AU2001236774A1 - Inhibitors of apoptosis - Google Patents

Inhibitors of apoptosis

Info

Publication number
AU2001236774A1
AU2001236774A1 AU2001236774A AU3677401A AU2001236774A1 AU 2001236774 A1 AU2001236774 A1 AU 2001236774A1 AU 2001236774 A AU2001236774 A AU 2001236774A AU 3677401 A AU3677401 A AU 3677401A AU 2001236774 A1 AU2001236774 A1 AU 2001236774A1
Authority
AU
Australia
Prior art keywords
iap
seq
nucleic acid
polypeptide
apoptosis
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
AU2001236774A
Inventor
Bruce D Hammock
Qihong Huang
Hiroko Maeda
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of California
Original Assignee
University of California
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of California filed Critical University of California
Publication of AU2001236774A1 publication Critical patent/AU2001236774A1/en
Abandoned legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8262Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield involving plant development
    • C12N15/8263Ablation; Apoptosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43563Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4747Apoptosis related proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2799/00Uses of viruses
    • C12N2799/02Uses of viruses as vector
    • C12N2799/021Uses of viruses as vector for the expression of a heterologous nucleic acid
    • C12N2799/026Uses of viruses as vector for the expression of a heterologous nucleic acid where the vector is derived from a baculovirus

Description

Inhibitors of Apoptosis
CROSS-REFERENCE TO RELATED APPLICATIONS Not applicable.
STATEMENT AS TO RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED RESEARCH AND DEVELOPMENT
This invention was made with government support under RO1 ES 02710 awarded by the National Institute of Environmental Health Sciences and under 97 35302 4406 awarded by the United States Department of Agriculture. The government has certain rights in the invention.
FIELD OF THE INVENTION
The present invention is directed to polynucleotides encoding inhibitors of apoptosis. The polynucleotides can be used to control apoptosis in target cells.
BACKGROUND OF THE INVENTION
Apoptosis denotes a type of programmed cell death in which the cell nucleus shrinks, the genetic material (DNA) progressively degrades, and the cell collapses (see, e.g. Kawabe, et al. Nature 349:245-248 (1991). In many organisms, apoptosis plays an important physiological role in development, tissue homeostasis, eradication of virus-infected cells, and other events (Wyllie, A. H., Kerr, J. F. R. & Currie, A. R. (1980) Int. Rev. Cytol. 68, 251-306)). Caspases are a family of intracellular proteases responsible for execution of the apoptotic program (Salvesen, G. S. & Dixit, V. M. (1997) Cell 91, 443-446). They are initially synthesized as inactive zymogens that are activated by proteolytic processing, generating the requisite large- and small-subunits which comprise the active caspase enzyme. The functional conservation of caspases in inducing apoptosis within various insect, plant, and animal species makes them appropriate targets for influencing the apoptosis process. Some viruses harbor genes which encode caspase inhibitory proteins, thereby suppressing host defense mechanisms which would otherwise eliminate virus- infected cells by apoptosis. Examples of viral caspase inhibitors include the baculoviral p35 protein (Clem, R. J. et al., (1991) Science 254, 1388-1390 and the crmA protein of the Poxviridae-family cowpox virus (Ray, C, et al., (1992) Cell 69, 597-604). IAP family proteins were first discovered in baculoviruses (Birnbaum, M., et al, (1994) Journal of Virology 68:2521-2525; Crook, N. E., et al., (1993) J. Virol. 67: 2168-2174). Genetic complementation analysis revealed that the Inhibitor of Apoptosis Protein ("IAP") genes of the CpGV and OpMNPV baculoviruses can rescue p35-defιcient viruses, maintaining host cell survival so that viral replication successfully occurs (Birnbaum, M., (1994), supra, Crook, N. E., et al., (1993) supra). Baculoviral IAPs contain two tandem copies of a Baculovirus Inhibitory Repeat (BIR) domain followed by a C-terminal RING domain. Mutagenesis studies suggest a requirement for both the BIR and RING domains for their anti-apoptotic function in insect cells. Since these initial discoveries, cellular IAP homologs have been found in many animal species, including Drosophila, mammals, and humans (reviewed in (Miller, L. (1999) Trends in Cell Biology 9:323-328; Deveraux, Q. & Reed, J. C. (1998) Genes Dev. 13:239-252)). All cellular IAPs contain one to three copies of a baculoviral inhibitory repeat (BIR) domain and most also contain a RING domain located near their C-termini. A mechanism for IAP-family proteins was shown when it was reported that several human IAPs, including XIAP, cIAPl, cIAP2, can directly bind and inhibit certain caspases, including caspases-3, -7, and -9 (Deveraux, Q., et al., (1999) EMBO J., in press.; Deveraux, Q. & Reed, J. C.
(1998) supra; Deveraux, Q., et al. (1997) Nature 388:300-303; Roy, N., et al., (1997) EMBO J. 16, 6914-6925). Subsequent deletional analysis indicated that the second BIR domain (BIR2) of XIAP is sufficient for inhibiting mammalian caspases-3 and -7 (Roy, N., et al., (1997), supra; Takahashi, R. et al., (1998) J. Biol. Chem. 273, 7787-7790). However, recently it was shown that a fragment of XIAP encompassing the third BIR domain (BIR3) and RING domain specifically inhibits mammalian caspase-9 (Takahashi, R. et al., (1998), supra). Thus, among mammalian IAPs, different regions of these proteins appear to mediate inhibitory interactions with specific caspases.
