AU2003287780A1 - In vivo affinity maturation scheme - Google Patents
In vivo affinity maturation scheme Download PDFInfo
- Publication number
- AU2003287780A1 AU2003287780A1 AU2003287780A AU2003287780A AU2003287780A1 AU 2003287780 A1 AU2003287780 A1 AU 2003287780A1 AU 2003287780 A AU2003287780 A AU 2003287780A AU 2003287780 A AU2003287780 A AU 2003287780A AU 2003287780 A1 AU2003287780 A1 AU 2003287780A1
- Authority
- AU
- Australia
- Prior art keywords
- seq
- cell
- nucleic acid
- gene
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 238000001727 in vivo Methods 0.000 title description 9
- 230000009824 affinity maturation Effects 0.000 title description 6
- 210000004027 cell Anatomy 0.000 claims description 243
- 108090000623 proteins and genes Proteins 0.000 claims description 143
- 238000000034 method Methods 0.000 claims description 95
- 108020004414 DNA Proteins 0.000 claims description 77
- 150000007523 nucleic acids Chemical class 0.000 claims description 71
- 239000003623 enhancer Substances 0.000 claims description 63
- 102000039446 nucleic acids Human genes 0.000 claims description 58
- 108020004707 nucleic acids Proteins 0.000 claims description 58
- 239000013598 vector Substances 0.000 claims description 51
- 230000010354 integration Effects 0.000 claims description 40
- 125000003729 nucleotide group Chemical group 0.000 claims description 37
- 108060003951 Immunoglobulin Proteins 0.000 claims description 36
- 102000018358 immunoglobulin Human genes 0.000 claims description 36
- 239000002773 nucleotide Substances 0.000 claims description 36
- 108700028369 Alleles Proteins 0.000 claims description 30
- 230000014509 gene expression Effects 0.000 claims description 29
- 230000035772 mutation Effects 0.000 claims description 28
- 238000011144 upstream manufacturing Methods 0.000 claims description 21
- 239000003550 marker Substances 0.000 claims description 18
- 102100022433 Single-stranded DNA cytosine deaminase Human genes 0.000 claims description 14
- 101150117115 V gene Proteins 0.000 claims description 14
- 108020003175 receptors Proteins 0.000 claims description 14
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 13
- 101710143275 Single-stranded DNA cytosine deaminase Proteins 0.000 claims description 12
- 108091033319 polynucleotide Proteins 0.000 claims description 11
- 102000040430 polynucleotide Human genes 0.000 claims description 11
- 239000002157 polynucleotide Substances 0.000 claims description 11
- 102000004190 Enzymes Human genes 0.000 claims description 10
- 108090000790 Enzymes Proteins 0.000 claims description 10
- 230000001580 bacterial effect Effects 0.000 claims description 10
- 210000004962 mammalian cell Anatomy 0.000 claims description 10
- 238000003556 assay Methods 0.000 claims description 9
- 239000011159 matrix material Substances 0.000 claims description 8
- 230000003321 amplification Effects 0.000 claims description 7
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 6
- 108091081024 Start codon Proteins 0.000 claims description 6
- 238000012258 culturing Methods 0.000 claims description 5
- 238000004519 manufacturing process Methods 0.000 claims description 5
- 238000003757 reverse transcription PCR Methods 0.000 claims description 5
- 241000238631 Hexapoda Species 0.000 claims description 3
- 108091023040 Transcription factor Proteins 0.000 claims description 3
- 102000040945 Transcription factor Human genes 0.000 claims description 3
- 239000005556 hormone Substances 0.000 claims description 3
- 229940088597 hormone Drugs 0.000 claims description 3
- 238000011084 recovery Methods 0.000 claims description 3
- 230000006820 DNA synthesis Effects 0.000 claims description 2
- 230000006819 RNA synthesis Effects 0.000 claims description 2
- 239000007850 fluorescent dye Substances 0.000 claims description 2
- 238000001498 protein fragment complementation assay Methods 0.000 claims 2
- 239000000047 product Substances 0.000 description 50
- 101710148027 Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic Proteins 0.000 description 47
- 239000012634 fragment Substances 0.000 description 38
- 239000013615 primer Substances 0.000 description 36
- 108090000765 processed proteins & peptides Proteins 0.000 description 36
- 102000004169 proteins and genes Human genes 0.000 description 36
- 241000282414 Homo sapiens Species 0.000 description 32
- 238000001890 transfection Methods 0.000 description 29
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 27
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 25
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Substances [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 20
- 239000011324 bead Substances 0.000 description 17
- 108091028043 Nucleic acid sequence Proteins 0.000 description 16
- 238000006243 chemical reaction Methods 0.000 description 15
- 230000008569 process Effects 0.000 description 14
- 230000000694 effects Effects 0.000 description 13
- 102000005962 receptors Human genes 0.000 description 13
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 12
- 238000000684 flow cytometry Methods 0.000 description 12
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 12
- 238000010367 cloning Methods 0.000 description 11
- 108020001507 fusion proteins Proteins 0.000 description 11
- 102000037865 fusion proteins Human genes 0.000 description 11
- 102000004196 processed proteins & peptides Human genes 0.000 description 11
- 238000013459 approach Methods 0.000 description 10
- 210000004602 germ cell Anatomy 0.000 description 10
- 238000000338 in vitro Methods 0.000 description 10
- 239000013612 plasmid Substances 0.000 description 10
- 230000002441 reversible effect Effects 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 9
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 9
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 description 9
- 108091092195 Intron Proteins 0.000 description 9
- 108010076504 Protein Sorting Signals Proteins 0.000 description 9
- 210000003719 b-lymphocyte Anatomy 0.000 description 9
- 239000003446 ligand Substances 0.000 description 9
- 229910052697 platinum Inorganic materials 0.000 description 9
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 8
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 8
- 241001529936 Murinae Species 0.000 description 8
- 238000000605 extraction Methods 0.000 description 8
- 230000012010 growth Effects 0.000 description 8
- 238000002703 mutagenesis Methods 0.000 description 8
- 231100000350 mutagenesis Toxicity 0.000 description 8
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 8
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 7
- 239000011543 agarose gel Substances 0.000 description 7
- 229920002521 macromolecule Polymers 0.000 description 7
- 229920001184 polypeptide Polymers 0.000 description 7
- 230000002285 radioactive effect Effects 0.000 description 7
- 230000001105 regulatory effect Effects 0.000 description 7
- 239000008223 sterile water Substances 0.000 description 7
- 241001515965 unidentified phage Species 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 6
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 6
- 230000001351 cycling effect Effects 0.000 description 6
- 239000000203 mixture Substances 0.000 description 6
- 230000010076 replication Effects 0.000 description 6
- 239000000523 sample Substances 0.000 description 6
- 238000012216 screening Methods 0.000 description 6
- 238000012163 sequencing technique Methods 0.000 description 6
- 238000007399 DNA isolation Methods 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 108091034117 Oligonucleotide Proteins 0.000 description 5
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- JGPOSNWWINVNFV-UHFFFAOYSA-N carboxyfluorescein diacetate succinimidyl ester Chemical compound C=1C(OC(=O)C)=CC=C2C=1OC1=CC(OC(C)=O)=CC=C1C2(C1=C2)OC(=O)C1=CC=C2C(=O)ON1C(=O)CCC1=O JGPOSNWWINVNFV-UHFFFAOYSA-N 0.000 description 5
- 230000032823 cell division Effects 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 238000004520 electroporation Methods 0.000 description 5
- 108091006047 fluorescent proteins Proteins 0.000 description 5
- 102000034287 fluorescent proteins Human genes 0.000 description 5
- 238000010647 peptide synthesis reaction Methods 0.000 description 5
- 230000008707 rearrangement Effects 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 4
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 4
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 4
- 229930193140 Neomycin Natural products 0.000 description 4
- 239000012979 RPMI medium Substances 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 210000000628 antibody-producing cell Anatomy 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 239000003636 conditioned culture medium Substances 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 239000000975 dye Substances 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 238000010363 gene targeting Methods 0.000 description 4
- 238000012544 monitoring process Methods 0.000 description 4
- 239000003471 mutagenic agent Substances 0.000 description 4
- 229960004927 neomycin Drugs 0.000 description 4
- 239000002953 phosphate buffered saline Substances 0.000 description 4
- 229940054269 sodium pyruvate Drugs 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- IPVFGAYTKQKGBM-BYPJNBLXSA-N 1-[(2r,3s,4r,5r)-3-fluoro-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-iodopyrimidine-2,4-dione Chemical compound F[C@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 IPVFGAYTKQKGBM-BYPJNBLXSA-N 0.000 description 3
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 3
- 108010029988 AICDA (activation-induced cytidine deaminase) Proteins 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 108010009575 CD55 Antigens Proteins 0.000 description 3
- 102100022002 CD59 glycoprotein Human genes 0.000 description 3
- 102000003952 Caspase 3 Human genes 0.000 description 3
- 108090000397 Caspase 3 Proteins 0.000 description 3
- 229920002307 Dextran Polymers 0.000 description 3
- 101000897400 Homo sapiens CD59 glycoprotein Proteins 0.000 description 3
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 3
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 3
- 102000004388 Interleukin-4 Human genes 0.000 description 3
- 108090000978 Interleukin-4 Proteins 0.000 description 3
- 108010021466 Mutant Proteins Proteins 0.000 description 3
- 102000008300 Mutant Proteins Human genes 0.000 description 3
- 241001494479 Pecora Species 0.000 description 3
- 108700008625 Reporter Genes Proteins 0.000 description 3
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 3
- 108020004440 Thymidine kinase Proteins 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000008512 biological response Effects 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 210000000349 chromosome Anatomy 0.000 description 3
- 230000009089 cytolysis Effects 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 3
- 229960005542 ethidium bromide Drugs 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 239000012894 fetal calf serum Substances 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 229960002963 ganciclovir Drugs 0.000 description 3
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 229940028885 interleukin-4 Drugs 0.000 description 3
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 3
- 235000019341 magnesium sulphate Nutrition 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 238000010899 nucleation Methods 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 3
- 230000012846 protein folding Effects 0.000 description 3
- 230000004850 protein–protein interaction Effects 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 210000005253 yeast cell Anatomy 0.000 description 3
- QXDXBKZJFLRLCM-UAKXSSHOSA-N 5-hydroxyuridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(O)=C1 QXDXBKZJFLRLCM-UAKXSSHOSA-N 0.000 description 2
- 101150079657 AICDA gene Proteins 0.000 description 2
- 241000271566 Aves Species 0.000 description 2
- 101100407073 Caenorhabditis elegans parp-1 gene Proteins 0.000 description 2
- 102000011727 Caspases Human genes 0.000 description 2
- 108010076667 Caspases Proteins 0.000 description 2
- 108091035707 Consensus sequence Proteins 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 108030004769 Membrane dipeptidases Proteins 0.000 description 2
- 101100260568 Mus musculus Thy1 gene Proteins 0.000 description 2
- 241000204031 Mycoplasma Species 0.000 description 2
- 101100353036 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) pme-1 gene Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 201000007902 Primary cutaneous amyloidosis Diseases 0.000 description 2
- 101000908013 Rattus norvegicus Ceruloplasmin Proteins 0.000 description 2
- 101000702488 Rattus norvegicus High affinity cationic amino acid transporter 1 Proteins 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 241000714474 Rous sarcoma virus Species 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- 238000002105 Southern blotting Methods 0.000 description 2
- 108700026226 TATA Box Proteins 0.000 description 2
- 102000006601 Thymidine Kinase Human genes 0.000 description 2
- 102100036922 Tumor necrosis factor ligand superfamily member 13B Human genes 0.000 description 2
- DZBUGLKDJFMEHC-UHFFFAOYSA-N acridine Chemical compound C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 239000002962 chemical mutagen Substances 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 210000003917 human chromosome Anatomy 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 238000005304 joining Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- 230000033607 mismatch repair Effects 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000007857 nested PCR Methods 0.000 description 2
- 239000002777 nucleoside Substances 0.000 description 2
- 150000003833 nucleoside derivatives Chemical class 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 210000002729 polyribosome Anatomy 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 208000014670 posterior cortical atrophy Diseases 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 238000000513 principal component analysis Methods 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 238000005215 recombination Methods 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 230000000392 somatic effect Effects 0.000 description 2
- 241000894007 species Species 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 230000014621 translational initiation Effects 0.000 description 2
- 229940045145 uridine Drugs 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- IRBSRWVXPGHGGK-LNYQSQCFSA-N (2R,3R,4S,5R)-2-(2-amino-6-hydroxy-6-methyl-3H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol Chemical compound CC1(O)NC(N)=NC2=C1N=CN2[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O IRBSRWVXPGHGGK-LNYQSQCFSA-N 0.000 description 1
- MXYRZDAGKTVQIL-IOSLPCCCSA-N (2r,3r,4s,5r)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)-2-methyloxolane-3,4-diol Chemical compound C1=NC2=C(N)N=CN=C2N1[C@]1(C)O[C@H](CO)[C@@H](O)[C@H]1O MXYRZDAGKTVQIL-IOSLPCCCSA-N 0.000 description 1
- LRPBXXZUPUBCAP-WOUKDFQISA-N (2r,3s,4r,5r)-2-(hydroxymethyl)-5-imidazo[2,1-f]purin-3-yloxolane-3,4-diol Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CN2C3=NC=C2)=C3N=C1 LRPBXXZUPUBCAP-WOUKDFQISA-N 0.000 description 1
- -1 06 -alkylguanosine Chemical compound 0.000 description 1
- MZBPLEJIMYNQQI-JXOAFFINSA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-2,4-dioxopyrimidine-5-carbaldehyde Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(C=O)=C1 MZBPLEJIMYNQQI-JXOAFFINSA-N 0.000 description 1
- YFVADZCYZSACSK-PEBGCTIMSA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-3-(2-hydroxyethyl)pyrimidine-2,4-dione Chemical compound O=C1N(CCO)C(=O)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 YFVADZCYZSACSK-PEBGCTIMSA-N 0.000 description 1
- UTQUILVPBZEHTK-ZOQUXTDFSA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-3-methylpyrimidine-2,4-dione Chemical compound O=C1N(C)C(=O)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 UTQUILVPBZEHTK-ZOQUXTDFSA-N 0.000 description 1
- RSSRMDMJEZIUJX-XVFCMESISA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-4-hydrazinylpyrimidin-2-one Chemical compound O=C1N=C(NN)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 RSSRMDMJEZIUJX-XVFCMESISA-N 0.000 description 1
- KCROWJKKMNOUSF-UAKXSSHOSA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-nitrosopyrimidine-2,4-dione Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(N=O)=C1 KCROWJKKMNOUSF-UAKXSSHOSA-N 0.000 description 1
- CLYBQLKNRHAHBL-IOSLPCCCSA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5h-imidazo[2,1-b]purin-4-one Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(N2C(=NC=C2)NC2=O)=C2N=C1 CLYBQLKNRHAHBL-IOSLPCCCSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- 101150072531 10 gene Proteins 0.000 description 1
- 101150029062 15 gene Proteins 0.000 description 1
- MWBWWFOAEOYUST-UHFFFAOYSA-N 2-aminopurine Chemical compound NC1=NC=C2N=CNC2=N1 MWBWWFOAEOYUST-UHFFFAOYSA-N 0.000 description 1
- WTLKTXIHIHFSGU-UHFFFAOYSA-N 2-nitrosoguanidine Chemical compound NC(N)=NN=O WTLKTXIHIHFSGU-UHFFFAOYSA-N 0.000 description 1
- 101150098072 20 gene Proteins 0.000 description 1
- KKAJSJJFBSOMGS-UHFFFAOYSA-N 3,6-diamino-10-methylacridinium chloride Chemical compound [Cl-].C1=C(N)C=C2[N+](C)=C(C=C(N)C=C3)C3=CC2=C1 KKAJSJJFBSOMGS-UHFFFAOYSA-N 0.000 description 1
- RDPUKVRQKWBSPK-UHFFFAOYSA-N 3-Methylcytidine Natural products O=C1N(C)C(=N)C=CN1C1C(O)C(O)C(CO)O1 RDPUKVRQKWBSPK-UHFFFAOYSA-N 0.000 description 1
- UTQUILVPBZEHTK-UHFFFAOYSA-N 3-Methyluridine Natural products O=C1N(C)C(=O)C=CN1C1C(O)C(O)C(CO)O1 UTQUILVPBZEHTK-UHFFFAOYSA-N 0.000 description 1
- RDPUKVRQKWBSPK-ZOQUXTDFSA-N 3-methylcytidine Chemical compound O=C1N(C)C(=N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 RDPUKVRQKWBSPK-ZOQUXTDFSA-N 0.000 description 1
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 1
- LZWSGWMPCIAGIJ-UAKXSSHOSA-N 4,5-diamino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidin-2-one Chemical compound O=C1N=C(N)C(N)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 LZWSGWMPCIAGIJ-UAKXSSHOSA-N 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- PXHKHCSQQQUDBL-FDDDBJFASA-N 4-amino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-(2-hydroxyethyl)pyrimidin-2-one Chemical compound C1=C(CCO)C(N)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 PXHKHCSQQQUDBL-FDDDBJFASA-N 0.000 description 1
- MPPUDRFYDKDPBN-UAKXSSHOSA-N 4-amino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-hydroxypyrimidin-2-one Chemical compound C1=C(O)C(N)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 MPPUDRFYDKDPBN-UAKXSSHOSA-N 0.000 description 1
- GFLVNHFRRLTIBS-UAKXSSHOSA-N 4-amino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-nitrosopyrimidin-2-one Chemical compound C1=C(N=O)C(N)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 GFLVNHFRRLTIBS-UAKXSSHOSA-N 0.000 description 1
- AGOOLAXXSHOFRL-HCWSKCQFSA-N 4-amino-1-[(2s,3r,4s,5r)-2-amino-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidin-2-one Chemical compound O=C1N=C(N)C=CN1[C@@]1(N)[C@H](O)[C@H](O)[C@@H](CO)O1 AGOOLAXXSHOFRL-HCWSKCQFSA-N 0.000 description 1
- HRDXGYQCVPZEJE-UAKXSSHOSA-N 4-amino-5-bromo-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidin-2-one Chemical compound C1=C(Br)C(N)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 HRDXGYQCVPZEJE-UAKXSSHOSA-N 0.000 description 1
- LOFVQBRIYOQFDZ-UAKXSSHOSA-N 4-amino-5-chloro-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidin-2-one Chemical compound C1=C(Cl)C(N)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 LOFVQBRIYOQFDZ-UAKXSSHOSA-N 0.000 description 1
- YBTWWWIJBCCYNR-UAKXSSHOSA-N 5-amino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidine-2,4-dione Chemical compound O=C1NC(=O)C(N)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 YBTWWWIJBCCYNR-UAKXSSHOSA-N 0.000 description 1
- LQLQRFGHAALLLE-UHFFFAOYSA-N 5-bromouracil Chemical compound BrC1=CNC(=O)NC1=O LQLQRFGHAALLLE-UHFFFAOYSA-N 0.000 description 1
- YUBHNOXBZKRMGV-MDNDXATMSA-N 5a-amino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5h-azeto[2,1-b]purin-4-one Chemical compound C1=2N(C=C3)C3(N)NC(=O)C=2N=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O YUBHNOXBZKRMGV-MDNDXATMSA-N 0.000 description 1
