrogenase Proteins 0.000 description 1
- 101710162684 Glyceraldehyde-3-phosphate dehydrogenase 3 Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 101710178376 Heat shock 70 kDa protein Proteins 0.000 description 1
- 101710152018 Heat shock cognate 70 kDa protein Proteins 0.000 description 1
- 101710113864 Heat shock protein 90 Proteins 0.000 description 1
- 102100034051 Heat shock protein HSP 90-alpha Human genes 0.000 description 1
- 208000000616 Hemoptysis Diseases 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 241001502974 Human gammaherpesvirus 8 Species 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 108010076876 Keratins Proteins 0.000 description 1
- 102000011782 Keratins Human genes 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 239000011786 L-ascorbyl-6-palmitate Substances 0.000 description 1
- QAQJMLQRFWZOBN-LAUBAEHRSA-N L-ascorbyl-6-palmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](O)[C@H]1OC(=O)C(O)=C1O QAQJMLQRFWZOBN-LAUBAEHRSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 241000282838 Lama Species 0.000 description 1
- 102000007547 Laminin Human genes 0.000 description 1
- 108010085895 Laminin Proteins 0.000 description 1
- 101710133652 Lectin-like protein Proteins 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 229920000057 Mannan Polymers 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- BYBLEWFAAKGYCD-UHFFFAOYSA-N Miconazole Chemical compound ClC1=CC(Cl)=CC=C1COC(C=1C(=CC(Cl)=CC=1)Cl)CN1C=NC=C1 BYBLEWFAAKGYCD-UHFFFAOYSA-N 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- 102100037369 Nidogen-1 Human genes 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 206010029803 Nosocomial infection Diseases 0.000 description 1
- 101000783504 Orgyia pseudotsugata multicapsid polyhedrosis virus Uncharacterized 15.4 kDa protein Proteins 0.000 description 1
- 101150012394 PHO5 gene Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 206010033661 Pancytopenia Diseases 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 208000004430 Pulmonary Aspergillosis Diseases 0.000 description 1
- 208000029464 Pulmonary infiltrates Diseases 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 239000012506 Sephacryl® Substances 0.000 description 1
- 108010034546 Serratia marcescens nuclease Proteins 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 229910000831 Steel Inorganic materials 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 241000589499 Thermus thermophilus Species 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 206010044314 Tracheobronchitis Diseases 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 108010031318 Vitronectin Proteins 0.000 description 1
- 102100035140 Vitronectin Human genes 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 238000007818 agglutination assay Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 150000001342 alkaline earth metals Chemical class 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 201000009961 allergic asthma Diseases 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 208000030961 allergic reaction Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 229940087168 alpha tocopherol Drugs 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 239000003816 antisense DNA Substances 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 159000000032 aromatic acids Chemical class 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000010385 ascorbyl palmitate Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 238000013096 assay test Methods 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 238000007622 bioinformatic analysis Methods 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 210000000621 bronchi Anatomy 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- JYIKNQVWKBUSNH-WVDDFWQHSA-N caspofungin Chemical compound C1([C@H](O)[C@@H](O)[C@H]2C(=O)N[C@H](C(=O)N3CC[C@H](O)[C@H]3C(=O)N[C@H](NCCN)[C@H](O)C[C@@H](C(N[C@H](C(=O)N3C[C@H](O)C[C@H]3C(=O)N2)[C@@H](C)O)=O)NC(=O)CCCCCCCC[C@@H](C)C[C@@H](C)CC)[C@H](O)CCN)=CC=C(O)C=C1 JYIKNQVWKBUSNH-WVDDFWQHSA-N 0.000 description 1
- 229960003034 caspofungin Drugs 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000030570 cellular localization Effects 0.000 description 1
- 210000003850 cellular structure Anatomy 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 238000011976 chest X-ray Methods 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- VDANGULDQQJODZ-UHFFFAOYSA-N chloroprocaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1Cl VDANGULDQQJODZ-UHFFFAOYSA-N 0.000 description 1
- 229960002023 chloroprocaine Drugs 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- OIDPCXKPHYRNKH-UHFFFAOYSA-J chrome alum Chemical compound [K]OS(=O)(=O)O[Cr]1OS(=O)(=O)O1 OIDPCXKPHYRNKH-UHFFFAOYSA-J 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000016532 chronic granulomatous disease Diseases 0.000 description 1
- 229960002376 chymotrypsin Drugs 0.000 description 1
- 238000004140 cleaning Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 230000001332 colony forming effect Effects 0.000 description 1
- 238000011284 combination treatment Methods 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 238000002591 computed tomography Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 229960002433 cysteine Drugs 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 229960001305 cysteine hydrochloride Drugs 0.000 description 1
- 208000024389 cytopenia Diseases 0.000 description 1
- 230000003436 cytoskeletal effect Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 239000012024 dehydrating agents Substances 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 150000001991 dicarboxylic acids Chemical class 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- 229940043237 diethanolamine Drugs 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 230000002222 downregulating effect Effects 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 230000008406 drug-drug interaction Effects 0.000 description 1
- 238000013399 early diagnosis Methods 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 206010014665 endocarditis Diseases 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000007515 enzymatic degradation Effects 0.000 description 1
- 230000006862 enzymatic digestion Effects 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 229940012017 ethylenediamine Drugs 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 208000024711 extrinsic asthma Diseases 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- RFHAOTPXVQNOHP-UHFFFAOYSA-N fluconazole Chemical compound C1=NC=NN1CC(C=1C(=CC(F)=CC=1)F)(O)CN1C=NC=N1 RFHAOTPXVQNOHP-UHFFFAOYSA-N 0.000 description 1
- 229960004884 fluconazole Drugs 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 229940014144 folate Drugs 0.000 description 1
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 230000000855 fungicidal effect Effects 0.000 description 1
- 239000000417 fungicide Substances 0.000 description 1
- 230000001408 fungistatic effect Effects 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010448 genetic screening Methods 0.000 description 1
- 238000009650 gentamicin protection assay Methods 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 230000034659 glycolysis Effects 0.000 description 1
- 230000002414 glycolytic effect Effects 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical class [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 210000002288 golgi apparatus Anatomy 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 231100001261 hazardous Toxicity 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000014951 hematologic disease Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- BHEPBYXIRTUNPN-UHFFFAOYSA-N hydridophosphorus(.) (triplet) Chemical compound [PH] BHEPBYXIRTUNPN-UHFFFAOYSA-N 0.000 description 1
- 150000002433 hydrophilic molecules Chemical class 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 230000008629 immune suppression Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000000760 immunoelectrophoresis Methods 0.000 description 1
- 238000010185 immunofluorescence analysis Methods 0.000 description 1
- 239000012133 immunoprecipitate Substances 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 229940124589 immunosuppressive drug Drugs 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 229960004125 ketoconazole Drugs 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 108010052987 latency-associated nuclear antigen Proteins 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 239000003120 macrolide antibiotic agent Substances 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 238000009115 maintenance therapy Methods 0.000 description 1
- 235000009973 maize Nutrition 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 150000008146 mannosides Chemical class 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960002509 miconazole Drugs 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 238000001471 micro-filtration Methods 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 235000019837 monoammonium phosphate Nutrition 0.000 description 1
- 230000000877 morphologic effect Effects 0.000 description 1
- 230000004899 motility Effects 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- ZTLGJPIZUOVDMT-UHFFFAOYSA-N n,n-dichlorotriazin-4-amine Chemical compound ClN(Cl)C1=CC=NN=N1 ZTLGJPIZUOVDMT-UHFFFAOYSA-N 0.000 description 1
- 231100000417 nephrotoxicity Toxicity 0.000 description 1
- 238000011587 new zealand white rabbit Methods 0.000 description 1
- 108010008217 nidogen Proteins 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 210000001331 nose Anatomy 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 230000000414 obstructive effect Effects 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 244000039328 opportunistic pathogen Species 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 239000005416 organic matter Substances 0.000 description 1
- 210000003695 paranasal sinus Anatomy 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000007110 pathogen host interaction Effects 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 208000024796 pleuritic chest pain Diseases 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920000447 polyanionic polymer Polymers 0.000 description 1
- 150000004291 polyenes Chemical class 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 108010005636 polypeptide C Proteins 0.000 description 1
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 239000000473 propyl gallate Substances 0.000 description 1
- 235000010388 propyl gallate Nutrition 0.000 description 1
- 229940075579 propyl gallate Drugs 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 208000005069 pulmonary fibrosis Diseases 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 238000003156 radioimmunoprecipitation Methods 0.000 description 1
- 238000009790 rate-determining step (RDS) Methods 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 230000000754 repressing effect Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 238000010079 rubber tapping Methods 0.000 description 1
- 239000012146 running buffer Substances 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 201000009890 sinusitis Diseases 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- WBHQBSYUUJJSRZ-UHFFFAOYSA-M sodium bisulfate Chemical compound [Na+].OS([O-])(=O)=O WBHQBSYUUJJSRZ-UHFFFAOYSA-M 0.000 description 1
- 229910000342 sodium bisulfate Inorganic materials 0.000 description 1
- 229940100996 sodium bisulfate Drugs 0.000 description 1
- HRZFUMHJMZEROT-UHFFFAOYSA-L sodium disulfite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 1
- 229940001584 sodium metabisulfite Drugs 0.000 description 1
- 235000010262 sodium metabisulphite Nutrition 0.000 description 1
- 229940001482 sodium sulfite Drugs 0.000 description 1
- 235000010265 sodium sulphite Nutrition 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 229940043517 specific immunoglobulins Drugs 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 230000028070 sporulation Effects 0.000 description 1
- 239000010959 steel Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 150000003432 sterols Chemical class 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 108010033090 surfactant protein A receptor Proteins 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 230000031068 symbiosis, encompassing mutualism through parasitism Effects 0.000 description 1
- 206010052366 systemic mycosis Diseases 0.000 description 1
- DOMXUEMWDBAQBQ-WEVVVXLNSA-N terbinafine Chemical compound C1=CC=C2C(CN(C\C=C\C#CC(C)(C)C)C)=CC=CC2=C1 DOMXUEMWDBAQBQ-WEVVVXLNSA-N 0.000 description 1
- 229960002722 terbinafine Drugs 0.000 description 1
- 238000012956 testing procedure Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- AOBORMOPSGHCAX-DGHZZKTQSA-N tocofersolan Chemical compound OCCOC(=O)CCC(=O)OC1=C(C)C(C)=C2O[C@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C AOBORMOPSGHCAX-DGHZZKTQSA-N 0.000 description 1
- 229960000984 tocofersolan Drugs 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000002110 toxicologic effect Effects 0.000 description 1
- 231100000759 toxicological effect Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 150000003852 triazoles Chemical class 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 1
- HFTAFOQKODTIJY-UHFFFAOYSA-N umbelliferone Natural products Cc1cc2C=CC(=O)Oc2cc1OCC=CC(C)(C)O HFTAFOQKODTIJY-UHFFFAOYSA-N 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 229910052720 vanadium Inorganic materials 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 238000009423 ventilation Methods 0.000 description 1
- 239000011800 void material Substances 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 239000002076 α-tocopherol Substances 0.000 description 1
- 235000004835 α-tocopherol Nutrition 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0071—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/37—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi
- C07K14/38—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi from Aspergillus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/14—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from fungi, algea or lichens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0006—Oxidoreductases (1.) acting on CH-OH groups as donors (1.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0008—Oxidoreductases (1.) acting on the aldehyde or oxo group of donors (1.2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0065—Oxidoreductases (1.) acting on hydrogen peroxide as acceptor (1.11)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/88—Lyases (4.)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56961—Plant cells or fungi
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Urology & Nephrology (AREA)
- Cell Biology (AREA)
- Mycology (AREA)
- Hematology (AREA)
- Animal Behavior & Ethology (AREA)
- Food Science & Technology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Gastroenterology & Hepatology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Botany (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Tropical Medicine & Parasitology (AREA)
- Virology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- General Chemical & Material Sciences (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
Description
WO 2004/108765 PCT/DK2004/000407 Extracellular Aspergillus polypeptides This application is a non-provisional of U.S. provisional applications Serial No. 5 60/477,355, filed June 11, 2003 and Serial No. 60/482,451, filed June 26, 2003, which are hereby incorporated by reference in their entirety. All patent and non-patent references cited in this application are hereby incorporated by reference in their entirety. 10 Field of the invention The present invention relates to extracellular polypeptides of Aspergillus fumigatus, to fragments of these polypeptides, to compositions comprising such polypeptides and fragments and to exposed domains and epitopes of these polypeptides. The 15 invention also relates to the use of these polypeptides and fragments for immunisation and for production of antibodies, and to antibodies that recognise and bind the polypeptides. Furthermore, the invention relates to methods of identifying binding partners and inhibitors, and to methods of diagnosing Aspergillus infections. 20 Background of the invention The rise of diseases that attack the immune system, such as AIDS, and medical treatments that depress the immune system, such as cancer chemotherapy or organ transplantation, have resulted in an increase in the death rate caused by fungal infections. Since the mid-1980's, fungal pathogens have begun to rival their bacterial 25 counterparts in many different medical settings. Species of the Aspergillus family account for a substantial number of these fungal infections and in particular Aspergillus fumigatus has emerged world-wide as a frequent cause of nosocomial infection in virtually every major medical centre. For almost 30 years, amphotericin B was the only drug approved for treating serious fungal infections despite significant 30 kidney toxicity. Azoles were introduced in the 1980s for treating the most common fungal pathogen, Candida albicans, which is responsible for approximately 50% of fungal infections. Widespread use of azoles encouraged the development of resistant strains to this drug. Unfortunately, most currently marketed azoles are largely ineffective against the more severe forms of fungal disease, such as WO 2004/108765 PCT/DK2004/000407 2 infections caused by Aspergillus. The increase in drug-resistant strains of fungal pathogens further underscores the need for new antimicrobial treatments. Aspergillus fumigatus is a saprophytic fungus found ubiquitously in the environment, 5 particularly in soil and in water and may be readily found in very large numbers in hay, grain and decaying organic matter. Aspergillus fumigatus plays an essential role in recycling environmental carbon and nitrogen. Reservoirs in hospitals and other institutions include unfiltered air, ventilation systems, contaminated dust during construction work, carpeting, food, ornamental plants and water and water supply 10 systems. It is generally believed that aspergillosis occurs as a consequence of the exogenous acquisition of spores; they are small enough (2.5-3.0 pm) to reach the alveoli upon inhalation and hardy enough to survive for prolonged periods in fomites. It remains unclear what the size of the infectious inoculum needs to be, although this probably depends upon the immunological status of the host. There are around 600 15 recognised species, but only a small number have been identified as pathogenic. Among these A. fumigatus which causes over 80% of human infections caused by Aspergillus species. A. fumigatus is an opportunistic pathogen and normal individuals are not susceptible to disease except after inhalation of large quantities of spores. Aspergillus can cause illness in at least three ways: an allergic reaction in 20 asthmatics (allergic aspergillosis); a colonisation in scarred lung tissue (aspergilloma); and an invasive infection with pneumonia which can affect the heart, lungs, brain and kidneys (invasive aspergillosis). Allergic asperqillosis 25 In the first type of aspergillosis illness, people with allergic asthma or genetic predisposition may develop this form of asthma upon becoming sensitised to Aspergilus species. Asthmatics may find their asthmatic condition aggravated upon exposure to A. fumigatus. Some people develop allergic bronchopulmonary aspergillosis (ABPA), a condition in which Aspergillus spores germinate and the 30 resultant mycelial growth can potentially block the bronchi. Patients may cough up small, brown plugs of mycelia. There is no invasion of tissue. However, the patient may suffer lung fibrosis and may, over time, become more susceptible to other lung diseases. ABPA is currently the most severe allergic pulmonary complication caused by Aspergillus species. It occurs in patients suffering from atopic asthma or 35 cystic fibrosis. Another disease entity, related to ABPA only because it is immune- WO 2004/108765 PCT/DK2004/000407 . 3 mediated, hypersensitivity pneumonitis (also called extrinsic allergic alveolitis) is often associated with repeated exposure to an identified -- often occupational source of high levels of antigen. 5 Aspergqilloma Aspergilloma, commonly referred to as "fungus ball," occurs in pre-existing pulmonary cavities that were caused by tuberculosis, sarcoidosis, or other bullous lung disorders and in chronically obstructed paranasal sinuses. 10 Invasive aspergqillosis (IA) Invasive aspergillosis (IA) is seen in people whose normal immune systems are compromised by other serious diseases such as leukaemia, lymphoma, carcinoma, tuberculosis, emphysema, diabetes, HIV/AIDS or by use of immunosuppressive drugs (often used in connection with organ or bone marrow transplant operations); 15 or by large doses of corticosteroids. In IA, there is an actual invasion of lung tissue or skin. Infection can also occur in many organs or tissues, e.g. heart, liver, eye, nose, ear and skeletal muscle. Pathologically invasive infections show clear invasion of the underlying tissue, eventually leading to bloodstream dissemination or contiguous spread to adjacent structures. The prognosis for IA is serious illness and 20 death. A fourfold increase in IA has been observed in the last 12 years. In 1992, IA was responsible for approximately 30% of fungal infections in patients dying of cancer, and it is estimated that IA occurs in 10 to 25% of all leukaemia patients, in whom the 25 mortality rate is 80 to 90%, even when treated. The average incidence of IA is estimated to be 5 to 25% in patients with acute leukemia, 5 to 10% after allogenic bone marrow transplantation (BMT), and 0.5 to 5% after cytotoxic treatment of blood diseases or autologous BMT and solid-organ transplantation. IA which follows solid organ transplantation is most common in heart-lung transplant patients (19 to 26%) 30 and is found, in decreasing order, in liver, heart, lung, and kidney recipients (1 to 10%) (Patel and Paya, 1997, Clin. Microbiol. Rev. 10: 86-124). IA also occurs in patients with nonhematogenous underlying conditions; it is increasingly reported in AIDS patients 1 to 12%) (Denning et al., 1991, N. Engl. J. Med. 324: 654-662) and is also a common infectious complication of chronic granulomatous disease (25 to 35 40%) Four types of IA have been described (Denning, 1998, Clin, Infect. Dis. 26: WO 2004/108765 PCT/DK2004/000407 4 781-805) : (i) acute or chronic pulmonary aspergillosis, the most common form of IA; (ii) tracheobronchitis and obstructive bronchial disease with various degrees of invasion of the mucosa and cartilage as well as pseudomembrane formation, seen predominantly in AIDS patients; (iii) acute invasive rhinosinusitis; and (iv) 5 disseminated disease commonly involving the brain (10 to 40% in BMT patients) and other organs (for example, the skin, kidneys, heart, and eyes). Diagnosis of Aspergqillus infections Unlike bacterial infections, cultures from blood or cerebrospinal fluid and other 10 sterile body fluids - are rarely positive for Aspergillus species, even in patients with endocarditis and disseminated disease. Given the ubiquitous nature of the spores, recovering Aspergillus from cultures of the respiratory tract does not discriminate between genuine infection, colonization or contamination. A number of clinical findings may trigger a diagnosis of invasive aspergillosis, such as neutropenic fever 15 not responding to broad-spectrum antibiotics, the development of new pulmonary infiltrates on chest X-ray and the presence of clinical signs suggestive of invasive mycosis (e.g. pleuritic chest pain, hemoptysis, etc.). Unfortunately, most of these triggers have low predictive value. Therefore, the only way to reach a precise and early diagnosis is to make intense efforts to collect specimens for culture and 20 histopathological examination (by biopsy or needle aspiration). However, this gold standard approach involves aggressive procedures (open lung biopsy, brain biopsy, etc.) that are often precluded by cytopenia or by the critical condition of the patient. Hence, definitive diagnosis is infrequently made before fungal proliferation becomes overwhelming and therapy may no longer be successful. 25 The detection of anti-Aspergillus antibodies has no place in the diagnosis of aspergillosis in neutropenic patients and hematopoietic stem cell transplant recipients because these populations are not capable of mounting an adequate antibody response. Diagnostic tools used at the moment are galactomannan 30 detection (a major cell wall constituent released during growth), high-resolution pulmonary CT-scanning and detection of aspergillar DNA. Obtaining both high sensitivity and high selectivity remains a problem, and there is a need for novel reliable diagnostic markers. 35 WO 2004/108765 PCT/DK2004/000407 5 Currently available anti-Aspercqillus agents The antifungal armamentarium that is currently available for the treatment of invasive aspergillosis is limited in number. It includes: 1. The polyene macrolide, amphotericin-B and its lipid-based formulations; 5 2. the triazole, itraconazole; 3. the fluorinated pyrimidine, 5-fluorocytosine; and 4. the allylamine, terbinafine. The lack of a highly selective fungal target, not present in other eukaryotic cells, has for a long time precluded the development of new agents. With the exception of 5 10 fluorocytosine, all available agents act by interfering with the structural or functional integrity of the fungal plasma membrane, either by physical disruption or by blocking the biosynthesis of membrane sterols. This strategy remains far from ideal since the non-selective nature of the therapeutic target results in concomitant cross-inhibition (or toxicity) in mammalian cells. 15 Treatment with antifungal drugs such as amphotericin-B and/or itraconazole involves many difficulties. Amphotericin-B, flucytosine and itraconazole are associated with low success rates and are hampered by serious infusion- or drug related toxicity, by hazardous drug-drug interactions, by pharmacokinetic problems 20 and by the development of resistance. Amphotericin-B has to be given by vein in large doses. In some patients the treatment can damage kidney and other organs. The overall success rate of Amphotericin-B therapy for IA is 34%. In addition, most IA cases occur in spite of empirical administration of Amphotericin-B in response to a fever unresponsive to antibacterial agents. Itraconazole is generally given orally 25 (also in large doses, e.g. at least 400 mg daily) and has been used for many years as a treatment, but even so, mortality is still as high as 85%. Vaccination Vaccination may be another approach for combating Aspergillus infections. As 30 explained above, IA is a severe problem for immunocompromised patients and especially in neutropenic patients, who have lost all their acquired immune response and are virtually without memory, Aspergillus infection is lethal in most cases. It seems that vaccination of these patients prior to immune suppression would not be a viable strategy. However, vaccination of a bone marrow donor could assist in the 35 clearance of infection post donation. Also passive immunisation with WO 2004/108765 PCT/DK2004/000407 6 immunoglobulins may be an option. Until now there have been no extensive preclinical and/or clinical data available concerning the efficacy of specific immunoglobulins. However, there are reports from invasive Aspergillosis studies in mice that show that active vaccination has influence on their mortality rate (Ito and 5 Lyons (2002) J. Infect. Dis. 186, 869-871). Targets As A. fumigatus is becoming a major fungal pathogen of humans there is an urgent need for identification of suitable biochemical targets in A. fumigatus and for the 10 discovery and development of new effective antifungal agents active against such biochemical targets. Recently, the A. fumigatus genome was analysed by random shotgun DNA sequencing. By sequence comparison with Candida albicans genes known to be essential for survival, a large number of potentially essential A. fumigatus genes was identified (WO 02/086090). Such genes may potentially be 15 interesting drug targets, but information on structure, function or cellular localisation of most of the encoded gene products is not yet available. Summary of the invention In a main aspect, the present application relates to extracellular polypeptides of A. 20 fumigatus. In the context of this application, an 'extracellular polypeptide' is defined as a polypeptide which is entirely or partially (i.e. part of the polypeptide chain or part of the population of polypeptide molecules) localised outside the plasma membrane of a fungal cell. Thus, extracellular polypeptides include plasma membrane polypeptides which have extracellular parts, cell-wall polypeptides, 25 periplasmic polypeptides, secreted polypeptides and all other polypeptides that are fully or partially exposed to or released into the space outside the plasma membrane. Extracellular polypeptides furthermore include all polypeptides or polypeptide fragments that can be found in cell-wall, cell-surface-exposed and diffusate fractions isolated as described herein. 30 Extracellular polypeptides are attractive targets for antifungal therapy and/or diagnosis since the exposure of such polypeptides to the extracellular space means that compounds that interact with these peptides (e.g. compounds used to prevent, treat or diagnose fungal infections) often do not need to pass through the plasma WO 2004/108765 PCT/DK2004/000407 7 membrane to be effective. This is a considerable advantage as the plasma membrane constitutes a major barrier for most types of compounds. Extracellular localisation of a fungal protein can usually not be predicted from its 5 amino-acid sequence. The presence of a signal sequence mediating entrance of protein into the secretory pathway can be predicted with a high degree of certainty, but many proteins carrying such sequences remain intracellular, in compartments such as the endoplasmic reticulum, the Golgi complex, endosomes and lysosomes. Very little is known about sorting signals in A. fumigatus. 10 In principle, localisation of A. fumigatus proteins could be inferred from a known localisation of homologous proteins in other fungi, such as Saccharomyces cerevisiae or the pathogenic yeast Candida albicans, which are much better characterised than A. fumigatus. However, in practice, such predictions are highly 15 uncertain. A recently performed genetic screening for putative exported C. albicans proteins identified a number of such proteins whose closest homologue was an intracellular protein (Monteoliva et al. (2002) Eukaryotic Cell 1, 514-525). Thus, even with the genome sequence of A. fumigatus available, it is not easy to predict which polypeptides can be found extracellularly. 20 The inventors have isolated and analysed cell-wall-, cell-surface-exposed- and diffusate fractions of A. fumigatus and thus determined extracellular localisation of the following polypeptides: 25 1. The polypeptide set forth in SEQ ID NO:1. This polypeptide has not previously been detected in A. fumigatus, as it was only previously proposed as a putative gene product on the basis of a nucleotide sequence. It is herein proposed to name this polypeptide Cssl, for Conidial Surface and Secreted protein I. 2. Hydrophobin (SEQ ID NO:2). Previously described in Parta et al. (1994) Infect. 30 Immun. 62, 4389-4395. 3. GAPDH-B, glyceraldehyde 3-phosphate dehydrogenase (SEQ ID NO:3). A 172 amino-acid fragment of this sequence has been described in the NCBI database under accession number AAL25819 (SEQ ID NO:35). However, the full-length polypeptide has not been described previously.