Though other types of mechanisms have not been excluded, it has been suggested that Drosophila and baculovirus IAPs also may inhibit some caspases. It has been shown that Drosophila IAP1 (DIAP1) is able to inhibit drICE and DCP-1 in insect cells and in yeast (Kaiser, W. et al., (1998) FEBSLett. 440, 243-248; Hawkins, C, et al,
(1999) Proc. Natl. Acad. Sci. USA 96, 2885-2890). It has also been shown that CpIAP and OpIAP require both BIR and RING domains to inhibit activation of Sf-caspase-1 during baculovirus-induced apoptosis in Sf-21 cells. (Seshagiri, S. & Miller, L. K. (1997) Proc. Natl. Acad. Sci. USA 94, 13606-13611.)
Interestingly, a group of apoptosis-inducing genes which encode IAP- binding proteins has been identified in Drosophila, including reaper , hid, and grim (White, E. & Cipriani, R. (1989) Proc. Natl. Acad. Sci. USA 86, 9886-9890). The Reaper, Hid, and Grim proteins contain a homologous -14 amino acid N-terminal domain which is both necessary and sufficient for binding DIAPl and for inducing apoptosis (Vucic, D., et al., (1991) Proc. Natl. Acad. Sci. USA 94, 10183-10188; Vucic, D., et al, (1998) Mo/. Cell. Biol. 18, 3300-3309). Though initially controversial (reviewed in Deveraux, Q. & Reed, J. C. (1998) Genes Dev. 13, 239-252; Miller, L. (1999) Trends in Cell Biology 9, 323-328), recent data suggest that Reaper, Hid, and Grim induce apoptosis by inhibiting IAPs thus interfering with IAP -mediated suppression of caspases (Wang, S., et al., (1999) Cell 98, 453-463).
SUMMARY OF THE INVENTION
The invention provides a cDNA for an Inhibitor of Apoptosis Protein ("IAP") from Spodoptera frugiperda (fall armyworm) (SEQ ID NO:l), as well as nucleic acids that are 85% or more identical to that cDNA. Further, the invention provides polypeptides that are at least 90% identical to a polypeptide encoded by SEQ ID NO:l (the polypeptide is SEQ ID NO:3). In preferred embodiments, the polypeptides are at least 95% identical to SEQ ID NO:3.
The invention further provides host cells comprising recombinant expression cassettes comprising a promoter operably linked to a polynucleotide at least 85% identical to SEQ ID NO:l, at least 95% identical to SEQ ID NO:l, or that comprises SEQ ID NO: 1. The promoter can be inducible or can be constitutive. The host cell can be an insect cell, a plant cell, a mammalian cell. The invention provides recombinant expression cassettes comprising polynucleotides that are 85% or more identical to, 95% or more identical to, or that comprises SEQ ID NO: 1. The recombinant expression cassette will typically comprise a promoter, which promoter can be inducible or can be constitutive.
The invention further provides recombinant baculoviruses which have been engineered to contain a nucleic acid which is 85% or more identical to SEQ ID NO:l, which is 95% or more identical to SEQ ID NO:l, or which comprises SEQ ID NO: 1. The invention further provides transgenic plants which contain a nucleic acid which is 85% or more identical to SEQ ID NO:l, which is 95% or more identical to SEQ ID NO:l, or which comprises SEQ ID NO:l.
The invention further provides in vitro methods of assaying for compounds capable of specifically binding to an IAP, wherein the method comprises combining an IAP with a test compound and assaying whether the test compound specifically binds to the IAP, where the IAP has a sequence at least 90% or more identical to SEQ ID NO:3. In preferred embodiments, the IAP has a sequence at least 95% identical to SEQ D NO:3. The IAP can be immobilized on a solid support or can be in an aqueous solution. In some embodiments, the test compound can be bound to a solid support and contacted with the IAP.
The invention further provides in vitro methods of assaying for modulators of IAP activity wherein the method comprises combining an LAP with a test compound and assaying whether the test compound can increase or decrease IAP binding specifically to a capsase polypeptide. The IAP can be immobilized on a solid support or can be in an aqueous solution. In some embodiments, the test compound can be bound to a solid support and contacted with the LAP.
The invention further provides an in vitro method of assaying for the presence of IAP cDNA comprising hybridizing said cDNA to a nucleic acid 85% or more identical to SEQ ID NO:l or to a contiguous portion of SEQ ID NO:l at least 20 nucleotides in length and detecting hybridization of the cDNA and the nucleic acid, wherein detection of said hybridization is indicative of the presence of said LAP cDNA. The method further provides an in vitro method of assaying for the presence of an IAP comprising binding the IAP with an antibody which specifically binds said IAP, or with a fragment of said antibody which retains specificity for said LAP, and detecting said binding, wherein said detection is indicative of the presence of the IAP. The detection can be by an ELISA, a Western blot, or other methods known in the art.