- DUCZQUFMCSTEHH-PEBGCTIMSA-N 6-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]imidazo[1,2-c]pyrimidin-5-one Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)N2C=CN=C2C=C1 DUCZQUFMCSTEHH-PEBGCTIMSA-N 0.000 description 1
- FPGSEBKFEJEOSA-UMMCILCDSA-N 8-Hydroxyguanosine Chemical compound C1=2NC(N)=NC(=O)C=2NC(=O)N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O FPGSEBKFEJEOSA-UMMCILCDSA-N 0.000 description 1
- HCAJQHYUCKICQH-VPENINKCSA-N 8-Oxo-7,8-dihydro-2'-deoxyguanosine Chemical compound C1=2NC(N)=NC(=O)C=2NC(=O)N1[C@H]1C[C@H](O)[C@@H](CO)O1 HCAJQHYUCKICQH-VPENINKCSA-N 0.000 description 1
- 239000012099 Alexa Fluor family Substances 0.000 description 1
- 101710204899 Alpha-agglutinin Proteins 0.000 description 1
- 102100022749 Aminopeptidase N Human genes 0.000 description 1
- 241000242762 Anemonia sulcata Species 0.000 description 1
- 108010028006 B-Cell Activating Factor Proteins 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 102100036008 CD48 antigen Human genes 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 101710094648 Coat protein Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102100025680 Complement decay-accelerating factor Human genes 0.000 description 1
- MIKUYHXYGGJMLM-UUOKFMHZSA-N Crotonoside Chemical compound C1=NC2=C(N)NC(=O)N=C2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O MIKUYHXYGGJMLM-UUOKFMHZSA-N 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- 101710159129 DNA adenine methylase Proteins 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 108091027757 Deoxyribozyme Proteins 0.000 description 1
- 241000168726 Dictyostelium discoideum Species 0.000 description 1
- 101100260709 Drosophila melanogaster tin gene Proteins 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 108060002716 Exonuclease Proteins 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 102100024165 G1/S-specific cyclin-D1 Human genes 0.000 description 1
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 1
- 101000757160 Homo sapiens Aminopeptidase N Proteins 0.000 description 1
- 101000980814 Homo sapiens CAMPATH-1 antigen Proteins 0.000 description 1
- 101000716130 Homo sapiens CD48 antigen Proteins 0.000 description 1
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 description 1
- 101000980756 Homo sapiens G1/S-specific cyclin-D1 Proteins 0.000 description 1
- 101000998953 Homo sapiens Immunoglobulin heavy variable 1-2 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101001114076 Homo sapiens Paladin Proteins 0.000 description 1
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102100036887 Immunoglobulin heavy variable 1-2 Human genes 0.000 description 1
- 101710099741 Immunoglobulin mu heavy chain Proteins 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 101710167241 Intimin Proteins 0.000 description 1
- 235000019687 Lamb Nutrition 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 102100025136 Macrosialin Human genes 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 241000713869 Moloney murine leukemia virus Species 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 101150033433 Msh2 gene Proteins 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 206010028470 Mycoplasma infections Diseases 0.000 description 1
- VQAYFKKCNSOZKM-IOSLPCCCSA-N N(6)-methyladenosine Chemical compound C1=NC=2C(NC)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O VQAYFKKCNSOZKM-IOSLPCCCSA-N 0.000 description 1
- VQAYFKKCNSOZKM-UHFFFAOYSA-N NSC 29409 Natural products C1=NC=2C(NC)=NC=NC=2N1C1OC(CO)C(O)C1O VQAYFKKCNSOZKM-UHFFFAOYSA-N 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 102000003729 Neprilysin Human genes 0.000 description 1
- 108090000028 Neprilysin Proteins 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- IOVCWXUNBOPUCH-UHFFFAOYSA-N Nitrous acid Chemical compound ON=O IOVCWXUNBOPUCH-UHFFFAOYSA-N 0.000 description 1
- 102000008297 Nuclear Matrix-Associated Proteins Human genes 0.000 description 1
- 108010035916 Nuclear Matrix-Associated Proteins Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- 108010079246 OMPA outer membrane proteins Proteins 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 102100023224 Paladin Human genes 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 102000005877 Peptide Initiation Factors Human genes 0.000 description 1
- 108010044843 Peptide Initiation Factors Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 101900235899 Plasmodium falciparum Merozoite surface protein 1 Proteins 0.000 description 1
- 101710083689 Probable capsid protein Proteins 0.000 description 1
- WDVSHHCDHLJJJR-UHFFFAOYSA-N Proflavine Chemical compound C1=CC(N)=CC2=NC3=CC(N)=CC=C3C=C21 WDVSHHCDHLJJJR-UHFFFAOYSA-N 0.000 description 1
- 102000013009 Pyruvate Kinase Human genes 0.000 description 1
- 108020005115 Pyruvate Kinase Proteins 0.000 description 1
- 108091030071 RNAI Proteins 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 101100208039 Rattus norvegicus Trpv5 gene Proteins 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- 102100038081 Signal transducer CD24 Human genes 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 239000004904 UV filter Substances 0.000 description 1
- 101150100931 VI gene Proteins 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 229940023020 acriflavine Drugs 0.000 description 1
- 125000003275 alpha amino acid group Chemical group 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 238000003782 apoptosis assay Methods 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 238000002819 bacterial display Methods 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 230000001427 coherent effect Effects 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000004624 confocal microscopy Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 1
- 238000004163 cytometry Methods 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 101150036185 dnaQ gene Proteins 0.000 description 1
- 230000005014 ectopic expression Effects 0.000 description 1
- 230000000547 effect on apoptosis Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 102000013165 exonuclease Human genes 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000005021 gait Effects 0.000 description 1
- 108091008053 gene clusters Proteins 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229930004094 glycosylphosphatidylinositol Natural products 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 125000002768 hydroxyalkyl group Chemical group 0.000 description 1
- 210000001822 immobilized cell Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 239000000138 intercalating agent Substances 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 229920006008 lipopolysaccharide Polymers 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 238000010841 mRNA extraction Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229960000901 mepacrine Drugs 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- 230000036438 mutation frequency Effects 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 210000000299 nuclear matrix Anatomy 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 229960000286 proflavine Drugs 0.000 description 1
- 230000005522 programmed cell death Effects 0.000 description 1
- 230000001915 proofreading effect Effects 0.000 description 1
- GPKJTRJOBQGKQK-UHFFFAOYSA-N quinacrine Chemical compound C1=C(OC)C=C2C(NC(C)CCCN(CC)CC)=C(C=CC(Cl)=C3)C3=NC2=C1 GPKJTRJOBQGKQK-UHFFFAOYSA-N 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 229960000329 ribavirin Drugs 0.000 description 1
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000001568 sexual effect Effects 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 108020003113 steroid hormone receptors Proteins 0.000 description 1
- 102000005969 steroid hormone receptors Human genes 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 125000004001 thioalkyl group Chemical group 0.000 description 1
- 238000010399 three-hybrid screening Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000001086 yeast two-hybrid system Methods 0.000 description 1
Description
WO 2004/055182 PCT/AU2003/001697 1 In vivo affinity maturation scheme Field of the Invention 5 The present invention relates to the field of evolution of nucleic acids in vivo and provides methods and compositions for introducing diversity into gene products. The present invention allows generation of new sequences that have desirable properties by virtue of high frequency mutation events within a cell. The high frequency mutation of a polynucleotide sequence results in the production of a large population of new 10 sequence variants. Appropriate selection and/or screening permits identification and isolation of mutant forms of the polynucleotide sequence as well as products resulting from expression of the mutant sequences. Background of the Invention 15 In vitro evolution of proteins involves generating diversity by introducing mutations into known gene sequences to produce a library of mutant sequences, translating the sequences to produce a very large number of mutant gene products, which are then selected for the desired properties. Such schemes can be divided into two distinct 20 groups; i) partial in vitro methods in which the mutated target protein is displayed on the surface of the either phage, bacteria or yeast but the mutation step is performed outside the cell and ii) entirely in vitro methods in which the target is displayed as part of a ribosome quaternary complex or polysome and all other steps including mutation are performed in a cell free environment. These processes have the potential for 25 generating proteins with improved diagnostic and therapeutic utilities. Unfortunately, however, the potential of such processes has been limited by deficiencies in methods currently available for mutation, library generation and display of correctly folded proteins. 30 For example, in the case of partial in vitro methods, the DNA must be synthesised in vitro or extracted from the cells for mutagenesis. Although various mutagenesis approaches (including error prone PCR, DNA shuffling, chain shuffling and site directed mutagenesis) have been successfully used to generate mutant libraries, some of this diversity is lost due to limitations in subsequent transformation efficiency. 35 Consequently, the generation of large libraries (e.g. beyond a library size of 1010) of unique individual genes and their encoded proteins has proven difficult particularly WO 2004/055182 PCT/AU2003/001697 2 with phage display systems. A further disadvantage is that methods which utilise phage display systems require several sequential steps of mutation, amplification, selection and further mutation. Given that extraction and reintroduction of DNA into the cell is required for these systems, their potential to generate large diversity in the 5 target gene library is further restricted. To circumvent this problem, entirely in vitro methods such as continuous in vitro evolution (CIVE) have been developed and are described, for example, in WO 99/58661. In theory any diversity created through mutagenesis in these systems is not 10 lost. In the case of CIVE, a mutating enzyme is used to introduce nucleic acid base changes into the target sequence. The only factor limiting diversity here is the mutation rate of this enzyme. Reports of mutation rates using other in vitro mutation methods such as error prone PCR, DNA shuffling (sexual PCR), chain shuffling and site directed mutagenesis over selected CDRs which can be used in this scheme vary 15 significantly. Despite using different mechanisms all these approaches operate in an artificial environment in which only defined components required for these processes are present. It is possible there may be additional unknown factors involved, which are not supplied. Furthermore, this cell-free environment lacks the secretory and post translational machinery required to produce a correctly folded and processed protein. 20 As a result, this restricts the type of targets which can be "evolved" in these systems and allows incorrectly folded, umnodified mutant proteins which have no functional relevance in a clinical setting to be selected. Bacterial and phage display also have the same associated problems. 25 In vivo evolution of proteins involves the same steps and principles as previously described for in vitro evolution (i.e. mutation, display, selection and amplification). However, in vivo systems overcome many of the problems associated with the in vitro approaches. One in vivo cyclical procedure that has been reported involves Escherichia coli mutator cells that were used as a vehicle for mutation of recombinant antibody 30 genes. The E.coli mutator cells, MUTD5-FIT which carried a mutated DNAQ gene were used as the source of the S-30 extracts and therefore allowed mutations to be introduced into DNA during replication as a result of proofreading errors. However, mutation rates were low compared to the required rate. For example, to mutate 20 residues with the complete permutation of 20 amino acid requires a library size of 35 lx1026, an extremely difficult task with currently available phage library display WO 2004/055182 PCT/AU2003/001697 3 methodology. Obviously, the disadvantages with using bacteria and phage in terms of transformation efficiencies, and protein folding etc. make this a less desirable scheme. In view of the above it is clear that the current affinity maturation schemes are 5 somewhat limited in their ability to generate and select functionally superior binders. Summary of the invention The present inventors have now developed a novel process for the in vivo evolution of 10 gene products. This process generates mutants of target nucleic acid sequences by somatic hypermutation, yielding mutant products capable of undergoing any post translational modifications that may be required for biological activity. A selection system particular to the properties of the target product is then utilized to identify desirable mutants. 15 Accordingly, in a first aspect, the present invention provides a method for producing and selecting a gene product with desired characteristics, the method comprising (i) introducing into a hypermutating cell a target nucleic acid molecule encoding a 20 gene product such that the target nucleic acid molecule is integrated into an immunoglobulin locus of the genome of the hypermutating cell; (ii) culturing the hypermutating cell such that the target nucleic acid molecule undergoes hypermutation during DNA and/or RNA synthesis, giving rise to a 25 population of cells expressing mutant gene products; and (iii) selecting a mutant gene product with desired characteristics. The term "immunoglobulin locus" refers to a variable region of an antibody molecule 30 or all or a portion of a regulatory nucleotide sequence that controls expression of an antibody molecule. Immunoglobulin loci for heavy chains may include but are not limited to all or a portion of the V, D, J, and switch regions (including intervening sequences called introns) and flanking sequences associated with or adjacent to the particular heavy chain constant region gene expressed by the antibody-producing cell to 35 be transfected and may include regions located within or downstream of the constant region (including introns). Immunoglobulin loci for light chains may include but are WO 2004/055182 PCT/AU2003/001697 4 not limited to the V and J regions, their upstream flanking sequences, and intervening sequences (introns), associated with or adjacent to the light chain constant region gene expressed by the antibody-producing cell to be transfected and may include regions located within or downstream of the constant region (including introns). 5 Immunoglobulin loci for heavy chain variable regions may include but are not limited to all or a portion of the V, D, and J regions (including introns) and flanking sequences associated with or adjacent to the particular variable region gene expressed by the antibody-producing cell to be transfected. Immunoglobulin loci for light chain variable regions may include but are not limited to the V and J region (including introns) and 10 flanking sequences associated with or adjacent to the light chain variable region gene expressed by the antibody-producing cell to be transfected. In the human, the immunoglobulin heavy chain (IgH) locus is located on chromosome 14. In the 5'-3' direction of transcription, the locus comprises a large cluster of variable 15 region genes (VH), the diversity (D) region genes, followed by the joining (JH) region genes and the constant (CH) gene cluster. The size of the locus is estimated to be about from 1,500 to about 2,500 kilobases (kb). During B-cell development, discontinuous gene segments from the germ line IgH locus are juxtaposed by means of a physical rearrangement of the DNA. In order for a functional heavy chain Ig polypeptide to be 20 produced, three discontinuous DNA segments, from the VH, D, and JH regions must be joined in a specific sequential fashion; first D to JH then VH to DJH, generating the functional unit VHDJH. Once a VHDJH has been formed, specific heavy chains are produced following transcription of the Ig locus, utilizing as a template the specific VHDJHCH unit comprising exons and introns. 25 There are two loci for immunoglobulin light chains (IgL), the kappa locus on human chromosome 2 and the lambda locus on human chromosome 22. The organization of the IgL loci is similar to that of the IgH locus, except that the D region is not present. Following IgH 'rearrangement, rearrangement of a light chain locus is similarly 30 accomplished by VL to JL joining of the kappa or lambda chain. The sizes of the lambda and kappa loci are each approximately 1000 kb to 2000 kb. Expression of rearranged IgH and an Ig kappa or Ig lambda light chain in a particular B-cell allows for the generation of antibody molecules.
WO 2004/055182 PCT/AU2003/001697 5 In a further preferred embodiment of the invention the immunoglobulin locus is a rearranged VH4 gene. In a further preferred embodiment, the immunoglobulin locus is a rearranged VH 4
..
3 4 allele. 5 By "hypermutation" we mean a mechanism by which mutagenesis occurs at a rate approaching that naturally occurring in the immunoglobulin variable region, which is preferably in the range of 10 4 to 10-3/base pair/generation/cell but more preferably in the range of 5x1 05 to 5x10 4/base pair/generation/cell. 10 A "hypennutating cell" is a cell or cell line containing hypermutation elements. By "hypermutation elements" we mean an intronic enhancer (Ei), matrix attachment regions (MAR), and a 3' enhancer. The intronic enhancer may be, for example, E mu or E kappa. The 3' enhancer may be, for example, a 3' kappa enhancer or a 3'H 15 enhancer. A "matrix attachment region" (MAR) is defined by its ability to bind to the nuclear matrix. Matrix attachment region sequences flank the IgH intronic enhancer. 20 In one embodiment the hypermutating cell is an immunoglobulin-expressing cell which is capable of expressing at least one immunoglobulin V gene. A V gene may be a variable light chain (VL) or a variable heavy chain (VH) gene, and may be produced as part of an entire immunoglobulin molecule. Preferred hypennutating cells for use in the present invention are derived from B-cell lines. Lymphoma cells may be used for 25 the isolation of constitutively hypermutating cell lines for use in the present invention. In a preferred embodiment of the present invention, following integration into the immunoglobulin locus of the hypermutating cell, the target nucleic acid molecule is located in proximity to one or more endogenous hypermutation elements. Preferably, 30 the immunoglobulin locus is a VH gene and the target nucleic acid molecule is located in proximity to an endogenous intronic enhancer, and endogenous matrix attachment regions. The phrase "located in proximity to" means that hypermutation elements are located 35 close enough to the target nucleic acid molecule to effect hypermutation of the target nucleic acid molecule.