WO 2004/108765 PCT/DK2004/000407 8 4. enolase (SEQ ID NO: 4). Described in the NCBI database under accession number AAK49451. 5. catalase B (SEQ ID NO:5). Described in the NCBI database under accession number AAB71223 and in Calera et al. (1997) Infect. Immun. 65, 4718-4724. 5 6. catalase A (SEQ ID NO:6). Described in the NCBI database under accession number U87630. 7. isopropylmalate dehydrogenase B (IMDH B) (SEQ ID NO: 36). This A. fumigatus polypeptide has not been described previously. 10 For several of these polypeptides, no localisation was known previously. For all polypeptides, novel polypeptide fragments that are useful in prevention, therapy or diagnosis of Aspergillus infections were identified by the inventors. Several of these fragments are relatively accessible from the extracellular space or released into it. 15 In a first main aspect, the invention relates to the polypeptide set forth in SEQ ID NO:3 and variants and fragments thereof, with the proviso that the fragment does not consist of the sequence set forth in SEQ ID NO:35. In another main aspect, the invention relates to the polypeptide set forth in SEQ ID 20 NO: 36 and variants and fragments thereof. In a further main aspect, the invention relates to polypeptide fragments which are derived from the polypeptides set forth in SEQ ID NOs: 1-6 and 36, and comprise one or more amino-acid residues from the sequences set forth in SEQ ID NOs:7-34 25 and 37. The invention also relates to variants of these polypeptide fragments. The invention also relates to exposed domains and epitopes which are comprised within or comprise part of the polypeptides or polypeptide fragments of the invention. 30 Furthermore, the invention relates to compositions comprising one or more extracellular Aspergillus polypeptides or polypeptide fragments of the invention. The techniques that were used by the inventors in the identification of polypeptides in the different cell-wall-, cell-surface-exposed and/or diffusate fractions favour 35 identification of highly expressed proteins. Thus, the polypeptides that were WO 2004/108765 PCT/DK2004/000407 9 identified are relatively abundant. This, added to the determination that they are exposed to the extracellular environment of the cell, make them highly suitable as biochemical targets or diagnostic markers. Thus, the identification of these polypeptides in these fractions by the inventors formed the basis for the 5 development of methods aimed at prevention, treatment and/or diagnosis of Aspergillus infections. Accordingly, in a main aspect, the invention relates to use of polypeptides or fragments of the invention for generating a medicament. Preferably, a medicament 10 that can be used for the immunisation or vaccination of a mammal, preferably a human being, preferably to generate a protective immune response. Furthermore, in another main aspect, the invention relates to methods of raising antibodies against these polypeptides or fragments thereof in non-human mammals. 15 The invention also, in a further main aspect, relates to antibodies capable of binding an extracellular Aspergillus fumigatus polypeptide selected from the group consisting of isopropylmalate dehydrogenase B (SEQ ID NO:36), Cssl (SEQ ID NO:1), hydrophobin (SEQ ID NO:2), GAPDH-B (SEQ ID.NO:3), and catalase A 20 (SEQ ID NO:6). Use of such antibodies for the manufacture of a medicament for treatment or prevention of infection with Aspergillus is also an aspect of the invention. Thus, the invention also relates to pharmaceutical compositions comprising antibodies of the invention and a pharmaceutically-acceptable carrier. 25 Moreover, the invention relates to methods of treating or preventing Aspergillus fumigatus infections and/or other fungal infections comprising the step of administering antibodies of the invention to an individual in need thereof. Furthermore, the invention relates to methods for screening for binding partners 30 and/or inhibitors of these extracellular polypeptides, to methods for screening for antifungal agents and to methods aimed at diagnosing Aspergillus infections.
WO 2004/108765 PCT/DK2004/000407 10 Detailed description of the invention Definitions A 'fragment' or 'polypeptide fragment' is defined as a non-full-length part of a 5 polypeptide. The length of fragments may vary from 2 amino-acid residues to the full-length polypeptide minus one amino-acid residue. Preferably, fragments are less than 100 amino acids, such as less than 50 amino acids, e.g. less than 40 amino acids, such as less than 30 amino acids, e.g. less than 25 amino acids, such as less than 20 amino acids in length. Thus, for example fragments can be 10 2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19 or 20 amino acids in length. In further embodiments, fragments comprise more than 5 amino acids, such as more than 9 amino acids, e.g. more than 10 amino acids, such as more than 15 amino acids, e.g. more than 20 amino acids, such as more than 30 amino acids. Expressed in another way, a fragment consists of a part of an amino-acid sequence which is less than 15 100% in length as compared to the full-length polypeptide. The length of the fragment can be less than 50%, such as less than 25%, such as less than 10% of the length of the full-length polypeptide. In other embodiments, the length of the fragment can be more than 5%, such as more than 10%, such as more than 25% of the length of the full-length polypeptide. 20 'Variants' of a given polypeptide or fragment are polypeptides or peptides that display a certain degree of sequence identity to said polypeptide or fragment. Variants preferably have at least 75% sequence identity, for example at least 80% sequence identity, such as at least 85% sequence identity, for example at least 90% 25 sequence identity, such as at least 91% sequence identity, such as at least 92% sequence identity, for example at least 93% sequence identity, such as at least 94% sequence identity, for example at least 95% sequence identity, such as at least 96% sequence identity, for example at least 97% sequence identity, such as at least 98% sequence identity, for example 99% sequence identity with the given polypeptide or 30 fragment. Sequence identity is determined with any of the algorithms GAP, BESTFIT, or FASTA in the Wisconsin Genetics Software Package Release 7.0, using default gap weights. Preferred variants of a given polypeptide or fragment are variants in which all amino 35 acid substitutions between the variant and the given polypeptide or fragment are WO 2004/108765 PCT/DK2004/000407 11 conservative substitutions. Conservative amino-acid substitutions refer to the interchangeability of residues having similar side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine 5 and threonine, a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur containing side chains is cysteine and methionine. Preferred conservative amino 10 acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine. Variants of a polypeptide or of a fragment thereof also include forms of the polypeptide or fragment wherein one or more amino acids have been deleted or 15 inserted. Preferably, less than 5, such as less than 4, e.g. less than 3, such as less than 2, e.g. only one amino acid has been inserted or deleted. 'Variants' of a polypeptide or of a fragment thereof also include forms of these polypeptides or fragments modified by post-translational modifications of the amino-acid sequence. Also included are fusion proteins wherein the given polypeptide or fragment thereof 20 has been fused (on the gene level or post-translationally) to another peptide or polypeptide. An 'exposed domain' is defined as a part of a polypeptide that is exposed to the external environment. Secreted or released parts of polypeptides, which are not cell 25 associated, are examples of exposed domains. Exposed domains can also be found in polypeptides that are cell-associated. This can e.g. be determined by protease treatment as described herein in the Examples. I.e. an exposed domain of a polypeptide is a part of the polypeptide which is more accessible for proteases, such as trypsin or chymotrypsin, than other parts of the same polypeptide, and can be 30 released from cellular association by protease treatment without disrupting the integrity of the cell. Surface exposure of a domain can also be determined using indirect immunofluorescence analysis, e.g. as described by Sanjuan et al. (1996) Microbiology 142, 2255-2262. Exposed domains of plasma-membrane-associated polypeptides are parts of such polypeptides that are located immediately adjacent to 35 membrane-spanning regions and are located on the extracellular side of the plasma WO 2004/108765 PCT/DK2004/000407 12 membrane. An exposed domain can be flanked on both or on only one side by a membrane-spanning region. Membrane-spanning regions can be predicted by a variety of methods, reviewed in Miller et al. (2001) Bioinformatics 17, 646-653. In a preferred embodiment, an exposed domain of a plasma-membrane-associated 5 polypeptide is a part of a polypeptide located on the extracellular side of the plasma membrane, immediately adjacent to a membrane-spanning region (transmembrane helix) as predicted by the TMHMM program 2.0 (Krogh et al. (2001) J. Mol. Biol. 305, 567-580. 10 'Epitope' in this context covers any part of a polypeptide capable of being recognised by an antibody or functional equivalent thereof. Epitopes may consist of a stretch of consecutive amino-acid residues or of non-consecutive parts of a polypeptide. Typically, an epitope consists of 2-20 amino acids, such as 3-10 amino acids, preferably 3-8 amino acids, such as 3,4,5,6,7 or 8 amino acids. 15 'Expression vector' refers to a plasmid or phage or virus, for producing a polypeptide from a polynucleotide sequence. An expression vector comprises an expression construct, comprising an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, promoters or enhancers, (2) a 20 structural or coding sequence which is transcribed into mRNA and translated into protein, and which is operably linked to the elements of (1); and (3) appropriate transcription initiation and termination sequences. 'Vaccine' is used to indicate a composition capable of inducing a protective immune 25 response against a microorganism in a human being or animal. 'Protective immune response' is used to indicate an immune response (humoral/antibody and/or cellular) inducing memory in an organism, resulting in the infectious agent, being met by a secondary rather than a primary response, thus 30 reducing its impact on the host organism. A 'binding partner' of a polypeptide refers to a molecule that can bind to said polypeptide. Such binding can be indirect, through another molecule, but is preferably direct. A binding partner can be any type of molecule, such as e.g. small 35 hydrophobic molecules or e.g. a cellular or extracellular macromolecule, such as a WO 2004/108765 PCT/DK2004/000407 13 protein, a carbohydrate or a nucleic acid. Preferred types of binding partners include antibodies, ligands or inhibitors. The term 'plurality' indicates more than one, preferably more than 10. 5 'Secreted' in the present context refers to soluble polypeptides or fragments thereof that are not cell-associated and thus in principle diffuse freely in the surrounding medium. This includes fragments of polypeptides that are released from cellular association, for instance through proteolysis. 10 The term 'indicator moiety' covers a molecule or a complex of molecules that can be detected or generates a detectable signal. Preferably, the indicator moiety is an antibody or includes an antibody molecule. Thus, a preferred indicator moiety is an antibody coupled to a detectable substance. The detectable substance can in some 15 embodiments comprise a second antibody. 'Host-derived molecule' or 'host molecule' refers to a molecule which is normally found in a host organism that can be infected with A. fumigatus. A host-derived molecule is preferably a host polypeptide, preferably a human polypeptide. 20 Examples of host-derived molecules that interact with pathogenic fungi are serum albumin and transferrin, fibrinogen, complement fragment C3d, complement fragment iC3b, laminin, fibronectin, entactin, vitronectin, mannan adhesins, epithelial binding lectin-like protein, and agglutinin-like proteins. 25 The term 'antibodies' when used herein is intended to cover antibodies as well as functional equivalents thereof. Thus, this includes polyclonal antibodies, monoclonal antibodies (mAbs) ) derived from any species including but not limited to mouse, rat, hamster, rabbit and lama, human, humanised or chimeric antibodies, single-chain antibodies, and also Fab fragments, F(ab') 2 fragments, fragments produced by a 30 Fab expression library, anti-idiotypic antibodies, hybrids comprising antibody fragments, and epitope-binding fragments of any of the these. The term also includes mixtures of monoclonal antibodies. 'Isolated' used in connection with polypeptides and polynucleotides disclosed herein 35 refers to these having been identified and separated and/or recovered from a WO 2004/108765 PCT/DK2004/000407 14 component of.its natural environment. Contaminant components of its natural environment are materials that would typically interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. 5 Polypeptides of the invention Fragments of extracellular Asperciqillus polypeptides The analysis of three different Aspergillus fractions (diffusate, cell-surface-exposed 10 and cell wall) that was performed by the inventors led to the identification of different types and numbers of fragments from the same polypeptides for each of the fractions. For example, as is described in Example 1, five Cssl peptides were identified in the cell-wall fraction while only one was identified in diffusate and cell surface-exposed fractions. This difference may indicate structural features of the 15 protein. Without being limited to a specific theory, a possible explanation for this is that a portion of Cssl can be cleaved from the cell wall, releasing one part of the protein into the surrounding milieu, while the remainder of the protein remains embedded in the cell wall. Similarly, although other explanations are possible, the fact that only one peptide is detected in cell-surface fractions may suggest that an 20 area of the protein comprising that peptide is exposed while the remainder of the protein is not. Even regions of a polypeptide which are not embedded in other cellular structures such as the cell wall, may still contain parts that are more accessible than other parts. For instance, the surface of a polypeptide may be more accessible than parts of the polypeptide which are buried within a tertiary protein 25 structure. Protease treatment may also identify such protein surface regions. Thus, the inventors have identified protein regions of particular interest. Exposed domains are, due to their accessibility, particularly attractive targets for diagnosis or for antifungal treatment. Moreover, exposed polypeptide fragments or domains are likely to contribute to, or comprise epitopes, and thus be highly suitable for antibody 30 recognition. For many of the applications described below, it can be advantageous to work with fragments that are larger than the ones that were identified by the inventors. This can in particular be the case for methods of identifying binding partners and methods for raising antibodies, such as immunisation, which sometimes do not work well with small fragments. 35 WO 2004/108765 PCT/DK2004/000407 15 In a main aspect, the invention relates to fragments of extracellular Aspergillus polypeptides that comprise exposed domains and/or epitopes. The invention also relates to the full-length GAPDH-B polypeptide (SEQ ID NO:3) and to the full-length isopropylmalate dehydrogenase B polypeptide (SEQ ID NO:36). 5 Accordingly, in a main aspect, the invention relates to an Aspergillus polypeptide selected from the group of fragments of SEQ ID NO:1 of less than 259 amino-acid residues in length, such as 10 less than 200, preferably less than 150, such as less than 100, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:7,8,17,26,28,29 and/or 30 and variants of said fragments; 15 fragments of SEQ ID NO:2 of less than 106 amino-acid residues in length, such as less than 75, preferably less than 50, such as less than 25 residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:9,10,18 and/or 19 and variants of said fragments; 20 polypeptides comprising SEQ ID NO:3, fragments thereof and variants thereof, with the proviso that if the polypeptide is a fragment of SEQ ID NO:3, that this fragment is not the fragment set forth in SEQ ID NO:35; fragments of SEQ ID NO:4 of less than 437 amino-acid residues in length, such as 25 less than 200, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:13,14,23,24 and/or 25 and variants of said fragments; 30 fragments of SEQ ID NO:5 of less than 727 amino-acid residues in length, e.g. less than 400, such as less than 200, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:15,16 and/or 27 and variants of said fragments; 35 WO 2004/108765 PCT/DK2004/000407 16 fragments of SEQ ID NO:6 of less than 748 amino-acid residues in length, e.g. less than 400, such as less than 200, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:34 and variants 5 of said fragments; and polypeptides comprising SEQ ID NO:36, fragments thereof and variants thereof. 10 In a preferred embodiment, the above fragments comprise one or more residues of the amino-acid sequences set forth in SEQ ID NOs: 7-27 and 37. In a more preferred embodiment, the fragments comprise one or more residues of the amino acid sequences set forth in SEQ ID NOs: 7-16. In another more preferred 15 embodiment, the fragments comprise one or more residues of the amino-acid sequences set forth in SEQ ID NOs: 17-25 and/or SEQ ID NO:14. In yet another more preferred embodiment, the fragments comprise one or more residues of the amino-acid sequences set forth in SEQ ID NO: 18, 19, 26, 27, and/or 37. 20 Further preferred polypeptides are fragments of SEQ ID NO:1 of less than 259 amino-acid residues in length, such as less than 200, preferably less than 150, such as less than 100, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:7,8,17,26,28,29 and/or 30, such as one or more residues of the amino 25 acid sequences set forth in SEQ ID NO:7, e.g. one or more residues of the amino acid sequence set forth in SEQ ID NO:8, such as one or more residues of the amino-acid sequences set forth in SEQ ID NO:17, e.g. one or more residues of the amino-acid sequence set forth in SEQ ID NO:26, such as one or more residues of the amino-acid sequences set forth in SEQ ID NO:28, e.g. one or more residues of 30 the amino-acid sequence set forth in SEQ ID NO:29, such as one or more residues of the amino-acid sequences set forth in SEQ ID NO:30. Further preferred polypeptides are fragments of SEQ ID NO:2 of less than 106 amino-acid residues in length, such as less than 75, preferably less than 50, such as 35 less than 25 residues in length comprising one or more residues of the amino-acid WO 2004/108765 PCT/DK2004/000407 17 sequences set forth in SEQ ID NO:9,10,18 and/or 19, such as one or more residues of the amino-acid sequences set forth in SEQ ID NO:9, e.g. one or more residues of the amino-acid sequence set forth in SEQ ID NO:10, such as one or more residues of the amino-acid sequences set forth in SEQ ID NO:18, e.g. one or more residues 5 of the amino-acid sequence set forth in SEQ ID NO:19. Preferred polypeptides include fragments of SEQ ID NO:3, with the proviso that if the polypeptide is a fragment of SEQ ID NO:3, that this fragment is not the fragment set forth in SEQ ID NO:35. Preferred are fragments of SEQ ID NO:3 of less than 10 171 amino acids in length, such as less than 150, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:11,12,20,21,22,31,32 and/or 33, such as one or more residues of the amino acid sequences set forth in SEQ ID NO:11, e.g. one or more residues of the amino 15 acid sequence set forth in SEQ ID NO:12, such as one or more residues of the amino-acid sequences set forth in SEQ ID NO:20, e.g. one or more residues of the amino-acid sequence set forth in SEQ ID NO:21, such as one or more residues of the amino-acid sequences set forth in SEQ ID NO:22, e.g. one or more residues of the amino-acid sequence set forth in SEQ ID NO:31, such as one or more residues 20 of the amino-acid sequences set forth in SEQ ID NO:32, e.g. one or more residues of the amino-acid sequence set forth in SEQ ID NO:33. Other preferred fragments of SEQ ID NO:3 are fragment between 173 residues and 317 residues in length, comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:11,12,20,21 and/or 22 or variants of said fragments. 25 Further preferred polypeptides are fragments of SEQ ID NO:4 of less than 437 amino-acid residues in length, such as less than 200, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino-acid residues, in length comprising one or more residues of the amino-acid sequences set forth in 30 SEQ ID NO:13,14,23,24 and/or 25, such as one or more residues of the amino-acid sequences set forth in SEQ ID NO:13, e.g. one or more residues of the amino-acid sequence set forth in SEQ ID NO:14, such as one or more residues of the amino acid sequences set forth in SEQ ID NO:23, e.g. one or more residues of the amino acid sequence set forth in SEQ ID NO:24, such as one or more residues of the 35 amino-acid sequences set forth in SEQ ID NO:25.