DESCRIPTION OF THE SPECIFIC EMBODIMENTS INTRODUCTION Apoptosis, or programmed cell death, is an essential process for normal development and homeostasis in multicellular organisms. It plays an important role in disease resistance in organisms as diverse as insects, plants and higher animals, including mammals. In insects, for example, resistance to viral infection includes apoptosis of infected cells, thereby limiting the spread of the invading pathogen. Similarly, in plants, apoptosis of infected cells limits the ability of viral and other infections to spread. This tendency of plants to react to infection by apoptosis of infected cells is in fact exploited by some fungi to create lesions exposing plant tissue more susceptible to fungal invasion. In mammals, such as humans, apoptosis kills cells which have undergone damage to their DNA when they go through the G2/M checkpoint. Many cancers are able to grow because they are able to avoid this control mechanism. Thus, the ability to modulate apoptosis (that is, to increase or to decrease it at will) is useful for modulating the ability of plants and of insects and other animals to pathogens and cancer,
Spodoptera frugiperda (fall armyworm) is a lepidopteran host of the Autographa Californica Nuclear Polyhedrosis Virus (AcMNPV), a member of the baculovirus family. Despite extensive use of S. frugiperda-deήved cells for studies of apoptosis-regulation by baculoviruses (reviewed in (Miller, L. (1999) Trends in Cell Biology 9, 323-328)), no endogenous apoptosis-regulating genes have yet been identified in these insect cells, with the exception of Sf-caspases-1 (Ahmad, M., Srinivasula, S., Wang, L., Litwack, G., Fernandes-Alnemri, T. & Alnemri, E. (1997) J. Biol. Chem. 272, 1421-1424).
The present invention demonstrates the cloning and characterization of a cellular IAP from S. frugiperda (SflAP). SflAP has been deposited with GenBank and will be publicly available after the filing of this specification under accession number AF186378. SflAP shares considerable sequence similarity with baculoviral IAPs
(vIAPs), suggesting these viruses acquired their vIAP genes from host cells. Analysis of the SflAP and CpIAP proteins indicates that they are direct inhibitors of mammalian caspase-9, suggesting evolutionary conservation of IAP-family protein functions and providing an explanation for previous reports that baculovirus IAPs can inhibit apoptosis induced by many stimuli in mammalian cells (Hawkins, C. J., Uren, A. G., Hacker, G., Medcalf, R. L. & Vaux, D. L. (1996) Proc. Natl. Acad. Sci. USA 93, 13786-13790; Hawkins, C, Ekert, P., Uren, A., Holmgreen, S. & Vaux, D. (1998) Cell Death and Differentiation 5, 569-576; Uren, A. G., Pakusch, M., Hawkins, C. L, Puls, K. L. & Vaux, D. L. (1996) Proc. Natl. Acad. Sci. USA 93, 4974-4978). Other IAPs are available in GenBank under accession numbers U45880 (human),U75285 (human),U45879 (human), U45878 (human), NM 009689 (mouse), NM 009688 (mouse), L05494 (baculovirus), and L224564 (baculovirus).
Peptides corresponding the N-terminal IAP -binding domain of Grim negate the ability of SflAP and CpIAP to inhibit mammalian caspases in vitro, providing evidence that mechanisms similar to those described in Drosophila may be used to regulate the IAPs of Spodoptera frugiperda and baculoviruses.
The IAPs of the invention provide a convenient new way to screen for compounds which can modulate apoptosis. Additionally, recombinant viruses encoding IAPs of the invention can be used to infect undesirable insects. The IAPs then decrease the ability of the insects to limit the resulting infection, with increased mortality. Further, IAPs of the invention can be used to transfect plants to render the plants less susceptible to fungi and other organisms which exploit the normal apoptosis response of the plant to render it more vulnerable to invasion. Further, the IAPs of the invention can be used in animals to combat various disorders in which apoptosis plays a role. In preferred embodiments, the animal is a mammal. In particularly preferred uses, the mammal is a human.
The invention can be exploited in a variety of ways. Polypeptides of the invention can be directly administered as therapeutic agents. For use in animals, such as humans, the polypeptides can be administered intravenously, or they can be encapsulated and administered orally. Cells can be transfected with antisense oligonucleotides to bind to IAP-encoding nucleic acids and block their expression. Small chemical compounds which block the binding of IAPs to caspases can be used to interfere with the normal activity of IAPs. The IAPs of the invention can also be used in vitro to monitor for expression of IAP cDNA. Conveniently, this can be done by immobilizing nucleic acid of an LAP of the invention on a solid substrate, such as a "chip," permitting the nucleic acid to act as a probe to screen a cDNA library or cDNA from a sample of interest. Typically, the length of the nucleic acid from the IAP of the invention used as a probe is chosen to be sufficiently long to permit specific hybridization to a cDNA of a IAP of the invention as opposed to other IAPs. Conveniently, such probes are 20 nucleotides or more, or 25, 30, 35, 40, 45, 50, or even more in length, to permit specific detection of the target cDNAs.
In another set of embodiments, the IAPs of the invention can be used to detect and monitor the presence of IAPs in a sample. Typically, antibodies are generated against an IAP of the invention. Depending on the purpose of the assays, the antibodies can be such that they detect all IAPs, or the antibodies can be absorbed against other known IAPs to eliminate antibodies which recognize IAPs other than those of the invention. Methods of generating antibodies against antigens are well known in the art. Typically, monoclonal antibodies are preferred. Fragments of antibodies which retain binding specificity for the IAP can also be used. Fragments such as single chain Fvs (scFvs), disufide stabilized Fvs (dsFvs), Fabs, and Fab's are well known in the art. Assays employing such antibodies, such as ELISAs and Western blots, are also well known in the art.