WO 2004/055182 PCT/AU2003/001697 6 In an alternative embodiment of the invention, following integration into the immunoglobulin locus of the hypermutating cell, the target nucleic acid molecule is located in proximity to at least one exogenous hypermutation element. For example, 5 the target nucleic acid molecule may be located in proximity to an exogenous intronic enhancer, an exogenous matrix attachment region and/or an exogenous 3' kappa enhancer. Any one or more of these exogenous elements may be integrated into the immunoglobulin locus simultaneously with the target nucleic acid molecule. 10 A suitable exogenous "intronic enhancer" may be, for example, the Xbal-EcoRI fragment described in Grosschedl et al (1985) Cell Vol 41:885-897, the intronic enhancer described in Rabbitts et al (1983) Nature 306 (5945):806-809, or the intronic enhancer described in Ravetch et al (1981) Cell 27 (3 Pt 2): 583-591; or can be one or more sub-fragments thereof detenrined to have hypermutation activity. 15 A suitable exogenous "3' kappa enhancer" is the ScaI-XbaI fragment described in Meyer et al (1989) EMBO Journal Vol. 8, no. 7 p. 1959-1964 and can be one or more sub-fragments determined to have hypermutation activity. 20 Hypermutation-competent fragments of exogenous intronic enhancers or the 3' kappa enhancer can be identified in a number of ways. One way is to perform deletional analysis by constructing hypermutation cassettes containing various enhancer deletion mutants and a reporter gene. The hypermutation efficency of the enhancer deletion mutant can be assessed by determining the rate of mutation of the reporter gene. 25 Deletion mutants can be prepared in a variety of ways. Oligonucleotides can be designed containing fragment sequences to be tested. Alternatively, a more random approach is to linearize the expression vector by restriction digest within an enhancer, followed by subsequent exonuclease treatment and religation. Yet another method is to simply use restriction digests to remove sections of DNA. 30 It is preferred that following integration, a 3' enhancer and/or an intronic enhancer are positioned at a location 3' of the target nucleic acid sequence. It is further preferred that the intronic enhancer be located in greater proximity to the target gene than the 3' enhancer. The 5' end of the intronic enhancer is preferably positioned up to 3 kb 3' of 35 the 3' end of the target gene, preferably less than 2 kb, more preferably less than 1 kb, and most preferably immediately adjacent to the target nucleic acid sequence. The WO 2004/055182 PCT/AU2003/001697 7 intronic enhancer can be positioned greater than 3 kb 3' of the target gene, but this is less preferred. The 3' enhancer is preferably located up to 20 kb and preferably 5-15 kb 3' of the intronic enhancer. The 3' enhancer can be located as close as 1 kb 3' of the intronic enhancer, but this is less preferred. In another embodiment, the 3' enhancer 5 fragment is located 5' relative to the target gene. The intronic enhancer can also be positioned 5' relative to the target gene, although this embodiment is less preferred. In a further preferred embodiment, the enhancers are present in a genomic orientation. The enhancer sequence present in the genomic immunoglobulin gene is present in a 10 "genomic orientation". If it is flipped in the construct so that it now appears in a 3' to 5' orientation (as opposed to the 5' to 3' orientation in the native genomic configuration), it is present in the "reverse orientation". However, the 3' enhancer can be present in reverse orientation. The enhancer can also be present in reverse orientation, but this is less preferred. 15 In a further preferred embodiment of the first aspect, following integration of the target nucleic acid molecule into the immunoglobulin locus, the target nucleic acid molecule is operatively linked to a promoter. .Preferably, the target nucleic acid molecule is located downstream of the promoter and upstream of an intronic enhancer. 20 The term "promoter" is well-known in the art and encompasses nucleic acid regions ranging in size and complexity from minimal promoters to promoters including upstream elements and enhancers. 25 In one preferred embodiment of the invention, the promoter is a naturally occurring promoter that exists within the immunoglobulin locus. In one embodiment, the promoter is an immunoglobulin heavy or light chain promoter. Preferably, the promoter is an immunoglobulin heavy chain promoter of a VH4 allele. There is strong conservation between the promoter sequences of the VH 4 alleles (Figure 1). A wide 30 range of hypermutating cell lines (including RAMOS and BL2 cell lines) carry rearranged VH4 alleles. Alternatively, the promoter may be a heterologous or exogenous promoter selected from those which are functional in mammalian cells, although prokaryotic promoters 35 and promoters functional in other eukaryotic cells may be used. The promoter may be derived from promoter sequences of viral or eukaryotic genes. For example, it may be a WO 2004/055182 PCT/AU2003/001697 8 promoter derived from the genome of a cell in which expression is to occur. With respect to eukaryotic promoters, they may be promoters that function in a ubiquitous manner (such as promoters of a-actin, P-actin, tubulin) or, alternatively, a tissue specific manner (such as promoters of the genes for pyruvate kinase). They may also 5 be promoters that respond to specific stimuli, for example promoters that bind steroid hormone receptors. Viral promoters may also be used, for example the Moloney murine leukaemia virus long terminal repeat (MMLV LTR) promoter, the rous sarcoma virus (RSV) LTR promoter or the human cytomegalovirus (CMV) IE promoter. In a preferred embodiment, the promoter is an immunoglobulin promoter sequence such as 10 a murine immunoglobulin promoter sequence or a human immunoglobulin heavy chain promoter. The promoter region of mammalian/human genes can contain several regulatory elements in the DNA sequences, and span several hundred bases or more, it is generally 15 observed that one of these elements, designated 'TATA box" sequence, in eukaryotic promoter regions is usually found approximately 300 bases or more upstream of the translation initiation site (start) sequence, ATG. Rearrangements which bring the V gene promoter into closer proximity to the ATG translation start signal also brings the promoter closer to the enhancer which is 3' and located in the C region. This activates 20 the promoter which indicates that the close proximity to the enhancer may affect the rate at which the DNA in the VH locus is mutated. The present inventors have found that in a RAMOS RA-1 cell line in which the rearrangement generates a functional VH4-34 allele, the promoter is significantly closer 25 to the translation initiation start site than in other mammalian/human genes (based upon the number of nucleotides between the 3' end of the "TATA box" and the initiation codon of the immunoglobulin leader sequence). This proximity of the promoter to the start codon and the three dimensional structure of the promoter caused significant difficulties in cloning this region from RAMOS RA-1. 30 Accordingly, in a further preferred embodiment of the invention, following integration of the target nucleic acid molecule into the immunoglobulin locus, the target nucleic acid molecule is located within close proximity to the promoter. Preferably, the initiation codon of the target nucleic acid molecule is located within 500 bp of the 3' 35 end of the promoter, more preferably within 200 bp of the 3' end of the promoter, more WO 2004/055182 PCT/AU2003/001697 9 preferably within 100 bp of the 3' end of the promoter and more preferably within 20 bp of the 3' end of the promoter. It may also be advantageous for the promoters to be inducible so that the levels of 5 expression of the heterologous gene can be regulated during the life-time of the cell. Inducible means that the levels of expression obtained using the promoter can be regulated. In addition, any of these promoters may be modified by the addition of further 10 regulatory sequences, for example enhancer sequences. Chimeric promoters may also be used comprising sequence elements from two or more different promoters described above. In a further preferred embodiment of the present invention, the target nucleic acid 15 molecule is introduced into the cell by way of an integration vector comprising a sequence homologous to a region of at least 500 bp, more preferably at least 2 kb, more preferably approximately 5 kb upstream of a rearranged V gene and a sequence homologous to a region of at least 500 bp, more preferably at least 2 kb, more preferably approximately 5kb downstream of the same rearranged V gene. Preferably, 20 the sequence homologous to a region downstream of the rearranged V gene comprises an intronic enhancer and matrix attachment regions or portions thereof. It is preferred that the upstream and downstream homologous sequences are at least 500 bp in length, more preferably about 5 kb in length. 25 A "target nucleic acid molecule" can be any nucleic acid molecule of interest (including DNA and RNA molecules) encoding a gene product where diversification of the gene product is desired. The "gene product" may be any biologically active molecule of interest. For example, 30 the gene product may be a catalytic molecule such as a ribozyme, a DNAzyme, an LNAzyme or an RNAi/siRNA molecule. Alternatively, the gene product may be an antibody or fragment thereof, an enzyme, a hormone, a receptor, a cell surface molecule, a viral protein, transcription factor or any other biologically active polypeptide. 35 WO 2004/055182 PCT/AU2003/001697 10 The selected mutant target sequence may be recycled through the methods of the present invention in order to introduce further diversification. Accordingly, in a further preferred embodiment of the first and second aspects, at least steps (ii) and (iii) of the method are repeated. 5 The hypermutating cell may be a mammalian, avian, yeast, fungi, insect or bacterial cell. In a preferred embodiment, the hypermutating cell is a mammalian cell. The mammalian hypermutating cell may be selected from the group consisting of RAMOS, BL2, BL41, BL70 and Nahm. 10 The method of the present invention may include further steps to increase the rate of mutation of the target nucleic acid sequence. For example, the hypermutating cell may be cultured in the presence of chemical mutagens. Suitable chemical mutagens include, for example, sodium bisulfite, nitrous acid, hydroxylamine, hydrazine or 15 formic acid. Other agents which are analogues of nucleotide or nucleoside precursors include nitrosoguanidine, ribavirin, 5-bromouracil, 2-aminopurine, 5-formyl uridine, isoguanosine, acridine and of N 4 -aminocytidine, N'-methyl-N 4 -aminocytidine, 3,N 4 ethenocytidine, 3-methylcytidine, 5-hydroxycytidine, N 4 -dimethyleytidine, 5-(2 hydroxyethyl)cytidine, 5-chlorocytidine, 5-bromocytidine, N 4 -methyl-N.sup.4 20 aminocytidine, 5-aminocytidine, 5-nitrosocytidine, 5-(hydroxyalkyl)-cytidine, 5 (thioalkyl)-cytidine and cytidine glycol, 5-hydroxyuridine, 3-hydroxyethyluridine, 3 methyluridine, 0 2 -methyluridine, 02-ethyluridine, 5-aminouridine, 0 4 -methyluridine, 0 4 -ethyluridine, 0 4 -isobutyluridine, 0 4 -alkyluridine, 5-nitrosouridine, 5 (hydroxyalkyl)-uridine, and 5-(thioalkyl)-uridine, 1,N 6 -ethenoadenosine, 3 25 methyladenosine, and N 6 -methyladenosine, 8-hydroxyguanosine, 0 6 -methylguanosine, 06 -ethylguanosine, 0-isopropylguanosine, 3,N2-ethenoguanosine, 06 -alkylguanosine, 8-oxo-guanosine, 2,N 3 -ethenoguanosine, and 8-aminoguanosineas well as derivatives/analogues thereof. Examples of suitable nucleoside precursors, and synthesis thereof, are described in further detail in USSN 20030119764. Generally, 30 these agents are added to the replication or transcription reaction thereby mutating the sequence. Intercalating agents such as proflavine, acriflavine, quinacrine and the like can also be used. Random mutagenesis of the target nucleic acid molecule can also be achieved by 35 irradiation with X-rays or ultraviolet light.
WO 2004/055182 PCT/AU2003/001697 11 Antigen stimulation of the hypermutating cells, or exposure of the cells to interleukins (such as IL-2, IL-4 or IL-10) or CD40 ligand or B cell activating factor (BAFF) may also be used to increase the mutation frequency. 5 In one preferred embodiment, the level or activity of activation-induced cytidine deaminase (AID) within the hypermutating cell is increased. This may be achieved, for example, by increasing expression levels of AID within the hypermutating cells. For example, the hypermutating cells may be transfected with plasmid vectors which encode and express AID. 10 It will be appreciated by those skilled in the art that any process of selecting a mutant product can be used in the methods of the present invention. In one embodiment, selection can be achieved by binding to a target molecule or by 15 measurement of a biological response affected by the mutant product. In another example, if the product of interest is an agent that promotes or reduces cell growth or division, the selection process can involve exposing mutant products to a population of cells and monitoring the biological responses of those cells. 20 In another example, if the mutant product is a receptor ligand, the process can involve exposing mutant proteins to cells expressing the receptor and monitoring a biological response effected by signalling of the receptor. 25 In one embodiment, the mutant product is selected by way of an assay performed within the hypermutating cell. For example, if the target nucleotide sequence encodes an enzyme, the assay may simply measure enzymatic activity. Alternatively , the assay performed within the hypermutating cell may be a protein 30 fragment complementation assay (PCA). PCAs rely on the complementation of enzyme fragments fused to interacting proteins that reconstitute enzymatic activity once dimerised. Examples of PCA protocols are described in Michnick (2001) Current opinion in structural biology 11:472-477; Wehrman et al. (2002). PNAS 99(6):3469 3474; and Galarneau et al. (2002). Nature 20:616-622. 35 WO 2004/055182 PCT/AU2003/001697 12 Suitable enzyme fragments may be derived, for example, from p-lactamase. Studies using the p-lactamase system in both bacteria and mammalian cells have successfully validated it as a suitable reporter system to detect protein-protein interactions inside the cell. 5 The target nucleic acid molecule may therefore encode a fusion protein comprising a binding partner and a p-lactamase fragment. Its binding partner may be introduced into the cell as a fusion protein comprising a complementary p-lactamase fragment. Selection occurs inside the cell with the binding of the target protein to its cognate 10 partner which is detected by p-lactamase activity on a substrate supplied. If selection assays such as PCAs are used, it is not necessary to display the target polypeptide on the surface of the hypermutating cell. These selection assays are particularly advantageous for targets which are naturally found intracellularly. 15 In an alternative embodiment of the present invention, the target nucleic acid molecule is linked to a sequence encoding an anchor domain such that following expression, the mutant gene product is displayed on the surface of the hypermutating cell. Examples of suitable anchor domains include attachment signals from glycosylphosphatidylinositol 20 (GPI) anchored membrane proteins or transmembrane domains of other cell surface proteins. If the gene product to be displayed is not normally found on the cell surface, it is preferred that the target nucleic acid molecule is also linked to a sequence encoding an 25 N-terminal signal peptide (or a leader peptide). This signal peptide facilitates targeting of the gene product to the plasma membrane. Following display on the surface of the hypermutating cell, the mutant gene product may be selected by detecting binding of a binding partner to the mutant gene product. 30 This may involve, for example, labelling cells with a detectable marker such as a fluorescent dye and allowing binding to occur between the mutant protein on the cell surface and its binding partner. If the binding partner has been immobilized on a plate, a suitable detection system, such as a fluorimeter, can be used to identify wells containing a mutant of interest. 35 WO 2004/055182 PCT/AU2003/001697 13 Alternatively, the binding partner may be labelled with a fluorescent tag, and cells expressing a mutant gene product of interest may be sorted using flow cytometric techniques. The binding partner may be selected from the group consisting of an antibody, receptor, hormone, enzyme, cell surface molecule, transcription factor, DNA 5 or RNA molecule. In another embodiment of the invention, the target gene product is expressed in soluble form. 10 To prevent repeated mutation after selection, hypermutation may be arrested prior to culturing the selected cells. This can be accomplished in a number of ways, including fusion to a myeloma or repression of an inducible promoter. In a further preferred embodiment of the invention, the mutant nucleic acid sequence 15 encoding the selected gene product is recovered from the hypermutating cell. This recovery can be achieved by amplification of the mutant nucleic acid sequence in whole or in part by polymerase chain reaction, using oligonucleotides that will anneal to locations outside the region of hypermutation or within the target sequence itself. Alternatively, the mutant nucleic acid sequence may be amplified using RT-PCR. The 20 mutant nucleic acid sequence can then be subeloned for other purposes, such as expression, purification, or characterization. The conditioned media from the transfected cells can be concentrated if desired and applied to the selection system. Specific binders can be identified directly or indirectly, 25 for example by antibody recognition of either the target gene product itself or an attached tag sequence. The mutant gene products of interest can then be further characterized by a number of protein chemistry techniques such as micro-sequencing. In a second aspect the present invention provides a gene product produced by a method 30 of the first aspect. In a third aspect the present invention provides a vector for targeted integration into an immunoglobulin locus of a hypermutating cell, the vector comprising a sequence homologous to a region upstream of a rearranged V gene of the hypermutating cell, a 35 sequence homologous to a region downstream of a rearranged V gene of the hypermutating cell and a site for insertion of a target nucleic acid molecule.
WO 2004/055182 PCT/AU2003/001697 14 In a preferred embodiment of the third aspect, the region upstream of the rearranged VH gene of the hypermutating cell is a region within nucleotides 1 to 5190 of SEQ ID NO:1. Preferably, the region is at least 500 bp, more preferably at least 2 kb, more 5 preferably about 5 kb within nucleotides 1 to 5190 of SEQ ID NO:1. In a further preferred embodiment the region upstream of the rearranged V gene of the hypernutating cell comprises nucleotides 191 to 5190 of SEQ ID NO: 1. In a further preferred embodiment of the third aspect, the region downstream of the 10 rearranged VH gene of the hypermutating cell is a region within nucleotides 5709 to 8699 of SEQ ID NO:1. Preferably, the region is at least 500 bp, more preferably at least 3 kb, 5709 to 8699 of SEQ ID NO:1. In a further preferred embodiment the region downstream of the rearranged. VH gene of the hypermutating cell comprises nucleotides 5709 to 8634 of SEQ ID NO:1. 15 In a further preferred embodiment of the third aspect, the vector further comprises a selectable marker. The term "selection marker" or "selectable marker" includes both positive and negative selection markers. A "positive selection marker" is a nucleic acid sequence that allows the survival of cells containing the positive selection marker under 20 growth conditions that kill or prevent growth of cells lacking the marker. An example of a positive selection marker is a nucleic acid sequence which promotes expression of the neomycin resistance gene, or the kanamycin resistance gene. Cells not containing the neomycin resistance gene are selected against by application of G418, whereas cells expressing the neomycin resistance gene are not harmed by G41 8 (positive selection). 25 A "negative selection marker" is a nucleic acid sequence that kills, prevents growth of or otherwise selects against cells containing the negative selection marker, usually upon application of an appropriate exogenous agent. An example of a negative selection marker is a nucleic acid sequence which promotes expression of the thymidine kinase gene of herpes simplex virus (HSV-TK). Cells expressing HSV-TK are selected 30 against by application of ganciclovir or 1-2'-deoxy-2'fluoro-b-D-arabinofuranosyl-5 iodouracil (FIAU); negative selection), whereas cells not expressing the gene are relatively unharmed by ganciclovir or FIAU. In a further preferred embodiment the vector encodes an anchor molecule suitable for 35 display of the protein encoded by the target nucleic acid molecule.
WO 2004/055182 PCT/AU2003/001697 15 In a further preferred embodiment the vector comprises a target nucleic acid molecule with an epitope tag(s) (for example, two flag tags). In a further preferred embodiment, the vector for targeted integration comprises a 5 sequence as set out in SEQ ID NO:110. The present invention provides a novel approach for generating diversity in a gene product (see Figure 2). An important feature of the present invention is that the target nucleic acid molecule is integrated into the immunoglobulin locus of a host cell 10 genome. This integration is achieved by including sequences homologous to regions upstream and downstream of the rearranged V gene in the integration vector. This directed integration ensures that the target nucleic acid molecule is positioned in proximity to elements that effect hypermutation (eg. in proximity to elements such as an intronic enhancer, matrix attachment regions and/or a 3' enhancer) following 15 integration. The integration process also ensures that only one copy of the target nucleic acid molecule is present in each cell. This facilitates the recovery of mutant target nucleic acid sequences of interest following the selection process by, for example, PCR or RT 20 PCR. In contrast, methods which involve the introduction of a target nucleic acid on a self replication vector or on a vector which integrates randomly into the host genome are likely to result in multiple mutated copies of target nucleic acid molecule in the host cell. This makes it difficult to determine which sequence encodes the mutant gene product which has been selected for its desired properties. 25 It will be appreciated that the methods of the present invention may be used for a variety of purposes. For example, the methods of the present invention can be used to effect affinity maturation of antibodies. In one aspect, the invention may be applied toward improving the affinity of antibodies from "naive," i.e., non-immune, phage 30 human antibody libraries. Such libraries already exist and yield antibodies to any antigen. However, since they are made from non-immunized individuals, their affinities are low. In another aspect of the invention, the affinity of antibodies that were generated by conventional hybridoma techniques can be improved by applying a high rate mutagenesis system of the invention to the isolated target nucleic acid 35 encoding for the initial low-affinity antibody. These enhanced-affinity antibodies can WO 2004/055182 PCT/AU2003/001697 16 be utilized as improvements over many antibody-based diagnostics and therapeutics currently available. The methods of the present invention allow a very large library of peptides and single 5 chain antibodies to be screened and the polynucleotide sequence encoding the desired peptide(s) or single-chain antibodies to be selected. The pool of polynucleotides can then be isolated and shuffled to recombine combinatorially the amino acid sequence of the selected peptide(s) (or predetermined portions thereof) or single-chain antibodies (or just VH, VL, or CDR portions thereof). Using these methods, one can identify a 10 peptide or single-chain antibody as having a desired binding affinity for a molecule and can exploit the process of the invention to converge rapidly to a desired high-affinity peptide or scFv. The peptide or antibody can then be synthesized in bulk by conventional means for any suitable use (e.g., as a therapeutic or diagnostic agent). 15 The mutagenesis system can also be used to effect receptor or ligand modification. In one aspect, the invention can generate a ligand or receptor with enhanced binding characteristics for its corresponding receptor or ligand. In another aspect, the mutagenesis system can be used to generate an inhibitor of functional receptor-ligand interaction by creating a ligand or receptor that still binds, but does not elicit a 20 functional response. In yet another aspect of the invention, multiple biologically active variants of a target protein can be identified and recovered, thereby providing a means to study structure-function relationships of the protein. Additionally, species diversity can be investigated by comparing results obtained by selections utilizing receptors or other molecules from different species. 25 A receptor or ligand can be modified such that it can still bind, but does not signal any more. Alternatively, a better signalling ligand can be selected, which would provide a lower effective dosage of a pharmacologically active therapeutic. 30 The mutagenesis system of the present invention may also be used, for example, on a target such as caspase, an initiation factor target involved in a novel survival mechanism. This involves a cascade of essentially signalling reactions on the route to programmed cell death (apoptosis). Caspase-3 once activated binds to, and cleaves (activates) the 'cell death' proteins (including Id3). In vivo mutation and expression of 35 mutated caspases, especially caspase-3, would have an effect on apoptosis. Therefore caspase 3 would be a preferred target molecule. This could be relevant to diagnostics WO 2004/055182 PCT/AU2003/001697 17 in cell signal transduction for monitoring and detection of cancer, and with potential therapeutic outcomes. Throughout this specification the word "comprise", or variations such as "comprises" or 5 "comprising", will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps. A Brief Description of the Figures 10 Figure 1: Alignment of human immunoglobulin heavy chain promoters for VH4 alleles. Sequences provided as SEQ ID NO's 2 to 7. Figure 2: Schematic representation of a preferred method of the present invention. 15 Figure 3: Schematic representation of the gene targeting region - the preferred site for direct insertion of the target nucleic acid into a rearranged V gene. Figure 4: Schematic representation of vector 3kb15a-7-4T. 20 Figure 5: Schematic representation of vector KW2. Figure 6: Schematic representation of vector for targeted integration, KW3. 25 Figure 7: RAMOS cells stained with CFSE showing successive divisions on each day. Figure 8: Schematic representation of vector pME18SasFP499. Figure 9: The effect of DNA amount and electroporation parameters on transfection 30 of RAMOS RA-1 cells with pME18SEGFP. Figure 10: Comparison of RAMOS RA-1 cells transfected with pME18sEGFP, pME18sasFP499 or mock transfected.