WO 2004/108765 PCT/DK2004/000407 18 Further preferred polypeptides are fragments of SEQ ID NO:5 of less than 727 amino-acid residues in length, e.g. less than 400, such as less than 200, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino 5 acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:15,16 and/or 27, such as one or more residues of the amino-acid sequences set forth in SEQ ID NO:15, e.g. one or more residues of the amino-acid sequence set forth in SEQ ID NO:16, such as one or more residues of the amino-acid sequences set forth in SEQ ID NO:27. 10 Further preferred polypeptides are fragments of SEQ ID NO:6 of less than 748 amino-acid residues in length, e.g. less than 400, such as less than 200, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino acid residues in length comprising one or more residues of the amino-acid 15 sequences set forth in SEQ ID NO:34. Preferred polypeptides include polypeptides comprising or consisting of SEQ ID NO:36. Further preferred are fragments of SEQ ID NO:36, of less than 367 amino acid residues in length, such as less than 200, preferably less than 100, such as 20 less than 75, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:37. In one embodiment, X, in SEQ ID NO:36 and SEQ ID NO: 37 is a serine. In another embodiment, X 1 in SEQ ID NO:36 and SEQ ID NO: 37 is an alanine. In a further embodiment, X 2 in SEQ ID NO:36 and SEQ ID NO: 37 is a leucine. In 25 another embodiment, X 2 in SEQ ID NO:36 and SEQ ID NO: 37 is an isoleucine. Thus, different sequence embodiments for SEQ ID NO: 37 and the equivalent part of SEQ ID NO:36 include LAAELALR, LSAELALR, LAAEIALR, LSAEIALR. Preferably, the above defined polypeptide fragments of SEQ ID NOs:1-6 and 36 30 comprise more than one residue of the specified amino-acid sequence, such as 2,3,4,5,6,7,8 or 9 residues of the specified amino-acid sequence. A non-limiting example of such a preferred fragment is a fragment of SEQ ID NO:1 comprising 9 residues of the amino-acid sequence set forth in SEQ ID NO:7. Most preferably, the above polypeptide fragments comprise all residues of the specified amino-acid 35 sequence. A non-limiting example of a most preferred fragment is a fragment of WO 2004/108765 PCT/DK2004/000407 19 SEQ ID NO:1 comprising all 16 residues of the amino-acid sequence set forth in SEQ ID NO:7. In one embodiment, the polypeptide of the invention, preferably consists of an 5 exposed domain, such as domains comprising an amino-acid sequence selected from the group of SEQ ID NOs: 7-34 and 37, preferably the group of SEQ ID NOs: 7-27 and 37, more preferably the group of SEQ ID NOs:17-27, SEQ ID NO:14 and SEQ ID NO:37, or variants thereof. An exposed domain may be determined as described above in the definition section. 10 Further preferred polypeptides consist of an epitope of a polypeptide selected from the group of SEQ ID NO:1-6 and 36, comprising at least one amino acid from a peptide selected from the group of SEQ ID NO: 7-27 and 37, and fragments or variants of said epitope. In one preferred embodiment, the amino acid residues of 15 the epitope are consecutive residues from the polypeptide. In another preferred embodiment, the amino acid residues of the epitope are non-consecutive residues from the polypeptide. Further preferred embodiments include more than 1, such as more than 2, preferably more than 3, such as more than 4 consecutive or non consecutive amino acids of the sequences of SEQ ID NO: 7-27 and 37. The 20 invention also relates to use of such epitopes in any of the methods or preferred methods of the invention. Fragments that consist or essentially consist of an amino-acid sequence selected from the group of SEQ ID NO: 7-34 and 37. 25 Preferred polypeptides of the invention are fragments of one of the polypeptides set forth in SEQ ID NO:1-6 and 36 that essentially consist of one of the fragments set forth in SEQ ID NO:7-34 and 37. 'Essentially consists of' is meant to indicate that the fragment comprises a substantial part of an amino-acid sequence selected from the group of SEQ ID NO:7-34 and 37 and in addition to that contains 10 or fewer 30 flanking residues from the polypeptide on either or both (N-terminal and/or C terminal) sides of the smaller fragment. A 'substantial part' herein means at least 2, such as at least 5 amino acids of any of the amino acid sequence set forth in SEQ ID NO:7-34 and 37. Such a fragment thus overlaps with the corresponding fragment selected from the group of SEQ ID NO:7-34 and 37. Preferably, the fragment that 35 essentially consists of any of the amino-acid sequences set forth in SEQ ID NO:7-34 WO 2004/108765 PCT/DK2004/000407 20 and 37 comprises the entire amino-acid sequence of that sequence. Thus, a preferred fragment of the invention is a fragment of one of the polypeptides set forth in SEQ ID NO:1-6 and 36 that comprises and essentially consists of one of the fragments set forth in SEQ ID NO:7-34 and 37. Such a fragment is thus larger than 5 the corresponding fragment selected from the group of SEQ ID NO:7-34 and 37. 'Comprises and essentially consists of' is meant to indicate that the larger fragment comprises a smaller peptide selected from the group of SEQ ID NO:7-34 and 37 and in addition to that contains 10 or fewer flanking residues from the polypeptide on either or both (N-terminal and/or C-terminal) sides of the smaller fragment. 10 Preferably, the larger fragment contains fewer than 8, such as fewer than 6, e.g. fewer than 4, e.g. fewer than 3, such as 2 or only 1 residue on one or both sides of the smaller fragment. Most preferred polypeptides of the invention are fragments selected from the group 15 of SEQ ID NO: 7-34 and 37. Thus, such most preferred polypeptides include any of the fragments from the group of fragments set forth in SEQ ID NO:7-34 and 37, such as the fragment set forth in SEQ ID NO:7, or the fragment set forth in SEQ ID NO:8, or the fragment set forth in SEQ ID NO:9, or the fragment set forth in SEQ ID NO:10, or the fragment set forth in SEQ ID NO:11, or the fragment set forth in SEQ 20 ID NO:12, or the fragment set forth in SEQ ID NO:13, or the fragment set forth in SEQ ID NO:14, or the fragment set forth in SEQ ID NO:15, or the fragment set forth in SEQ ID NO:16, or the fragment set forth in SEQ ID NO:17, or the fragment set forth in SEQ ID NO:18, or the fragment set forth in SEQ ID NO:19, or the fragment set forth in SEQ ID NO:20, or the fragment set forth in SEQ ID NO:21, or the 25 fragment set forth in SEQ ID NO:22, or the fragment set forth in SEQ ID NO:23, or the fragment set forth in SEQ ID NO:24, or the fragment set forth in SEQ ID NO:25, or the fragment set forth in SEQ ID NO:26, or the fragment set forth in SEQ ID NO:27, or the fragment set forth in SEQ ID NO:28, or the fragment set forth in SEQ ID NO:29, or the fragment set forth in SEQ ID NO:30, or the fragment set forth in 30 SEQ ID NO: 31, or the fragment set forth in SEQ ID NO:32, or the fragment set forth in SEQ ID NO:33, or the fragment set forth in SEQ ID NO:34, or the fragment set forth in SEQ ID NO:37. The invention also relates to a variant of any of the above fragments or any other fragment described herein. Preferably, the fragment is selected from the group of fragments set forth in SEQ ID 35 NO:7-16 and 37, such as the fragment set forth in SEQ ID NO:7, or the fragment set forth in SEQ ID NO:8, or the fragment set forth in SEQ ID NO:9, or the fragment set WO 2004/108765 PCT/DK2004/000407 21 forth in SEQ ID NO:10, or the fragment set forth in SEQ ID NO: 1, or the fragment set forth in SEQ ID NO:12, or the fragment set forth in SEQ ID NO:13, or the fragment set forth in SEQ ID NO:14, or the fragment set forth in SEQ ID NO:15, or the fragment set forth in SEQ ID NO:16, or the fragment set forth in SEQ ID NO:37, 5 or a variant of any of these fragments. Compositions of the invention Compositions of the invention comprising one or more of polypeptides of the invention can be used in various methods and for various applications as described 10 below. Having more than one polypeptide of the invention in such a composition can have important advantages. For instance, immunisation or vaccination may be more effective when several polypeptides or fragments are introduced at the same time. Thus, in a main aspect the invention relates to a composition comprising one or more extracellular Aspergillus polypeptides or polypeptide fragments of the 15 invention. Preferred compositions of the invention are ones that comprise one or more preferred polypeptides of the invention, i.e. the polypeptides described above. Thus, any preferred polypeptide of the invention can be used to generate a preferred composition of the invention. A preferred composition of the invention is a pharmaceutical composition comprising one or more polypeptide(s) and/or one or 20 more polypeptide fragments of the invention and a pharmaceutically-acceptable carrier. Cssl, isopropylmalate dehydrogenase B and GAPDH-B 25 Three extracellular polypeptides that were identified by the inventors are of particular interest, namely Cssl, isopropylmalate dehydrogenase B, and GAPDH-B. CsslI This document presents data indicating the first identifications of Cssl, a novel cell 30 surface-exposed/secreted protein. This protein had previously been hypothesised based on the output of a gene prediction programme. However, the inventors' studies have confirmed the existence of this protein and have revealed it to be a conidial cell-wall-associated protein that is exposed on the surface while also being secreted/released into the surrounding milieu. The function of this protein is yet to 35 be determined. However, its location within the diffusate is interesting in light of the documented abilities of diffusate to suppress the immune responses (Hobson RP WO 2004/108765 PCT/DK2004/000407 22 (2000) Med. Mycol. 38, 133-141). Attempts to identify the protein(s) responsible for this suppressing activity have to date been unsuccessful. Without being limited to any specific theory, it is possible that Cssl is responsible for these functions, but that they have not been attributed to it due to the basic difficulties in performing 5 molecular biology studies in Aspergillus fumigatus. It is interesting to note that the protein displays homology to LANA, a transcriptional regulator of Herpes virus (see below under Examples). Again without limitation to a specific theory, the possibility exists that Cssl possesses a similar function. If so, one could envisage it functioning as an extracellular sensor that transmits signals into the interior of the fungus. 10 Alternatively, this protein may become active upon uptake into the host cell, where it utilises its transcriptional activities to interfere with host processes, to the benefit of the fungus. Other possible functions of this protein may include roles in adhesion, invasion, conidial cell-wall processing or enzymatic digestion of host proteins. 15 Isopropylmalate dehydrogenase B Isopropylmalate dehydrogenase B (IMDH B) is an enzyme involved in the biosynthesis of leucine. It has previously been found intracellularly in other microorganisms. The inventors have now identified this protein in cell surface 20 fractions of A. fumigatus. The primary sequence of the enzyme does not reveal a traditional signal sequence and thus the question arises as to how the enzyme is transported to the cell surface. Without being limited to a particular theory, it is possible that the protein interacts with a heat shock protein and that the heat shock protein mediates translocation of IMDH B across the membrane. Similar 25 mechanisms have been described for other proteins in Young et al. (2003) Cell 112:41-50. GAPDH-B The inventors have been the first to identify GAPDH-B, the polypeptide of SEQ ID 30 NO:3. In one aspect, the invention relates to the sequence set forth in SEQ ID NO:3, and variants thereof. Furthermore, the invention relates to use of the polypeptide set forth in SEQ ID NO:3 in any of the methods or preferred methods of the invention. GAPDHs are documented to function in glycolysis. Without being limited to a 35 particular theory, the cell-surface localisation of GAPDH-B might suggest a role for WO 2004/108765 PCT/DK2004/000407 23 this protein in the initiation of germination. It would seem logical to assume that dormant conidia are more prone to germination when environmental conditions become more favourable for growth and propagation of the species. One requirement for growth is a carbon source, e.g. glucose. However, the dormant 5 conidia must have some way of detecting external environmental conditions while in its state of low metabolic activity. It is possible that the presence of glycolytic enzymes on the cell surface could result in the production of glucose by-products that may communicate to the cell that the external environment is of sufficient status to support propagation of the species. The protein may alternatively or additionally 10 function in other processes such as adhesion, invasion, intracellular motility or intracellular survival. It is interesting to note that GAPDH proteins possess the capability to bind to cytoskeletal components (see e.g. Tisdale (2002) J. Biol. Chem. 277, 3334-3341). This feature may provide conidia with a mechanism by which it can traverse host cells in order to reach the basal membranes and cause invasive 15 disease. Production of polypeptide and fragments The polypeptides and fragments of the invention can be produced synthetically by conventional techniques known in the art. Alternatively, they can be produced 20 recombinantly in heterologous host cells. Thus, the invention also encompasses polynucleotide sequences encoding polypeptides and fragments of the invention, expression vectors comprising such polynucleotides, and host cells transformed or transfected with such polynucleotides or expression vectors. Non-exclusive examples of polynucleotides of the invention are the polynucleotides of SEQ ID 25 NO:38 and SEQ ID NO:39. Suitable host cells can be mammalian cells, e.g. CHO, COS or HEK293 cells. Alternatively, insect cells, bacterial cells or fungal cells can be used. In preferred embodiments, yeast cells or cells from other Aspergillus species than A. fumigatus are used. Methods for heterologous expression of polynucleotide sequences in the cell types listed above and subsequent purification 30 of the produced polypeptides are well-known to those skilled in the art. Preferably, polypeptides, fragments and polynucleotides of the invention are isolated.
WO 2004/108765 PCT/DK2004/000407 24 Vaccination Exposure of a fungal polypeptide or a fragment thereof to the extracellular space often allows it to be detected by the immune system of a host organism. If such a polypeptide furthermore has a relatively high copy number, such as is the case for 5 the extracellular polypeptides of this invention, such a polypeptide or a fragment thereof becomes particularly suitable as a target for antibodies. In an important aspect, the invention relates to use of any one or more of the polypeptides, polynucleotides or compositions as defined herein for the manufacture 10 of a medicament, preferably a vaccine. Such a medicament can preferably be used for prevention (i.e. prophylactic treatment) of Aspergillus infections in a mammal. In such use the polypeptide, polynucleotide or composition is used for active immunisation or vaccination. Accordingly, the invention also relates to a medicament for treating Aspergillus infections comprising a polypeptide, polynucleotide or 15 composition of the invention as an active ingredient. Thus, the invention relates to a vaccine comprising a pharmaceutically-acceptable carrier and - a polypeptide comprising a sequence selected from the group of extracellular 20 Aspergillus fumigatus sequences of SEQ ID NO:1-6, or an antigenic fragment of any of said sequences, or - a polynucleotide comprising a sequence encoding said polypeptide or fragment. 25 Furthermore, the invention relates to a method of treatment comprising the step of administering to an individual a pharmaceutically effective amount of any of the polypeptides, polynucleotides or compositions of the invention. Preferably, the treatment generates a protective immune response. Preferably, the medicament is used for the treatment or prophylactic treatment of a human being. Preferred 30 embodiments include the use of any of the polypeptides set forth in SEQ ID NO:1,2,3 or 36 or fragments of these polypeptides for said manufacture of said medicament or said method of treatment, preferably any of the preferred polypeptide fragments defined herein.
WO 2004/108765 PCT/DK2004/000407 25 In preferred embodiments of this method, said polypeptide is selected from the group of SEQ ID NOs:1, 2, 3, 5, 6, and 36. In a more preferred embodiment, the polypeptide that is provided is Cssi (SEQ ID NO:1) or a fragment thereof, preferably a fragment comprising one or more residues of the amino-acid sequences set forth 5 in SEQ ID NO:7,8,17,26,28,29 and/or 30, or a variant of said polypeptide. In another more preferred embodiment, the polypeptide that is provided is hydrophobin (SEQ ID NO:2) or a fragment thereof, preferably a fragment comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:9,10,18 and/or 19, or a variant of said polypeptide. In a further more preferred embodiment GAPDH-B 10 (SEQ ID NO:3) or a fragment thereof, preferably a fragment comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:11,12,20,21,22,31,32 and/or 33, or a variant of GAPDH-3 or the fragment is provided. In a still further more preferred embodiment, the polypeptide that is provided is catalase A (SEQ ID NO:6) or a fragment thereof, preferably a fragment comprising one or more residues 15 of the amino-acid sequence set forth in SEQ ID NO:34, or a variant of said polypeptide. In a further more preferred embodiment, the polypeptide that is provided is isopropylmalate dehydrogenase B (SEQ ID NO:36) or a variant or fragment thereof, preferably a fragment comprising one or more residues of the amino-acid sequence set forth in SEQ ID NO:37. 20 In other preferred embodiments, a fragment selected from the group of SEQ NO:7 34 and 37 is provided, preferably a fragment selected from the group of SEQ ID NO:7-16, such as the fragment set forth in SEQ ID NO:7, or the fragment set forth in SEQ ID NO:8, or the fragment set forth in SEQ ID NO:9, or the fragment set forth in 25 SEQ ID NO:10, or the fragment set forth in SEQ ID NO:11, or the fragment set forth in SEQ ID NO:12, or the fragment set forth in SEQ ID NO:13, or the fragment set forth in SEQ ID NO:14, or the fragment set forth in SEQ ID NO:15, or the fragment set forth in SEQ ID NO:16. 30 Active immunisation or vaccination may be done in different ways, such as raising anti-protein antibodies indirectly using DNA immunisation techniques or directly using the polypeptide or a fragment thereof. The polypeptide may be administrated to said mammal more than once, such as twice, for example 3 times, such as 3 to 5 times, for example 5 to 10 times, such as 10 to 20 times, for example 20 to 50 times, 35 such as more than 50 times. It is also possible that different polypeptides or WO 2004/108765 PCT/DK2004/000407 26 fragments are administered to the same mammal, either simultaneously of sequentially in any order. Administration may be done by any suitable method, for example parenterally, orally or topically. Preferably, however it is administered by injection, for example intramuscular, intradermal, intravenous or subcutaneous 5 injection, more preferably by subcutaneous or intravenous injection. Methods for determining suitable protocols for active immunisation, such as determining dosage, use of adjuvants and/or pharmaceutically acceptable carriers are known to those skilled in the art. Various adjuvants can be used to increase the 10 immunological response, depending on the host species, including, but not limited to, Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and 15 Corynebacterium parvum. Antibodies In another main aspect, the invention relates to isolated antibodies capable of binding an extracellular Aspergillus fumigatus polypeptide selected from the group 20 consisting of isopropylmalate dehydrogenase B (SEQ ID NO:36), Cssl (SEQ ID NO:1), hydrophobin (SEQ ID NO:2), GAPDH-B (SEQ ID NO:3), and catalase A (SEQ ID NO:6). In preferred embodiments, the antibody is capable of binding a polypeptide selected 25 from the group consisting of isopropylmalate dehydrogenase B (SEQ ID NO:36), Cssl (SEQ ID NO:1) and catalase A (SEQ ID NO:6). More preferably, the antibody is capable of binding a polypeptide selected from the group consisting of isopropylmalate dehydrogenase B (SEQ ID NO:36) and Cssl (SEQ ID NO:1). Most preferably, the antibody is capable of binding isopropylmalate dehydrogenase B 30 (SEQ ID NO:36). Preferred affinities of the binding of the antibody to the target polypeptide include those with a dissociation constant or Kd of less than 5 X 104M, such as less than 104M, e.g. less than 5 X 10-5M, such as less than 10 5 M, e.g. less than 5 X 10-6M, 35 such as less than 10- 6 M, e.g. less than 5 X 10- 7 M, such as less than 10- 7 M, e.g. less WO 2004/108765 PCT/DK2004/000407 27 than 5 X 10-8M, such as less than 10 8 M, e.g. less than 5 X 10-'M, such as less than 10- 9 M, e.g. less than 5 X 10-1 0 M, such as less than 10-1 0 M, e.g. less than 5 X 10-11M, such as less than 10-11M, e.g. less than 5 X 10- 12 M, such as less than 10-1 2 M, e.g. less than 5 X 10-1 3 M, such as less than 10-1 3 M, e.g. less than 5 X 10-1 4 M, such as 5 less than 10- 1 4 M, e.g. less than 5 X 10- 15 M, or less than 10-1 5 M. Binding constants can be determined using methods well-known in the art, such as ELISA (e.g. as described in Orosz and Ovadi (2002) J. Immunol. Methods 270:155-162) or surface plasmon resonance analysis. 10 In preferred embodiments, the antibody of the invention is capable of binding an intact Aspergillus fumigatus cell, i.e. capable of binding a living or a dead Aspergillus cell which has maintained its structural integrity, preferably a cell that has maintained the integrity of the plasma membrane (i.e. wherein the plasma membrane is not permeabilised). Binding of antibodies to intact cells can e.g. be 15 tested as described in the Examples herein. In further preferred embodiments, the antibody of the invention, or at least an Fab fragment thereof, is capable of reducing the adhesion of Aspergillus fumigatus conidia to lung epithelia in an in vitro assay set-up as described herein in the 20 Examples, preferably reducing said adhesion with at least 20%, such as at least 40%, e.g. at least 60% or at least 80%. Furthermore, it is preferred that the antibody of the invention, or at least an Fab fragment thereof, is capable of reducing the germination of Aspergillus fumigatus 25 conidia in an in vitro assay set-up as described herein in the Examples, preferably reducing said adhesion with at least 20%, such as at least 40%, e.g. at least 60% or at least 80%. The antibodies of the invention are capable of specifically recognising and binding 30 an Aspergillus fumigatus target polypeptide selected from the group of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:6 and SEQ ID NO:36. 'specifically' is, in this content, not intended to mean absolute specificity. Thus, 'species-specific' is used when it is intended to indicate that the antibody cannot bind to homologous polypeptides from other fungi. 35 WO 2004/108765 PCT/DK2004/000407 28 In some embodiments, the antibody of the invention is, in addition to being capable of binding an Aspergillus fumigatus polypeptide, capable of binding a homologous polypeptide from another fungus. E.g. in these embodiments, the antibody of the invention is further capable of binding a homologous polypeptide, wherein the 5 homologous polypeptide has a sequence identity of 39% or more, such as 42% or more, e.g. 48% or more, such as 68% or more, e.g. 80% or more, such as 90% or more, to a polypeptide selected from the group consisting of isopropylmalate dehydrogenase B (SEQ ID NO:36), CssI (SEQ ID NO:1), hydrophobin (SEQ ID NO:2), GAPDH-B (SEQ ID NO:3), and catalase A (SEQ ID NO:6). Preferred are 10 antibodies that are capable of binding a homologous polypeptide originating from one of the following species: - an Aspergillus species, such as Aspergillus fumigatus, Aspergillus nidulans, Aspergillus niger, or Aspergillus oryzea, - Neurospora crassa, 15 - Saccharomyces cerevisiae, - a Candida species such as Candida albicans, - a Coccidioides species, such as Coccidioides posadasii, or Coccidioides immitis, - a Cryptococcus species, such as Cryptococcus neoformans var. neoformans, - a Fusarium species, 20 - a Pneumocystis species, - a Penicillium species, - Histoplasma capsulatum. More preferably, the homologous polypeptide originates from - an Aspergillus species, such as Aspergillus fumigatus, Aspergillus nidulans, 25 Aspergillus niger or Aspergillus oryzea, - Candida albicans, - Coccidioides posadasii, or - Cryptococcus neoformans var. neoformans. 30 In one specific embodiment, the antibody of the invention further recognises a homologous polypeptide which also originates from Aspergillus fumigatus, such as the polypeptide of SEQ ID NO:41. In preferred examples of the type of embodiments described above, said 35 homologous polypeptide is also extracellular. Thus, the antibody capable of binding WO 2004/108765 PCT/DK2004/000407 29 both an Aspergillus fumigatus polypeptide as well as a homologous polypeptide, will be capable of binding an intact cell of any one or more of the species from which the homologous polypeptide originates, i.e. one of - an Aspergillus species other than Aspergillus fumigatus, such as Aspergillus 5 nidulans, Aspergillus niger, or Aspergillus oryzea, - Neurospora crassa, - Saccharomyces cerevisiae, - a Candida species such as Candida albicans, - a Coccidioides species, such as Coccidioides posadasii, or Coccidioides immitis, 10 - a Cryptococcus species, such as Cryptococcus neoformans var. neoformans, - a Fusarium species, - a Pneumocystis species, - a Penicillium species, and 15 - Histoplasma capsulatum. Binding of the antibodies of the invention to homologous polypeptides andlor other intact cells of other fungi can be tested by the method described herein in the Examples or by other standard methods known in the art. 20 In preferred embodiment, the antibody of the invention is capable of binding one or more amino acid residues comprised within a region of SEQ ID NO:36 that has significant identity to homologous polypeptides from other fungi, such as regions of SEQ ID NO:36 that have identity with a homologous polypeptide of 4,5,6,7,8 or 25 more consecutive amino acids. Most preferably, antibody of the invention recognises an epitope which is entirely consisting of residues comprised within one of these regions of SEQ ID NO:36. In particular the following regions are preferred: Ser67-Leu71, Ala74-Trp80, Ser191-Arg205, Leu268-Leu273, His292-Pro296, Glu355-11e360, Asp193-Glu209, Asp193-Alal199, Ilel15-Val19, Val75-Trp80, and 30 Proll-Glul18. Further preferred are antibodies that bind to an epitope of SEQ ID NO:36 which comprises one or more residues of SEQ ID NO:37. Methods for epitope mapping are well known in the art.