DEFINITIONS
"IAP" refers generally to an inhibitor of apoptosis protein and, more specifically herein, to an inhibitor of apoptosis protein of the invention. Which use is intended will be clear in context. IAPs of the invention typically are at least substantially identical to SEQ ID NO:3. "SflAP" specifically denotes an IAP of the invention cloned from Spodoptera frugiperda (fall armyworm). All cellular IAPs contain one to three copies of a baculoviral inhibitory repeat (BIR) domain and most also contain a RING domain located near their C-termini. SflAP contains two BIR domains, followed by a RING domain near its C- terminus. Within the BIR and RING regions, SflAP shares 85% amino acid identity (90% similarity) with baculoviral CpIAP and 70% identity (80% similarity) with OpIAP.
"Apoptosis" refers to programmed cell death. It is an essential process for normal development and homeostasis in multicellular organisms such as mammals, insects and plants. Apoptosis differs from general cell death as from a toxin or ischemic event in that the cell is shutting down according to a controlled pattern of events.
" Apoptosis-inducing chemical" refers to a chemical that promotes programmed cell death. The chemical can be a administered directly to the plant or indirectly by secretion of a pathogen.
"Heterologous gene" refers to a gene introduced into a host cell via recombinant technology where that gene is either not naturally present in the cell or represents an additional copy of an endogenous gene or is operably linked to a promoter that is not normally found in association with the gene in the host cell. "Inducible plant promoter" refers to a promoter which directs expression of a gene where the level of expression is alterable by factors such as temperature, pH, transcription factors and chemicals. "Insecticidal protein" refers to a diverse group of compounds that are lethal to insects when ingested. Examples include the crystal proteins or delta endotoxins from Bacillus thuringiensis.
"Viral plant disease resistance" refers to the ability of a plant to prevent or inhibit a viral pathogen from successfully infecting it.
"Operably linked" refers to nucleotide sequences which are joined in such a manner that their individual function complements each other. Examples are promoters, transcription terminators, enhancers or activators and heterologous genes which when transcribed and if appropriate to translate will produce a functional product, i.e. a protein, ribozyme or anti-sense construct.
"Plant" includes whole plants, plant organs (e.g., leaves, stems, roots, etc.), seeds and plant cells and progeny of same. The class of plants which can be used in the methods of the invention is generally as broad as the class of higher plants amenable to transformation techniques, including both monocotyledonous and dicotyledonous plants.
"Plant pathogens" refer to fungi, bacteria, virus and insects that infect plants and have negative effects on their growth and health.
"Promoter" refers to a region of DNA involved in binding the RNA polymerase to initiate transcription. "Transformation rate" refers to the percent of cells that are successfully incorporate a heterologous gene into its genome and survive.
"Transfecting" refers to the process of introducing a heterologous gene into a cell.
The term "protein" is used herein interchangeably with "polypeptide" and "peptide."
"Nucleic acid" refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. The term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non- naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs). Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al. (1991) Nucleic Acid Res . 19:5081; Ohtsuka et al. (1985) J Biol. Chem. 260:2605-2608; Rossolini et al. (1994) Mo/. Cell. Probes 8:91-98). The term nucleic acid is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and polynucleotide.
A polynucleotide sequence comprising a fusion protein of the invention hybridizes under stringent conditions to each of the nucleotide sequences encoding each individual polypeptide of the fusion protein. The polynucleotide sequences encoding the individual polypeptides of the fusion polypeptide therefore include conservatively modified variants, polymorphic variants, alleles, mutants, subsequences, and interspecies homologs.
"Percentage of sequence identity" is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
The term "substantial identity" of polynucleotide sequences means that a polynucleotide comprises a sequence that has at least 85% sequence identity. Alternatively, percent identity can be any integer from 85% to 100%. More preferred embodiments include at least: 85%, 90%, 95%, or 99% or higher, compared to a reference sequence using the programs described herein; preferably BLAST using standard parameters, as described below. One of skill will recognize that these values can be appropriately adjusted to determine corresponding identity of proteins encoded by two nucleotide sequences by taking into account codon degeneracy, amino acid similarity, reading frame positioning and the like. "Substantial identity" of amino acid sequences for these purposes normally means sequence identity of at least 87%. Preferred percent identity of polypeptides can be any integer from 87% to 100%. More preferred embodiments include at least 87%, 90%, 95%, or 99% identity. Polypeptides which are "substantially similar" share sequences as noted above except that residue positions which are not identical may differ by conservative amino acid changes. Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur- containing side chains is cysteine and methionine. Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, aspartic acid-glutamic acid, and asparagine- glutamine. Optimal alignment of sequences for comparison may be conducted by the local identity algorithm of Smith and Waterman (1981) Add. API. Math. 2:482, by the identity alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc. Natl. Acad. Sci. (U.S.A.) 85: 2444, by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, WI), or by inspection.
A preferred example of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402 and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff ( 1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
Another indication that nucleotide sequences are substantially identical is if two molecules hybridize to each other, or to a third nucleic acid, under moderately, and preferably highly, stringent conditions. Stringent conditions are sequence dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques in Biochemistry and Molecular Biology—Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays" (1993) (Elsevier Science, Inc., New York). Generally, stringent conditions are selected to be about 5-10°C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., 10 to 50 nucleotides) and at least about 60°C for long probes (e.g., greater than 50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal is at least two times background, preferably 10 times background hybridization.