WO 2004/055182 PCT/AU2003/001697 18 Figure 11: (A): Quantum Simply Cellular Beads stained with mouse anti-human IgM Alexa 488. (B) RAMOS cells stained with mouse anti-human IgM-Alexa 488. (C) Quantitation of IgM molecules on the surface of RAMOS RA- 1 cells. 5 Figure 12: Comparison of IgM expression on RAMOS RA-1 cells of different passage number. (A) RAMOS RA-1 passage 1 (B) RAMOS RA-1 passage 14. Figure 13: IgM expression on RAMOS RA-1 samples from different sources. 10 Figure 14: Schematic representation of sequential overlap extension PCR. Figure 15: Schematic representation of mammalian expression vector pME18sCD26asfp499. 15 Figure 16: Comparison of expression of asFP499 with and without the CD26 anchor in RAMOS RA-1. Figure 17: Comparison of expression of asFP499 with and without the CD26 anchor in HEK 293 T. 20 Key to the Sequence Listing SEQ ID NO:1 - Heavy chain locus of Ramos RA-1 cells. SEQ ID NO:2 - Sequence of promoter region of a VH4 allele. 25 SEQ ID NO:3 - Sequence of promoter region of a VH4 allele. SEQ ID NO:4 - Sequence of promoter region of a VH4 allele. SEQ ID NO:5 - Sequence of promoter region of a VH4 allele. SEQ ID NO:6 - Sequence of promoter region of a VH4 allele. SEQ ID NO:7 - Consensus sequence of SEQ ID NO's 2 to 6. 30 SEQ ID NO:8 - Plasmid pME18SasFP499. SEQ ID NO:9 - Sequence of enhancer of human immunoglobulin D segment locus. SEQ ID NO:10 - Sequence of enhancer of human immunoglobulin heavy locus on chromsome 14. SEQ ID NO: 11 - Sequence of sheep immunoglobulin heavy chain 5' intronic enhancer. 35 SEQ ID NO:12 - Sequence of mouse 3' IgH regulatory enhancer. SEQ ID NO:13 - Sequence of murine IgH enhancer.
WO 2004/055182 PCT/AU2003/001697 19 SEQ ID NO:14 - Sequence of mouse 3' kappa enhancer. SEQ ID NO:15 - Promoter sequence of mouse immunoglobulin VH gene. SEQ ID NO: 16 - Promoter sequence of mouse immunoglobulin VI gene. SEQ ID NO:17 - Promoter sequence of mouse immunoglobulin mu heavy chain gene. 5 SEQ ID NO:18 - Promoter sequence of mouse immunoglobulin VH gene. SEQ ID NO:19 - Homo sapiens germline IgH chain (ProV4-39) gene fragment. SEQ ID NO:20 - Homo sapiens germline IgH chain (ProV3-30) gene fragment. SEQ ID NO:21 - Homo sapiens germline IgH chain (ProV3-9) gene fragment. SEQ ID NO:22 - Homo sapiens germline IgH chain (ProVl-18) gene fragment. 10 SEQ ID NO:23 - GPI signal from human decay-accelerating factor. SEQ ID NO:24 - Polynucleotide encoding SEQ ID NO:23. SEQ ID NO:25 - GPI signal from porcine membrane dipeptidase. SEQ ID NO:26 - Polynucleotide encoding SEQ ID NO:25. SEQ ID NO:27 - GPI signal from rat ceruloplasmin. 15 SEQ ID NO:28 - Polynucleotide encoding SEQ ID NO:27. SEQ ID NO:29 - GPI signal from mouse Thy-1. SEQ ID NO:30 - Polynucleotide encoding SEQ ID NO:29. SEQ ID NO:31 - Transmembrane domain of murine B7-1. SEQ ID NO:32 - Polynucleotide encoding SEQ ID NO:31. 20 SEQ ID NO:33 - Signal sequence of CD59. SEQ ID NO:34 - Polynucleotide encoding SEQ ID NO:33. SEQ ID NO's 35 to 86, 88 to 90, 92 to 103, 105, 106, 108 tol20 - Oligonucleotide primers. SEQ ID NO:87 - Plasmid 3kbl5a-7-4T. 25 SEQ ID NO:91 - Plasmid KW2. SEQ ID NO:104 - Plasmid pME18sCD26asFP499. SEQ ID NO:107 - Sequence of coding region of AICDA cDNA. SEQ ID NO:110 - Plasmid KW3. 30 Detailed Description of the Invention General Techniques The present invention is performed without undue experimentation using, unless 35 otherwise indicated, conventional techniques of molecular biology, microbiology, virology, recombinant DNA technology, peptide synthesis in solution, solid phase WO 2004/055182 PCT/AU2003/001697 20 peptide synthesis, and immunology. Such procedures are described, for example, in the following texts that are incorporated by reference: 1. Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratories, New York, Second Edition (1989), whole of Vols I, 5 II, and III; 2. DNA Cloning: A Practical Approach, Vols. I and II (D. N. Glover, ed., 1985), IRL Press, Oxford, whole of text; 3. Oligonucleotide Synthesis: A Practical Approach (M. J. Gait, ed., 1984) IRL Press, Oxford, whole of text, and particularly the papers therein by Gait, pp 1 -22; 10 Atkinson et al., pp35-81; Sproat et al., pp 83-115; and Wu et al., pp 135-151; 4. Nucleic Acid Hybridization: A Practical Approach (B. D. Hames & S. J. Higgins, eds., 1985) IRL Press, Oxford, whole of text; 5. Animal Cell Culture: Practical Approach, Third Edition (John R.W. Masters, ed., 2000), ISBN 0199637970, whole of text; 15 6. Immobilized Cells and Enzymes: A Practical Approach (1986) IRL Press, Oxford, whole of text; 7. Perbal, B., A Practical Guide to Molecular Cloning (1984); 8. Methods In Enzymology (S. Colowick and N. Kaplan, eds., Academic Press, Inc.), whole of series; 20 9. J.F. Ramalho Ortigio, "The Chemistry of Peptide Synthesis" In: Knowledge database of Access to Virtual Laboratory website (Interactiva, Germany); 10. Sakakibara, D., Teicbman, J., Lien, E. Land Fenichel, R.L. (1976). Biochem. Biophys. Res. Commun. 73 336-342 11. Merrifield, R.B. (1963). J. Am. Chem. Soc. 85, 2149-2154. 25 12. Barany, G. and Merrifield, R.B. (1979) in The Peptides (Gross, E. and Meienhofer, J. eds.), vol. 2, pp. 1-284, Academic Press, New York. 13. Winsch, E., ed. (1974) Synthese von Peptiden in Houben-Weyls Metoden der Organischen Chemie (Mniler, E., ed.), vol. 15, 4th edn., Parts 1 and 2, Thieme, Stuttgart. 30 14. Bodanszky, M. (1984) Principles of Peptide Synthesis, Springer-Verlag, Heidelberg.
WO 2004/055182 PCT/AU2003/001697 21 15. Bodanszky, M. & Bodanszky, A. (1984) The Practice of Peptide Synthesis, Springer-Verlag, Heidelberg. 16. Bodanszky, M. (1985) Int. J. Peptide Protein Res. 25, 449-474. 5 Hypermutating cells In the context of the present invention, the hypermutating cells may be bacterial, yeast, avian, fungal, insect or mammalian cells. Examples of suitable hypermutating cells are described below. 10 Bacterial hypermutating strains: (i) Epicurian coli mutator strain XL1-Red (triple DNA repair deficient mutD, mutS, mut T) by Stratagene; (ii) Escherichia coli mutator strain MutD5 (MutD5-FIT, mutated DNAQ 15 gene) Irving RA, Kortt AA, Hudson PJ (1996). Immunotechnology 2(2) 127-43; (iii) Escherichia coli strain FC40. Foster PL (2000) Bioessays 22(12) : 1067 74 and Powell SC & Wartwell RM (2001) Mutation Research 473 (2) 219-28; (iv) Serogroup B meningococcal strains BF18, BF21 (defect in methyl directed mismatch repair - lack DNA adenine methyltransferase (Dam) 20 activity). Bucci et al. (1999) Mol Cell 3 (4) 435-45. Yeast hypermutating strains: (i) Saccharomyces cerevisiae strain (mlh1 A mutant). Shcherbakova & Kunkel (1999). Molecular and Cellular Biology 19(4) 3177-3183. 25 (ii) Saccharomyces cerevisiae strain DAG60 (msh2 mutant). (deficient in mismatch repair system). Drotschmann et al. (1999) Proc. Natl Acad Sci USA 96 2970-2975. Mammalian hypermutating strains: 30 (i) Human B cell lines from Burkitt's lymphoma strains : RAMOS, BL2, BL41, BL70, Nalm-6. Sale & Neuberger (1998) Immunity 9 (6) 859-869. (ii) BL2 : Denepouxs et al. (1997) Immunity 6(1) 3 5-46 and Poltorasky et al. (2001) Proc Natl Acad Sci USA 98 (14) 7976-81 (iii) Human pre B cell line strain 18.81. Bachl et al. (2001) Journal 35 Immunology 166 (8) 5051-7.
WO 2004/055182 PCT/AU2003/001697 22 Intronic Enhancers Examples of suitable exogenous intronic enhancers for use in the present invention include the following: 5 1) 1) DNA sequence of the human immunoglobulin D segment locus (Rabbitts et al (1983) Nature 306 (5945), 806-809): 5' CGGCCCCGATGCGGGACTGCGTTTTGACCATCATAAATCAAGTTTATTTT 10 TTTAATTAATTGAGCGAAGCTGGAAGCAGATGATGAATTAGAGTCAAGATG GCTGCATGGGGGTCTCCGGCACCCACAGCAGGTGGCAGGAAGCAGGTCAC CGCGAGAGTCTATTTTAGGAAGCAAAAAAACACAATTGGTAAATTTATCAC TTCTGGTTGTGAAGAGGTGGTTTTGCCCAGGCCCAGATCTGAAAGTGCTCT ACTGAGCAAAACAACACCTGGACAATTTGCGTTTCTAAAATAAGGCGAGGC 15 TGACCGAAACTGAAAAGGCTTTTTTTAACTATCTGAATTTCATTTCCAATCT TAGCTTATCAACTGCTAGTTTGTGCAAACAGCATATCAACTTCTAAACTGCA TTCATTTTTAAAGTAAGATGTTTAAGAAATTAAACAGTCTTAGGGAGAGTTT ATGACTGTATTCAAAAAGTTTTTTAAATTAGCTTGTTATCCCTTCATGTGTA ATTAATCTCAAATACTTTTTCGATACCTCAGAGCATTATTTTCATAATGACT 20 GTGTTCACAATCTTTTT 3' (SEQ ID NO:9) 2) Homo sapiens immunoglobulin heavy locus (IGH.1@) on chromosome 14 (Ravetch et al (1981) Cell 27 (3 Pt 2), 583-591): 25 5'GGCCCCGATGCGGGACTGCGTTTTGACCATCATAAATCAAGTTTATTTTTT TAATTAATTGAGCGAAGCTGGAAGCAGATGATGAATTAGAGTCAAGATGG CTGCATGGGGGTCTCCGGCACCCACAGCAGGTGGCAGGAAGCAGGTCACC GCGAGAGTCTATTTTAGGAAGCAAAAAAACACAATTGGTAAATTTATCACT TCTGGTTGTGAAGAGGTGGTTTTGCCCAGGCCCAGATCTGAAAGTGCTCTA 30 CTGAGCAAAACAACACCTGGACAATTTGCGTTTCTAAAATAAGGCGAGGCT GACCGAAACTGAAAAGGCTTTTTTTAACTATCTGAATTTCATTTCCAATCTT AGCTTATCAACTGCTAGTTTGTGCAAACAGCATATCAACTTCTAAACTGCAT TCATTTTTAAAGTAAGATGTTTAAGAAATTAAACAGTCTTAGGGAGAGTTT ATGACTGTATTCAAAAAGTTTTTTAAATTAGCTTGTTATCCCTTCATGTGAT 35 AATTAATCTCAAATACTTTTTCGATACCTCAGAGCATTATTTTCATAATGAC TGTGTTCACAATCTTTTT 3' (SEQ ID NO:10) WO 2004/055182 PCT/AU2003/001697 23 3) Ovis aries immunoglobulin heavy chain 5' intronic enhancer (Dufour et al (1996) J. Immunol 156:2163-2170): 5 5'CTGCGAATACCGAGACGGGGCCTCTCAAAGCCACCCCTGATAGTCTGGAA AATTGAAACTTTAAAAAGAGAGATGTTTAAAGTATTTTAAATTTTTATCATT TAATTAACAACTGCGAATCATGGCTTTGGAGAGTTGAGTAAGAGTTTGGCT GAAAAGTACTAACTAGGTTCCATCGGCCCTCGGCCCCAATTCAGGGCTGTT TTGAGAATAATAAATTCAGCTTATTTTTTTAATGTAATTGGTGGTGCCGAGT 10 TAGTCAAGATGGCCACGGGCCAGACTGACCACCTGCAGCAGGTGGCAGGA AGCATGTCCACTTGAGAGTCTGTTTTTGGAAGCAAGAAAAAACAGTTGGTA AATTTATCGCTTCTGGTTTCCAAAAGGTGGTTTGCGGCTGGTTTTGCCCAGC CCCACAGAACCGAAAGTGTTCCACTGAGCACAACAGCACCTGGCTAATTTG CATTTCTAAAATAAGGCGCAGATGCTGACCGAAACTGGAAGGTTCCTCTTC 15 TAACTATTTGAGTTAACTTCAGCTTTAGCTTATCAACTGCTCACTTATCTTCA TTTTCAAAGTCGATGTTTAAGAAAGCCACCTGTCTCGGGTGCACTGTCTCGG TGCATTGCTGCACTCTCTGATGAGCCGTCCTTCAAGGTGGTTGAGCTGAG 3' (SEQ ID NO:11) 20 4) Mouse 3' IgH regulatory enhancers (C alpha3'E and hs3) (Saleque et al (1997) J. Immunol. 158 (10), 4780-4787): 5'CTAGATACTGAGTTCTGGTTCTAATAACTGGCTCCTGTACTGATGGATGG GTCCTGACTAGTCATTGGGCCCTGATCCTCAACATTGACTTCAAAACCTGAA 25 CTCTAGCCCCATGCCTCATTCACATTAGGATGATCCCTACAGGGGATTCCTG CAGAAGATTCCAGAATCCCCACAACACTGTTCACACACTGGGCTGCAACTG GGACAGTGACCCTTTTGACTCATAGGACTTGCCAGGCACAGAGGCACAGAA TGGAGACAAAGCAAGCCCAGGACCCTGGAGATGGAGCCTCTGGTGGGGTC TACAGATGTGGGGTCAGCATCGTAGGGAGGTTTGCAGGGCAGGTGTGGGG 30 CAGGGCAGAGGTAGTCATGCTTATAGATACTATTTTTCTCTCCTCTGGAGCC TCCTTTGTCTATCACCTGCTGTCCTGGGATCTCTATCTGGGGTCAACAATGT
TTGCAGTACAGGTGTGGGGGTAGGGCAGGGATGCTCACATTAGCAACTTGT
WO 2004/055182 PCT/AU2003/001697 24 TTTTCTCTCTTCTGAAGTCTCTGTTGTCTATCACCTGCTGAAACATTCAAAGC AGCTCTCAGCTGAGGGCAGCTGAGTCATCCTGAGCCTGTCTCAGCACAGGT GCCCCAAACCAGAGCTACTGTTCTGAGAATCACATCACACTGGACCAGGCC AGGTGGGCCTGGGACATGGATGAGGGGTGGGAGCCAGGGGAGCCTGCCAG 5 GGGCTGAGGAGGCCCCAACCCCCACTACCCAAGGCCATCCACACCTGTGCC TTAGTGAGGCCATGTTCTGTCCCAATGAGAACAAGTCCAATTAAGATTAAG TATGGTCTTCCCAGGACTATCCAGAGCTAAGGGGTGTCAGCCAGGGACAAC CCAGACCAGCCTGAGGTCAGCCAGCATCACCCAAGGCCACACAGCTATTCT GGCTAGAGGACTAGATAGCTAGCTCATCGAGGCCCTGGAGATGCAGAATG 10 GAAGAGTTTATCCCTGCCAGACAGGGCTCATCAGAAAGGCAGGTATCTCAC TACACATGACCTCCCTGAATATTTCCCAGAGTCCAGTTGGTTCTAG 3' (SEQ ID NO:12) 5) Murine IgH enhancer (Kadesch et al (1986) Nucleic Acids Res. 14 (20), 8209 15 8221): 5'AGTCAAGATGGCCGATCAGAACCAGAACACCTGCAGCAGCTGGCAGGAA GCAGGTCATGTGGCAAGGCTATTTGGGGAAGGGAAAATAAAACCACTAGG TAAACTTGTAGCTGTGGTTTGAAGAAGTGGTTTTGAAACACTCTGTCCAGCC 20 CCACCAAACCGAAAGTCCAGGCTGAGCAAAACACCACCTGGGTAATTTG CATTTCTAAA ATAAGTTGAGG 3' (SEQ ID NO:13) 3' kappa enhancers 25 An example of a suitable exogenous 3' kappa enhancer for use in the present invention is as follows. 1) Murine 3' kappa enhancer (Meyer and Neuberger (1989) EMBO J. 8 (7), 1959 1964): 30 5'AGCTCAAACCAGCTTAGGCTACACAGAGAAACTATCTAAAAAATAATTA CTAACTACTTAATAGGAGATTGGATGTTAAGATCTGGTCACTAAGAGGCAG
AATTGAGATTCGAACCAGTATTTTCTACCTGGTATGTTTTAAATTGCAGTAA
WO 2004/055182 PCT/AU2003/001697 25 GGATCTAAGTGTAGATATATAATAATAAGATTCTATTGATCTCTGCAACAA CAGAGAGTGTTAGATTTGTTTGGAAAAAAATATTATCAGCCAACATCTTCT ACCATTTCAGTATAGCACAGAGTACCCACCCATATCTCCCCACCCATCCCCC ATACCAGACTGGTTATTGATTTTCATGGTGACTGGCCTGAGAAGATTAAAA 5 AAAGTAATGCTACCTTATTGGGAGTGTCCCATGGACCAAGATAGCAACTGT CATAGCTACCGTCACACTGCTTTGATCAAGAAGACCCTTTGAGGAACTGAA AACAGAACCTTAGGCACATCTGTTGCTTTCGCTCCCATCCTCCTCCAACAGC CTGGGTGGTGCACTCCACACCCTTTCAAGTTTCCAAAGCCTCATACACCTGC TCCCTACCCCAGCACCTGGCCAAGGCTGTATCCAGCACTGGGATGAAAATG 10 ATACCCCACCTCCATCTTGTTTGATATTACTCTATCTCAAGCCCCAGGTTAG TCCCCAGTCCCAATGCTTTTGCACAGTCAAAACTCAACTTGGAATAATCAGT ATCCTTGAAGAGTTCTGATATGGTCACTGGGCCCATATACCATGTAAGACA TGTGGAAAAGATGTTTCATGGGGCCCAGACACGTTCTAG 3' (SEQ ID NO:14) 15 Promoter sequences Examples of suitable exogenous promoter sequences for use in the present invention include: 20 1) (Kataoka et al (1982). J Biol. Chem. 257 : 2777-285): 5' AAGCAGCCCTCAGGCAGAGGATAAAAGCTCACACTAACTGAGAAGC TCCATCCTCTTCTC 3' (SEQ ID NO:15) 25 2) (Clarke et al (1982). Nucleic Acids Res. 10 : 7731): 5' AATTAGGCCACCCTCATCACATGAAAACCAGCCCAGAGTGACTCTAG CAGTGGGATCCTG 3' (SEQ ID NO:16) 30 3) Grosschedl and Baltimore D., (1985). Cell 41: 885-897): 5' CATGTGCGACTGTGATGATTAATATAGGGATATCCACACCAAACATC ATATGAGCCCTAT 3' (SEQ ID NO:17) 35 4) (Schiff et al (1986). J. Exp. Med. 163 : 573-587): WO 2004/055182 PCT/AU2003/001697 26 5' AACATGAGTCTGTGATTATAAATACAGAGATATCCATACCAAACAAC TTATGAGCACTGT 3' (SEQ ID NO:18) Murine B lymphocyte VH promoters (eg. V1 Ig VH promoter, BCL1 VH promoter) 5 may also be used in the methods of the present invention. Human Immunoglobulin heavy chain promoters The following human heavy chain promoters are described in in Haino et al (1994) J. 10 Biol. Chem. 269 (4), 2619-2626: 1) Homo sapiens germline IGH chain (ProV4-39) gene fragment: 5'ATCCCAAAATCTGTCNTTGATCCAGGATCACACTCATCTCTCAGACCAGC 15 TCCTTCAGCACATCTCTTTACCTGGAAGAAGAGGACTCTGGGCTTGGAGAG GGGAGCCCCCAAGAAGAGAACTGAGTTCTCAAAGGGCACAGCCAGCATTC TCCTCCCAGGGTGAGCTCAAAAGACTGGCGCCTCTCTCATCCCTTTTCACTG CTCCGTACAAACGCACCACCCCCATGCAAATCCTCACTTAGGCGCCCACAG GAAGCCACCACACATTTCCTTAAATTCAGGTCCAACTCATAAGGGAAATGC 20 TTTCTGAGAGTCATGGATCTCATGTGCAAGAAA 3' (SEQ ID NO:19) 2) Homo sapiens germline IGH chain (ProV3-30) gene fragment: 5'AGATATAACTATATTTTCCTGAATGATGGAATTACTACCAGTCTCCCCCA 25 GGACACTTCATCTGCCCTGAGCCCAGCCTCTCCTCAGATGTCCCACCCAGA GCTTGCTATATAGTGGGGGACATGCAAATAGGGCCCTCCCTCTACTGATGA AAACCAGCCCAGCCCTGACCCTGCAGCTCTGGGAGAGGAGCCCAGCACTA GAAGTCGGCGGTGTTTCCATTCGGTGATCAGCACTGAACACAGAGGAC