WO 2004/108765 PCT/DK2004/000407 30 In a different set of embodiments, the antibody of the invention is not capable of binding intact cells from one or more another fungi. For instance, in one such embodiment, the antibody is not capable of binding an intact cell of any of - Neurospora crassa, 5 - Saccharomyces cerevisiae, - Candida albicans, - Coccidioides posadasii, or Coccidioides immitis, - Cryptococcus neoformans var. neoformans, or 10 - Histoplasma capsulatum. More preferably, the antibody of the invention is not capable of binding an intact cell of any of - Aspergillus nidulans - Aspergillus niger 15 - Aspergillus oryzea, - Neurospora crassa, - Saccharomyces cerevisiae, - Candida albicans, - Coccidioides posadasii, or Coccidioides immitis, 20 - Cryptococcus neoformans var. neoformans, or - Histoplasma capsulatum. In one specific embodiment, the antibody of the invention is species-specific, i.e. not capable of binding homologous polypeptides or intact cells from other fungi than 25 Aspergillus fumigatus. The invention also relates to pharmaceutical compositions comprising an antibody of the invention and a pharmaceutically-acceptable carrier. 30 Raising antibodies and functional equivalents In another aspect, the invention relates to a method for raising specific antibodies to a polypeptide selected from the group of polypeptides set forth in SEQ ID NOs: 1-6 and 36 in a non-human animal comprising the steps of a. providing a polypeptide selected from the group of polypeptides set forth in SEQ 35 ID NOs: 1-6 and 36 or a polypeptide selected from the group of the polypeptide WO 2004/108765 PCT/DK2004/000407 31 fragments as defined in the present application, or a cell expressing any of these polypeptides, b. introducing a composition comprising said polypeptide or said cell into said animal, 5 c. raising antibodies in said animal, and d. isolating and optionally purifying the antibodies. In one embodiment of the above method, the polypeptide that is provided is Cssl (SEQ ID NO:1) or a fragment thereof, or a variant of said polypeptide. In another 10 embodiment of the above method, the polypeptide that is provided is hydrophobin (SEQ ID NO:2) or a fragment thereof, or a variant of said polypeptide. In yet another embodiment of the above method, the polypeptide that is provided is GAPDH-B (SEQ ID NO:3) or a fragment thereof, or a variant of said polypeptide. In a yet further embodiment of the above method, wherein the polypeptide that is provided is 15 catalase A (SEQ ID NO:6) or a fragment thereof, or a variant of said polypeptide. And in an even further embodiment of the above method, the polypeptide that is provided is isopropylmalate dehydrogenase B (SEQ ID NO:36) or a fragment thereof, or a variant of said polypeptide. 20 Antibodies include polyclonal antibodies, monoclonal antibodies, human, humanised or chimeric antibodies, single-chain antibodies, and also Fab fragments, F(ab') 2 fragments, fragments produced by a Fab expression library, anti-idiotypic antibodies, hybrids comprising antibody fragments, and epitope-binding fragments of any of the these. The term also includes mixtures of monoclonal antibodies. 25 In some embodiments, the antibody of the invention is polyclonal. Polyclonal antibodies are heterogeneous populations of antibody molecules derived from the sera of animals immunised with an antigen, such as one of the extracellular polypeptides identified by the inventors, or a fragment, epitope or variant thereof. 30 For the production of polyclonal antibodies, host animals can be immunised by injection with the polypeptide supplemented with adjuvants. The antibody titer in the immunised animal can be monitored over time by standard techniques, such as ELISA using immobilised polypeptide. If desired, the antibody molecules can be isolated from the animal, for instance from the blood, and further purified by well 35 known techniques, such as protein-A chromatography, to obtain the IgG fraction.
WO 2004/108765 PCT/DK2004/000407 32 Thus, in a preferred embodiment, the above described method for generating an immune response comprises a step d. of isolating and purifying antibodies generated in said immune response. 5 In other embodiments, the antibody of the invention is monoclonal. Monoclonal antibodies, which are homogeneous populations of antibodies to a particular epitope, can be obtained by any technique which provides for the production of antibody molecules by continuous cell-lines in culture. These include, but are not limited to the hybridoma technique of Kohler and Milstein ((1975) Nature 256, 495 10 497; and U.S. 4,376,110), the human B-cell hybridoma technique (Kosbor et al., 1983, Immunology Today 4, 72; Cole et al., 1983, Proc. Natl. Acad. Sci. USA 80, 2026-2030), and the EBV-hybridoma technique (Cole et al., 1985, Monoclonal Antibodies And Cancer Therapy, Alan R. Liss, Inc., pp. 77-96). Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD and any subclass 15 thereof. A preferred class is IgG1. The hybridoma producing the monoclonal antibody of this invention can be cultivated in vitro or in vivo. Alternative to preparing monoclonal antibody-secreting hybridomas, a monoclonal antibody directed against a polypeptide of the invention can be identified and 20 isolated by screening a recombinant combinatorial immunoglobulin library (e.g., an antibody phage-display library) with the polypeptide of interest or a fragment thereof. Kits for generating and screening phage display libraries are commercially available (e.g., the Pharmacia Recombinant Phage Antibody System, Catalog No. 27-9400 01; and the Stratagene SurfZAPTM Phage Display Kit, Catalog No. 240612). 25 Additionally, examples of methods and reagents particularly amenable for use in generating and screening antibody display library can be found in, for example, U.S. 5,223,409; WO 92/18619; WO 91/17271; WO 92/20791 ; WO 92/15679 ; WO 93/01288; WO 92/01047; WO 92/09690; WO 90/02809; Fuchs et al. (1991) Bio/Technology 9: 1370-1372; Hay et al.(1992) Hum. Antibod. Hybridomas 3, 81-85; 30 Huse et al. (1989) Science 246, 1275-1281; and Griffiths et al. (1993) EMBO J. 12, 725-734. Additionally, recombinant antibodies, such as chimeric and humanised monoclonal antibodies comprising both human and nion-human portions, which can be made 35 using standard recombinant DNA techniques, are within the scope of the invention.
WO 2004/108765 PCT/DK2004/000407 33 A chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable region derived from a murine mAb and a human immunoglobulin constant region. (See, e.g., U.S. 4,816,567; and U.S. 4,816,397, which are incorporated herein by reference in their 5 entirety.) Humanised antibodies are antibody molecules from non-human species having one or more complementarity-determining regions from the non-human species and a framework region from a human immunoglobulin molecule. (See, e.g. U.S. 5,585,089, which is incorporated herein by reference in its entirety.) Such chimeric and humanised monoclonal antibodies can be produced by recombinant 10 DNA techniques known in the art, for example using methods described in WO 87/02671 ; European Patent Application 184,187; European Patent Application 171,496; European Patent Application 173,494; WO 86/01533; U.S. 4,816,567; European Patent Application 125,023. Better et al. (1988) Science 240:1041-1043; Liu et al. (1987) Proc. Natl. Acad. Sci. USA 84:3439-3443; Liu et al. (1987) J. 15 Immunol. 139:3521-3526; Sun et al. (1987) Proc. Natl. Acad. Sci. USA 84:214-218; Nishimura et al. (1987) Cancer Res. 47:999-1005; Wood et al. (1985) Nature 314:446-449; and Shaw et al. (1988) J. Natl. Cancer Inst. 80:1553-1559); Morrison (1985) Science 229:1202-1207; Oi et al. (1986) Bio/Techniques 4:214; U.S. Pat. No. 5,225,539; Jones et al. (1986) Nature 321:552-525; Verhoeyen et al. (1988) Science 20 239:1534-1536; Beidler et al. (1988) J. Immunol. 141:4053-4060; and Westin Kwon et al. (2002) Clin. Diagn. Lab. Immunol. 9, 201-204. In a highly preferred embodiment, the antibody of the invention is a human antibody. Completely human antibodies are particularly desirable for therapeutic treatment of 25 human patients. Such antibodies can be produced using transgenic mice which are incapable of expressing endogenous immunoglobulin heavy and kappa light chains genes, but which can express human heavy and light chain genes. The transgenic mice are immunised in the normal fashion with a selected antigen, e.g., all or a fragment of a polypeptide of the invention. Monoclonal antibodies directed against 30 the antigen can e.g. be obtained using conventional hybridoma technology. The human immunoglobulin transgenes harboured by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation. Thus, using such a technique, it is possible to produce therapeutically useful IgG, IgA and IgE antibodies. For an overview of this technology for producing 35 human antibodies, see Lonberg and Huszar (1995) Int. Rev. Immunol. 13: 65-93).
WO 2004/108765 PCT/DK2004/000407 34 For a detailed discussion of this technology for producing human antibodies and human monoclonal antibodies and protocols for producing such antibodies, see, e.g. WO 02/43478; U.S. 5,625,126; U.S. 5,633,425; U.S. 5,569,825; U.S. 5,661,016; and U.S. 5,545,806. Completely human antibodies which recognise a selected 5 epitope can be generated using a technique referred to as "guided selection". In this approach a selected non-human monoclonal antibody, e.g. a mouse antibody, is used to guide the selection of a completely human antibody recognising the same epitope (see Jespers et al. (1994) Bio/Technology 12, 899-903). 10 Highly suitable methods for the production of human monoclonal antibodies have been described in WO 04/035607 (Genmab) and WO 04/043989 (Medarex). Further similar methods have been described in WO 03/017935 (Genmab), WO 02/100348 (Genmab), WO 02/064634 (Medarex) and WO 03/040169 (Medarex). 15 Antibody fragments which recognise specific epitopes can be generated by known techniques. For example, such fragments include but are not limited to: F(ab') 2 fragments which can be produced by pepsin digestion of the antibody molecule and Fab fragments which can be generated by reducing the disulfide bridges of the F(ab') 2 fragments. Alternatively, Fab expression libraries can be constructed (Huse 20 et al. (1989) Science 246, 1275-1281) to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity. Antibodies of the invention also include bispecific antibodies having two binding specificities, of which at least one is a specificity for a polypeptide selected from the 25 group of SEQ ID NO:1-6 and 36, preferably selected from the group of SEQ ID NOs:1-4 and 36. In preferred embodiments, the antibody of the invention is purified. 30 Antibody treatment Antibodies can be used for passive immunisation of mammals, preferably human beings, more preferably immunocompromised patients. A treatment with antibodies can be done to cure or to prevent Aspergillus infections. Thus, the invention relates to use of an antibody as defined herein for the manufacture of a medicament, 35 preferably a medicament for the treatment of fungal infections or the prophylactic WO 2004/108765 PCT/DK2004/000407 35 treatment (prevention) of fungal infections, preferably Aspergillus infections, such as Aspergillus fumigatus infections. Examples of fungal infections are invasive aspergillosis, aspergilloma, and allergic aspergillosis, such as allergic bronchopulmonary aspergillosis. 5 Formulated in another way, the invention relates to an antibody as defined herein or a composition as defined herein for use as a medicament. The invention also relates to a method of treatment comprising the step of administering to an individual a 10 pharmaceutically-effective amount of an antibody of the invention as defined herein, and to a medicament for treating Aspergillus infections comprising an antibody of the invention as an active ingredient. Antibodies of the invention may be mechanistically divided into the following 15 preferred groups: 1. Function-inhibiting antibodies that work as an antifungal (i.e. affect the viability of the fungus, including both fungicidal and fungistatic effects). Such antibodies should be effective regardless of the immune status of the patient. This category of antibodies includes pathogenesis-inhibiting antibodies, which block a protein 20 required for disease (Adhesion/Invasion), and growth-inhibiting antibodies, which block a protein required for germination and/or sporulation. 2. Opsonising antibodies that are designed to enhance phagocytic killing. Effectiveness of such antibodies may depend on the immune status of the patient, but it is very well possible that they will enhance phagocytic killing even in 25 compromised patients. Opsonising antibodies also comprise antibodies which enhance clearance by the immune system via complement and phagocytosis. 3. Antibodies conjugated to a therapeutic moiety such as a toxin or fungicidal agent, e g. ricin or radioisotopes, directed against fungal surface components. Techniques for conjugating a therapeutic moiety to antibodies are well known, see, e.g. Thorpe 30 et al.(1982) Immunol. Rev. 62, 119-158. These antibodies should also be effective regardless of the immune status of the patient. Validation of targets and antibodies can be done by the following methods known in the art: 35 - Invasion assays - test whether invasion of Aspergillus into lung cells is prevented WO 2004/108765 PCT/DK2004/000407 36 - Adhesion assays - test whether adhesion to and colonisation of lung cells is prevented - Germination assays - test whether growth and germination is prevented - Opsonisation assay - test whether function is inhibited, and clearance is eased 5 - Aggregation assays - test whether clumping is prevented, and whether clearance is eased - Invasive disease animal models - test whether disease is prevented In another aspect, the present invention provides a composition, e.g., a 10 pharmaceutical composition, comprising an antibody, e.g. a human monoclonal antibody of the present invention. The pharmaceutical compositions may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in Remington: The Science and Practice of Pharmacy, 19th 15 Edition, Gennaro, Ed., Mack Publishing Co., Easton, PA, 1995. The pharmaceutical composition may be administered by any suitable route and mode. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. The pharmaceutical 20 compositions of the present invention include those suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration. Formulations of the present invention which are suitable for vaginal administration include pessaries, tampons, creams, gels, pastes, foams or spray formulations containing such carriers as are known in the art to be appropriate. Dosage forms for 25 the topical or transdermal administration of compositions of this invention include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches -and inhalants. The pharmaceutical composition is preferably administered parenterally. The 30 phrases "parenteral administration" and "administered parenterally" as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, 35 intraspinal, epidural and intrasternal injection and infusion. In one embodiment the WO 2004/108765 PCT/DK2004/000407 37 pharmaceutical composition is administered by intravenous or subcutaneous injection or infusion. In one embodiment the antibodies of the invention are administered in crystalline form by subcutaneous injection, cf. Yang et al. (2003) PNAS, 100(12):6934-6939. 5 Regardless of the route of administration selected, the compounds of the present invention, which may be used in the form of a pharmaceutically acceptable salt or in a suitable hydrated form, and/or the pharmaceutical compositions of the present invention, are formulated into pharmaceutically acceptable dosage forms by 10 conventional methods known to those of skill in the art. As used herein, "pharmaceutically acceptable carrier" includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonicity agents, antioxidants and absorption delaying agents, and the like that are physiologically 15 compatible. Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof 20 in the pharmaceutical compositions of the invention is contemplated. Preferably, the carrier is suitable for parenteral administration, e.g. intravenous or subcutaneous injection or infusion. Pharmaceutical compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other ordered structure 25 suitable to high drug concentration. Examples of suitable aqueous and non-aqueous carriers which may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be 30 maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants. The pharmaceutical compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization 35 procedures and by the inclusion of various antibacterial and antifungal agents, for WO 2004/108765 PCT/DK2004/000407 38 example, paraben, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonicity agents, such as sugars, polyalcohols such as mannitol, sorbitol, glycerol or sodium chloride in the compositions. Pharmaceutically acceptable antioxidants may also be included, for example (1) water soluble 5 antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric 10 acid, phosphoric acid, and the like. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin. Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients e.g. as 15 enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients e.g. from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and 20 freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. If appropriate, the antibody may be used in a suitable hydrated form or in the form of a pharmaceutically acceptable salt. A "pharmaceutically acceptable salt" refers to a 25 salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S.M., et al. (1977) J. Pharm. Sci. 66:1-19). Examples of such salts include acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, 30 phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic WO 2004/108765 PCT/DK2004/000407 39 amines, such as N,N'-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like. Depending on the route of administration, the active compound, i.e., antibody, and 5 bispecific/multispecific molecule, may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound. For example, the compound may be administered to a subject in an appropriate carrier, for example, liposomes. Liposomes include water-in-oil-in-water CGF emulsions as well as conventional liposomes (Strejan et al. (1984) J. 10 Neuroimmunol. 7:27). The active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, 15 and polylactic acid. Methods for the preparation of such formulations are generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York, 1978. The pharmaceutical compositions can be administered with medical devices known 20 in the art. For example, in a preferred embodiment, a therapeutic composition of the invention can be administered with a needleless hypodermic injection device, such as the devices disclosed in US 5,399,163, US 5,383,851, US 5,312,335, US 5,064,413, US 4,941,880, US 4,790,824, or US 4,596,556. Examples of well-known implants and modules useful in the present invention include: US 4,487,603, which 25 discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; US 4,486,194, which discloses a therapeutic device for administering medicaments through the skin; US 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; US 4,447,224, which discloses a variable flow implantable infusion apparatus for 30 continuous drug delivery; US 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and US 4,475,196, which discloses an osmotic drug delivery system. Many other such implants, delivery systems, and modules are known to those skilled in the art.
WO 2004/108765 PCT/DK2004/000407 40 In certain embodiments, the antibodies of the invention can be formulated to ensure proper distribution in vivo. For example, the blood-brain barrier (BBB) excludes many highly hydrophilic compounds. To ensure that the therapeutic compounds of the invention cross the BBB (if desired), they can be formulated, for example, in 5 liposomes. For methods of manufacturing liposomes, see, e.g., US 4,522,811; US 5,374,548; and US 5,399,331. The liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V.V. Ranade (1989) J. Clin. Pharmacol. 29:685). Exemplary targeting moieties include folate or biotin (see, e.g., US 5,416,016 to Low et al.); 10 mannosides (Umezawa et al., (1988) Biochem. Biophys. Res. Commun. 153:1038); antibodies (P.G. Bloeman et al. (1995) FEBS Lett. 357:140; M. Owais et al. (1995) Antimicrob. Agents Chemother. 39:180); surfactant protein A receptor (Briscoe et al. (1995) Am. J. Physiol. 1233:134), different species of which may comprise the formulations of the inventions, as well as components of the invented molecules; 15 p120 (Schreier et al. (1994) J. Biol. Chem. 269:9090); see also K. Keinanen; M.L. Laukkanen (1994) FEBS Lett. 346:123; J.J. Killion; l.J. Fidler (1994) Immunomethods 4:273. In one embodiment of the invention, the therapeutic compounds of the invention are formulated in liposomes; in a more preferred embodiment, the liposomes include a targeting moiety. In a most preferred 20 embodiment, the therapeutic compounds in the liposomes are delivered by bolus injection to a site proximal to the desired area, e.g., the site of infection. The composition must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. 25 In a further embodiment, the antibodies of the invention can be formulated to prevent or reduce their transport across the placenta. This can be done by methods known in the art, e.g., by PEGylation of the antibodies or by use of F(ab')2 fragments. Further references can be made to "Cunningham-Rundles C, Zhuo Z, 30 Griffith B, Keenan J. (1992) Biological activities of polyethylene-glycol immunoglobulin conjugates. Resistance to enzymatic degradation. J Immunol Methods. 152:177-190; and to "Landor M. (1995) Maternal-fetal transfer of immunoglobulins, Ann Allergy Asthma Immunol 74:279-283.