Exemplary stringent hybridization conditions can be as following: 50% formamide, 5x SSC, and 1% SDS, incubating at 42°C, or, 5x SSC, 1% SDS, incubating at 65°C, with wash in 0.2x SSC, and 0.1% SDS at 65°C. For the purpose of the invention, suitable "moderately stringent conditions" include, for example, prewashing in a solution of 5 X SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridizing at 50°C-65°C, 5X SSC overnight, followed by washing twice at 65°C for 20 minutes with each of 2X, 0.5X and 0.2X SSC (containing 0.1% SDS). Such hybridizing DNA sequences are also within the scope of this invention.
SCREENING FOR IAP BINDING ACTIVITY
The invention provides in vitro and in vivo methods of assaying for a modulator of IAP activity by identifying molecules that specifically bind an LAP, thereby affecting its activity. While the invention is not limited by what means the IAP activity is inhibited, specific embodiments include assaying for IAP binding to members of the caspase family, as described herein. The methods of the invention also include screening for antibodies directed to an IAP or small molecule binders of IAPs. To assay for specific binding of a putative modulatory molecule, the IAP can be in solution or can be attached to a fixed substrate. In some embodiments, an IAP is fixed to a solid substrate for high throughput screenings or column chromatography.
High-Throughput Screening of Candidate Agents that Bind IAPs of the invention
Conventionally, new chemical entities with useful properties are generated by identifying a chemical compound (called a "lead compound") with some desirable property or activity, creating variants of the lead compound, and evaluating the property and activity of those variant compounds. The current trend is to shorten the time scale for all aspects of drug discovery. Because of the ability to test large numbers quickly and efficiently, high throughput screening (HTS) methods are replacing conventional lead compound identification methods. In one embodiment, high throughput screening methods are used to identify compositions that specifically bind an IAP and modulate its activity. This involves providing a library containing a large number of potential compounds (candidate compounds). Such "combinatorial chemical libraries" are then screened in one or more assays to identify those library members (particular chemical species or subclasses) that bind IAP. The compounds thus identified can serve as conventional "lead compounds" or can themselves be used as potential or actual reagents. Combinatorial chemical libraries
A combinatorial chemical library is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis by combining a number of chemical "building blocks" such as reagents. For example, a linear combinatorial chemical library such as a polypeptide library is formed by combining a set of chemical building blocks called amino acids in every possible way for a given compound length (i.e., the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks. For example, the systematic, combinatorial mixing of 100 interchangeable chemical building blocks can result in the theoretical synthesis of 100 million tetrameric compounds or 10 billion pentameric compounds (see, e.g., Gallop (1994) 37:1233-1250).
Preparation and screening of combinatorial chemical libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Patent 5,010,175, Furka (1991) Int. J. Pept. Prot. Res., 37:487-493, Houghton (1991) Nature, 354: 84-88). Peptide synthesis is by no means the only approach envisioned and intended for use with the present invention. Other chemistries for generating chemical diversity libraries can also be used. Such chemistries include, but are not limited to: peptoids (PCT Publication No WO 91/19735, 26 Dec. 1991), encoded peptides (PCT Publication WO 93/20242, 14 Oct. 1993), random bio-oligomers (PCT Publication WO 92/00091, 9 Jan. 1992), benzodiazepines (U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs (1993) Proc. Nat. Acad. Sci. USA 90: 6909-6913), vinylogous polypeptides (Hagihara (1992) J Amer. Chem. Soc. 114: 6568), nonpeptidal peptidomimetics with a Beta- D- Glucose scaffolding (Hirschmann (1992)J Amer. Chem. Soc. 114: 9217-9218), analogous organic syntheses of small compound libraries (Chen (1994) J. Amer. Chem. Soc. 116: 2661), ohgocarbamates (Cho (1993) Science 261 : 1303), and/or peptidyl phosphonates (Campbell (1994) J. Org. Chem. 59: 658). See, generally, Gordon (1994) J. Med. Chem. 37:1385, nucleic acid libraries, peptide nucleic acid libraries (see, e.g., U.S. Patent 5,539,083) antibody libraries (see, e.g., Vaughn (1996) Nature Biotechnol 14:309-314), and PCT/US96/10287), carbohydrate libraries (see, e.g., Liang (1996) Science 274:1520-1522, and U.S. Patent
5,593,853), and small organic molecule libraries (see, e.g., benzodiazepines, Baum (1993) C&EN, Jan 18, page 33, isoprenoids U.S. Patent 5,569,588, thiazolidinones and metathiazanones U.S. Patent 5,549,974, pyrrolidines U.S. Patents 5,525,735 and 5,519,134, morpholino compounds U.S. Patent 5,506,337, benzodiazepines 5,288,514). Devices for the preparation of combinatorial libraries are commercially available; see, e.g., 357 MPS, 390 MPS, Advanced Chem Tech, Louisville KY; Symphony, Rainin, Wobum, MA; 433A Applied Biosystems, Foster City, CA; 9050 Plus, Millipore, Bedford, MA; the Ultra-high Throughput Screening System (UHTSS™) capable of screening over 100,000 compounds per day, Aurora BioSciences, San Diego, CA.