TCACC 3' (SEQ ID NO:20) 30 3) Homo sapiens germline IGH chain (ProV3-9) gene fragment: 5'CAGTAGAAATGCTAATAAGAATTAATTGTTTATGAAGTGTAATCACTCTG GGACACAGCCCACTCAGAGGCATCCCTTCCAGAACCCGCTATATAGTAGGA 35 GACATGCAAATAGGGCCCTCCCTCTGCTGATGAAAACCAGCCCAGCCCTGA WO 2004/055182 PCT/AU2003/001697 27 CCCTGCAGCTCTGGGAGAGGAGCCCCAGCCCTGAGATTCCCAGGTGTT TCCATTCAGTGATCAGCACTGAACACAGAGGACTCACC 3' (SEQ ID NO:21) 4) Homo sapiens germline IGH chain (ProV1-1 8) gene fragment: 5 5'GATGGGTAGGGGATGCGTGTCCTCTAACAGGATTACGTCTTGAACCCTCA GCTTCTACAATTGTGTCGTCCATGTGTCATGTATTTGCTCTTTCTCATCCTGG GTCAGGAATTGGGCTATTAAATAGCATCCTTCATGAATATGCAAATAACTG AGGTGAATATAGATATCTGTGTGCCCTGAGAGCATCACCCAAAAACCACAC 10 CCCTCCTTGGGAGAATCCCCTAGATCACAGCTCCTCACC 3' (SEQ ID NO:22) Methods for selection of nucleic acids or proteins/peptides with an altered phenotype The terms "altered phenotype", "desired activity" and "altered activity" are generally 15 used interchangeably herein. In particular embodiments of the present invention, the mutated nucleic acid, or gene product encoded thereby, is subjected to an assay for identifying an altered phenotype. Suitable procedures for identifying altered phenotypes include, but are not limited to, 20 those described below. Protein/peptide display and selection In one embodiment of the invention, proteins encoded by nucleic acids obtained using 25 the methods of the invention are displayed on the surface of the hypermutating cells. One well-known peptide display method involves the presentation of a peptide sequence on the surface of a filamentous bacteriophage, typically as a fusion with a bacteriophage coat protein. The bacteriophage library can be incubated with an 30 immobilized, predetermined macromolecule or small molecule (e.g., a receptor) so that bacteriophage particles which present a peptide sequence that binds to the immobilized macromolecule can be differentially partitioned from those that do not present peptide sequences that bind to the predetermined macromolecule. The bacteriophage particles (i.e., library members) which are bound to the immobilized macromolecule are then 35 recovered and replicated to amplify the selected bacteriophage subpopulation for a subsequent round of affinity enrichment and phage replication. After several rounds of WO 2004/055182 PCT/AU2003/001697 28 affinity enrichment and phage replication, the bacteriophage library members that are thus selected are isolated and the nucleotide sequence encoding the displayed peptide sequence is determined, thereby identifying the sequence(s) of peptides that bind to the predetermined macromolecule (e.g., receptor). Such methods are further described in 5 WO 91/17271, WO 91/18980, WO 91/19818 and WO 93/08278. WO 93/08278 describes a recombinant DNA method for the display of peptide ligands that involves the production of a library of fusion proteins with each fusion protein composed of a first polypeptide portion, typically comprising a variable sequence, that 10 is available for potential binding to a predetermined macromolecule, and a second polypeptide portion that binds to DNA, such as the DNA vector encoding the individual fusion protein. When transformed host cells are cultured under conditions that allow for expression of the fusion protein, the fusion protein binds to the DNA vector encoding it. Upon lysis of the host cell, the fusion protein/vector DNA 15 complexes can be screened against a predetermined macromolecule in much the same way as bacteriophage particles are screened in the phage-based display system, with the replication and sequencing of the DNA vectors in the selected fusion protein/vector DNA complexes serving as the basis for identification of the selected library peptide sequence(s). 20 The displayed protein/peptide sequences can be of varying lengths, typically from 3 5000 amino acids long or longer, frequently from 5-100 amino acids long, and often from about 8-15 amino acids long. A library can comprise library members having varying lengths of displayed peptide sequence, or may comprise library members 25 having a fixed length of displayed peptide sequence. Portions or all of the displayed peptide sequence(s) can be random, pseudorandom, defined set kernal, fixed, or the like. The display methods include methods for display of single-chain antibodies, such as nascent scFv on polysomes or scFv displayed on phage, which enable large-scale screening of scFv libraries having broad diversity of variable region sequences and 30 binding specificities. Another method of display is bacterial surface display. The protein of interest is expressed on the bacterial cell surface as a fusion with one of the following proteins, OmpA, LamB, PhoE, FliC, PALD, and EaeA intimin. Alternatively it may be 35 expressed in the periplasm (periplasmic expression with cytometric screening, (PECS)) (Chen et al., 2001). Whilst experiments demonstrate expression on the bacterial cell WO 2004/055182 PCT/AU2003/001697 29 surface, this display system is not operating as well or used as frequently as the yeast surface display. The nature of a prokaryotic system itself may explain why the system is not always preferred. Firstly, bacteria lack the protein folding and post-translational modification machinery required for the presentation of an eukaryotic protein. 5 Secondly, the protein of interest needs to be expressed in a soluble form. Thirdly, steric interference from the bacterial lipopolysaccharide layer can potentially impede binding to larger macromolecular antigens. Despite being a single cell system (one plasmid to each bacterium), capable of displaying thousands of copies of the protein of interest on the cell surface and being amenable to screening using flow cytometry, this 10 system offers no additional advantages over the yeast surface display system. A further method of display is yeast surface display. The protein of interest is fused to an alpha agglutinin subunit called Aga2p and expressed on the surface of the yeast cell. This form of display appears to be very successful and offers several advantages over 15 other display systems. These include; correct protein folding and secretion (homologous to that in mammalian cells), display of large numbers of protein on yeast cell surface, single cell system (i.e. each yeast cell contains only one plasmid copy), system is amenable to screening using flow cytometry which offers finer quantitative discrimination between mutants and the dissociation constant (KD) can be estimated in 20 situ in the display format without having to subelone. The major disadvantage of this system is that the library size is restricted due to low transfection efficiency. To date no one has managed to overcome this limitation of the system. Proteins can be anchored to the surface of mammalian cells via a number of different 25 anchors including, but not limited to, Type I transmembrane domains (TM I), type II transmembrane (TM II) and glycosylphosphatydlinisitol (GPI). Examples of suitable GPI anchor attachment signals include: 30 (i) GPI signal from human decay-accelerating factor (DAF). Caras IW, Weddell GN, Davits MA, Nussenzweig W, Martin DW. (1987) Science 238(4831):1280-3 Accession No.: AY055758 Peptide sequence: PNKGSTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT (SEQ ID NO:23) 35 Nucleotide sequence: 1158-1268 WO 2004/055182 PCT/AU2003/001697 30 CCAAATAAAGGAAGTGGAACCACTTCAGGTACTACCCGTCTTCTATCTGGG CACACGTGTTTCACGTTGACAGGTTTGCTTGGGACGCTAGTAACCATGGGC TTGCTGACT (SEQ ID NO:24) 5 (ii) GPI signal from porcine membrane dipeptidase. Hooper NM, Low MG, Turner AJ. (1987) Biochem. J. 244(2):465-9 Accession No.: E04233 Peptide sequence: CRTNYGYSAAPSLHLPPGSLLASLVPLLLLSLP (SEQ ID NO:25) 10 Nucleotide sequence: 1248-1346 TGCCGGACGAATTACGGCTACTCAGCCGCCCCCAGCCTCCACCTCCCGCCG GGCTCGCTGCTGGCCTCCCTCGTGCCCCTCCTCCTCCTCAGTCTTCCG (SEQ ID NO:26) 15 (iii) GPI signal from rat ceruloplasmin. Patel BN, Dunn RJ & David S. (2000) 1. Biol. Chem. 275(6):4305-10 Accession No.: AF202115 Peptide sequence: ASSQSYRMTWNILYTLLISMTTLFQISTKE (SEQ ID NO:27) Nucleotide sequence: 3161-3252 20 GCATCGTCTCAGAGCTACAGGATGACCTGGAACATACTCTATACACTGTTA ATCAGCATGACTACTTTATTCCAAATATCTACCAAGGAG (SEQ ID NO:28) (iv) GPI signal from mouse Thy-1. Bernasconi E, Fasel N & Wittek R. (1996) J. Cell Sci. 109(6):1195-201 25 Peptide sequence: SSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL (SEQ ID NO:29) Nucleotide sequence: AGCTCCAATAAAAGTATCAGTGTGTATAGAGACAAGCTGGTCAAGTGTGGC 30 GGCATAAGCCTGCTGGTTCAGAACACATCCTGGATGCTGCTGCTGCTGCTTT CCCTCTCCCTCCTCCAAGCCCTGGACTTCATT (SEQ ID NO:30) (v) Dictyostelium discoideum protein 11. Stevens BA, White IJ, Hames BD Hooper NM. (2001) Biochimica et Biophysica Acta 1511: 317-329. 35 WO 2004/055182 PCT/AU2003/001697 31 (vi) Plasmodium falciparum merozoite surface protein-1. Burghas PA, Gerold P, Pan W, Schwartz RT, Lingelbach K, Burjard H. (1999) Molecular and Biochemical Parisitology 104:171-183. 5 An example of a suitable transmembrane domain for use as an anchor domain in the present invention is: (i) The transmembrane domain of murine B7-1. Chou W., Liao K., Jiang S.Y., Yeh M.Y. and Roffler S.R.(1999) Biotechnol Bioeng. 1999 Oct 20;65(2):160-9. 10 Accession No.:AH00465S3 Peptide sequence: PEDPPDSKNTLVLFGAGFGAVITVVVIVVIIKCFCKH (SEQ ID NO:31) Nucleotide sequence: 171-281: CCCAGAAGACCCTCCTGATAGCAAGAACACACTTGTGCTCTTTGGGGCAGG 15 ATTCGGCGCAGTAATAACAGTCGTCGTCATCGTTGTCATCATCAAATGCTTC TGTAAGCAC (SEQ ID NO:32) Other suitable examples include those provided in Table 1. 20 Table 1 : Examples of anchors suitable for surface display: Anchor type Molecule name Accession No. Transmembrane type I (TM I) CD1a X04450 (gi 32495) CD68 BC05557(gi 33869409) Transmembrane type II (TM II) CD10 Y00811 (gi 29625) CD13 X13276 (gi 28677) CD26 M74777 (gi 180082) Glycosylphosphatydlinisitol (GPI) CD14 X113334 (gi 29740) CD24 M58664 (gi 180167) CD48 M59904 (gi 180138) CDw52 X62466 (gi 29645) CD55 M31516 (gi 181467) CD59 X16447(gi 29805) CD67 X52378 (gi 29918) WO 2004/055182 PCT/AU2003/001697 32 Signal peptide sequences For TM1 and GPI anchors, an N-terminal signal sequence as well as a C-terminal signal sequence is preferably be added to the polypeptide if it is not normally found on 5 the cell surface. For TM2 the signal and anchor sequence are one and the same and are added to the N-terminus of the polypeptide. To achieve adequate levels of surface expression, it may be necessary to mutate the initiation codon of the target gene so that only chimeric proteins consisting of the signal and/or anchor fused to the target protein are produced. 10 An example of an appropriate signal sequence is the signal sequence of CD59: Accession No.:X1 6447 (gi 180082) Peptide sequence: MGIQGGSVLFGLLLVLAVFCHSGHS (SEQ ID NO:33) 15 Nucleotide sequence: 64-138 5'ATGGGAATCCAAGGAGGGTCTGTCCTGTTCGGGCTGCTGCTCGTCCTGGC TGTCTTCTGCCATTCAGGTCATAGC 3' (SEQ ID NO:34) Proteins/peptides encoded by mutant nucleic acids obtained using the methods of the 20 invention can be used in a number of yeast based methods to detect protein-protein interactions. One well known system is the yeast two-hybrid system (Fields and Song 1989) which has been used to identify interacting proteins and to isolate the corresponding encoding genes. In this system, prototrophic selectable markers which allow positive growth selection are used as reporter genes to facilitate identification of 25 protein-protein interactions. Related systems which may be employed include the yeast three-hybrid system (Licitra and Liu 1996) and the yeast reverse two-hybrid system (Vidal et al. 1996). Such procedures are known to those skilled in the art. Examples 30 Example 1: Defining a region in RAMOS cells for integration of target genes Methods & Materials 35 Cell line and cell culture conditions WO 2004/055182 PCT/AU2003/001697 33 The RAMOS strain RA 1 was obtained from the American Tissue Culture Collection (ATCC-CLR- 1596). This strain is 1gM positive and expresses the interleukin 4 (IL-4) and CD23 receptors. Cells were maintained in RPMI 1640 medium (Gibco BRL) supplemented with 10% heat inactivated fetal calf serum (FCS) and penicillin (100 U / 5 ml) and streptomycin (100 pg / ml), and incubated at 37 'C with 5% CO 2 . Extraction of DNA from cells Cells were harvested and centrifuged at 1500 rpm and resuspended in PBS. DNA was 10 extracted from cells using a Genoprep DNA isolation kit (Scientifix, Australia) according to manufacturer's instructions. Briefly, after removing the supernatant 375 pl of lysis and binding solution was added to cells (5 x 105), together with 20 p1 Genoprep DNA magnetic beads. This mixture was vortexed for five seconds then incubated at room temperature for a minimum of ten minutes on a rocker, or rotating wheel. Beads 15 with attached DNA were collected using a magnet, the supernatant was removed and 450 pl of washing solution was added. The mixture was subsequently vortexed for five seconds and the beads were collected as described previously. This washing procedure was repeated twice, with the final wash solution being 70 % ethanol. Beads were resuspended in 450 jpl of 70 % ethanol and transferred to a new tube. After removing 20 the supernatant, 450 pl of sterile water was added to the beads and removed immediately. The beads were then resuspended in 200 pl of sterile water and incubated at 70 *C for two minutes to elute the DNA. The beads were collected again using a magnet and the supernatent containing the eluted DNA was transferred to a new tube. 25 The quantity and quality of isolated DNA was determined by spectrometry and electrophoresis. A culture containing 5 x 105 cells consistently yielded 10 ng / PIl of DNA. This DNA migrated as a single band at approximately 23 kbp on a 0.9 % gel indicating that the genomic DNA was intact. 30 Sequencing of the 5' region upstream of the rearranged VH allele The homologous sequence upstream of the site of integration chosen for the vector corresponds to a ~ 5kb fragment between the VH 7 -3 5 and VH 4
..
34 alleles of the immunoglobulin heavy chain locus of the RAMOS cell line (corresponding to the 35 sequence gi 4512287 nucleotides 54521 - 59517).