WO 2004/108765 PCT/DK2004/000407 41 Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or ihcreased as indicated by the exigencies of the therapeutic situation. It is 5 especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required 10 pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals. Actual dosage levels of the active ingredients 15 in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the 20 particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior 25 medical history of the patient being treated, and like factors well known in the medical arts. A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian could start doses of the compounds of the invention employed in the pharmaceutical composition at levels 30 lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved. In general, a suitable daily dose of a composition of the invention will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect. Such an effective dose will generally depend upon the factors described above. It is 35 preferred that administration be intravenous, intramuscular, intraperitoneal, or WO 2004/108765 PCT/DK2004/000407 42 subcutaneous, preferably administered proximal to the site of the target. If desired, the effective daily dose of a therapeutic composition may be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms. While it is possible for 5 a compound of the present invention to be administered alone, it is preferable to administer the compound as a pharmaceutical formulation (composition). In one embodiment, the antibodies according to the invention can be administered by infusion in a weekly or daily dosage of from 10 to 500 mg/m2, such as of from 10 200 to 400 mg/m2. Such administration can be repeated, e.g., 1 to 8 times, such as 3 to 5 times. The administration may be performed by continuous infusion over a period of from 2 to 24 hours, such as of from 2 to 12 hours. In another embodiment, the human monoclonal antibodies can be administered by slow continuous infusion over a long period, such as more than 24 hours, in order to reduce toxic side effects. 15 In still another embodiment the human monoclonal antibodies can be administered in a weekly dosage of from 250 mg to 2000 mg, such as for example 300 mg, 500 mg, 700 mg, 1000 mg, 1500 mg or 2000 mg, for up to 8 times, such as from 4 to 6 times. The administration may be performed by continuous infusion over a period of from 2 to 24 hours, such as of from 2 to 12 hours. Such regimen may be repeated 20 one or more times as necessary, for example, after 6 months or 12 months. In yet another embodiment, the human monoclonal antibodies can be administered by maintenance therapy, such as, e.g., once a week for a period of 6 months or more. Combination treatment 25 The pharmaceutical composition of the invention may contain one or a combination of antibodies of the invention. Thus, in a further embodiment, the pharmaceutical compositions include a combination of multiple (e.g., two or more) isolated antibodies of the invention which act by different mechanisms. 30 Treatment of antifungal infections as defined herein, for example passive immunisation with antibodies specifically recognising and binding the extracellular Aspergillus polypeptides as defined herein, can also be combined with any other type of therapy, in particular other antifungal therapy. Thus, an antibody with or without a therapeutic moiety conjugated to it can be used as a therapeutic that is 35 administered alone or in combination with antifungal chemotherapeutics or other WO 2004/108765 PCT/DK2004/000407 43 therapeutic agents. For instance, treatment with an antibody as defined herein can be combined with treatment with antifungal compounds, such as azoles (e.g. fluconazole, itraconazole, ketoconazole, miconazole), amphotericin B, flucytosine, or echinocandins, such as Caspofungin. Alternatively, or in addition, treatment with 5 antibodies as defined herein can also be combined with treatment with other antifungal antibodies, for instance antibodies directed against HSP90, such as Mycograb (Matthews et al. (2003) Antimicr. Agents and Chemotherapy 47:2208 2216). 10 Combination therapy can in some circumstances be more effective than single component therapy. Combination therapy can be particularly useful for patients that suffer from infection with multiple fungal species, for example patients having both a Candida and an Aspergillus infections. 15 Binding partners and inhibitors of extracellular polypeptides In addition to antibodies, it is of interest to identify other types of binding partners to extracellular polypeptides. Extracellular polypeptides of a pathogenic fungus often interact with the host organism. Any type of binding partner of an extracellular polypeptide may interfere with host-pathogen interaction. Binding partners may thus 20 antagonise the pathogenicity of the fungus. Identification of binding partners of the extracellular polypeptides set forth in SEQ ID NO:1-6 and 36, or fragments thereof, is another main aspect of this invention. This may be done using biochemical or cell-based methods. 25 Biochemical methods In a main aspect, the invention relates to a method for identifying a binding partner of a polypeptide of the .invention and/or a polypeptide selected from the group of SEQ ID NOs:1-6 and 36, comprising the steps of 30 a. providing a polypeptide of the invention as defined herein or a polypeptide selected from the group of SEQ ID NOs:1-6 and 36, b. contacting said polypeptide with a putative binding partner, and c. determining whether said putative binding partner is capable of binding to said polypeptide. 35 WO 2004/108765 PCT/DK2004/000407 44 Thus, in one embodiment of the above method, the polypeptide that is provided is Cssl (SEQ ID NO:1) or a fragment thereof, or a variant of said polypeptide. In another embodiment, the polypeptide that is provided is hydrophobin (SEQ ID NO:2) or a fragment thereof, or a variant of said polypeptide. In another embodiment, the 5 polypeptide that is provided is GAPDH-B (SEQ ID NO:3) or a fragment thereof, or a variant of said polypeptide. In a yet other embodiment, the polypeptide that is provided is catalase B (SEQ ID NO:5) or a fragment thereof, or a variant of said polypeptide. In a further embodiment, wherein the polypeptide that is provided is catalase A (SEQ ID NO:6) or a fragment thereof, or a variant of said polypeptide. In 10 an even further embodiment, wherein the polypeptide that is provided is isopropylmalate dehydrogenase B (SEQ ID NO:36) or a fragment thereof, or a variant of said polypeptide. In a preferred embodiment of this method of the invention, said polypeptide is 15 selected from the group of SEQ ID NOs:1,2,3,5,6, and 36 such as the polypeptide set forth in SEQ ID NO:1, or the polypeptide set forth in SEQ ID NO:2, or polypeptide set forth in SEQ ID NO:3, or the polypeptide set forth in SEQ ID NO:5, or the polypeptide set forth in SEQ ID NO:6 or the polypeptide set forth in SEQ ID NO:36. In other preferred embodiments, an exposed domain, an epitope or a 20 fragment of one of the polypeptides set forth in SEQ ID NOs:1-6 and 36 comprising one or more amino-acid residues of the sequences set forth in SEQ ID NO: 7-34 and 37 is provided in step a. In further preferred embodiments, a fragment selected from the group of SEQ NO:7-34 and 37 is provided, preferably a fragment selected from the group of SEQ ID NO:7-27 and 37, or a variant or fragment of any of the 25 amino-acid sequences set forth in SEQ ID NO:7-27 and 37. In preferred embodiments of this method, the polypeptide or fragment thereof is provided immobilised on a solid support, such as e.g. a column or microtiter plate, and, after the contacting step, it is determined whether or not the putative binding 30 partner has bound to the solid support. Immobilisation of the polypeptide or fragment thereof may be through direct binding to the solid support, or through indirect binding e.g. using a specific antibody. In preferred embodiments, a washing step is performed between the contacting step and the determination step, in order to improve the specificity of detection. In further preferred embodiments, the putative 35 binding partner is labelled. The putative partner may be labelled before the WO 2004/108765 PCT/DK2004/000407 45 contacting takes place. Alternatively, labelling may also be performed after the contacting step. Furthermore, in some embodiments of this method, immobilisation may be performed after the polypeptide or fragment thereof has been bound to the binding partner. In preferred embodiments, the method is repeated for a plurality of 5 putative binding partners. Putative binding partners include host-derived molecules. Alternatively, a binding partner of a polypeptide of the invention or of a polypeptide selected from the group of SEQ ID NO:1,2,4,5, 6 and 36 may be identified as follows: purified host membranes are electrophoretically separated, blotted over to a 10 membrane and incubated with the polypeptide of interest or fragment thereof. Binding can then be detected using antibodies specific for the polypeptide of interest or fragment thereof. The host binding partner to which the polypeptide or fragment thereof has bound can subsequently be identified by elution from the blot and subsequent analysis by mass spectrometry, or by any other technique known in the 15 art. If the binding partner of an extracellular polypeptide of a pathogenic organism is a host-derived molecule, then such an interaction between the extracellular polypeptide and the host may be important for the virulence of the fungus. 20 Compounds that interfere with the interaction of the extracellular polypeptide and the host binding partner may thus be suitable for prevention or treatment of fungal infections. Accordingly, another method of the invention relates to a method of identifying an inhibitor of the interaction of an extracellular Aspergillus polypeptide selected from the group of SEQ ID NO:1-6 and 36 or fragment thereof with a host 25 derived binding partner comprising the steps of: a. providing a polypeptide selected from the group of SEQ ID NO:1-6 and 36, or a fragment thereof, b. providing a host-derived binding partner of said polypeptide c. contacting said polypeptide with said host-derived binding partner in the 30 absence of a putative inhibitor of said interaction d. contacting said polypeptide with said host-derived binding partner in the presence of said putative inhibitor e. determining whether the strength of the binding of said polypeptide to said host derived binding partner resulting from step d. is reduced as compared to that 35 resulting from step c.
WO 2004/108765 PCT/DK2004/000407 46 In some embodiments, step c. and d. may be performed in two different sample compartments. In other embodiments, step d. may be performed by adding the putative inhibitor to the mixture of step c. In preferred embodiments, a fragment selected from the group of SEQ ID NO:7-34 and 37 is provided in step a. In other 5 preferred embodiments, the polypeptide of SEQ ID NO:1,2,3,5, 6, or 36 is provided. In further preferred embodiments, the method is repeated for a plurality of putative inhibitors. Of further particular interest are binding partners that inhibit an activity of an extracellular polypeptide. Such activity may be enzymatic activity, transport activity, or any type of other biochemical or cellular activity, preferably enzymatic 10 activity. Inhibitors of IMDH B, GAPDH, enolase or catalase may be screened for using known biochemical assays of the enzymes, such as the catalase assay kit of CALBIOCHEM, cat. no. 219263, and e.g. the assays described in Pirrung et al. (1996) J Org Chem 61, 4527-4531; Bartolini et al. (2003) J. Chromatogr. 987, 331 340; Lal et al.(1991) Plant Mol. Biol. 16, 787-795; Machida et al. (1996) Biosci 15 Biotechnol Biochem 60, 161-163; and Maitra and Lobo (1971) J Biol Chem 246, 475-88. Cell-based methods Reducing the level of an extracellular polypeptide, by deletion or disruption of the 20 structural gene for it or by down-regulating gene expression (see below), may affect a fungal cell. The cell may become more sensitive to cytotoxic compounds. Especially for extracellular polypeptides, a reduction of their level may affect the function of the cell's exterior parts, such as the plasma membrane or cell wall, in preventing compounds of entering the cell. Thus, reduction of the level of an 25 extracellular polypeptide can make a cell more 'permeable' for various compounds. An aspect of the present invention relates to a method for identifying a compound with anti-Aspergillus fumigatus activity comprising the steps of a. providing a sensitised cell which has a reduced level of a polypeptide selected 30 from the group of SEQ ID NO:1-6 and 36, and b. determining the sensitivity of said cell to a putative inhibitor, for instance by a growth assay. In a preferred embodiment, a sensitised cell which has a reduced level of a polypeptide selected from the group of SEQ ID NO:1,2,3,5, 6, and 36 is provided in 35 step a. In an even more preferred embodiment of the method, a sensitised cell WO 2004/108765 PCT/DK2004/000407 47 which has a reduced level of Cssl (SEQ ID NO:1), hydrophobin (SEQ ID NO:2), GAPDH (SEQ ID NO:3), catalase A (SEQ ID NO:6), or isopropylmalate dehydrogenase B (SEQ ID NO:36) is provided. 5 The rationale behind this approach is that a cell with a lower level of the extracellular polypeptide will exhibit increased sensitivity to cytotoxic compounds, allowing identification of antifungal compounds with low potency that are missed when using wild-type cells for the assay. Compounds identified by this method will be often need to be modified in order to improve potency. This can be done by chemical 10 modification. In preferred embodiments, the method is repeated for a plurality of putative binding partners. Inhibition of the activity of an extracellular polypeptide may affect the viability (i.e. survival, growth and/or proliferation) of the fungus. Of particular interest is inhibition 15 of extracellular polypeptides that are essential for viability of A. fumigatus. Essentiality of an Aspergillus gene may be investigated e.g. using regulatable expression as. described in WO 02/086090. Inhibitors of essential extracellular polypeptides may not need to enter the fungal cell to be able to affect its viability. Thus, generally fewer requirements are posed on the structure of an inhibitor of 20 essential extracellular target polypeptide than on an inhibitor of an intracellular target, to be effective as an antifungal agent. Thus, the invention relates to a method for identifying an inhibitor of an extracellular 25 Aspergillus fumigatus polypeptide selected from the group of SEQ ID NO:1-6 and 36 comprising the steps of a. providing two cells which differ in the level of a polypeptide selected from the group of SEQ ID NO:1-6 and 36, b. determining the sensitivity of said cells to a putative inhibitor, for instance by a 30 growth assay, and c. determining whether said two cells are differently affected by the presence of said putative inhibitor. The rationale behind this approach is that the viability of a cell with a lower activity of the essential polypeptide will be more affected by an inhibitor of the polypeptide than 35 the viability of the cell with a higher level. If the two cells are differently affected, this is an indication that the inhibitor acts on the target or in the same biochemical WO 2004/108765 PCT/DK2004/000407 48 pathway. In a preferred embodiment of the method, said polypeptide is Cssl (SEQ ID NO:1), GAPDH (SEQ ID NO:3), catalase A (SEQ ID NO:6), or isopropylmalate dehydrogenase B (SEQ ID NO:36). 5 In some embodiments of the method, the two cells with different activity of the polypeptide of interest are a wild-type cell (or other cell with wild-type activity of the gene of interest) and a sensitised cell with a reduced activity of the polypeptide of interest. In some embodiments, the different or reduced level in the sensitised cell can be a different or reduced expression level of the gene of interest (resulting in a 10 different or reduced copy number of the polypeptide). This can be accomplished by putting the gene under control of a regulatable promoter or by regulatable expression of an antisense RNA which inhibits translation of an mRNA encoding the essential polypeptide. In other embodiments, the different or reduced activity can be a different or reduced activity of the polypeptide of interest, e.g. due to a mutation, 15 such as a temperature-sensitive mutation. In preferred embodiments, the method is repeated for a plurality of putative binding partners. Suitable ways of generating sensitised cells and of using these in screening for inhibitors have been described in WO 02/086090. Sensitised cells may be obtained 20 by growing a conditional-expression A. fumigatus mutant strain in the presence of a concentration of inducer or repressor which provides a level of a gene product required for fungal viability such that the presence or absence of its function becomes a rate-determining step for viability. A number of suitable regulatable promoters for constructing such conditional-expression mutants of Aspergillus is 25 described in WO 02/086090, page 76, line 34 through page 85, line 4. For example, if the regulatable promoter is repressed by tetracycline, the conditional-expression Aspergillus fumigatus mutant strain may be grown in the presence of partially repressing concentrations of tetracyline. The sub-lethal concentration of inducer or repressor may be any concentration consistent with the intended use of the assay. 30 For example, the sub-lethal concentration of the inducer or repressor may be such that growth inhibition is at least about 10%, such as at least about 25%, e.g. at least about 50%, such as at least about 75%, e.g. at least 90%, such as at least 95%. Similarly, the virulence or pathogenicity of cells exposed to a candidate compound 35 which express a rate-limiting amount of a gene product required for virulence or WO 2004/108765 PCT/DK2004/000407 49 pathogenicity may be compared to the virulence or pathogenicity of cells exposed to the candidate compound in which the level of expression of the gene product required for virulence or pathogenicity is not rate-limiting. In such methods, test animals are challenged with the conditional-expression A. fumigatus mutant strain 5 and fed a diet containing the desired amount of tetracycline and the candidate compound. Thus, the conditional-expression mutant strain infecting the test animals expresses a rate limiting amount of a gene product required for virulence or pathogenicity (i. e. the conditional-expression mutant cells in the test animals are sensitised). Control animals are challenged with the conditional-expression mutant 10 strain and are fed a diet containing the candidate compound but lacking tetracycline. The virulence or pathogenicity of the conditional-expression A. fumigatus mutant strain in the test animals is compared to that in the control animals. For example, if a significant difference in growth is observed between the sensitised conditional expression mutant cells (i. e. the cells in animals whose diet included tetracycline) 15 and the non-sensitised cells (i. e. the conditional-expression mutant cells animals whose diet did not include tetracycline), the candidate compound may be used to inhibit the virulence or pathogenicity of the organism or may be further optimised to identify compounds which have an even greater ability to inhibit the virulence or pathogenicity of the organism. Virulence or pathogenicity may be measured using 20 the techniques known in the art. In another embodiment of the cell-based assays of the present invention, sensitised cells are obtained by reduction of the level activity of a polypeptide required for fungal viability using a mutation, such as a temperature-sensitive mutation, in the 25 polypeptide. Growing such cells at an intermediate temperature between the permissive and restrictive temperatures produces cells with reduced activity of the gene product. It will be appreciated that the above method may be performed with any mutation which reduces but does not eliminate the activity or level of the gene product which is required for fungal viability. This approach may also be combined 30 with the conditional-expression approach. In this combined approach, cells are created in which there is a temperature-sensitive mutation in the gene of interest and in which this gene is also conditionally-expressed. When screening for inhibitors of an essential polypeptide, growth inhibition can be 35 measured by directly comparing the amount of growth, measured by the optical WO 2004/108765 PCT/DK2004/000407 50 density of the culture relative to uninoculated growth medium, in an experimental sample with that of a control sample. Alternative methods for assaying cell proliferation include measuring green fluorescent protein (GFP) reporter construct emissions, various enzymatic activity assays, and other methods well known in the 5 art. Other parameters used to measure viability include e.g. colony forming units. The above method may be performed in solid phase, liquid phase, a combination of the two preceding media, or in vivo. Multiple compounds may be transferred to agar plates and simultaneously tested using automated and semi-automated equipment. 10 Cell-based assays of the present invention are capable of detecting compounds exhibiting low or moderate potency against the target molecule of interest because such compounds are substantially more potent on sensitised cells than on non sensitised cells. The effect may be such that a test compound may be two to several times more potent, e.g. at least 10 times more potent, such as at least 20 times 15 more potent, e.g. at least 50 times more potent, such as at least 100 times more potent, e.g. at least 1000 times more potent, or even more than 1000 times more potent when tested on the sensitised cells as compared to non-sensitised cells. A mutant A. fumigatus strain that overexpresses an extracellular polypeptide can 20 also be used to identify a compound that inhibits such a polypeptide. If the compound is cytotoxic, overexpression of the target polypeptide can make cells more resistant. Thus, the invention also relates to a method for identifying an inhibitor of an extracellular Aspergillus polypeptide selected from the group of SEQ ID NO:1-6 and 36 comprising the steps of 25 a. providing two cells which differ in the activity of a polypeptide selected from the group of SEQ ID NO:1-6 and 36, wherein one cell contains a substantially wild type copy number of said polypeptide and the other cell contains higher than wild-type activity of said polypeptide b. determining the sensitivity of said cells to a putative inhibitor, for instance by a 30 growth assay, and c. determining whether or not said two cells are differently affected by the presence of said putative inhibitor. Preferably, the two cells differ in the activity of a polypeptide selected from the group 35 of SEQ ID NO:1,2,3,5,6, and 36, such as the polypeptide of SEQ ID NO:1, or the WO 2004/108765 PCT/DK2004/000407 51 polypeptide of SEQ ID NO:2, or the polypeptide of.SEQ ID NO:3, or the polypeptide of SEQ ID NO:5, or the polypeptide of SEQ ID NO:6 or the polypeptide of SEQ ID NO:36 5 As also overexpression of polypeptides that are not the cellular target of an inhibitor can make cells resistance to an inhibitor, inhibition of the target polypeptide of interest by said inhibitor will need to be verified by other means, such as e.g. a biochemical assay. 10 Overexpression may be achieved using strong promoters, e.g. the A. niger Pgla A promoter, the A. nidulans promoter alcA(p), or the constitutive promoters PGK (phosphoglycero-kinase), GPD-(glucose-6-phosphate dehydrogenase) or ENO (enolase) promoters or regulated promoters such as ADH2, PHO5, GALl, GALl10, CUP1 or HSP70. Other useful promoters include the ones described in Adams et al. 15 (1998) Microbiol. Mol. Biol. Rev. 62, 35-54; Adams et al. (1988) Cell 54, 353-362; Andrianopoulos and Timberlake (1991) Plant Cell 3, 747-748; Gwynne et al. (1987) Gene 51:205-216; Lockington et al. (1985) Gene 33:137-149. In addition to inhibitors of a biochemical or other cellular activity of an extracellular 20 polypeptide, the cellular methods described above may identify compounds that reduce the expression level of a target, and thereby its copy number, e.g. by interfering with gene regulation. In preferred embodiments of the any of the cell-based- or biochemical methods for 25 identifying binding partners or inhibitors, the method is repeated for a plurality of candidate compounds. In a further aspect, the invention relates to the mutant A. fumigatus strains used in the cell-based methods described herein, such as strains in which the gene 30 encoding the extracellular polypeptide is placed under the control of a heterologous regulatable promoter, strains carrying temperature-sensitive alleles of the extracellular polypeptides, and strains overexpressing the extracellular polypeptides. Other methods of interfering with fungal growth by targeting essential extracellular 35 polypeptides include suppression of gene expression using specific antisense WO 2004/108765 PCT/DK2004/000407 52 molecules, such antisense RNA or DNA, and using ribozyme molecules specific for mRNA encoding the essential extracellular polypeptides. Diagnosis 5 In a further main aspect, the invention relates to a method of diagnosing Aspergillus infection comprising the steps of a. providing a sample from an individual, b. contacting said sample with an indicator moiety specific for a polypeptide of the invention as defined herein, or specific for a polypeptide selected from the group 10 of Cssl (SEQ ID NO:1), hydrophobin (SEQ ID NO:2), GAPDH (SEQ ID NO:3), catalase A (SEQ ID NO:6) and isopropylmalate dehydrogenase B (SEQ ID NO:36), and c. determining whether a signal has been generated by the indicator moiety. 15 In a preferred embodiment of this method, the polypeptide of the invention is a polypeptide selected from the group of SEQ ID NO:1,2,3,5,6, and 36 such as the polypeptide of SEQ ID NO:1, or the polypeptide of SEQ ID NO:2, or the polypeptide of SEQ ID NO:3, or the polypeptide of SEQ ID NO:5, or the polypeptide of SEQ ID NO:6, or the polypeptide of SEQ ID NO:36. In other preferred embodiments of this 20 method, the indicator moiety is specific for a fragment selected from the group of fragments set forth in SEQ ID NO:7-34 and 37. The indicator moiety is capable of binding to the target polypeptide of interest. In preferred embodiments, said indicator moiety is or comprises an antibody. 25 Antibodies directed against a target extracellular polypeptide or fragment thereof can be used to detect the polypeptide in order to evaluate the abundance and pattern of expression of the polypeptide under various environmental conditions, in different morphological forms (mycelium, yeast, spores) and stages of an organism's life cycle. 30 Preferably, however, antibodies directed against a target polypeptide or fragment thereof can be used diagnostically to monitor levels of a target gene product in the tissue of an infected host as part of a clinical testing procedure, e. g., to, for example, diagnose a patient for Aspergillus infection or determine the efficacy of a 35 given treatment regimen. In particular Cssl is of considerable interest for diagnostic WO 2004/108765 PCT/DK2004/000407 53 purposes. It appears that the protein is unique to A. fumigatus as no significant homologues to the protein have yet been detected through the use of immunological or sequence-based procedures. Furthermore, the cell-surface and secreted nature of the protein is also favourable feature from the point of view of detecting the 5 protein in human fluids. Detection using antibodies can be facilitated by coupling the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent 10 materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase ; examples of suitable prosthetic group complexes include Streptavidin/biotin and avidin/biotin ; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, 15 dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin ; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include 1251, 1311, 35 S or 3 H. 20 Various diagnostic assays employing the above indicator moieties can be set up to test samples for Aspergillus. Exemplary assays are described in detail in Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press, 1988. Representative examples of such assays include: countercurrent immuno-electrophoresis (CIEP), radioimmunoassays, radioimmunoprecipitations, 25 enzyme-linked immuno-sorbent assays (ELISA), dot blot assays, inhibition or competition assays, and sandwich assays, immunostick (dipstick) assays, simultaneous immunoassays, immunochromatographic assays, immunofiltration assays, latex bead agglutination assays, immunofluorescent assays, biosensor assays, and low-light detection assays (see U.S. Pat. Nos. 4,376,110 and 30 4,486,530; see also Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press, 1988. 35 WO 2004/108765 PCT/DK2004/000407 54 Detailed description of the tables and figures Table 1 shows the sequences of the peptides that were identified in the AfC fractions. Shown are, for each of the polypeptides (Cssl, Hydrophobin, GAPDH, enolase, catalase (A+B) and isopropylmalate dehydrogenase B), the peptides that 5 were identified in the three different fractions (diffusate, cell-surface-exposed, and cell wall), and the sequences of the peptides that were used for antibody production. X, is serine or alanine, X 2 is leucine or isoleucine. Table 2 shows some biochemical characteristics for the full-length Cssl polypeptide 10 and for its N-terminal and its C-terminal half. 'MW' indicates molecular weight. 'Residues' indicates the number of residues. Table 3. Sequence of peptides chosen for the production of multiple antigenic peptides and antisera against selected target proteins 15 Table 4. Analysis of the ability of anti-IMDH B IgG to bind the surface of clinical isolates. Figure 1 shows the predicted full-length polypeptide sequences of Cssl (A) (SEQ ID NO:1), hydrophobin (B) (SEQ ID NO:2), GAPDH-B (C) (SEQ ID NO:3), enolase (D) 20 (SEQ ID NO:4), catalase B (E) (SEQ ID NO:5), catalase A (F) (SEQ ID NO:6), and isopropylmalate dehydrogenase B (G) (SEQ ID NO:36). Figure 2 shows the predicted antigenicity indices of Cssl (A) and hydrophobin (B) residues, predicted according to Jameson and Wolf (1988). 25 Figure 3. Alignment of the predicted protein sequences for GAPDH-A (AfA), GAPDH-B (AfB), and GAPDH-C (AfC) from Aspergillus fumigatus. Residues that are identical in all three proteins are presented on a dark background. Peptides of GAPDH-B that have been identified by MS have been underlined. 30 Figure 4. Silver stained SDS-PAGE of AfM lysate samples (lanes 2 and 7) added to affigel immunoaffinity columns prepared with (lanes 2-5) or without (lanes 6-10) anti AfM lgG. Lanes 1 and 6 indicate the samples that were eluted from these columns after extensive washing steps (lanes 3-5 and 8-10). The proteins that are eluting at WO 2004/108765 PCT/DK2004/000407 55 approximate weights of 97, 64 and 51 were all identified as IMDH B via mass spectrometry. Figure 5. Phase contrast (A) and immunofluorescent micrographs (B) of AfM 5 labelled with anti-AfM sera (C) and with secondary antibody alone (D). Figure 6. Adhesion of AfC to lung epithelia demonstrating the ability of anti-AfM Fab fragments to reduce adhesion of AfC to A549 cells. 10 Figure 7. A silver stained SDS-PAGE illustrating the steps involved in purification of IMDH B. Lane 1, MW standard; lane 2, recombinant IMDH B purified via a nickel sepharose column; lane 3, recombinant protein following purification via an S200 gel filtration column; lane 4, as with lane 4 but ten times the quantity of protein is added. 15 Figure 8. Coomasie blue stained SDS-PAGE indicating the nickel sepharose purified recombinant IMDH B that was used to immunize rabbits (1); and the reactivity of preimmune serum (2), the first bleed post immunization (3) and the second bleed post immunization against the recombinant protein as detected via Western blotting. 20 Figure 9. Immunofluorescent micrographs of AfC and AfM from ATCC 46640 stained with Pre and Post immune IgG isolated from a rabbit immunized with IMDH B. Figure 10. Pre-incubation of AfC with anti-IMDH B reactive post immune Fab 25 fragments reduces AfC adhesion to A549 cells. Figure 11. Pre-incubation of rlMDH B with A549 cells, followed by washing, reduces subsequent adherence of AfC in a linear manner. 30 Figure 12. Incubation of AfC in the presence of anti-IMDH B sera and normal complement (sample 2) results in reduced germination as compared to samples incubated in the presence of preimmune or unrelated sera (samples 5 and 8, respectively).