A number of well known robotic systems have also been developed for solution phase chemistries. These systems include automated workstations like the automated synthesis apparatus developed by Takeda Chemical Industries, LTD. (Osaka, Japan) and many robotic systems utilizing robotic arms (Zymate II, Zymark Corporation, Hopkinton, MA; Orca, Hewlett-Packard, Palo Alto, C A.) which mimic the manual synthetic operations performed by a chemist. Any of the above devices are suitable for use with the present invention. The nature and implementation of modifications to these devices (if any) so that they can operate as discussed herein will be apparent to persons skilled in the relevant art. In addition, numerous combinatorial libraries are themselves commercially available (see, e.g., ComGenex, Princeton, NJ; Tripos, Inc., St. Louis, MO; 3D Pharmaceuticals, Exton, PA; Martek Biosciences, Columbia, MD).
High throughput assays of chemical libraries
Any of the assays for compounds capable of binding IAPs and/or modulating IAP activity described herein are amenable to high throughput screening. These systems (examples of which are described above) can automate entire procedures including all sample and reagent pipetting, liquid dispensing, timed incubations, and final readings of the microplate in detector(s) appropriate for the assay. These configurable systems provide high throughput and rapid start up as well as a high degree of flexibility and customization.
Attaching of the IAP to a Solid Support IAP, whether full length, or subsequences thereof (e.g., a BIR domain or
RING domain) can be bound to a variety of solid supports. Solid supports that can be used in the methods of the invention include polymer beads, membranes (e.g., nitrocellulose or nylon), microtiter dishes (e.g., PVC or polystyrene), test tubes, dip sticks (e.g., glass, PVC, polypropylene, and the like), micro fuge tubes, glass, silica, plastic, metallic beads, or substrates such as paper.
Adhesion of a IAP "target" molecule to the solid support can be direct (i.e. directly contacting the solid support) or indirect (a particular compound or compounds are bound to the support and IAP binds to this compound rather than the solid support). Immobilization of compounds can be covalent, e.g., utilizing single reactive thiol groups of cysteine residues (see, e.g., Colliuod (1993) Bioconjugate Chem. 4:528-536). Alternatively, compounds can be immobilized non-covalently but specifically, e.g., via immobilized antibodies (see above), as described by Schuhmann (1991) Adv. Mater. 3:388-391; Lu (1995) Anal. Chem. 67:83-87; or, the biotin/strepavidin system, see, e.g., Iwane (1991) Biophys. Biochem. Res. Comm. 230:76-80); or metal chelating, e.g., Langmuir-Blodgett films (Ng (1995) Langmuir 11:4048-4055; Schmitt (1996) Angew. Chem. Int. Ed. Engl. 35:317-20; Frey (1996) Proc. Natl. Acad. Sci. USA 93:4937-41; Kubalek (1994) J. Struct. Biol. 113:117-123; or, metal-chelating self-assembled monolayers, see, e.g., Sigal (1996) Anal. Chem. 68:490-497, for binding of polyhistidine fusion proteins.
Indirect binding of IAP can be achieved using a variety of linkers, many of which are commercially available. The reactive ends can be any of a variety of functionalities, e.g., amino reacting ends such as N-hydroxysuccinimide (NHS) active esters, aldehydes, epoxides, isocyanate, and nitroaryl halides; and thiol reacting ends such as pyridyl disulfides, maleimides, and active halogens. The heterobifunctional crosslinking reagents have two different reactive ends, e.g. , an amino-reactive end and a thiol-reactive end, while homobifunctional reagents have two similar reactive ends, e.g., bismaleimidohexane (BMH) which permits the cross-linking of sulfhydryl-containing compounds. The spacer can be aliphatic or aromatic. Examples of commercially available homobifunctional cross-linking reagents include, but are not limited to, the imidoesters such as dimethyl adipimidate dihydrochloride (DMA), dimethyl pimelimidate dihydrochloride (DMP); and dimethyl suberimidate dihydrochloride (DMS). Heterobifunctional reagents include commercially available active halogen-NHS active esters coupling agents such as N-succinimidyl bromoacetate and N-succinimidyl (4- iodoacetyl)aminobenzoate (SIAB) and the sulfosuccinimidyl derivatives such as sulfosuccinimidyl(4-iodoacetyl)aminobenzoate (sulfo-SIAB) (Pierce Chemicals, Rockford, IL). Another group of coupling agents is the heterobifunctional and thiol cleavable agents such as N-succinimidyl 3-(2-pyridyidithio)propionate (SPDP) (Pierce). By manipulating the solid support and the mode of attachment of the target
IAP molecule to the support, it is possible to control the orientation of the IAP. Thus, for example, it is possible to attach the IAP molecule to a surface in a manner that leaves a "tail" free to interact with other molecules, e.g., a IAP fusion protein with a non-IAP tag (e.g., FLAG, myc, GST, polyHis, etc.) for attachment to the column. Once bound there are a variety of assay formats that can be used to screen for modulators of the IAP. For example, molecules that interact with a IAP binding domain can be identified by attaching the IAP to a solid support, contacting a second molecule with the support coated with IAP, and detecting the binding of the second molecule to the IAP. Molecules that interact or bind with the target are then eluted, thereby isolating molecules that interacted with the LAP.