WO 2004/055182 PCT/AU2003/001697 34 RAMOS RA-1 genomic DNA was prepared using the Genoprep DNA isolation kit (Scientifix, Australia). Platimun PfX DNA polymerase (GibcoBRL, Life Technologies) was used to amplify fragments varying from 300bp to 1000 bp from genomic DNA. The reaction included 1 X PfX amplification buffer, 50 mM 5 Magnesium sulfate, 1 X PCR enhancer solution, forward primer (10 pM), reverse primer (10 pM), dNTPs (10 mM each) template DNA (100 ng), platinum PfX DNA polymerase (0.6 U) and sterile water in a final volume of 20 tl. Cycling conditions were as follows; one cycle of 95'C for 5 minutes, 30 cycles of 95'C for seconds, 60 0 C for 30 seconds, 68'C for one and a half seconds, and one cycle of 72"C for 7 minutes. 10 Annealing temperatures and extension times for some primer sets varied, ranging from 55*C to 65'C and one minute to two and a half minutes respectively. Primers were designed based on the human germline DNA for immunoglobulin heavy-chain variable region, complete sequence gi 4512287 nucleotides 54786 to 59721 (Table 2). A second PCR reaction was performed using 0.5 / 20 ptl of the first PCR as a template to gain 15 sufficient DNA for cloning. PCR products were run on 1.0 % agarose gels and DNA was extracted using Nucleospin Extraction Kit (Nagel-Macherey, Germany) according to manufacturer's instructions. The purified DNA was digested with restriction enzymes EcoR I and Hind 20 III. Digested products were cleaned up and concentrated using phenol extraction followed by ethanol precipitation. These products were ligated into into pBluescript SK + (Stratagene, Texas, USA) and transformed into Escherichia coli XL1 Blue electro competent bacteria. Minipreps were prepared from 5 ml overnight cultures using QlAprep miniprep spin kit (Qiagen, CA, USA) and sequenced using an ABI 373 DNA 25 sequencer with primers T3 and T7. Sequences were analysed using BLAST program (NBCI, http://www.ncbi.nlm.nih.gov/BLAST/) and assembled in Clone Manager Suite 7 (Scientific and Educational Software). The assembled sequence is set out as 30 nucleotides I to 5190 of SEQ ID NO:1. This sequence shares 99 % similarity with the published sequence gi 4512287 nucleotides 54521-59517. Cloning of the 5kb fragment upstream of the rearranged VH allele from genomic DNA 35 Genomic DNA was prepared using Genoprep DNA isolation kit (Scientifix, Australia). Platinum PfX DNA polymerase (Invitrogen, CA. USA ) was used to amplify the 5 kb WO 2004/055182 PCT/AU2003/001697 35 fragment from genomic DNA. The reaction included 1 X PfX amplification buffer, 50 mM magnesium sulfate, 1X PCR enhancer solution, forward primer 8771 (5'CCATCGATAATTTAGTTTTCACGGGGCATCTGCAGGGT 3') 10 pM, reverse primer 8872 (5' GGGGTACCGTTCTTGTGCAGGAGGTCCATGACTCTCAG 3') 10 5 pM, dNTPs (10 mM each) template DNA (100 ng), platinum PfX DNA polymerase (0.6 U) and sterile water in a final volume of 20 pl. Cycling conditions were as follows ; one cycle of 94 'C for 15 seconds, fifteen cycles of 94'C for 10 seconds, 68'C for 3.5 minutes, 15 cycles of 94'C for 10 seconds, 68*C for 3.5 minutes with and an extra 15 seconds added each cycle, and one cycle of 72 0 C for 7 minutes. A second PCR 10 reaction was performed using 0.5 / 20.0 pl of the first PCR reaction as a template to gain sufficient DNA for detection using ethidium bromide. PCR products were run on a 0.9 % agarose gel and DNA was extracted using Gel Extraction Kit (Qiagen, CA, USA). Purified DNA was cloned into pPCRScript using 15 the PCR-Script Amp cloning kit (Stratagene, Texas, USA) at the Srf I site. The resulting construct was referred to as 5kbPCRScript 15a-7 (7971 bp). This construct was sequenced using primers in Table 3. Table 2: Primers used for genomic PCR to sequence the 5' region upstream of the 20 rearranged VH allele (VH 4
..
34 ) in RAMOS RA-1 Primer Sequence Homologous sequence Name in gi AB019439 8444 5' CCGGAATTCAATTTGAGATTGTGTGTGAGATCTCAGGAG 3' NT 58890 - 58920 (SEQ ID NO:35) 8436 5' CCGGAATTC ATAGACAGCGCAGGTGAGGGACAG GGTCTC 3' NT 59702 - 59731 (SEQ ID NO:36) 8438 5' CCGGAATTCCTG AGA ACTCAG TTCTCTTCCTGTGGCCTC 3' NT 59281 -59310 (SEQ ID NO:37) 8440 5' CCGGAATTCAATTTGAGATTGTGTGTGAGATCTCAGGAG 3' NT 58890 - 58920 (SEQ ID NO:38) 8441 5' CCCAAGCTITCCTGTTACAACATCCATGGAGATATTTTG 3' NT 58420 - 58450 (SEQ ID NO:39) 8442 5' CCGGAATTC TGAATTGCAAGAACATACCCTAGGGTGTGC 3' NT 58500 -58530 (SEQ ID NO:40) WO 2004/055182 PCT/AU2003/001697 36 8464 5' CCGGAATTCTAGGGCAAACAGAGGCCAGATGTTTGAGGAG NT 57720 - 57750 3' (SEQ ID NO:41) 8466 5' CCGGAATTCAATTTAACAGCATAAAAACGATCAGTCCAA NT 57330 - 57360 3' (SEQ ID NO:42) 8470 5' CCGGAATTCCGTGTTTCTGGAGCAGGGCATGGCTTTGGG 3' NT 56550 - 56580 -(SEQ ID NO:43) 8472 5' CCGGAATTCGTTGGGTTCCCAGTGTAGGTGATGATCCAT 3' NT 56160 - 56190 -(SEQ ID NO:44) 8550 5' CCGGAATTCTCCCAGGAAGTGGGTTATTTAAATAGTA 3' NT 58951- 58981 (SEQ ID NO:45) 8553 5' CCGGAATTCACTATAGTCACCTCAGTTAATTGCATATTC 3' NT 55770 - 55800 (SEQ ID NO:46) 8554 5' CCCAAGCTTGACTTCCTTTAAAAATATCTAAAATAAGTA 3' NT 55300 - 55330 (SEQ ID NO:47) 8555 5' CCGGAATTCGGTTCTCATTACAACATCCAGTTTGATAAA 3' NT 55380 - 55410 (SEQ ID NO:48) 8557 5' CCGGAATTCCTCCAAGAAAAGATCTCATGCATCACCAGG NT 54990 - 55020 3' (SEQ ID NO:49) 8558 5' CCCAAGCTTAATTTAGTTTTCACGGGGCATCTGCAGGGT 3' NT 54520 - 54550 (SEQ ID NO:50) 8606 5' CCCAAGCTTTGCACACCCTAGGGTATGTTCTTGCAATTC 3' NT 58500 - 58530 (SEQ ID NO:51) 8607 5' CCCAAGCTTCCCAAAGCCATGCCCTGCTCCAGAAACACG NT 56550 - 56580 3' (SEQ ID NO:52) 8608 5' CCGGAATTC CCATAATATGTGAATGCGTTATTTAGG GAA NT 55500 - 55529 3' (SEQ ID NO:53) 8687 5' CCCAAGCTTCATGTTCCACGCATTACGTC 3' (SEQ ID NO:54) NT 54336 - 54355 8689 5' CCCAAGCTTAAGAGTGTTTGGGTTCACCG 3' (SEQ ID NT 54927 - 54946 _ NO:55) WO 2004/055182 PCT/AU2003/001697 37 Table 3 : Primers used for sequencing clones containing the 5 kb region upstream of the rearranged VII allele (V1 4
..
34 ) in RAMOS RA-1 Primer Sequence Homologous Name sequence in gi AB019439 8445 5' CCCAAGCTPTAACTCAGGAGGACTCAATACACCCTGGA NT 57640-57670 3' (SEQ ID NO:56) 8443 5' CCCAAGCTTAAACAATACCTACAAATTCAGAAGCTCTTT NT 58030-58060 3' (SEQ ID NO:57) 8471 5' CCCAAGCTT AAGTCTTCTGGTTACACCTTCACCAT TAT 3' NT 56080-56110 (SEQ ID NO:58) 8465 5'CCCAAGCTTACTCTCTTCCCTCTGTGACTAGAGCTCTGT 3' NT 57250-57280 (SEQ ID NO:59) 8473 5' CCCAAGCTTTCAGCTTCTACAGTTGTGTCACCCATGTGT 3' NT 55690-55720 (SEQ ID NO:60) 8609 5' CCCAAGCTTTGCAGAGTTCACTGGGTTTCCTAAAGG CAA NT 55027-55056 3' (SEQ ID NO:61) 8467 5' CCCAAGCTTTCACCACAAAGGAACTTTCATCTCTCCTGG 3' NT 56860-56890 (SEQ ID NO:62) 8439 5' CCCAAGCTTTCACACAGAAATGTTTAGAGGT CAGGCC NT 58810-58840 3' (SEQ ID NO:63) 8606 5' CCCAAGCTTTGCACACCCTAGGGTATGTTCTTGCAATTC 3' NT 58500- 58530 (SEQ ID NO:64) 8551 5' CCCAAGCTTCCCAAAGCCATGCCCTGCTCCAGAAACACG NT 56550- 56580 3' (SEQ ID NO:65) 0003 5' CCCAAGCTTATGATGTAACCCTCATTGGCCTCA 3' (SEQ ID NT 54497-54520 NO:66) 0006 5' CCGGAATTCGAGACTCCAAGAAAAGATCTCATG 3' (SEQ NT 55001-55024 ID NO:67) 0007 5' CCCAAGCTTATGTrCTTGCAATTCAGCGGAGGA 3' (SEQ ID NT 58514-58537 NO:68) 0008 5' CCGGAATTCTGTGTGAGATCTCAGGAGAAGGTA 3' (SEQ NT 58885-58908 ID NO:69) 5 PCR amplification of rearranged VH, D and JHsegments from genomic DNA WO 2004/055182 PCT/AU2003/001697 38 Genomic DNA was prepared using the Genoprep DNA isolation kit (Scientifix, Australia). Platinum PfX DNA polymerase (Invitrogen, CA, USA) was used to amplify the rearranged VH, D and JH genes from genomic DNA. The PCR reaction included 5 IX PfX amplification buffer, 50 mM magnesium sulfate, IX PCR enhancer solution, forward primer (10 pM), reverse primer (10 pM), dNTPs (10 mM each), template (100 ng), platinum PfX DNA polymerase (0.6 U) and sterile water in a final volume of 20 tl. Cycling conditions were as follows; one cycle of 95*C for 5 minutes, 30 cycles of 95'C for 30 seconds, 65*C for 3O seconds, 68*C for 2.5 minutes, and one cycle of 72*C 10 for 7 minutes. Primers used were specific for each of the seven VH family leader sequences together with a previously described consensus JH primer, JOL48, that anneals to all six human JH segments (Table 4). A second PCR reaction was performed using 0.5 / 20 l of the first PCR as template to gain sufficient DNA for detection using ethidium bromide. 15 PCR products were run on 1.5 % agarose gels and DNA was extracted from bands using Nucleospin . Extraction Kit (Nagel-Macherey, Germany) according to manufacturer's instructions. A third PCR was performed on the purified DNA as described above. Products were cloned into pBluescript SK + (Stratagene, Texas, USA) 20 using EcoR I and Hind III sites and sequenced as previously described. Table 4: Primers for PCR amplification of rearranged VH, D and JH segments from genomic DNA. Primer Sequence Specificity Name 8111 5'CCCAAGCTTATGGACTGGACCTGGAGGATCCTCTTCTTGGTGGCAGCA 3' VH1 (SEQ ID NO: 113) leader 8116 5'CCCAAGCTTATGGACACACTTTGCTCCACGCTCCTGCTGCTGACC ATCCCT VH2 3' (SEQ ID NO: 114) leader 8112 5'CCCAAGCTTATGGAGTTTGGGCTGAGCTGGGTTTTCCTTGTTGCTATT 3' VH3 (SEQ ID NO: 115) leader 8113 5'CCCAAGCTTATGAAACACCTGTGGTTCTTCCTCCTGCTGGTGGCAGCT 3' VH4 (SEQ ID NO:116) leader 8118 5'CCCAAGCTTATGGGGTCAACCGCCATCCTCGCCCTCCTCCTGGCTGTTCTC VH5 3' (SEQ ID NO:117) leader 8114 5'CCCAAGCTTATGTCTGTCTCCTTCCTCATCTTCCTGCCCGTGCTGGGCCTC 3' VH6 (SEQ ID NO:118) leader 8115 5'CCCAAGCTTATGGACTGGACCTGGAGGATCCTCTTCTTGGTGGCAGCAGCA H7 leader 3' (SEQ ID NO:119) N8336 5'CCCAAGCTTCCCCAAGCTTCCCAGGTGCAGCTACAGCAG 3' (SEQ ID Consensus (JOL48) NO:120)
JH
WO 2004/055182 PCT/AU2003/001697 39 Table 5 : Primer sequences used for genomic PCR to sequence the 3 kb region downstream of the rearranged VH allele (VH 4
-
3 4 ) in RAMOS RA-1 Primer Sequence Homologous Name sequence in NCBI database 8604 5' CCCAAGCTTCGGCCCCGATGCGGGACTGCGTTGACCA 3' Gi 34819 NT 1- 30 (SEQ ID NO:70) 8605 5' CCGGAATTCATAACAAGCTAATTTAAAAAACTTTTTGAA 3' Gi 34819 NT 450 (SEQ ID NO:71) 500 8559 5' CCCAAGCTTGCACAGACGGGAGGTACGGTATGGACGTCT 3' Gi 33100 NT 460 (SEQ ID NO:72) 490 8562 5' CCGGAATTCAAAAAAATAAACTTGATTTATGAT GGTCAA 3' Gi 33100 NT 705 (SEQ ID NO:73) 734 8603 5' CCGGAATTCCGCGGTGACCTGCTTCCTGCCACCTGCTGT 3' Gi 34819 NT 126 (SEQ ID NO:74) 155 8692 5' CCGGAATTC AGTTAGTGCAGCCAAGCCCT 3' (SEQ ID NO:75) Gi 33101 NT 301 320 8695 5' CCGGAATTCAAAAGGCAAGTGGACTTCGGTGCTTACCTG 3' Gi 188910 NT 945 (SEQ ID NO:76) 974 8697 5' CCCAAGCTT CAGCTCAGCTCAGTTCAGTTCAGCCCT 3' (SEQ Gi 188910 NT 4-30 ID NO:77) 8508 5' CCCAAGCTTATGCGAGGGTCTGGACGGCTGAGGACCCCC 3' Gi 188910 NT 370 (SEQ ID NO:78) 400 8696 5' CCGGAATTCATGCGGCAAGGGTTGCGGACCGCTGGCTGG 3' Gi 188910 NT 715 (SEQ ID NO:79) 744 8694 5' CCGGAATTCGCCCAGCCCAGCCTAGCTCA 3' (SEQ ID NO:80) Gi 33101 NT 770 790 8691 5' CCCAAGCTTTTATCAACTGCTAGTTTGTG 3' (SEQ ID NO:81) Gi 34819 NT 361 381 9090 5' CCGGAATTCAGGGCTGAACTGAACTGAGCTGAGCTG 3' (SEQ Gi 188910 NT 1-30 ID NO:82) 9879 5' CGGCTGATATCTGGGAGCCTCTGTGGATTCCGA 3' (SEQ ID Gi 33100 NT 1-24 NO:83) 9805 5' AGCCGGATATCGCCCAGCCCAGCCTAGCTCA 3' (SEQ ID Gi 33101 NT 770 NO:84) 790 WO 2004/055182 PCT/AU2003/001697 40 0002 5' GAAAGTTAAATGGGAGTGACCCAG 3' (SEQ ID NO:85) GI 29502084 NT 962860 - 962884 0021 5' GAGTGACCATCGCACCCTTGACAG 3' (SEQ ID NO:86) Gi 29502084 Identification of rearranged VDJsegment in RAAMOS RA-1 5 The sequenced VH allele for RAMOS RA-1 was identified as V14-34 (DP 63) using V Base (http://www.mrc-cpe.cam.ac.uk/vbase). A schematic diagram of the gene targeting region is shown in Figure 3 and the genomic sequence is set out in SEQ ID NO:1. The immunoglobulin heavy chain promoter shown in Figure 3 corresponds to nucleotides 4852 - 5190 of SEQ ID NO:1. The leader sequence (including intron 1) 10 shown in Figure 3 corresponds to nucleotides 5191 - 5329 of SEQ ID NO:1. The VDJ segment shown in Figure 3 corresponds to nucleotides 5330 - 5708 of SEQ ID NO: 1. The consensus nucleotide sequence differs from the published VH 4
.
34 sequence (V Base) by six nucleotides only (C 68 ->G, C 72 ->T, C 228 ->G, T 23 2 ->C, C 244 ->T, C 24 8->A) of 15 which four were coding changes (A 23 ->G; N 76 ->K, F 78 ->L, T 83 ->N). The sequence was further classified as VH 4 -34 subgroup 2 (Journal of Molecular Biology, 1987, Vol 195, 761-768) using the Kabat database (Kabat et al., 1991, Sequences of proteins of immunological interest, vol 1, 5 edition). The C 68 -> G mutation in framework 1 and
N
76 - > K mutation in framework 4 were unique to RAMOS RA-1 and occurred in 20 otherwise conserved residues in the other four members of the group (Lee et al. 1987, Journal of Immunology, 142, 4054-4061, Sanz et al. 1988, Clinical Experimental Immunology 71, 508-516). The nucleotide sequence generated from RAMOS DNA corresponding to the D allele 25 differed significantly from the published alleles in V Base. Although no significant homology was identified, the closest related sequence similarity (and sequence length) was to D 3
-
16 (Corbett, S et al, Journal of Molecular Biology, 270, 587-597). The sequenced JH allele for RAMOS RA-1 was identified as JH6b (Mattila et al. 1995) 30 using V-Base. No nucleotide base changes were detected between the consensus sequence and the published JH 6 b sequence.
WO 2004/055182 PCT/AU2003/001697 41 Sequencing of the 3' region downstream of the rearranged VH allele The homologous sequence downstream of the site of integration chosen for the vector corresponds to a ~ 3kb region between the rearranged VJD genes through to the mu 5 enhancer of the human immunoglobulin heavy chain locus of the RAMOS cell line (corresponding to sequence gi 29502084 nucleotides 960091 - 962947). The region 3' downstream of the rearranged VDJ segment was sequenced using methods previously described. Primers were designed based on published sequences, 10 human immunoglobulin heavy chain enhancer on chromosome 14 (gi 34819), human J6 to enhancer DNA of the immunoglobulin heavy-chain gene (gi 33100), human (AW Ramos) translocated t(8;14) c-myc oncogene, exon 1 (gi 188910) and human mu switch DNA of the immunoglobulin heavy-chain gene locus (gi 33 101)(Table 5). 15 Sequences- were analysed using BLAST program (NBCI, http://www.ncbi.nlm.nih.gov/BLAST/) and assembled in Clone Manager Suite 7 (Scientific and Educational Software). The assembled sequence is set out as nucleotides 5709 to 8634 of SEQ ID NO: 1. This sequence shares 98 % similarity with the published sequence gi 29502084 nucleotides 960091-962947. 20 Cloning of the 3kb fragment downstream of the rearranged VH allele from genomic DNA The 3 kb fragment was amplified from genomic DNA extracted from RAMOS RA-1 25 cells using Platinum PfX DNA polymerase (Invitrogen, CA, USA). The PCR reaction was the same as previously described except the forward primer 9779 (5' CCGCTCGAGTGGGAGCCTCTGTGGATTTTCCGA 3') (SEQ ID NO:111) and reverse primer 9801 (5' TGACCGGACGTCGCCCAGCCCAGCCTAGCTCA 3') (SEQ ID NO: 112) were used and the cycling conditions were as follows ; one cycle of 30 94'C for 15 seconds, fifteen cycles of 94*C for 10 seconds, 68*C for 2 minutes, 15 cycles of 94'C for 10 seconds, 68'C for 2 minutes with and an extra 15 seconds added each cycle, and one cycle of 72*C for 7 minutes. A second PCR reaction was performed using 0.5 / 20.0 il of the first PCR reaction as a template to gain sufficient DNA for detection using ethidium bromide. 35 WO 2004/055182 PCT/AU2003/001697 42 The 3 kb fragment was cloned into pPCRScript using the PCR-Script Amp cloning kit (Stratagene, Texas, USA) at the Srf I site. The resulting construct was referred to as 3kbPCRScript 10-1-3 (5822 bp). This construct was sequenced using primers in Table 5. 5 The size and GC rich stretches present in the 5 kb and 3 kb homology regions gave rise to structural regions which caused difficulties in cloning and thereafter problems with stability of the cloned regions. 10 Example 2: Design and construction of a vector for integration into the rearranged VH allele, VH4-34 in RAMOS RA-1 1) Construction of Vector For Integration 15 A 3 kb fragment, containing sequence homologous to the region downstream of the rearranged allele VH 4
.