WO 2004/108765 PCT/DK2004/000407 56 Figure 13. Incubation of AfC in the presence of anti-IMDH B IgG and normal complement results in reduced germination as compared to samples incubated in the presence of preimmune or anti-KLH IgG. 5 Figure 14. An alignment of IMDH B 1 versus IMDH B 2. Figure 15. Immunofluorescent microscopy analysis of A. fumigatus ATCC 46640 performed with antisera raised against MAP molecules. AfC and AfM were stained with both pre- and post-immunisation sera. 10 Figure 16. Immunofluorescent microscopy analysis performed with a clinical isolate using antisera raised against GAP-B-2. AfC were stained with both pre- and post immunisation sera. 15 Figure 17. Western blot experiments illustrating the detection of (A) recombinant enolase with anti-his (lane 1) and anti-enolase (lane 3; ENO-2, see Table 3) antibodies, but not with pre immune serum from the animal used to produce anti enolase sera (Lane 4); and (B) native enolase in the cell membrane of AfC by anti enolase (ENO-2, see Table 3) antibodies (lane 6). 20 Figure 18. An alignment of part of SEQ ID NO:36 with a homologous sequence from Candida albicans, derived from publicly available nucleotide sequences (contigl9 10262 in the Ca-Assemblyl9.contigs). 25 Figure 19. An alignment of part of SEQ ID NO:36 with Aspergillus nidulans homolog (ACCESSION: AnrP4374925 - DESCRIPTION: LE3BASPNG 3-isopropylmalate dehydrogenase B (Beta-IPM dehydrogenase B) (IMDH B) (3-IPM-DH B) [Aspergillus nidulans FGSC A4] DBXREF: gi|407440451gb|EAA63227.1) 30 Figure 20. An alignment of part of SEQ ID NO:36 with Aspergillus oryzae homolog (ACCESSION: AnrP3711474 - DESCRIPTION: hypothetical protein [Aspergillus oryzae] DBXREF: gij27901558|dbjlBAC55906.1).
WO 2004/108765 PCT/DK2004/000407 57 Figure 21. An alignment of part of SEQ ID NO:36 with Aspergillus nidulans homolog (ACCESSION: AnrP4379986 - DESCRIPTION conserved hypothetical protein [Aspergillus nidulans FGSC A4] DBXREF: gi1407412021gb|EAA60392.1). 5 Figure 22. An alignment of part of SEQ ID NO:36 with a Coccidioides posadasii homolog: TIGR 222929/contig 1772 C. posadasii C735. Figure 23. An alignment of part of SEQ ID NO:36 with a Cryptococcus homolog. Ref.nr.: chr01lb.b3501.031220.cl 1. 10 Figure 24. ClustalW of IMDH B homologs from figures 18-22. Figure 25. Continuation of figure 24. 15 Examples Example 1. Identification of peptides in extracts of A. fumiqatus. A number of protein purification procedures were used to facilitate identification of A. fumigatus proteins that are secreted, cell-surface exposed or cell-wall associated. 20 Proteins were then identified from these extracts via mass spectrometry techniques. Culture of A. fumigatus. A. fumigatus conidia (AfC) of strain NCPF 2140 or ATCC 46640 were routinely prepared by inoculation of malt agar plates with AfC and subsequent growth at 30 0 C for 10 days. 25 Preparation of a diffusible extract from A. fumigatus conidia. A. fumigatus Diffusate (AfD) was routinely prepared as follows. AfC (2 x 108) were added to water (0.5 ml) containing protease inhibitors (Roche, cat. no. 1 697 498) and the mixture was vortexed and then sonicated to solubilise the AfC. The resultant solution was 30 incubated for 1 hour at 371C, with shaking. AfD was then separated from washed spores by passage through a 0.2 mrn filter, or, by centrifugation (3000 x g) of washed spores and passage of the AfD through a 0.2 pLm filter. Preparation of surface-exposed protein extracts from A. fumigatus conidia. Washed 35 AfC (2.0 x 1010) were resuspended in 1 ml of PBS (0.01 M phosphate buffer, 0.0027 WO 2004/108765 PCT/DK2004/000407 58 M potassium chloride, 0.137 M sodium chloride, pH 7.4) containing a reducing agent (10 mM Tris 2-carboxy-ethyl phosphine (TCEP)) and incubated for 20 min at room temperature. AfC were pelleted by centrifugation (20000 x g, 30 min) and washed in PBS to remove TCEP before being resuspended in a trypsin-solution (seq. grade 5 modified porcine trypsin, Promega cat. no. V5111, 20 gg/ml PBS) and incubated for 30 min at room temperature. AfC were then removed by centrifugation and filtration. To get rid of any conidia in the supernatant, the supernatant was purified using a YM-10 column (from Millipore, cat. no. 4206, 5000xg, 40C for 30 min.) and the supernatant was incubated over night at 370C with shaking at 40 rpm. The 10 supernatant was concentrated using a SpeedVac concentrator, 1 p.1 was added to 6 p1 5% formic acid, and the resultant solution was analysed via mass spectrometry. Preparation of cell wall extracts from A. fumigatus conidia. AfC solutions (20 ml; 1.8 x 108 conidia/ml) were prepared in both PYG (C rich) (Peptone-yeast extract and 15 glucose: 0.1% peptone, 0.1% g yeast extract and 0.3% glucose) and HBSS (C poor) (HANKS 1X from Gibco, Invitrogen (cat. no. 24020-083)) media. These solutions were vortexed for 3 min, sonicated for 5 min and then incubated for 4 hours at 370C with shaking (160 rpm). AfC were pelleted by centrifugation (6000 x g, 30 min) and the supernatant from the HBSS incubation was collected and passed through a 0.2 20 pm filter. The supernatant from the PYG was discarded. Both AfC pellets were washed with 5 ml HBSS and pelleted as before. To each pellet 1 ml of lysis buffer (2% Triton, 1% SDS, 10 mM Tris (pH=2), 1 mM EDTA, 100 mM NaCI, 1 proteinase inhibitor tablet (Roche, cat. no. 1 697 498) and approx. 500 R1 glass beads (200-300 microns) were added. The resultant solution was then incubated in a water bath 25 sonicator for 40 min, vortexed for 30 min, chilled on ice for 5 min, and finally vortexed for another 30 min. Glass beads were then removed from the sample and conidial walls were sedimented by centrifugation at 1200 x g for 10 min. The supernatant was removed and stored for future use. 30 Conidial wall enriched pellets were washed three times with 1 ml of cold distilled water, resuspended in 250 p1 of 2% (w/v) SDS, 1% (w/v) 2-mercaptoethanol solution and boiled for 5 min. The resultant solution was centrifuged (10,000 x g for 15 min), the supernatant was transferred to a new tube, and added to 1 ml ice-cold acetone prior to an overnight incubation at -301C. Precipitated proteins were pelleted (20,810 35 x g for 45 min) and dried in a SpeedVac for 15 min to remove residual acetone.
WO 2004/108765 PCT/DK2004/000407 59 Pellets were resuspended in ddH20, and proteins were separated -on an SDS PAGE according to standard procedures. Resultant gels were then visualised via silver staining. 5 Analysis of A. fumigatus protein extracts by mass spectrometry. Analysis of -A. fumigatus proteins separated by SDS-PAGE was performed as follows. Fragments of SDS-PAGE gels, corresponding to specific protein bands, were extracted and placed in sodium bicarbonate solution (50 mM NH 4
HCO
3 ). These gel plugs were then washed twice with 50 mM NH 4
HCO
3 in 50% ethanol for 30 min and dehydrated 10 by incubation in 96% ethanol for 10 min. Reduction and alkylation was performed by incubating in reducing solution (50 mM DTT, 50 mM NH 4
HCO
3 ) for 45 min at 56 0 C followed by a 30 min room temperature incubation in alkylation solution (55 mM iodoacetamide, 50 mM NH 4
HCO
3 ) in the dark. Two cycles of washing and dehydration were then performed prior to the addition of 10 p1l trypsin solution (12.5 15 ng/gl trypsin in 50 mM NH 4
HCO
3 (seq. grade modified porcine trypsin, Promega batch no. V51 1X 14755007)). After 15 min an additional 20 gl of sodium bicarbonate solution was added and the digests were incubated overnight at 37 0 C. Samples were then extracted twice by 30 min incubations, with shaking, in 3 A1 of 20% trifluoroacetic acid, and 20 p1 of a solution containing acetonitrile (10%) and 20 trifluoroacetic acid (1%). Both extracts were pooled, dried down, and resuspended in 9% of 5% formic acid prior to analysis via LC-MS. Peptide and fragment mass tolerance was set to 200 ppm and 0.5 Da, respectively. Search parameters were adjusted to include oxidation of Met, the addition of alkyl of 25 polyacrylamide groups to Cys, and trypsin was allowed to miss one cleavage site per peptide. Search parameters for analysis of cell surface peptide fragments were adjusted to include oxidation of Met, trypsin was allowed to miss one cleavage site on each 30 peptide; and, peptide and fragment mass tolerance was set to 100 ppm and 0.3 Da, respectively. Following the identification of a peptide sequence, a TBLASTN was performed against A. fumigatus shotgun sequences in the public domain. This identified all 35 shotgun sequences capable of encoding the peptide fragment. These shotgun WO 2004/108765 PCT/DK2004/000407 60 sequences were then used to extract all other shotgun sequences that shared regions of homology of at least 40 bp in length with no less than 90% identity. All appropriate shotgun sequences were then formed into a contiguous sequence using Seqman. Resulting contigs were submitted to a GenScan search using maize, 5 arabidopsis, and human parameters. Output predicted protein sequences were then compared with the encoding nucleotide sequence and with the sequences of protein homologues to facilitate the prediction of a potentially more accurate protein sequence. Resulting predicted nucleotide and peptide sequences were then entered into appropriate in-house databases and MASCOT searches were then rerun 10 against a database containing these newly predicted proteins. For isopropylmalate dehydrogenase B, mismatches were found between the peptide found by peptide sequencing and the corresponding polypeptides predicted from the nucleotide sequences in the database. The mismatches may be due to differences between strains due to mutation or to sequencing errors. Furthermore, an MS instrument 15 does not differentiate between a leucine and an isoleucine. Mutations in this region may have significant structural implications and alter the thermostability of the enzyme, as has been described for a homologous enzyme from Thermus thermophilus (Qu et al. 1997 Protein Eng. 10, 45-52). 20 The peptides identified in the Diffusate, Cell-surface exposed, and Cell-wall fractions are shown in Table 1. The corresponding predicted protein sequences are given in Figure 1. SEQ ID NO:38 and SEQ ID NO:39 are predicted polynucleotide sequences encoding isopropylmalate dehydrogenase B (SEQ ID NO:36). 25 Peptides from both hydrophobin and the hypothetical protein were identified in all three fractions indicating both to be cell-wall-associated proteins that are exposed on the surface of the AfC while also being secreted/released into the surrounding milieu. Based on these data we propose to name the newly identified, former hypothetical, protein Conidial Surface and Secreted protein I, Cssl. It was also 30 interesting to note the presence of GAPDH in the AfD and cell wall; .enolase in the AfD; IMDH B in the cell-surface-exposed fraction and of cell wall located, and surface exposed variants of catalase. Since the procedures used to purify and identify these peptides are biased for proteins of high abundance, one can also conclude that they are expressed in relatively high copy numbers. 35 WO 2004/108765 PCT/DK2004/000407 61 Example 2. Bioinformatic analyses SignalP predictions were performed using the parameters recommended for a eukaryotic protein, while Antigenicity index studies were performed using the default 5 parameters determined by DNAStar. BLAST searches were performed using default parameters. Analysis of Cssl for the presence of a signal peptide. The group who reported the original hypothetical sequence predicted an N-terminal signal peptide of 24 residues 10 (NCBI entry CAD29600. Protein AfA35G10.07). However, a repeat of these studies using the SignalP program with default parameters (Nielsen et al. (1997) Protein Engineering 10, 1-6) indicates the presence of a 47-residue signal peptide with predicted signal cleavage occurring between A47 and R48. 15 Analysis of the predicted protein sequence of Cssl. A brief overview of the sequence of this protein reveals the two most abundant residues to be E and Q, which comprise 9.62% and 8.64%, respectively, of all residues in the protein. A closer analysis revealed that 67% of charged residues (D, E, K, R) are located in the C-terminal half of the protein (see Table 2), and 62% of 20 hydrophobic residues (A, I, L, F, W, V) in the N-terminal half. The sequence of CssI was analysed via the antigenicity index programme of Jameson and Wolf (1988). This programme predicted the C-terminal half of the protein to be most antigenic (see Figure 2). 25 BLAST analysis of Cssl revealed the absence of a protein with high homology. However, a number of proteins displayed low, yet significant, levels of homology. One such protein, ORF73 of Human herpesvirus 8, is the Latency associated nuclear antigen (LAN/LANA) that is used as a marker for Kaposi's sarcoma. It 30 displays 26% identity and 46% similarity to the C-terminal half of Cssl. This region of LANA is rich in Q and E repeats and is located in the middle of the protein. It has been suggested that similar regions of acidic repeats often function in transcriptional activation in viral and cellular transcription factors (Struhl, 1995, Annu. Rev. Genet. 29, 651-674). LANA has been shown to be capable of modulating both viral and 35 cellular gene expression (Renne et al., 2001, J. Virol. 75, 458-468).
WO 2004/108765 PCT/DK2004/000407 62 GAPDH sequences. An attempt to construct a gene sequence for this protein revealed the presence of at least three genes in Aspergillus fumigatus that are capable of expressing a GAPDH-related protein. These predicted proteins have 5 been labelled GAPDH-A, GAPDH-B, and GAPDH-C. A number of differences exist between these two proteins (see Fig 3). However, it is possible to conclude that only GAPDH-B has been identified to date. An inability to identify GAPDH-A or -C, to date, could be due to a number of reasons, e.g., a failure to be expressed under laboratory conditions; or, to the absence of an appropriate predicted protein 10 sequence in the databases. The fact that only GAPDH-B was identified in cell wall and secreted preparations indicates that this version of the protein is likely to be primarily a cell-wall variant, and perhaps GAPDH-A and -C the cytoplasmic variants. GAPDH-A and GAPDH-B share 73% identity and 85% similarity over a over a 15 stretch of 269 residues. The more divergent GAPDH-C shares only 43% identity with both GAPDH-A and GAPDH-B. An analysis of all three sequences via an InterProScan revealed all three to be GAPDH sequences. However, only proteins A and B had sequences that matched to the active-site motif ([ASV]-S-C-[NT]-T-x(2) [LIM]). This could imply that C does not function as a true GAPDH protein. Upon 20 closer analysis of the sequences it is apparent that C contains a V residue, instead of [LIM], at the last position in the motif. Considering that V, L, M, and I are all hydrophobic residues, it is unlikely that the difference will result in a non-functional GAPDH active site. 25 Isopropylmalate dehydrogenase B sequence. The closest homologues of the predicted isopropylmalate dehydrogenase sequence were previously described enzymes from A. niger, (accession number in NCBI database P87257 (77% identity over 363 aa)) and A. oryzae, (accession number in NCBI database BAC55906 (52% identity over 367 aa)). 30 Homology to human proteins and essentiality to A. fumigatus. Of the protein mentioned above, neither Cssl, IMDH B nor Hydrophobin have any significant human homologues. Both enolase (61% identical, 77% similar) and GAPDH (77% identical/ 83% similar), on the other hand, do have human homologues over the full length of the protein. However, due to the small size of any given epitope, and to the WO 2004/108765 PCT/DK2004/000407 63 specificity of antibodies in general, it is likely that a suitable antibody can be found to distinguish A. fumigatus versions from the human versions. Peptides for antibody production 5 The peptides found in the mass spectrometry analysis were used for antibody production. Some of them were extended with flanking residues from the predicted or known sequences. Example 3. Generation and properties of anti-AfM and anti-IMDH antibodies 10 Methods Phosphate buffered saline PBS tablets (Sigma) were used to produce a final solution of 0.01M phosphate 15 buffer, 0.0027 M KCI and 0.137 NaCl, pH 7.4 at25 0 C. Generation of anti-Aspergillus fumigatus mycelia (anti-AfM) antibodies AfM-rich preparations were grown as follows: 10E5 AfC were added to 10 ml RPMI and incubated for approximately 10 hours at 37 0 C. AfM were then harvested by 20 centrifugation and washed twice in PBS. These preparations were fixed by incubation in 3% formaldehyde for 30 min at room temperature, washed and 100 Rg quantities injected into rabbits according to the following protocol. Null sera was collected from New Zealand White female rabbits (4-6 months old, 25 approximately 3 kg) prior to immunisation with 100 pg AfM and Freunds complete adjuvant. A booster was administered on day 14 in conjunction with Freunds incomplete adjuvant and again on day 28. The first and second bleeds were harvested on days 42 and 72, respectively, before the final bleed was taken on day 93. Subsequent analysis via immunofluorescent microscopy and western blotting 30 demonstrated that the rabbit raised an Ab-based immune response against AfM. IqG purification IgG was then purified from this sera using the MabTrap kit (Amersham) in accordance with the manufacturers instructions. Fab fragments were purified from WO 2004/108765 PCT/DK2004/000407 64 IgG via Immunopure Fab kit (Pierce) again in accordance with the manufacturers instructions. Adhesion assay protocol 5 A549 cells (1 x 105) (DeHart et al. (1997) J. Infect Dis. 175(1):146-150) were seeded into the well of a Lab-Tek II 8 well chamber slide (Nalge Nunc International) and grown overnight. A solution of AfC (1 x 10 8 /ml) was prepared in RPMI medium, vortexed for 10 min and sonicated for 10 sec to suspend the AfC (in house studies have demonstrated that greater than 99% of AfC are viable after this step). The AfC 10 population was then aliquoted, IgG preparations added where appropriate, and the samples incubated with shaking for 30 min at 37 0 C. A549 cells were prepared by washing three times with 400 Il F12K media. If required, purified protein was pre incubated with A549 cells for 30 mins at 370C after which the cells were washed three times with 400 pl F12K media. Finally, 190 p1 of F12K was added to each 15 well, prior to the addition of 10 p1 (1 x 106 AfC) of the appropriate AfC solution. The samples were then incubated at 370C for 60 min. Unbound AfC were removed by washing 4 times with F12K media and A549 cells were detached using 400 p.l trypsin EDTA. Following detachment the solutions were removed from the wells, stored in an eppendorf, and sonicated at medium intensity for 10 s to lyse 20 mammalian cells. Finally, 0.03% Triton-X-100 was added to each solution to ensure that the AfC existed in a single cell form. The quantity of AfC in each sample was then determined by counting using a haemocytometer. All assays were run in triplicate. 25 Antigen identification via IP with anti-AfM antibodies Resultant IgG preparations were used, in conjunction with the Affigel kit (Biorad), to prepare an anti-AfM affinity column. This was done in accordance with manufacturers instructions. Thus, 20 mg of anti-AfM IgG was coupled to 200 p1 affi gel and the resultant column was rotated overnight with 100 mg of whole AfM lysate 30 prepared in PBS. A column containing 200 [1 affi-gel without IgG was also treated in the same manner. The supernatant was then removed and the gel washed twice with 0.5 ml PBS adjusted to 0.5 M NaCl. Washing was then performed with 0.5 ml PBS adjusted to 0.25 M NaCI and samples were eluted with 100 p1 0.2 M Glycin-HCI pH 2.5. Following storage on ice for 5 mins the samples were neutralised via the 35 addition of 24 pl of 1 M Tris-HCI pH 8.5 and separated via SDS-PAGE.