Assays
A variety of different assays for detecting compounds and compositions capable of binding IAP can be used in this invention. For a general description of different formats for binding assays, see BASIC AND CLINICAL IMMUNOLOGY, 7th Ed. (D. Stiles and A. Terr, ed.)(1991); ENZYME IMMUNOASSAY, E.T. Maggio, ed., CRC Press, Boca Raton, Florida (1980); and "Practice and Theory of Enzyme Immunoassays" in P. Tijssen, LABORATORY TECHNIQUES IN BIOCHEMISTRY AND MOLECULAR BIOLOGY, Elsevier Science Publishers, B.V. Amsterdam (1985). In competitive binding assays, the test compound competes with a second compound (known to specifically bind IAP) for specific binding sites on the IAP molecule attached to the solid support. Binding is determined by assessing the amount of second compound associated with the fixed IAP molecule. The amount of second compound associated with IAP is inversely proportional to the ability of a test compound to compete in the binding assay.
The amount of inhibition or stimulation of binding of a labeled second compound by the test compound depends on the binding assay conditions and on the concentrations of labeled analyte and test compounds used. Under specified assay conditions, a test compound is said to be capable of inhibiting the binding of a second compound to a IAP target compound if the amount of bound second compound is decreased by 50% or more compared to a control (no test compound) sample.
Alternatively, various known or unknown compounds, including proteins, carbohydrates, and the like, can be assayed for their ability to directly, and specifically, bind to the target immobilized IAP. In one embodiment, samples from various tissues are contacted with IAP. In another embodiment, small molecule libraries and high throughput screening methods are used to identify compounds that bind to the target. The IAP -binding molecules is then eluted using any method, e.g., column chromatography techniques. Isolation of nucleic acids of the invention
The nucleic acids of the invention can be used to prepare recombinant proteins and transgenic organisms for a number of purposes. Generally, the nomenclature and the laboratory procedures in recombinant DNA technology described below are those well known and commonly employed in the art. Standard techniques are used for cloning, DNA and RNA isolation, amplification and purification. Generally enzymatic reactions involving DNA ligase, DNA polymerase, restriction endonucleases and the like are performed according to the manufacturer's specifications. These techniques and various other techniques are generally performed according to Sambrook et al,
Molecular Cloning - A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, (1989) or Current Protocols in Molecular Biology Volumes 1-3, John Wiley & Sons, Inc. (1994-1998).
The isolation of nucleic acids may be accomplished by a number of techniques. For instance, oligonucleotide probes based on the sequences disclosed here can be used to identify the desired gene in a genomic DNA library. To construct genomic libraries, large segments of genomic DNA are generated by random fragmentation, e.g. using restriction endonucleases, and are ligated with vector DNA to form concatemers that can be packaged into the appropriate vector.
The genomic library can then be screened using a probe based upon the sequence of a cloned IAP gene disclosed here. Probes may be used to hybridize with genomic DNA sequences to isolate homologous genes in the same or different species. Alternatively, antibodies raised against a polypeptide such as an IAD of the invention can be used to screen an expression library. Making antibodies against an antigen of choice is well known in the art.
Alternatively, the nucleic acids of interest can be amplified from nucleic acid samples using amplification techniques. For instance, polymerase chain reaction (PCR) technology can be used to amplify the sequences of IAP genes directly from genomic DNA or from cDNA libraries. PCR and other in vitro amplification methods may also be useful, for example, to clone nucleic acid sequences that code for proteins to be expressed, to make nucleic acids to use as probes for detecting the presence of the desired RNA in samples, for nucleic acid sequencing, or for other purposes. For a general overview of PCR see PCR Protocols: A Guide to Methods and Applications. (Innis, M, Gelfand, D., Sninsky, J. and White, T., eds.), Academic Press, San Diego (1990). Appropriate primers and probes for identifying sequences from tissues are generated from comparisons of the sequences provided here (e.g. SEQ ID NO: 1, etc.).
Polynucleotides may also be synthesized by well-known techniques as described in the technical literature. See, e.g., Carruthers et al, Cold Spring Harbor Symp. Quant. Biol. 47:411-418 (1982), and Adams et al, J. Am. Chem. Soc. 105:661 (1983). Double stranded DNA fragments may then be obtained either by synthesizing the complementary strand and annealing the strands together under appropriate conditions, or by adding the complementary strand using DNA polymerase with an appropriate primer sequence.
Expression in prokaryotes and eukaryotes To obtain high level expression of a cloned gene, such as polynucleotides encoding IAPs of the invention, one typically subclones polynucleotides encoding the IAP into an expression vector that contains a strong promoter to direct transcription, a transcription/translation terminator, and if for a nucleic acid encoding a protein, a ribosome binding site for translational initiation. Suitable bacterial promoters are well known in the art and described, e.g., in Sambrook et al. and Ausubel et al. Bacterial expression systems for expressing the IAP are available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et al, Gene 22:229-235 (1983); Mosbach et al, Nature 302:543-545 (1983). Kits for such expression systems are commercially available. Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
Selection of the promoter used to direct expression of a heterologous nucleic acid depends on the particular application. The promoter is preferably positioned about the same distance from the heterologous transcription start site as it is from the transcription start site in its natural setting. As is known in the art, however, some variation in this distance can be accommodated without loss of promoter function.
In addition to the promoter, the expression vector typically contains a transcription unit or expression cassette that contains all the additional elements required for the expression of the IAP encoding nucleic acid in host cells. A typical expression cassette thus contains a promoter operably linked to the nucleic acid sequence encoding IAP and signals required for efficient polyadenylation of the transcript, ribosome binding sites, and translation termination. Additional elements of the cassette may include enhancers and, if genomic DNA is used as the structural gene, introns with functional splice donor and acceptor sites.