3 4 was amplified from the construct 3kbPCRScript 10-1-3 with the forward primer 9879 (5' CGGCTGATATCTGGGAGCCTCTGTGGATTTTCCGA 3') (SEQ ID NO:83) and the reverse primer 9805 (5' AGCCGGATATCGCCCAGCCCAGCCTAGCTCA 3') (SEQ ID NO:84) using 20 Platinum PfX DNA polymerase (Invitrogen, CA. USA). PCR products were purified using QIAquick PCR Purification Kit (Qiagen
TM
) according to manufacturer's instructions then digested with EcoRV and ethanol precipitated. Digested fragments were ligated into construct 5kbPCRScript 15a-7 containing the 5 kb sequence upstream of the rearranged VH allele. The DNA was transformed into Esherichia coli and grown 25 at 37 'C overnight. Bacterial colonies were screened by Southern blotting and probed using 1 2 P labeled oligonucleotides 8604 (5' CCCAAGCTTCGGCCCCGATGCGGGACTGCGTTTTGACCA 3') (SEQ ID NO:70) 30 to detect the 3 kb fragment and a pool of labeled oligonucleotides 8687 (5' CCCAAGCTTCATGTTCCACGCATTACGTC 3') (SEQ ID NO:54), 8440 (5' CCGGAATTCAATTTGAGATTGTGTGTGAGATCTCAGGAG 3') (SEQ ID NO:38) and 8472 (5' CCGGAATTCGTTGGGTTCCCAGTGTAGGTGATGATCCAT 3') (SEQ ID NO:44) to detect the 5 kb fragment. Colonies that were positive for both 35 fragments were subcultured and DNA was extracted using QlAprep Miniprep kit (QiagenTM). Clones were analysed by diagnostic restriction enzymes and PCR for each WO 2004/055182 PCT/AU2003/001697 43 fragment and sequenced using an ABI 373 DNA sequencer with T7 and T3 primers. This new construct is referred to as 3kbl5a-7- 4T is 10 826 bp long (Figure 4). The sequence of is shown in SEQ ID NO:87. 5 2) Transfection of 3kbl5a-7-4T into RAMOS and screening for integration Clone 3kb15a-7-4T (5 tg) is transfected into 3 x 106 RAMOS RA-1 cells using the following protocol ; cells are centrifuged to remove spent media then resuspended at 1 x106 cells / ml in RPMI containing DEAE Dextran (25 pg / ml). Resuspended cells (1 10 ml) are transferred into electroporation cuvettes (4 mm gap) and DNA is added. The cuvette containing the cell / DNA mixture is then incubated at 37 0 C for 10 minutes. Cells are then pulsed twice at 550 V and 25 pFd capacitance, using a Gene Pulser (BioRad). Following a 10 minute incubation on ice, the cells are removed from the cuvette and transferred to T 25 flasks containing 9 ml of RPMI + 15 % FCS. Flasks are 15 incubated at 37 0 C for at least 24 hours before the efficiency of transfection is assessed. Mock transfected cells are used as controls. Three days after transfection, cells are stained for surface IgM and sorted by flow cytometry into an IgM positive population and IgM negative population. Prior to this 20 experiment the background level of IgM negative cells is determined. Genomic DNA is extracted from IgM negative cells using the Genoprep DNA isolation kit (Scientifx, Australia) according the manufacturers' instructions. The DNA is then digested using Xba I enzyme and run on a 0.6 % agarose gel. DNA is transferred onto 25 nitrocellulose membrane using standard methods for Southern blotting and probed with 32P labeled oligonucleotides 0041 (5' GACGGTATCGATAAGCTTGATATCGAATTCCTGCAGCCCGGG 3') (SEQ ID NO:88) and 0042 (5' GACCTCCTGCACAAGAACGGTACCGGGCTAGAGCGGCCGCCA 3') (SEQ ID 30 NO:89) that span the junction regions. A probe against the middle of the sequence that would be integrated, 9403 (5' CAGTGCTGCAATGATACCGCGAGAC 3') (SEQ ID NO:90) is also used. The following patterns of radioactive probe binding to DNA extracted from cells 35 transfected with i) vector only, no radioactive signals ii) the construct containing the 3kbl5a-7 4T shows radioactive signals with all three radioactive probes as is expected WO 2004/055182 PCT/AU2003/001697 44 when the 5kb and 3kb recombination occurs with the chromosomal DNA integrating the middle sequence; the binding of the radioactive 9403 probe shows this iii) DNA from untransfected cells show no binding with the 9403 radioactive probe, iv) the lanes on the agarose gel with the plasmid 3kb15a-7-4T show radioactive signal with all 5 probes. Obtaining this pattern i-iv) is indicative of 3kbl5a-7-4T integration into the host cell genome. Example 3 : Design and construction of a vector for integration into the rearranged VH allele, Y 3 in RAMOS RA-1 and mutation of the asFP499 gene 10 The components of the vector for integration are as follows: i) Construct 5 kb in PCRScript 15a-7 is modified by removing the Nae I - Xho I fragment which effectively deletes an additional Kpn I site. This new construct is 15 herein referred to as 5kbPCRScript minus Nae I - Xho I and is 7608 bp in length. ii) The cloned gene for asFP499, which is a fluorescent protein isolated from the sea anemone Anemonia sulcata, was obtained from J. Wiedenmann (University of Ulm, Germany) in the plasmid pQE32 (Qiagen, CA. USA). Four sequential PCR reactions 20 were performed to introduce restriction sites Kpn I and Not I at the 5' and 3' ends of the asFP499 gene respectively and two C-terminal flag tags with a Sal I site at the 3' end of the second flag tag. This final product (-770 bp) is subeloned into pPCRscript (Stratagene, Texas, USA) and herein is referred to as targetPCRScriptasFP499-1. 25 iii) The gene encoding thymidine kinase is amplified by PCR and restriction sites Hind III and Cla I are introduced at the 5' and 3' end of the gene respectively. This product (1260 bp) is subcloned into pPCRscript (Stratagene, Texas, USA) and herein is referred to as construct TKPCRscript -64. 30 iv) pMClneo Poly A (3800 bp) was obtained from Stratagene (Texas, USA). These components are assembled in the following order: Constructs targetPCRScriptasFP499-1 and 5kbPCRScript minus Nae I - Xho I are 35 digested with Kpn I and Sal I and run on 1.0 and 0.9 % agarose gels respectively. The desired products (~7608 bp and ~770 bp) are cut out and DNA extracted using WO 2004/055182 PCT/AU2003/001697 45 QlAquick gel extraction kit (QiagenTM). The asFP499 gene (-770 bp) is ligated into 5kbPCRScript minus Nae I - Xho I (-7608 bp) to create 5kb-asFP499PCRscript minus Nae I - XhoI (8289 bp). 5 Constructs TKPCRscript -64 and 5kb-asFP499PCRscript minus Nae I - XhoI are subsequently digested with Cla I and Sal I and run on agarose gels and DNA is extracted as described above. The asFP499-5kb fragment (~5770 bp) is ligated to the TKPCRScript-64 backbone (- 4737 bp) to generate TK-5kb-asFP499 PCRscript (10464 bp). 10 The TK-5kb-asFP499 cassette (-7558 bp) is digested out of TK-5kb-asFP499 PCRscript with Sal I and Hind III and ligated into pMClneo Poly A, cleaved with Sal I and Hind III (3837 bp). This new construct is designated KW 1. 15 Finally, 3kbPCRscript 10-1-3 and KWi are digested with restriction enzymes Xho I and Aat II and gel purified as described above. The 3kb fragment is ligated into the KW1 backbone (-10868 bp) yielding the final integration vector designated KW2 (13722 bp) (Figure 5). The sequence of integration vector KW2 is set out in SEQ ID NO:91. 20 The asFP499 gene was deleted from vector KW2 to generate vector KW3 (Figure 6). The sequence of integration vector KW3 is set out in SEQ ID NO:110. It will be appreciated that any target nucleic acid molecule of interest can be inserted into this vector for use in the affinity maturation process of the present invention. 25 Example 4: Optimal culturing conditions for RAMOS RA-1 cells Optimal growth conditions for RAMOS cells were determined by performing growth 30 curve experiments using different supplements to the medium and different seeding concentrations. RAMOS cells were seeded at 1 x 10 4 , 5 x 104, 1x 10s, and 2 x 10 5 (cells / ml) and cultured as 25 ml cultures in either RPMI medium with 10 % heat inactivated FBS and 1mM sodium pyruvate or RPMI medium with 15 % heat inactivated FBS, 1 mM sodium pyruvate and 50 % conditioned medium. Every 24 35 hours, 1 ml samples of cells were taken and the number of viable cells was determined using the Vi-Cell Viability Analyser (Beckman Coulter, CA, USA,). The results WO 2004/055182 PCT/AU2003/001697 46 showed that RAMOS cells had a lag phase of 48 hours regardless of the seeding concentrations. Cultures reach an exponential growth phase at a density of 0.25 - 0.5 x 106 cells / ml RPMI medium with 10 % heat inactivated FBS and 1 mM sodium pyruvate whereas cells growing in RPMI medium with 15 % heat inactivated FBS, 1 5 mM sodium pyruvate and 50 % conditioned medium did not enter an exponential phase. The optimal seeding rate for RAMOS was 1 x 105 cells / ml. Mycoplasma infection can affect transfection rates, therefore we tested RAMOS RA-1 monthly. Cells were tested using 4', 6-diamidino-2-phenylindole (DAPI) staining in 10 which all DNA is stained specifically with this very bright dye. If mycoplasma is present small bright specks of dye are seen in the cytoplasm. Cells were fixed onto glass slides and viewed under a 100 X objective with a UV filter system. Cells were negative for mycoplasma over a period of 12 months. 15 Example 5: RAMOS RA-1 cell division rate Transfection rates in RAMOS are affected by the viability of cells in culture. To identify the optimal time during the growth cycle to transfect RAMOS cells, we first determined the cell division rate. RAMOS cells were stained with cell-permeant 20 fluorescein-based dye carboxyfluorescein diacetate succinimidyl ester (CFSE) and analysed by flow cytometry based on established techniques in Current Protocols in Cytometry 9.11.2. Briefly, RAMOS cells in exponential log phase growth were washed and re-suspended 25 in phosphate buffered saline at 5x10 6 cells / ml. A volume of 2 pl of 5 mM CFSE was added per ml of cells. Cells were incubated for 10 minutes at 37*C after which 5 volumes of ice cold RPMI + 10 % FBS was added. Cells were then incubated on ice for a further 5 minutes and washed three times in culture medium before transferring to flasks and culturing under normal conditions (see example 1). Initially cells were not 30 analysed until 12 hours post staining to allow for the initial fluorescence decay. Thereafter cells were anlaysed by flow cytometry every 24 hours. The CFSE fluorescence was plotted against the number of cells anlaysed (Figure 7). Upon cell division, the dye is equally distributed between daughter cells, allowing the resolution of up to eight cycles of cell division by flow cytometry. In the case of using cultured 35 cells that divide in concert, the resulting fluorescent distribution is halved per cell after WO 2004/055182 PCT/AU2003/001697 47 each division. Therefore, these results indicate that the cell population was dividing at least once every 24 hours. Example 6: Optimisation of conditions for transfection of RAMOS RA-1 cells 5 1) Construction ofvector for expression of asFP499 in RAMOS RA-1 Primers were designed to add a Xho I site to the 5' end of the asFP499 gene and two flag tags, two stop codons and a Xba I to the 3' end of the gene to allow cloning into 10 pME18s. The primers used are 8934 (5' CCGCTCGAGATGTATCCTTCCATCAAGGAAACC 3') (SEQ ID NO:92), 8935 (5' TCTAGATTATTATTTATCATCATCATCTTTATAATCTTTATCATCATCATCTT TATAATCAGCGGCCGC 3' (SEQ ID NO:93); 8936 (5' CTAGTCTAGATTATTATTTATCATCATCATC 3') (SEQ ID NO:94), and 8398 (5' 15 GTTATGTCCTAATTTCGAAGGCACTTGGGAGTA 3') (SEQ ID NO:95). The cloned sequence was confirmed by DNA sequence analysis. The resulting construct, referred to as pME18sasFP499 (3693 bp) (Figure 8) (SEQ ID NO:8) was used for subsequent transfection of RAMOS cells. 20 ii) Transfection ofpME18sasFP499 into RAiMOS RA-1 cells A number of different transfection reagents or methods can be used to transfect mammalian cells including Calcium Phosphate coprecipitation, Lipofectamine (Invitrogen), FuGENE6 (Roche, Germany), SuperFect (Qiagen, CA, USA), Effectene 25 (Qiagen, CA, USA), GenePORTER (Gene Therapy Systems, CA, USA) and Metafectene (Biontex, Germany). Electroporation is another method commonly used to transfect mammalian cells. Electroporation can be carried out using different electroporators such as the Gene Pulser (BioRad, CA, USA) or the Electro Square Porator ECM 830 (BTX, Fisher Biotech, Australia) and various voltage and 30 capacitance settings can also be used. Since RAMOS RA-1 cells are of B-lymphoid origin and it is known that lymphoid cells can be difficult to transfect, we optimised transfection of this cell line. The efficiency of transfection of RAMOS RA-1 cells was monitored by flow 35 cytometric analysis using an EPICS Elite (Beckman Coulter, CA, USA). Samples of transfected cells were stained with 1 stg / mL Propidium Iodode (PI). The live cell WO 2004/055182 PCT/AU2003/001697 48 population (based on forward and side scatter characteristics and PI staining) was gated and the percentage of Fluorescent Protein (FP) positive cells was assessed. FP expression was also assessed by fluorescence microscopy using an Olympus IX70 microscope and Olympus U-RFL-T burner. 5 In order to optimise the transfection process, a number of different transfection parameters were tested including: set voltage, set capacitance, amount of DNA, concentration of DEAE Dextran and analysis time post transfection. 10 Figures 9 show the results of a representative set of optimisation experiments. The combination of 550 V and 25 pFd resulted in the highest transfection efficiency. No significant effect on the transfection efficiency was observed using 1 pig or 30 jig of pME18sEGFP. The optimum time to analyse FP expression was between 24 and 36 hours post electroporation. DEAE Dextran varying from 25 Ig / ml to 1 mg / ml was 15 tested and concentrations between 25 ig / ml and 100 jig / ml were optimal for transfection but concentrations above 500 jig / ml were found to be toxic to the cells (data not shown). Using the optimum conditions, transfection rates of between 0.5 % and 3.5 % were 20 achieved with the average being approximately 1.0 %. Figure 10 shows the comparison of RAMOS RA-1 cells transfected with pME18sEGFP, pME18sasFP499 or mock transfected. The level of expression of asFP499 in RAMOS RA-1 was assessed 24 hours post transfection and was found to be 25 approximately 10 fold lower than that of EGFP. Example 7: Quantitation of the number of IgM molecules on the surface of RAMOS RA-1 cells 30 It is known in the art that the loss of surface IgM may be used to monitor integration into the rearranged VH allele. We therefore determined the number of natural IgM molecules on the surface of 35 RAMOS cells. RAMOS cells (50 pil) and Quantum Simply Cellular T M beads (Bangs Laboratories, IN, USA) (50 pl) were separately incubated on ice for 1 hour with a WO 2004/055182 PCT/AU2003/001697 49 saturating amount (2.5 pg) of a mouse anti-human IgM monoclonal antibody (Southern Biotech, AL, USA) conjugated to Alexa Fluor 4 8 8TM (Molecular Probes, OR, USA). Cells and beads were then analysed by flow cytometry using an EPICS Elite (Beckman-Coutler). Fluorescence intensity (at 488 nm) was plotted against the number 5 of cells or beads analysed (Figures 11 a and 1 1b). Five distinct populations of beads (labeled B, C, D, E, G) which have defined numbers of anti-mouse IgG binding sites (0, 2000, 20 000, 46 000 and 68 000) were observed (Figure 11 a). Figure 11b (H) shows a normal distribution of fluorescence intensity, ranging from 2 to 100, as expected for a population of cells. The mean fluorescence for each of these populations 10 was plotted against the corresponding number of predetermined binding sites to generate a linear line graph (Figure 11e) from which we extrapolated the average number of IgM molecules on RAMOS cells. The mean fluorescence intensity was calculated as 23.5 which corresponded to 1.25 X 106 molecules for RAMOS RA-1. 15 Example 8: Monitoring cell surface IgM loss on RAMOS RA-1 RAMOS RA-1 cell surface IgM decreases with time in culture. We therefore established the rate of natural loss of surface IgM in order to use this characteristic as a marker for integration. To evaluate the percentage of the population that were IgM 20 positive, RAMOS RA-1 cells were stained for IgM and analysed by flow cytometry. Briefly, cells were washed and resuspended at 1x10 6 cells / 100 pl. A sheep polyclonal antibody against human IgM (p chain specific) FITC conjugated (Chemicon, CA, USA) (10 sl) was added to cells which were incubated on ice for hour. Cells were 25 then washed with 2 ml of cold wash buffer (PBS + 2 % FBS, 0.01 % sodium azide) and resuspended in 500 p1 this buffer with 5 pl propidium iodide (1mg / ml) (Sigma Aldrich, Australia). Cells were anlaysed by flow cytometry using an EPICS Elite (Beckman Coulter, CA, USA). Cells were gated on the basis of forward and side scatter and negative propidium iodide. In passage one of RAMOS RA-1 98.39 % of 30 the cell population was positive for surface IgM (Figure 12a) by passage 14, 26.55 % of the cell population was positive (Figure 12b). This loss is attributed to either a high mutation rate or a growth advantage of IgM negative mutants. Therefore, RAMOS RA-1 cells were presorted to remove IgM negative cells and the IgM+ cells quantitated prior to transfection as the IgM loss is used as a measure of integration. 35 WO 2004/055182 PCT/AU2003/001697 50 To further investigate IgM loss on RAMOS, we quantitated the number of cell surface IgM molecules using the methodology described above. We observed that the average number of cell surface IgM molecules significantly decreased over time. In passage 4, RAMOS RA 1 cells possessed an average 9.0 x 105 molecules of IgM on their surface, 5 however by passage 16 the number of IgM molecules had decreased to 4.1 x 105 molecules (Figure 12). Together these data indicate that the decrease in cell surface IgM is dependent on passage number. We have also observed and quantitated differences in the rate of IgM loss between 10 RAMOS strains, 'RAMOS RA-l' supplied by American Tissue Culture Collection and 'RAMOS' supplied by European Collection of Cell Culture (ECAC) (Figure 13). Together these data suggest that although IgM loss is a marker for integration reported widely in the literature, we have opted to use an antibiotic marker, such as neomycin as a positive selection marker and thymidine kinase as a negative selection marker for 15 integration in our system. Example 9: Surface display of asFP499 using the anchor domain of CD26 For cell surface display of the asFP499 gene product on RAMOS cells we used the 20 transmembrane domain of CD26 (Tanaka,T et al., 1992, J. Immunol. 149 (2), 481-486) as an anchor. Transmembrane domain of CD26 Accession No: M74777 (gi 180082) 25 Peptide sequence: MKTPWKVLLGLLGAAALVTIITVPVVLLNK (SEQ ID NO:96) Nucleotide sequence: 10 -100 5'ATGAAGACACCGTGGAAGGTTCTCCTGGGACTGCTGGGTGCTGCTGCGC TTGTCACCATCATCACCGTGCCCGTGGTTCTGCTGAACAAA 3' (SEQ ID NO:97) 30 This anchor sequence was added to the 3' end of the asFP499 gene, to provide an N terminal anchor on the protein (CD26asFP499). This was achieved by sequential overlap extension PCR using primers that partially overlapped the existing DNA end and also added new sequence. A representation of this sequential overlap PCR is shown 35 in Figure 14. This method can be used to add sequence to either the 3' or 5' end of a sequence. Primers are listed in Table 6.