WO 2004/108765 PCT/DK2004/000407 65 Amplification and cloning of the cDNA copy of IMDH B Total RNA was purified from 1x10 9 AfC using the RNAEasy Kit (Qiagen) in accordance with manufacturers instructions. In order to design oligonucleotide 5 primers to assist in the amplification of the cDNA, the sequence of the IMDH B was predicted using a number of bioinformatic steps. First, peptides identified via LCMS were BLASTED against the A. fumigatus shotgun database. All sequences matching the peptide were then aligned to produce a large contig sequence that was then input into the gene prediction program Genscan. This produced a number of 10 predicted gene sequences and those that were predicted to encode the peptide identified via LCMS were selected for further study. IMDH B genes from other organisms that displayed homology to the A. fumigatus sequence were also used to assist in the selection of the most likely STOP and START codon. Thus, 18-mer oligos (F: 5'-ATGGTAACTACTTACAAC-3' (SEQ ID NO:44); R: 5' 15 TGAACTACCCTGCAACGC-3' (SEQ ID NO:45)) were designed and used to amplify a cDNA copy of the Af IMDH B gene using the Superscript One Step kit from Invitrogen in accordance with manufacturers instructions. Following amplification the product was cloned into pBAD using the TOPO TA cloning kit (Invitrogen) and sequencing was used to confirm the sequence and orientation of the insert. 20 Sequencing Sequence reactions were performed using the BigDye terminatorv3.1 (Applied Biosystems) kit in accordance with the manufacturers instructions. 25 Expression of heterologous proteins Upon identification of a clone containing the desired sequence a number of experiments were performed to identify the optimal expression conditions for the heterologous protein. These revealed optimal expression when induced with 0.02% arabinose for 4 hours. Proteins were then purified via utilisation of pBAD encoded 30 his-tag sequence. Preparation of bacterial lysates Each liter of E col culture was induced for four hours with 0.02% arabinose and bacterial cells were harvested by centrifugation (5000 rpm, 15 min). The bacterial 35 pellet was then resuspended in 25 ml cold native buffer (20 mM NaPO 4 , 500 mM WO 2004/108765 PCT/DK2004/000407 66 NaCI, 25 mM imidazole, pH 7.4), and the solution supplemented with 2 protease inhibitor tablets (ROCHE, complete-EDTA free Protease inhibitors) and 625 lIl lysozyme (25 gg/pl) before incubation on ice for I h. The solution was then sonicated for 4 min, subjected to a cycle of freeze thaw, and 7.5 pl benzonase (362 units/pl) 5 added prior to incubation on ice for 20 minutes. In order to assist in the removal of insoluble components the solution was centrifuged at 5000 x g for 20 min and the supernatant harvested. This step was repeated twice more and the cleared lysate then analysed via SDS-PAGE. 10 Preparation of nickel sepharose columns for purification of his-tagged proteins Purification of recombinant proteins was performed using Probond resin (invitrogen), a nickle-sepharose based resin that utilises the pBAD-encoded his-tag on the heterologously-expressed recombinant protein. All centrifugation steps were 15 performed at 800 x g for 2 min. The resin was resuspended by inverting and gently tapping the container and 2 ml slurry of resin was added to an Econo-Pac Chromatography Columns (BioRad, Cat. No. 732-1010) for equilibration. The column was centrifuged and the supernatant discarded. The resin was then washed with 10 ml sterile water, and again the supernatant discarded following 20 centrifugation. Next, the resin was resuspended in 10 ml Native buffer (20 mM NaPO 4 , 500 mM NaCI, 25 mM imidazole, pH 7.4), centrifuged and the supernatant discarded. This process was repeated twice. Finally the resin was resuspended in 1 ml native buffer giving a final volume of 2 ml. 25 Application of lysate, washing and elution of purified protein The bacterial lysate containing the recombinant protein was added to the column containing the equilibrated resin and the mixture incubated on a roller for 100 min at 41C. The mixture was then centrifuged at 800 x g for 2 min and the supernatant poured off and saved. The resin was then allowed to settle, the column plug was 30 removed and the liquid allowed to flow through. The run through from this step, and all subsequent steps, was collected for SDS-PAGE analysis. The column was then washed with 20 ml Native buffer (20 mM NaPO 4 , 500 mM NaCI, 25 mM imidazole, pH 7.4) a total of 5 times and the protein eluted protein by applying 20 ml Native elution buffer (20 mM NaPO 4 , 500 mM NaCI, 250 mM imidazole, pH 7.4) and WO 2004/108765 PCT/DK2004/000407 67 collecting ten 2 ml aliquots. SDS-PAGE analysis was then performed to determine the outcome of the procedure. Gel filtration purification of nickel sepharose purified IMDH B 5 Probond purified IMDH B was first desalted via dialysis in PBS (dialysis tubing 12 14000 Daltons, Visking). Gel filtration was performed using a HiPrep 16/60 Sephacryl S-200 High Resolution column (Amersham Biosciences). Preparation, equilibration and cleaning of the column was completed according to the manufacturers instructions. Protein purification was performed with a Tris running 10 buffer (10 mM Tris + 0.15 M NaCI, pH 8) at an approximate flow rate of 0.25 milmin. Batches of his-tagged protein (10-20 mg) were added to the column and were eluted using 80 ml running buffer, a void volume of approximately 40 ml was calculated and 18 x 2 ml fractions were collected. 15 Generation of anti-IMDH B antisera. Probond-purified protein was used to immunise New Zealand White female rabbits (4-6 months old, ~3 kg). Pre-immune sera were harvested on day 1 prior to immunisation with 100 pg of protein in the presence of Freunds complete adjuvant. Further immunisations were also carried out on days 28 and 49 in the presence of 20 Freunds incomplete adjuvant. Blood samples were taken on days 28, 42, 69 and finally on 87. IgG and Fab fragments were prepared as previously described. Immunofluorescent microscopy Immunofluorescence microscopy slides were first cleaned in a detergent solution 25 and rinsed in distilled water. The slides were then incubated in coating solution (0.1% gelatin [w/v], 0.01% [w/v] chrome alum) and allowed dry at room temperature. Harvested AfC spores were placed onto the well of a treated immunofluorescence microscopy slide and the slide was washed three times with PBS to remove unbound AfC. If AfM were required 30 gl RPMI was added to the surface of the well 30 and the slide incubated at 370C for 12-14 hours before washing with PBS. IgG (30 pl, 1:500 dilution in PBS) was then added to each well and incubated at 370C for 30 min in a moist environment. The wells were washed three times with PBS before the addition of Alexa Fluor 488 goat-anti-rabbit IgG (30 g1 of a 1:400 dilution prepared in PBS) to each well. Again the slides were incubated at 370C for 30 min in a moist 35 environment, washed three times with PBS and then fixed in 3% formaldehyde for WO 2004/108765 PCT/DK2004/000407 68 30 min at room temperature. The slides were washed three times in PBS, allowed to dry and then a drop of Sigma oil was added to the surface and a coverslip applied. This was sealed with nail polish and the slides stored at 40C in the dark until use. All wells were scanned in both bright and fluorescent fields. 5 Determination of the ability of IgG to inhibit conidial germination AfC were resuspended in RPMI medium and the concentration adjusted to give a solution containing 1 x 106 AfC ml. 0.5 ml of this solution was then added to an eppendorf and 10 pl of each IgG/serum sample added to 3 aliquots of AfC. Normal 10 fresh rabbit serum was added to one aliquot, heat-inactivated (6000 for 30 min) serum to the second, and 10 pl PBS to the third. The samples were then incubated for 7 hours at 200 rpm. The total number of cells was then counted and the number of conidia that have germinated, or started to produce a germ tube, determined. Percent filamentation equals the number of cells with germ tubes divided by the total 15 number of cells. Generation of sera against predicted antiqenic peptides of target proteins Analysis of target proteins was performed with the aim of identifying a number of antigenic peptides within each target sequence. The peptides chosen (see table 3 20 below) correspond to those that were identified during mass spectrometry procedures used to identify surface exposed peptides (see table 1) and to those predicted to be most antigenic (Jameson, B.A. & Wolf, H (1988) Comput Appl Biosci 4, 181-186). 25 Peptides and antisera were produced in accordance with Sigma's standard Custom Peptide Synthesis and rabbit immunisation protocols. The peptides were produced as part of their multiple antigenic peptides (MAP) service.The immunisation protocol used is as follows: on day 0 pre-immune sera was collected from New Zealand white rabbits which were then immunised with 200 pg of MAP in complete freunds 30 adjuvant (CFA). A second immunisation was performed on day 14 with 100 Rg in Incomplete freunds adjuvant (IFA). This immunisation was repeated on days 28, 42, 56 and 70. Bleeds were taken on days 35, 49, 63, and finally on day 77. 35 WO 2004/108765 PCT/DK2004/000407 69 MS analysis In-gel digestion The gel bands are washed two times with 25mM NH 4
HCO
3 /50% ethanol. The 5 cysteine residues are reduced (DTT) and alkylated (iodoacetamide), followed by 2 cycles of wash and dehydration of the gel bands. Washing buffer is 50mM NH 4
HCO
3 and dehydrating agent is ethanol. After the last dehydration step, the digestion is started by addition of protease, dissolved in suitable digestion buffer. Default enzyme is trypsin for which a 50mM NH 4
HCO
3 /10% Acetonitrile digestion buffer is 10 used. The digestion takes place over night at 37 0 C. The resulting peptide pool are extracted with TFA and formic acid and analysed by mass spectrometry. The handling of all samples takes place in a dust free environment with a minimum of manual handling to avoid keratin contamination. 15 MALDI-TOF sample preparation and analysis The peptide mixture extracted after in-gel digestion is analysed by a fully automated procedure on an Ultraflex Bruker MALDI-TOF mass spectrometer. A peptide mass fingerprint is recorded and each spectrum is annotated and internally calibrated using trypsin auto-digest peaks. Sample preparation: 20 1. A 96 tip robot is used to prepare a Bruker 384 polished steel target with a nitrocellulose/E-cyano-4-hydroxy-cinnamid acid (HCCA) matrix. 2. Approximately 5% of the sample is added to the matrix (1,5 l1). 3. When the sample is completely dry, it is washed with 0.1% TFA and is now 25 ready to be analysed in the Bruker mass spectrometer. Database search The resulting peak list is used in a database search that is performed using Mascot software (MATRIX SCIENCE). 30 The database is a non-redundant database (NRDB) based on data from NCBI. Results Antigen identification via IP with anti-AfM antibodies 35 An affinity column consisting of anti-AfM lgG was used to immunoprecipitate the most antigenic proteins from an AfM lysate. Eluted samples were separated via WO 2004/108765 PCT/DK2004/000407 70 SDS-PAGE and then analysed via LC MSMS analysis, which revealed 3 isopropylmalate dehydrogenase B (IMDH B) to be the prime target of anti-AfM antibodies, suggesting IMDH B to be the main antigen of AfM (figure 4). 5 Anti-AfM antibodies bind to the surface of AfM giving a considerably higher signal than the null sera. IFM studies revealed that anti-AfM antibodies bound to both AfM and AfC giving a higher signal than was observed with null sera. This again suggests IMDH B to be a major surface antigen of both conidia and mycelia (figure 5). 10 Anti-AfM Fab fragments reduce the proportion of AfC that adhere to A549 cells Having substantiated that IMDH B is a major surface antigen of both AfC and AfM it was decided to analyse the potential ability of anti-IMDH B antibodies (in the form of anti-AfM antisera) to interfere with the pathogenicity of AfC. Thus, adhesion assays 15 were performed where the ability of AfC, pre-incubated in IgG, to bind to lung epithelia was measured. These studies indicated that antibodies, in the form of Fab fragments, were indeed capable of reducing adhesion of the organism to lung epithelia (figure 6). Without being bound by any theory, it is believed that the Fabs possess the ability to reduce adhesion to lung epithelia by interfering with the 20 interaction between a receptor and its ligand, either by binding an adhesin and preventing its function, or by binding to the AfC surface and sterically inhibiting the function of an underlying adhesin. While IgG molecules may also possess such properties, the Fc region is capable of binding Fc receptors on the surface of the mammalian cells, an event which has the potential to elevate adhesion of AfC. 25 Cloning, expression and purification of recombinant IMDH B A copy of cDNA encoding IMDH B was successfully cloned into pBAD and the sequence of the insert confirmed (see SEQ ID NO:46 and SEQ ,ID NO:47). The protein was expressed following induction with 0.02% arabinose for 4 h and purified 30 to a high degree of purity using nickel speharose and gel filtration columns (figure 7). The nickel sepharose purified fraction was used to immunise rabbits and this procedure was successful in generating anti-IMDH B antibodies (figure 8). IFM analysis also confirmed that anti-IMDH B IgG bound to the surface of AfC and AfM (figure 9), thus confirming the surface localisation of IMDH B. 35 WO 2004/108765 PCT/DK2004/000407 71 IFM analysis of clinical isolates IFM analysis was performed on a number of clinical isolates to confirm. the presence or absence of surface expressed IMDH B. All clinical isolates were purchased from the Belgian Co-ordinated Collections of Micro-organisms (BCCM
TM
). Their features 5 and reactivity to anti-IMDH B IgG are listed in Table 4. Post-translational modifications A number of studies were performed with the aim of identifying the presence of post translational modifications in the recombinant IMDH B protein. These studies took a 10 number of forms. First, MALDI analysis was performed with the aim of identifying all of the predicted tryptic fragments of the protein. Thus the protein was digested with trypsin and analysed via MS. Using this method it was possible to get 84% sequence coverage: (SEQ ID NO:47 (vector-derived sequences in italics, sequences identified by MALDI analysis underlined)) 15 MGSGSGDDDDLALMVTTYNILVLPGDGIGPEVMTEAVKVLKVFENEHRKFNLRQELIGGCSIDAHGKSVTEEVKK AALESDAVLFAAVGGPKWDHIRRGLDGPEGGLLQLRKAMDIYANLRPCSASSPSASIAKEFSPFRQEVIEGVDFVV VRENCGGAYFGKKIEEEDYAMDEWGYSEREIQRITRLSAEIALRHNPPWPVISLDKANVLASSRLWRRVVEKTMTT EYPQVKLVHQLADSASLILATNPRALNGVILADNTFGDMISDQAGSIVGTLGVLPSASLDGLPSETRKRTNGLYEP 20 THGSAPTIAGQNIANPVAMILCVALMFRYSLDMETEAQRIEKAVQGVLDAGIRTPDLGGKSGTNEVGDAIVAALQG SSKGELEGKPIPNPLLGLDSTRTGHHHHHH. SDS-PAGE and time of flight analyses of the predicted 44233 Da Protein revealed apparent masses of 45000 Da and 44235 Da, respectively. In total, these studies 25 did not provide any evidence indicating the presence of post-translational modifications. Adhesion assays results A number of studies support the theory that IMDH B acts as an adhesin. Thus, pre 30 incubation of AfC with anti-IMDH B Fab fragments produced a decline in the number of adherent AfC in comparison to AfC that had been pre-incubated in the presence of Fab fragments isolated from pre-immune sera (see figure 10). Furthermore, pre incubation of A549 epithelia with varying quantities of recombinant IMDH B, followed by washing to remove unbound protein, suggested that the protein had sequestered 35 the receptor on the surface of the A549 cells and thus prevented the AfC from adhering (see figure 11).
WO 2004/108765 PCT/DK2004/000407 72 Germination inhibition experiments A number of experiments were performed to determine the ability of anti-IMDH B antibodies to reduce germination of AfC in the presence of normal or heat 5 inactivated rabbit serum. These experiments revealed that only anti-IMDH B heat inactivated sera in the presence of fresh rabbit sera possessed the ability to reduce the rate of germination of AfC (see figure 12). Further studies revealed that purified anti-IMDH B IgG in the presence of normal rabbit serum also possessed the ability to reduce germination of AfC in comparison to null IgG (see figure 13). 10 Identification of a second copy of IMDH B Further bioinformatic analysis revealed the presence of a second region on the Af genome that displays homology to the IMDH B gene and that is predicted to encode a protein that is 50% ID and 63% similar to IMDH B 1 (for alignment, see figure 14). The sequence of the respective gene and protein were predicted by BLAST 15 analysis. Features of this protein are displayed below. Predicted Features of gene/protein compared to ACE5033 (IMDH B 1) IMDH B 2 ACE5033 Number of exons 5 3 20 Size of ORF 1093 bp 1107 bp Protein length 363 residues 368 residues Protein size 38723 Da 39773 Da pl 5.26 5.32 Identity to ACE5033 53% (over full length) -- 25 Similarity to ACE5033 69% (over full length) - IMDH B 2 contains the final predicted ORF sequence (SEQ ID NO: 40): atgccgtcatataacattgtcgttttcgctggggaccactgtggtccggaggtaagttcggtcctgcgcgtcatcgagaa gtgccgtgacgatgctaccttcaacctccaggatcaattgctcggtggtgtaagttcgatcgatgctaccggatctcccc 30 ttaccgacgaagctcttaacgccgcaaagaacgccgatgccgttctctcggtgccattggcggtcccaaatggggcact ggcgccgtccgccccgaacagggcctcctccgtctgcgcaaggagatgggcacattcggtaacctacgcccctgcaactt cgccgccccgtcgctggtcgacggctcccctctccgccccgaagtctgccgcggcgtcgacttcaacattatccgcgaac tgaccggtggcatctacttcggcgaccgcaaggaggacgacggcagcggcttcgccatggacacggagccgtactcccgc gcggagatcgagcgcatcacccgccttgcggcccacctcgctctgcagcacaacccccctcttcccgtgtggagcttgga 35 caaggacaacgtcctcgcgacgagccggctgtggcggaagacegtgacggaggtcatggccaaggagttcccccagctca aggtggagcaccagctcattgactccgcggccatgatcatggtcaaggagcctagaaagcttaacggtattgttgtcact agcaacctgttcggtgacatcatcagtgatgaagccagcgttatccctggttctctgggactcttgcccagcgcaagctt gagcggcattcctgacggaaagaccaaggtcaatggtatctatgagcctattcacggttctgcccctgacattgccggca agggcatcgttaaccccgtcgccgccattctctctgtcgccatgatgatgcagtactccctgaaccgtatggatgacgcc 40 agggccatcgagacggccgtccgcaatgtgatcgaggccggtatccgcactgccgatattggcggcaagtcgacaactag cgaggtcggtgacgctgttgctgccgagctggagaagctgttgaagcaatagt WO 2004/108765 PCT/DK2004/000407 73 This encodes the following protein (SEQ ID NO: 41): MPSYNIVVFAGDHCGPEVSSVLRVIEKCRDDATFNLQDQLLGGVSSIDATGSPLTDEALNAAKNADAVLLGAIGGPKWGT GAVRPEQGLLRLRKEMGTFGNLRPCNFAAPSLVDGSPLRPEVCRGVDFNIIRELTGGIYFGDRKEDDGSGFAMDTEPYSR AEIERITRLAAHLALQHNPPLPVWSLDKANVLATSRLWRKTVTEVMAKEFPQLKVEHQLIDSAAMIMVKEPRKLNGIVVT 5 SNLFGDIISDEASVIPGSLGLLPSASLSGIPDGKTKVNGIYEPIHGSAPDIAGKGIVNPVAAILSVAMMMQYSLNRMDDA RAIETAVRNVIEAGIRTADIGGKSTTSEVGDAVAAELEKLLKQ Example 4. Studies performed on additional ACE targets 10 Generation of sera against predicted antiqenic peptides of target proteins Following the identification of a number of novel proteins on the surface of the AfC it was decided to further these studies through the production of antisera that had been raised against multiple antigenic peptides (MAP) of the novel molecules. 15 Thus, two peptides from each chosen target were selected (see table below) and the information relayed to Sigma who produced the peptides and antisera in accordance with their Custom Peptide Synthesis and rabbit immunisation protocols. The peptides chosen (see table 3) correspond to those that were identified during mass spectrometry procedures (see table 1) and to those predicted to be most 20 antigenic using the guidelines supplied by Sigma. IFM analysis with sera raised against MAP molecules Following the production of MAPs and the corresponding antisera, IgG was purified and used in IFM experiments to assist in the confirmation of the surface expression 25 of the various target molecules. The results of these IFM experiments are summarised in table 3 and exemplified for GAP-B-2 in figure 15. Sera raised against the GAP-B-2 molecule of GAPDH2 were also tested against a number of the clinical isolates. Reactivity of this sera against the surface of the clinical isolates (exemplified in figure 16, other not shown) supports the surface localisation of 30 GAPDH2 within isolates other than ATCC 46640. Cloning, expression and purification of recombinant enolase; plus detection of native enolase. The enolase gene of A. fumigatus was cloned and the protein expressed using the 35 same protocols detailed for IMDH B, the only difference being the sequence of the forward (5'-ATGCCTATCTCCAAGATC-3' (SEQ ID NO:42)) and reverse primers (5'-CAGGTTGACGGCAGT-3' (SEQ ID NO:43)). The sequence of the cloned cDNA WO 2004/108765 PCT/DK2004/000407 74 molecule was confirmed using standard procedures) (SEQ ID NO:48 and SEQ ID NO:49). Expression of the recombinant protein was confirmed using anti-his antibodies (figure 17(A)). Furthermore, the protein was shown to react with anti MAP sera raised against ENO-2 (figure 17(A)). Having confirmed that the anti-MAP 5 sera binds recombinant enolase it was decided to test the sera against isolated membrane and wall fractions from AfC. These studies revealed the protein to exist in the cell membrane of AfC (figure 17(B)). Example 5. Alignment of Asperqillus fumigatus IMDH B with homologous 10 polypeptides from other fungi The sequence of Aspergillus fumigatus IMDH B (SEQ ID NO:36) was compared with homologous sequences from other fungi in order to find areas of high sequence identity. Figures 18-25 show alignments of SEQ ID NO:36 with homologous polypeptides. 15
Claims (60)
1. An isolated antibody capable of binding an extracellular Aspergillus fumigatus polypeptide selected from the group consisting of isopropylmalate 5 dehydrogenase B (SEQ ID NO:36), Cssl (SEQ ID NO:1), hydrophobin (SEQ ID NO:2), GAPDH-B (SEQ ID NO:3), and catalase A (SEQ ID NO:6).
2. The antibody of claim 1, wherein the antibody binds said polypeptide with a dissociation constant of less than 10-7M, e.g. less than 5 X 10- 8 M, such as less 10 than 10 8 M, e.g. less than 5 X 10-9M, such as less than 10-9M, e.g. less than 5 X 10 1 0 M, such as less than 10 1 0 M, e.g. less than 5 X 10- 1 1 M, such as less than 10 11M, e.g. less than 5 X 10- 12 M, such as less than 10- 12 M, e.g. less than 5 X 10 13 M, such as less than 10- 13 M, e.g. less than 5 X 10-1 4 M, such as less than 10 14M, e.g. less than 5 X 10- 5 M, or less than 10- 1 5 M. 15
3. The antibody of any of the preceding claims, wherein the antibody is selected from the group consisting of IgG, IgA, IgE, IgM and IgD, wherein IgG preferably is IgG1. 20
4. The antibody of any of the preceding claims, wherein the antibody is capable of binding an intact Aspergillus fumigatus cell.
5. The antibody of any of the preceding claims, wherein the antibody, or at least an Fab fragment thereof, is capable of reducing the adhesion of Aspergillus 25 fumigatus conidia to lung epithelia in an in vitro assay, preferably reducing said adhesion with at least 20%, e.g. at least 40%, or at least 60%.
6. The antibody of any of the preceding claims, wherein the antibody or at least an Fab fragment thereof, is capable of reducing the germination of Aspergillus 30 fumigatus conidia in an in vitro assay, preferably reducing said adhesion with at least 20%, e.g. at least 40%, or at least 60%.
7. The antibody of any of claims 1-6, wherein the antibody is polyclonal. 35
8. The antibody of any of claims 1-6, wherein the antibody is monoclonal. WO 2004/108765 PCT/DK2004/000407 76
9. The antibody of claim 8, wherein the antibody is a chimeric, human or humanised antibody. 5
10. The antibody of claim 8, wherein the antibody is a human antibody.
11. The antibody of any of the preceding claims, wherein the antibody is purified.
12. The antibody of any of the preceding claims, wherein the antibody is further 10 capable of binding a homologous polypeptide, wherein the homologous polypeptide has a sequence identity of 39% or more, such as 42% or more, e.g. 48% or more, such as 68% or more, e.g. 80% or more, such as 90% or more, to a polypeptide selected from the group consisting of isopropylmalate dehydrogenase B (SEQ ID NO:36), Cssl (SEQ ID NO:1), hydrophobin (SEQ ID 15 NO:2), GAPDH-B (SEQ ID NO:3), and catalase A (SEQ ID NO:6).
13. The antibody of claim 12, wherein said homologous polypeptide originates from - an Aspergillus species, such as Aspergillus fumigatus, Aspergillus nidulans, Aspergillus niger, or Aspergillus oryzea, 20 - Neurospora crassa, - Saccharomyces cerevisiae, - a Candida species such as Candida albicans, - a Coccidioides species, such as Coccidioides posadasii, or Coccidioides immitis, 25 - a Cryptococcus species, such as Cryptococcus neoformans var. neoformans, - a Fusarium species, - a Pneumocystis species, - a Penicillium species, or 30 - Histoplasma capsulatum.
14. The antibody of claim 13, wherein said homologous polypeptide originates from - an Aspergillus species, such as Aspergillus fumigatus, Aspergillus nidulans, Aspergillus niger or Aspergillus oryzea, 35 - Candida albicans, WO 2004/108765 PCT/DK2004/000407 77 - Coccidioides posadasii, or - Cryptococcus neoformans var. neoformans. 5
15. The antibody of claim 14, wherein said homologous polypeptide originates from an Aspergillus species, such as Aspergillus fumigatus, Aspergillus nidulans, Aspergillus niger or Aspergillus oryzea,
16. The antibody of claim 15, wherein said homologous polypeptide originates from 10 Aspergillus fumigatus.
17. The antibody of claim 16, wherein the said homologous polypeptide is the polypeptide of SEQ ID NO:41. 15
18. The antibody of any of claims 12-17, wherein said homologous polypeptide is extracellular.
19. The antibody of any of the preceding claims, wherein the antibody further is capable of binding an intact cell of any one or more of 20 - an Aspergillus species other than Aspergillus fumigatus, such as Aspergillus nidulans, Aspergillus niger, or Aspergillus oryzea, - Neurospora crassa, - Saccharomyces cerevisiae, - a Candida species such as Candida albicans, 25 - a Coccidioides species, such as Coccidioides posadasii, or Coccidioides immitis, - a Cryptococcus species, such as Cryptococcus neoformans var. neoformans, - a Fusarium species, - a Pneumocystis species, 30 - a Penicillium species, or - Histoplasma capsulatum.
20. The antibody of any of claims 1-11, wherein the antibody is not capable of 35 binding an intact cell of any of WO 2004/108765 PCT/DK2004/000407 78 - Neurospora crassa, - Saccharomyces cerevisiae, - Candida albicans, - Coccidioides posadasii, or Coccidioides immitis, 5 - Cryptococcus neoformans var. neoformans, or - Histoplasma capsulatum.
21. The antibody of any of the preceding claims, wherein the antibody is capable of 10 binding a polypeptide selected from the group consisting of isopropylmalate dehydrogenase B (SEQ ID NO:36), Cssl (SEQ ID NO:1) and catalase A (SEQ ID NO:6).
22. The antibody of any of the preceding claims, wherein the antibody is capable of 15 binding a polypeptide selected from the group consisting of isopropylmalate dehydrogenase B (SEQ ID NO:36) and Cssl (SEQ ID NO:1).
23. The antibody of any of the preceding claims, wherein the antibody is capable of binding isopropylmalate dehydrogenase B (SEQ ID NO:36). 20
24. The antibody of claim 23, wherein the antibody is capable of binding an epitope which comprises one or more of the residues of a region of SEQ ID NO:36 selected from the group consisting of: Ser67- Leu71, Ala74-Trp80, Serl91 Arg205, Leu268-Leu273, His292-Pro296, Glu355-11e360, Asp193-Glu209, 25 Asp193-Ala199, Ile15-Vall9, Val75-Trp80, Proll-Glul8 and the region defined by SEQ ID NO:37, preferably an epitope which is entirely consisting of residues comprised within said region.
25. A pharmaceutical composition comprising an antibody as defined in any of 30 claims 1-24 and a pharmaceutically-acceptable carrier.
26. An antibody as defined in any of claims 1-24 or a composition as defined in claim 25 for use as a medicament. WO 2004/108765 PCT/DK2004/000407 79
27. Use of an antibody as defined in any of claims 1-24 or a composition as defined in claim 25 for the manufacture of a medicament for the treatment or prevention of fungal infections. 5
28. Use of claim 27, wherein the medicament is a medicament for the treatment or prevention of Aspergillus infections, preferably Aspergillus fumigatus infections.
29. Use of claim 27, wherein the medicament is a medicament for the treatment or prevention of a fungal disease selected from the group consisting of: invasive 10 aspergillosis, aspergilloma, and allergic aspergillosis, such as allergic bronchopulmonary aspergillosis.
30. A composition comprising one or more Aspergilus fumigatus polypeptides selected from the group of 15 polypeptides comprising SEQ ID NO:36, fragments thereof and variants thereof, fragments of SEQ ID NO:1 of less than 259 amino-acid residues in length, such as less than 200, preferably less than 150, such as less than 100, e.g. less than 20 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:7,8,17,26,28,29 and/or 30 and variants of said fragments; fragments of SEQ ID NO:2 of less than 106 amino-acid residues in length, such 25 as less than 75, preferably less than 50, such as less than 25 residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:9,10,18 and/or 19 and variants of said fragments; polypeptides comprising SEQ ID NO:3, fragments thereof and variants thereof, 30 with the proviso that if the polypeptide is a fragment of SEQ ID NO:3, that this fragment is not the fragment set forth in SEQ ID NO:35; fragments of SEQ ID NO:4 of less than 437 amino-acid residues in length, such as less than 200, preferably less than 100, such as less than 75, e.g. less than 35 50, such as less than 25 amino-acid residues in length comprising one or more WO 2004/108765 PCT/DK2004/000407 80 residues of the amino-acid sequences set forth in SEQ ID NO:13,14,23,24 and/or 25 and variants of said fragments; fragments of SEQ ID NO:5 of less than 727 amino-acid residues in length, e.g. 5 less than 400, such as less than 200, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:15,16 and/or 27 and variants of said fragments; 10 and fragments of SEQ ID NO:6 of less than 748 amino-acid residues in length, e.g. less than 400, such as less than 200, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino-acid residues in length 15 comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:34 and variants of said fragments.
31. An Aspergillus fumigatus polypeptide selected from the group of 20 polypeptides comprising SEQ ID NO:36, fragments thereof and variants thereof, fragments of SEQ ID NO:1 of less than 259 amino-acid residues in length, such as less than 200, preferably less than 150, such as less than 100, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more 25 residues of the amino-acid sequences set forth in SEQ ID NO:7,8,17,26,28,29 and/or 30 and variants of said fragments; fragments of SEQ ID NO:2 of less than 106 amino-acid residues in length, such as less than 75, preferably less than 50, such as less than 25 residues in length 30 comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:9,10,18 and/or 19 and variants of said fragments; polypeptides comprising SEQ ID NO:3, fragments thereof and variants thereof, with the proviso that if the polypeptide is a fragment of SEQ ID NO:3, that this 35 fragment is not the fragment set forth in SEQ ID NO:35; WO 2004/108765 PCT/DK2004/000407 81 fragments of SEQ ID NO:4 of less than 437 amino-acid residues in length, such as less than 200, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more 5 residues of the amino-acid sequences set forth in SEQ ID NO:13,14,23,24 and/or 25 and variants of said fragments; fragments of SEQ ID NO:5 of less than 727 amino-acid residues in length, e.g. less than 400, such as less than 200, preferably less than 100, such as less than 10 75, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO:15,16 andlor 27 and variants of said fragments; and 15 fragments of SEQ ID NO:6 of less than 748 amino-acid residues in length, e.g. less than 400, such as less than 200, preferably less than 100, such as less than 75, e.g. less than 50, such as less than 25 amino-acid residues in length comprising one or more residues of the amino-acid sequences set forth in SEQ 20 ID NO:34 and variants of said fragments.
32. The polypeptide of claim 31, wherein the polypeptide is a fragment comprising one or more residues of the amino-acid sequences set forth in SEQ ID NOs: 7 27 and/or 37, or a variant of said fragment. 25
33. The polypeptide of claim 32, wherein the polypeptide is a fragment comprising one or more residues of the amino-acid sequences set forth in SEQ ID NOs: 7 16, or a variant of said fragment. 30
34. The polypeptide of claim 32, wherein the polypeptide is a fragment comprising one or more residues of the amino-acid sequences set forth in SEQ ID NOs: 17 25 and/or SEQ ID NO:14, or a variant of said fragment. WO 2004/108765 PCT/DK2004/000407 82
35. The polypeptide of claim 32, wherein the polypeptide is a fragment comprising one or more residues of the amino-acid sequences set forth in SEQ ID NO: 18, 19, 26, 27, and/or 37, or a variant of said fragment. 5
36. A polynucleotide encoding a polypeptide as defined in any of claims 31-35.
37. An expression vector comprising a polynucleotide as defined in claim 36.
38. A host cell transformed or transfected with a polynucleotide as defined in claim 10 36 and/or an expression vector as defined in claim 37.
39. A pharmaceutical composition comprising a polypeptide as defined in any of claims 31-35 or a polynucleotide as defined in claim 36 and a pharmaceutically acceptable carrier. 15
40. A polypeptide as defined in any of claims 31-35, or a polynucleotide as defined in claim 36 for use as a medicament.
41. Use of a polypeptide as defined in any of claims 31-35, a polynucleotide as 20 defined in claim 36 for the manufacture of a medicament for the immunisation of a mammal against fungal infections.
42. The use of claim 41, wherein said mammal is a human being. 25
43. A method for raising specific antibodies to a polypeptide selected from the group of polypeptides set forth in SEQ ID NO:1,2,3,6 and 36 in a non-human mammal comprising the steps of a. providing a polypeptide selected from the group of isopropylmalate dehydrogenase B (SEQ ID NO:36), CssI (SEQ ID NO:1), hydrophobin (SEQ ID 30 NO:2), GAPDH (SEQ ID NO:3), and catalase A (SEQ ID NO:6), or a polypeptide as defined in any of claims 31-35, or a cell expressing any of these polypeptides, b. introducing a composition comprising said polypeptide or said cell into said animal, c. raising antibodies in said animal, and 35 d. isolating and optionally purifying the antibodies. WO 2004/108765 PCT/DK2004/000407 83
44. The method of claim 43, wherein the raising of antibodies is done in a transgenic animal which is capable of producing human antibodies.
45. The method of claim 43 or 44, wherein the polypeptide that is provided is 5 isopropylmalate dehydrogenase B (SEQ ID NO:36) or a fragment thereof, or a variant of said polypeptide.
46. The method of claim 43 or 44, wherein the polypeptide that is provided is CssI (SEQ ID NO:1) or a fragment thereof, or a variant of said polypeptide. 10
47. The method of claim 43 or 44, wherein the polypeptide that is provided is hydrophobin (SEQ ID NO:2) or a fragment thereof, or a variant of said polypeptide. 15
48. The method of claim 43 or 44, wherein the polypeptide that is provided is GAPDH-B (SEQ ID NO:3) or a fragment thereof, or a variant of said polypeptide.
49. The method of claim 43 or 44, wherein the polypeptide that is provided is catalase A (SEQ ID NO:6) or a fragment thereof, or a variant of said polypeptide. 20
50. A method for identifying a binding partner of a polypeptide selected from the group of isopropylmalate dehydrogenase B (SEQ ID NO:36), Cssl (SEQ ID NO:1), hydrophobin (SEQ ID NO:2), GAPDH-B (SEQ ID NO:3), enolase (SEQ ID NO:4), catalase B (SEQ ID NO:5) and catalase A (SEQ ID NO:6), comprising 25 the steps of a. providing a polypeptide as defined in any of claims 31-35 or a polypeptide selected from the group of isopropylmalate dehydrogenase B (SEQ ID NO:36), Cssl (SEQ ID NO:1), hydrophobin (SEQ ID NO:2), GAPDH-B (SEQ ID NO:3), catalase B (SEQ ID NO:5), and catalase A (SEQ ID NO:6), 30 b. contacting said polypeptide with a putative binding partner, and c. determining whether said putative binding partner is capable of binding to said polypeptide.
51. The method of claim 50, wherein the putative binding partner is a host-derived 35 molecule. WO 2004/108765 PCT/DK2004/000407 84
52. The method of any of claims 50-51, wherein said method is repeated for a plurality of putative binding partners. 5
53. A method for identifying a compound with antifungal activity comprising the steps of a. providing a sensitised cell which has a reduced level of a polypeptide selected from the group of SEQ ID NOs:1,2,3,5,6, and 36 and b. determining the sensitivity of said cell to a putative antifungal compound, for 10 instance by a growth assay.
54. A method for identifying an inhibitor of an extracellular Aspergillus polypeptide selected from the group of isopropylmalate dehydrogenase B (SEQ ID NO:36), Cssl (SEQ ID NO:1), GAPDH (SEQ ID NO:3), and catalase A (SEQ ID NO:6), 15 comprising the steps of a. providing two cells which differ in the level of a polypeptide selected from the group of isopropylmalate dehydrogenase B (SEQ ID NO:36), CssI (SEQ ID NO:1), GAPDH (SEQ ID NO:3), and catalase A (SEQ ID NO:6), b. determining the sensitivity of said cells to a putative inhibitor, for instance by a 20 growth assay, and c. determining whether said two cells are differently affected by the presence of said putative inhibitor.
55. The method of claim 54, wherein the two cells differ in the copy number of said 25 polypeptide.
56. The method of claim 54, wherein the two cells differ in the activity of said polypeptide. 30
57. A method of diagnosing fungal, preferably Aspergillus fumigatus, infection comprising the steps of a. providing a sample from an individual, b. contacting said sample with an indicator moiety capable of specifically recognising and binding a polypeptide selected from the group of 35 isopropylmalate dehydrogenase B (SEQ ID NO:36), Cssi (SEQ ID NO:1), WO 2004/108765 PCT/DK2004/000407 85 hydrophobin (SEQ ID NO:2), GAPDH-B (SEQ ID NO:3), and catalase A (SEQ ID NO:6), and c. determining whether a signal has been generated by the indicator moiety. 5
58. The method of the preceding claim, wherein said indicator moiety is or comprises an antibody, such as an antibody as defined in any of claims 1-24 .
59. A kit for the detection of fungal material, preferably intact fungal cells, most preferably intact Aspergillus fumigatus cells, in a biological sample comprising 10 a. an indicator mnoiety capable of specifically recognising and binding a polypeptide selected from the group of isopropylmalate dehydrogenase B (SEQ ID NO:36), Cssl (SEQ ID NO:1), hydrophobin (SEQ ID NO:2), GAPDH-B (SEQ ID NO:3), and catalase A (SEQ ID NO:6), and b. one or more of: a buffer for promoting binding of the indicator moiety to the 15 fungal material; a reagent for generating a detectable signal; and written instructions to the user.
60. The kit of claim 59, wherein said indicator is or comprises an antibody, such as an antibody as defined in any of claims 1-24. 20
Applications Claiming Priority (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DKPA200300862 | 2003-06-10 | ||
DKPA200300862 | 2003-06-10 | ||
US47735503P | 2003-06-11 | 2003-06-11 | |
US60/477,355 | 2003-06-11 | ||
US48245103P | 2003-06-26 | 2003-06-26 | |
DKPA200300968 | 2003-06-26 | ||
DKPA200300968 | 2003-06-26 | ||
US60/482,451 | 2003-06-26 | ||
PCT/DK2004/000407 WO2004108765A2 (en) | 2003-06-10 | 2004-06-10 | Extracellular aspergillus polypeptides |
Publications (1)
Publication Number | Publication Date |
---|---|
AU2004245174A1 true AU2004245174A1 (en) | 2004-12-16 |
Family
ID=33514773
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2004245174A Abandoned AU2004245174A1 (en) | 2003-06-10 | 2004-06-10 | Extracellular Aspergillus polypeptides |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP1636269A2 (en) |
JP (1) | JP2007535897A (en) |
AU (1) | AU2004245174A1 (en) |
CA (1) | CA2528851A1 (en) |
WO (1) | WO2004108765A2 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN107164478A (en) * | 2017-05-27 | 2017-09-15 | 山西维尔生物乳制品有限公司 | A kind of probe, primer and genetic chip for differentiating aspergillus fumigatus |
Families Citing this family (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EA200901489A1 (en) | 2007-05-07 | 2010-04-30 | Новартис Аг | ORGANIC COMPOUNDS |
DE102007031947A1 (en) * | 2007-07-06 | 2009-01-08 | Helmholtz-Zentrum Für Umweltforschung Gmbh - Ufz | Allergens from Aspergillus versicolor and methods for detecting an indoor mold allergy |
AU2008334629B2 (en) | 2007-12-10 | 2012-04-12 | Novartis Ag | Organic compounds |
EP2300010B1 (en) | 2008-06-10 | 2015-03-04 | Novartis AG | Pyrazine derivatives as epithelial sodium channel blockers |
CA2777245A1 (en) | 2009-10-22 | 2011-04-28 | Vertex Pharmaceuticals Incorporated | Compositions for treatment of cystic fibrosis and other chronic diseases |
US8247436B2 (en) | 2010-03-19 | 2012-08-21 | Novartis Ag | Pyridine and pyrazine derivative for the treatment of CF |
US8372845B2 (en) | 2010-09-17 | 2013-02-12 | Novartis Ag | Pyrazine derivatives as enac blockers |
EP2743699A4 (en) | 2011-08-12 | 2015-04-08 | Nat Inst Infectious Diseases | Method for testing for, preventing, and treating infectious disease aspergillus fumigatus, and composition |
US8883819B2 (en) | 2011-09-01 | 2014-11-11 | Irm Llc | Bicyclic heterocycle derivatives for the treatment of pulmonary arterial hypertension |
WO2013038378A1 (en) | 2011-09-16 | 2013-03-21 | Novartis Ag | Pyridine amide derivatives |
WO2013038381A1 (en) | 2011-09-16 | 2013-03-21 | Novartis Ag | Pyridine/pyrazine amide derivatives |
EP2755967B1 (en) | 2011-09-16 | 2015-10-21 | Novartis AG | Heterocyclic compounds for the treatment of cystic fibrosis |
WO2013038390A1 (en) | 2011-09-16 | 2013-03-21 | Novartis Ag | N-substituted heterocyclyl carboxamides |
WO2013038373A1 (en) | 2011-09-16 | 2013-03-21 | Novartis Ag | Pyridine amide derivatives |
US8809340B2 (en) | 2012-03-19 | 2014-08-19 | Novartis Ag | Crystalline form |
US9073921B2 (en) | 2013-03-01 | 2015-07-07 | Novartis Ag | Salt forms of bicyclic heterocyclic derivatives |
ES2667424T3 (en) | 2014-04-24 | 2018-05-10 | Novartis Ag | Pyrazine derivatives as phosphatidyl-inositol-3-kinase inhibitors |
US10112926B2 (en) | 2014-04-24 | 2018-10-30 | Novartis Ag | Amino pyridine derivatives as phosphatidylinositol 3-kinase inhibitors |
BR112016024533A8 (en) | 2014-04-24 | 2021-03-30 | Novartis Ag | amino pyrazine derivatives as phosphatidylinositol 3-kinase or salt inhibitors, their use, and pharmaceutical composition and combination |
WO2020250116A1 (en) | 2019-06-10 | 2020-12-17 | Novartis Ag | Pyridine and pyrazine derivative for the treatment of cf, copd, and bronchiectasis |
US20220306617A1 (en) | 2019-08-28 | 2022-09-29 | Novartis Ag | Substituted 1,3-phenyl heteroaryl derivatives and their use in the treatment of disease |
WO2023225459A2 (en) | 2022-05-14 | 2023-11-23 | Novozymes A/S | Compositions and methods for preventing, treating, supressing and/or eliminating phytopathogenic infestations and infections |
-
2004
- 2004-06-10 AU AU2004245174A patent/AU2004245174A1/en not_active Abandoned
- 2004-06-10 JP JP2006515711A patent/JP2007535897A/en not_active Withdrawn
- 2004-06-10 WO PCT/DK2004/000407 patent/WO2004108765A2/en active Application Filing
- 2004-06-10 EP EP04736511A patent/EP1636269A2/en not_active Withdrawn
- 2004-06-10 CA CA002528851A patent/CA2528851A1/en not_active Abandoned
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN107164478A (en) * | 2017-05-27 | 2017-09-15 | 山西维尔生物乳制品有限公司 | A kind of probe, primer and genetic chip for differentiating aspergillus fumigatus |
Also Published As
Publication number | Publication date |
---|---|
WO2004108765A2 (en) | 2004-12-16 |
EP1636269A2 (en) | 2006-03-22 |
CA2528851A1 (en) | 2004-12-16 |
JP2007535897A (en) | 2007-12-13 |
WO2004108765A3 (en) | 2005-07-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2004245174A1 (en) | Extracellular Aspergillus polypeptides | |
US20080085286A1 (en) | Aspergillus vaccine preparation and methods of making and using thereof | |
WO2000068265A1 (en) | Antimicrobial theta defensins and methods of using same | |
Fox et al. | Plasminogen-binding activity of enolase in the opportunistic pathogen Pneumocystis carinii | |
US20190194301A1 (en) | Immunotherapy and diagnosis of mucormycosis using coth | |
AU2005310981A1 (en) | Vaccines, compositions and methods based on Staphylococcus aureus iron-regulated surface determinants IsdA, IsdB, and IsdC | |
Nayak et al. | Characterization of recombinant terrelysin, a hemolysin of Aspergillus terreus | |
JP5340926B2 (en) | Rheumatoid fever-related peptide (PARF) and its use as a diagnostic marker | |
Kaur et al. | The CXC chemokine-degrading protease SpyCep of Streptococcus pyogenes promotes its uptake into endothelial cells | |
CN111606980A (en) | SARS-COV coronavirus S2 protein polypeptide and its application | |
CA2251593A1 (en) | Assays and reagents for identifying anti-fungal agents, and uses related thereto | |
US20140178884A1 (en) | Method of diagnosing and treating an aspergillus species-associated condition | |
US20060241288A1 (en) | Extracellular aspergillus polypeptides | |
Satala et al. | Towards understanding the novel adhesin function of Candida albicans phosphoglycerate mutase at the pathogen cell surface: Some structural analysis of the interactions with human host extracellular matrix proteins | |
WO2007049770A1 (en) | Outer coat protein pa5158 of pseudomonas aeruginosa | |
WO2006073133A1 (en) | Novel tannase gene and protein thereof | |
US20190225652A1 (en) | Generation of peptides | |
JP5925783B2 (en) | Methods and compositions for testing, prevention and treatment of Aspergillus fumigatus infections | |
CA2983732A1 (en) | Fungal detection using mannan epitope | |
US20110086035A1 (en) | Immunotherapeutic methods and molecules | |
US20220221455A1 (en) | Antigen binding proteins and assays | |
KR20120088917A (en) | Detecting method of CMV or GMO that tolerant to CMV | |
WO2000039342A9 (en) | Use of essential saccharomyces genes and polypeptides | |
DelVecchio et al. | Proteomics for the development of vaccines and therapeutics | |
WO2013051606A1 (en) | Monoclonal antibody capable of specifically recognizing asparagine synthase |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
MK4 | Application lapsed section 142(2)(d) - no continuation fee paid for the application |