WO 2004/055182 PCT/AU2003/001697 51 Table 6: Primers used for addition of CD26 anchor sequence to asFP499 Primer Sequence 9712 5'CGTGCCCGTGGTTCTGCTGAACAAAATGTATCCTTCCATCAAGGAAACCA 3 ' (SEQ ID NO:98) 9713 5' CCGTGCCCGTGGTTCTGCTGAACAAAGTGTATCCTTCCATCAAGGAAACCA3' (SEQ ID NO:99) 9726 5'TGCTGCTGCGCTTGTCACCATCATCACCGTGCCCGTGGTTCTGCTGAACAAA3' (SEQ ID NO:100) 9727 5'GGAAGGTTCTCCTGGGACTGCTGGGTGCTGCTGCGCTTGTCACCATCATCA3' (SEQ ID NO:101) 9728 5'CCGGAATTCATGAAGACACCGTGGAAGGTTCTCCTGGGACTGCTGGG3' (SEQ ID NO: 102) 9963 5'GACTAGTTTATrATTTATCATCATCATCTTTATAATCTTTATCATCATC3' (SEQ ID NO:103) 5 The final PCR product was cloned into pME18s as described previously except that the restriction sites SpeI and EcoRI were used. The cloned sequence was confirmed by DNA sequence analysis. The resulting vector was designated pME18sCD26asFP and is shown in Figure 15. The sequence of pMEl8sCD26asFP is set out in SEQ ID NO:104. 10 Example 10: Transfection and analysis of CD26asFP499 To demonstrate cell surface display of CD26asFP499, the plasmid pME18sasFP499CD26 was transfected into RAMOS RA-1 and control HEK 293T cells. 15 RAMOS RA-1 cells were transfected as previously described (Example 6). Transfections in HEK 293T cells, which were 60 % - 90 % confluent, were carried out using FuGENE6 (Roche, Germany) according to the manufacturer's instructions. 5 pg of DNA was used in each transfection and pME18sasFP499 was used as a positive 20 control. Efficiency of transfection was assessed by flow cytometry as previously described. Figure 16 shows the flow cytometry data for transfection of RAMOS RA-1 cells with WO 2004/055182 PCT/AU2003/001697 52 pME18sCD26asFP499. It can be seen that the efficiency of transfection with this vector in this cell line is very low (0.01 % corresponds to 4 positive cells in this case). The data for transfection of HEK 293T cells is shown in Figure 17. In this cell line, the transfection efficiency of pME18sCD26asFP499 is equal to that of pME18sasFP499 5 and the expression of both vectors is improved in this cell line. The mean fluorescence intensity of pME18sCD26asFP499 was lower than that of pMEl8sasFP499. HEK 293 T cells transfected with pME18sCD26asFP499 were analysed by confocal microscopy using a Nikon C1 (Coherent Life Sciences, Australia). The majority .of 10 cells showed a diffuse fluorescence at their periphery indicating expression of asFP499CD26 at the cell membrane, whereas bright fluorescence was observed uniformly throughout control cells transfected with pME1 8sasFP499 (data not shown). Example 11: Cloning of the coding region of AICDA (AID) gene into pME1 8s 15 Activation Induced Cytidine Deaminase (AID), the protein product of the differentiation specific AICDA gene has been shown to be a B-cell-specific factor required and essential for the processes of Class Switch Recombination (CSR) and Somatic Hypermutation (SHM) in B-cells. Its ectopic expression in a number of 20 mammalian cell systems including non B-cell systems has shown the ability of AID protein to induce and/or enhance hypermutation (Martin et. al 2002, Okazaki et. al 2002, Yoshikawa et. al 2002). Extraction of total mRATA from RAMOS RA-1 25 Cells were harvested and centrifuged at 1500 rpm and resuspended in PBS. Total cellular mRNA was extracted using a GenoPrepTM mRNA isolation kit (Scientifix, Australia) according to the manufacturer's instructions. Briefly, after removing the supernatant, 700 pl of Lysis and Binding solution was added to cells (1x10 6 ). This 30 mixture was combined with 50 gl (250 pg) of GenoPrepTM mRNA magnetic beads and incubated at room temperature for 5 minutes. Beads were magnetically collected and washed with 500 ptl of washing solution I. Beads were then washed twice with 500 [l of washing solution II. mRNA-bead complexes were resuspended in 20 pLl sterile water and then incubated at 65 *C for 2 minutes. Beads were magnetically collected 35 and the mRNA-containing supernatant was transferred to a new tube.
WO 2004/055182 PCT/AU2003/001697 53 The human AICDA (AID) gene was amplified from RAMOS RA-1 total RNA using the Superscript One-step RT-PCR with platinum Taq kit (Invitrogen, CA. USA). The reaction included 1 X reaction mix, forward primer 9645 (5' ATG GACAGCCTCTTGATGAACCGGAGGA 3') (SEQ ID NO:105) 10pM, reverse 5 primer 9646 (5' CAAAGTCCCAAAGTACGAAATGCGT 3') (SEQ ID NO:106) 10pM, template RNA (~150 ng), RT / Taq mix (1.0 RI) and sterile water in a final volume of 50 pl. Cycling conditions were as follows; one cycle of 55'C for 30 minutes, 94'C for 2 minutes, 35 cycles of 94'C for 30 seconds, 55"C for 30 seconds, 68'C for one minute, and one cycle of 72*C for 7 minutes. 10 The RT-PCR product (596 bp) was amplified by PCR using Platinum Pfx polymerase (Invitrogen CA., USA) as previously described. This product was then cloned into pPCRScript using the PCR-Script Amp cloning kit (Stratagene, Texas, USA) at the Srf I site. The coding region of AID was then subeloned into the pME18s using Xho I and 15 Xba I restriction sites with primers 9792 (5' CCCTCGAGATGGACAGCCTCTTGATGAACCGGA 3') (SEQ ID NO:108) and 9793 (5' GCTCTAGACAAAGTCCCAAAGTACGAAATGCGT 3') (SEQ ID NO: 109). The PCR reaction and cycling conditions were as described above. These constructs were verified by sequencing as previously described. The DNA sequence of 20 the coding region of the AICDA gene is set out in SEQ ID NO:107. Example 12: Affinity maturation of an antibody fragment The gene targeting vector KW2 is modified such that following integration and target 25 nucleic acid expression, a chimeric protein consisting of an antibody fragment fused to an anchor is produced. This is achieved by using standard molecular biology techniques to clone the CD26 anchor sequence into KW2 and then inserting the sequence for the antibody fragment downstream of the CD26 anchor sequence. The resulting vector is called KW3. 30 RAMOS RA-1 cells are transfected with the gene targeting vector KW3, using the optimised protocol previously described. The cells are allowed to recover for 48 to 72 hours before G418 at 5 mg / ml and gancyclovir or FIAU are added to the media for 7 to 9 days. This results in the selection of stable transfectants and also allows time for 35 mutation and surface display to occur. The live cell population, which consists of the stable transfectants, is sorted using flow cytometry and allowed to react with the WO 2004/055182 PCT/AU2003/001697 54 fluorescently labelled binding partner of the displayed antibody fragment. The cells with the highest fluorescence intensity (ie highest binding) are then single cell sorted into 96 well U bottomed plates containing 100 pl of 50 % conditioned media and 50 % fresh growth media. Single cell sorting is achieved using the Autoclone function of the 5 EPICS Elite (Beckman Coulter, CA, USA). It is also possible to select the cells with the highest affinity gene products on the cell surface, by capturing cells with immoblised binding partner, and selecting for the highest affinity gene product by competitive elution. 10 If necessary, the cells can be cycled through the in vivo strategy (Figure 2). The single cells can be expanded to between 1x10 5 and 1x10 6 to allow further mutation to occur and then reacted with the labelled binding partner and single cell sorted again. This cycle of single cell sorting/expansion and mutation/re-selection can be carried out until 15 cells displaying the molecule with the desired characteristic, in this case increased binding affinity, have been isolated. The DNA from these cells can be extracted and the mutated gene can be amplified by PCR. Alternatively, the RNA can be extracted and the gene amplified by RT-PCR. The amplified gene can then be inserted into an appropriate expression vector for high-level production of the affinity matured antibody 20 fragment. Any discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is solely for the purpose of providing a context for the present invention. It is not to be taken as an admission that any or all of 25 these matters form part of the prior art base or were common general knowledge in the field relevant to the present invention as it existed before the priority date of each claim of this application. It will be appreciated by persons skilled in the art that numerous variations and/or 30 modifications may be made to the invention as shown in the specific embodiments without departing from the spirit or scope of the invention as broadly described. The present embodiments are, therefore, to be considered in all respects as illustrative and not restrictive.
Claims (38)
1. A method for producing and selecting a gene product with desired characteristics, the method comprising 5 (i) introducing into a hypermutating cell a target nucleic acid molecule encoding a gene product such that the target nucleic acid molecule is integrated into an immunoglobulin locus of the genome of the hypermutating cell; 10 (ii) culturing the hypermutating cell such that the target nucleic acid molecule undergoes hypermutation during DNA and/or RNA synthesis, giving rise to a population of cells expressing mutant gene products; and (iii) selecting a mutant gene product with desired characteristics. 15
2. A method as claimed in claim 1 wherein the immunoglobulin locus contains a rearranged V gene.
3. A method as claimed in claim 1 wherein the immunoglobulin locus contains a 20 rearranged VH gene.
4. A method as claimed in claim 1 wherein the immunoglobulin locus contains the rearranged VH 434 allele. 25
5. A method as claimed in any one of claims 1 to 4 wherein following integration of the target nucleic acid molecule into the immunoglobulin locus, the target nucleic acid molecule is operatively linked to a promoter.
6. A method as claimed in claim 5 wherein the promoter is an imnimunoglobulin 30 heavy or light chain promoter.
7. A method as claimed in claim 5 or claim 6 wherein the promoter is endogenous to the hypermutating cell. 35
8. A method as claimed in claim 5 or claim 6 wherein the promoter is exogenous to the hypermutating cell. WO 2004/055182 PCT/AU2003/001697 56
9. A method as claimed in any one of claims 5 to 8 wherein following integration the initiation codon of the target nucleic acid molecule is located within 2 kb of the 3' end of the promoter. 5
10. A method as claimed in any one of claims 5 to 8 wherein following integration the initiation codon of the target nucleic acid molecule is located within 500 bp of the 3' end of the promoter. 10
11. A method as claimed in any one of claims 5 to 8 wherein following integration the target nucleic acid molecule is located downstream of the promoter and upstream of an intronic enhancer with or without matrix attachment regions and/or 3' enhancer.
12. A method as claimed in any one of claims 1 to 9 wherein the target nucleic acid 15 molecule is introduced into the cell by way of an integration vector comprising a sequence homologous to a region of at least 500 bp upstream of a rearranged V allele and a sequence homologous to a region of at least 500 bp downstream of a rearranged V gene. 20
13. A method as claimed in any one of claims 1 to 12 wherein steps (ii) and (iii) are repeated.
14. A method as claimed in any one of claims 1 to 13 wherein the method comprises a further step to increase the rate of mutation of the target nucleic acid molecule. 25
15. A method as claimed in claim 14 wherein the further step is to increase the levels of expression of activation-induced cytidine deaminase (AID) within the hypermutating cell. 30
16. A method as claimed in any one of claims 1 to 13 wherein the mutant gene product is selected by way of an assay performed within the hypermutating cell.
17. A method as claimed in claim 16 wherein the assay performed within the hypermutating cell is a protein-fragment complementation assay (PCA). 35 WO 2004/055182 PCT/AU2003/001697 57
18. A method as claimed in any one of claims 1 to 17 wherein the target nucleic acid molecule is linked to a sequence encoding an anchor molecule such that following expression, the mutant gene product is displayed on the surface of the hypermutating cell. 5
19. A method as claimed in claim 18 wherein the mutant gene product is selected by detecting binding of a binding partner to the mutant gene product.
20. A method as claimed in claim 19 wherein the hypermutating cells are labelled 10 with a detectable marker such as a fluorescent dye and the binding partner is immobilized.
21. A method as claimed in claim 19 wherein the binding partner is labelled with a fluorescent tag. 15
22. A method as claimed in claim 18 wherein hypermutating cell(s) displaying the mutant gene product bound to the labelled binding partner are sorted using a flow cytometric technique. 20
23. A method as claimed in any one of claims 19 to 22 wherein the binding partner is selected from the group consisting of an antibody, receptor, transcription factor hormone, enzyme, cell surface molecule, DNA or RNA molecule.
24. A method as claimed in any one of claims 1 to 23 which further comprises the 25 step of recovering the target nucleic acid molecule encoding the selected mutant gene product.
25. A method as claimed in claim 24 wherein the recovery involves amplification of the polynucleotide by PCR or RT-PCR. 30
26. A method as claimed in any one of claims 1 to 25 wherein the hypermutating cell is a mammalian, yeast, insect or bacterial cell.
27. A method as claimed in claim 26 wherein the hypermutating cell is a 35 mammalian cell. WO 2004/055182 PCT/AU2003/001697 58
28. A method as claimed in claim 27 wherein the mammalian hypermutating cell is selected from the group consisting of RAMOS, BL2, BL41, BL70 and Nalm.
29. A gene product produced by a method as claimed in any one of claims 1 to 28. 5
30. A vector for targeted integration into an immunoglobulin locus of a hypermutating cell, the vector comprising a sequence homologous to a region upstream of a rearranged V gene of the hypermutating cell, a sequence homologous to a region downstream of a rearranged V gene of the hypermutating cell and a site for integration 10 of a target nucleic acid molecule.
31. A vector as claimed in claim 30 wherein the region upstream of the rearranged VH gene of the hypermutating cell is a region within nucleotides 1 to 5190 of SEQ ID NO:1 15
32. A vector as claimed in claim 31 wherein the region is at least 500 bp within nucleotides 1 to 5190 of SEQ ID NO:1.
33. A vector as claimed in claim 31 wherein the region upstream of the rearranged 20 VH gene of the hypermutating cell comprises nucleotides 191 to 5190 of SEQ ID NO:l.
34. A vector as claimed in any one of claims 30 to 33 wherein the region downstream of the rearranged VH gene of the hypermutating cell is a region within 25 nucleotides 5709 to 8699 of SEQ ID NO:1.
35. A vector as claimed in any one of claims 30 to 34 wherein the downstream region is at least 500 bp within nucleotides 5709 to 8699 of SEQ ID NO:1. 30
36. A vector as claimed in any one of claims 30 to 35 wherein the vector further comprises a selectable marker.
37. A vector for targeted integration comprising a sequence as set out in nucleotides 1 to 12990 of SEQ ID NO:110. WO 2004/055182 PCT/AU2003/001697 59
38. A vector as claimed in any one of claims 30 to 37 wherein the vector further comprises a sequence encoding a signal and/or anchor molecule suitable for display of the gene product encoded by the target nucleic acid molecule. 5
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2003287780A AU2003287780B2 (en) | 2002-12-18 | 2003-12-18 | In vivo affinity maturation scheme |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2002953381A AU2002953381A0 (en) | 2002-12-18 | 2002-12-18 | In vivo affinity maturation scheme |
AU2002953381 | 2002-12-18 | ||
PCT/AU2003/001697 WO2004055182A1 (en) | 2002-12-18 | 2003-12-18 | In vivo affinity maturation scheme |
AU2003287780A AU2003287780B2 (en) | 2002-12-18 | 2003-12-18 | In vivo affinity maturation scheme |
Publications (2)
Publication Number | Publication Date |
---|---|
AU2003287780A1 true AU2003287780A1 (en) | 2004-07-09 |
AU2003287780B2 AU2003287780B2 (en) | 2007-03-22 |
Family
ID=34378291
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2003287780A Expired AU2003287780B2 (en) | 2002-12-18 | 2003-12-18 | In vivo affinity maturation scheme |
Country Status (1)
Country | Link |
---|---|
AU (1) | AU2003287780B2 (en) |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ES2336982T3 (en) * | 1998-10-09 | 2010-04-19 | Medical Research Council | PROCEDURE FOR THE GENERATION OF DIVERSITY. |
-
2003
- 2003-12-18 AU AU2003287780A patent/AU2003287780B2/en not_active Expired
Also Published As
Publication number | Publication date |
---|---|
AU2003287780B2 (en) | 2007-03-22 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP4067516B2 (en) | DNA mutagenesis by random fragmentation and reassembly | |
US10329555B2 (en) | High throughput generation and affinity maturation of humanized antibody | |
JP4629787B2 (en) | Protein / (poly) peptide library | |
JP4015193B2 (en) | Method for producing a polynucleotide having desired characteristics by iterative selection and recombination | |
Boder et al. | Yeast surface display for screening combinatorial polypeptide libraries | |
US6479243B1 (en) | Method for generating libraries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules | |
US5885827A (en) | Eukaryotic high rate mutagenesis system | |
US5780225A (en) | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules | |
US20220090053A1 (en) | Integrated system for library construction, affinity binder screening and expression thereof | |
IE84214B1 (en) | Heterodimeric receptor libraries using phagemids | |
JP2005514927A5 (en) | ||
ITMI982509A1 (en) | PROCESS FOR THE PREPARATION OF POLYPEPTIDE GENERATORS USING THESE GENERATORS AND THE POLYPEPTIDES OBTAINED | |
US20060099611A1 (en) | In vivo affinity maturation scheme | |
PT1117774E (en) | Method for generating diversity | |
KR100491810B1 (en) | Method of inducing DNA mutations by random fragmentation and reassembly | |
Kay et al. | Principles and applications of phage display | |
GB2421950A (en) | Method of mutagenesis | |
AU2003287780B2 (en) | In vivo affinity maturation scheme | |
WO2004046189A2 (en) | Method for generating immunoglobulin genes | |
JP4748984B2 (en) | Recombination of nucleic acid library members | |
WO2006074765A1 (en) | Molecular biology method | |
Boder | Molecular engineering of a single-chain Fv antibody fragment to femtomolar affinity |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FGA | Letters patent sealed or granted (standard patent) | ||
PC | Assignment registered |
Owner name: QUINTAIN CONSULTING PTY LTD Free format text: FORMER OWNER WAS: DIATECH PTY LTD |
|
PC | Assignment registered |
Owner name: ANAPTYSBIO, INC. Free format text: FORMER OWNER WAS: QUINTAIN CONSULTING PTY LTD |
|
MK14 | Patent ceased section 143(a) (annual fees not paid) or expired |