In addition to a promoter sequence, the expression cassette should also contain a transcription termination region downstream of the structural gene to provide for efficient termination. The termination region may be obtained from the same gene as the promoter sequence or may be obtained from different genes.
The particular expression vector used to transport the genetic information into the cell is not particularly critical. Any of the conventional vectors used for expression in eukaryotic or prokaryotic cells may be used. Standard bacterial expression vectors include plasmids such as pBR322 based plasmids, pSKF, pET23D, and fusion expression systems such as GST and LacZ. Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, e.g., c-myc. Expression vectors containing regulatory elements from eukaryotic viruses are typically used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus. Other exemplary eukaryotic vectors include pMSG, pAV009/A+, pMTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the CMV promoter, SV40 early promoter, SV40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
Some expression systems have markers that provide gene amplification such as thymidine kinase and dihydrofolate reductase.
Alternatively, high yield expression systems not involving gene amplification are also suitable, such as using a baculovirus vector in insect cells, with a LAP encoding sequence under the direction of the polyhedrin promoter or other strong baculovirus promoters. The elements that are typically included in expression vectors also include a replicon that functions in E. coli, a gene encoding antibiotic resistance to permit selection of bacteria that harbor recombinant plasmids, and unique restriction sites in nonessential regions of the plasmid to allow insertion of eukaryotic sequences. The particular antibiotic resistance gene chosen is not critical, any of the many resistance genes known in the art are suitable. The prokaryotic sequences are preferably chosen such that they do not interfere with the replication of the DNA in eukaryotic cells, if necessary.
Standard transfection methods are used to produce bacterial, mammalian, yeast or insect cell lines that express large quantities of the IAP, which are then purified using standard techniques (see, e.g., Colley et al, J. Biol. Chem. 264:17619-17622 (1989); Guide to Protein Purification, in Methods in Enzymology, vol. 182 (Deutscher, ed., 1990)). Transformation of eukaryotic and prokaryotic cells are performed according to standard techniques (see, e.g., Morrison, J. Bact. 132:349-351 (1977); Clark-Curtiss & Curtiss, Methods in Enzymology 101:347-362 (Wu et al, eds, 1983).
Any of the well-known procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, liposomes, microinjection, plasma vectors, viral vectors and any of the other well known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell (see, e.g., Sambrook et al, supra). It is only necessary that the particular genetic engineering procedure used be capable of successfully introducing at least one gene into the host cell capable of expressing IAP.
After the expression vector is introduced into the cells, the transfected cells are cultured under conditions favoring expression of LAP, which is recovered from the culture using standard techniques. A number of procedures can be employed when recombinant polypeptides are being purified. For example, proteins having established molecular adhesion properties can be reversible fused to the polypeptides. With the appropriate ligand, the polypeptides can be selectively adsorbed to a purification column and then freed from the column in a relatively pure form. The fused protein is then removed by enzymatic activity. Finally the polypeptides could be purified using immunoaffinity columns.
Production of trans genie plants The IAPs of the invention can be used for increasing plant disease resistance. More specifically, IAPs can be used to delay, suppress or inhibit an apoptosis response in plants. Many plant pathogens, in particular, non-viral plant pathogens, induce apoptosis in plants as a part of the infection process. When a plant is transformed with IAP of the invention, the plant will not be as susceptible to pathogen induced apoptosis and a resistance phenotype is generated.
DNA constructs of the invention may be introduced into the genome of the desired plant host by a variety of conventional techniques. For example, the DNA construct may be introduced directly into the genomic DNA of the plant cell using techniques such as electroporation and microinjection of plant cell protoplasts, or the DNA constructs can be introduced directly to plant tissue using ballistic methods, such as DNA particle bombardment.
Microinjection techniques are known in the art and well described in the scientific and patent literature. The introduction of DNA constructs using polyethylene glycol precipitation is described in Paszkowski et al. (1984) EMBO J. 3:2717-2722. Electroporation techniques are described in Fromm et al. (1985) Proc. Natl. Acad. Sci. USA 82:5824. Ballistic transformation techniques are described in Klein et al. (1987) Nature 327:70-73.
Alternatively, the DΝA constructs may be combined with suitable T-DΝA flanking regions and introduced into a conventional Agrobacterium tumefaciens host vector. The virulence functions of the Agrobacterium tumefaciens host will direct the insertion of the construct and adjacent marker into the plant cell DΝA when the cell is infected by the bacteria. Agrobacterium tume ά 'eMs-mediated transformation techniques, including disarming and use of binary vectors, are well described in the scientific literature. See, for example Horsch et al. Science 233:496-498 (1984), and Fraley et al. Proc. Natl. Acad. Sci. USA 80:4803 (1983) and Gene Transfer to Plants, Potrykus, ed. (Springer- Verlag, Berlin 1995).
Transformed plant cells which are derived by any of the above transformation techniques can be cultured to regenerate a whole plant which possesses the transformed genotype and thus the desired phenotype such as increased seed mass. Such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium, typically relying on a biocide and/or herbicide marker that has been introduced together with the desired nucleotide sequences. Plant regeneration from cultured protoplasts is described in Evans et al., Protoplasts Isolation and Culture, Handbook of Plant Cell Culture, pp. 124-176, MacMillilan Publishing Company, New York, 1983; and Binding, Regeneration of Plants, Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985. Regeneration can also be obtained from plant callus, explants, organs, or parts thereof. Such regeneration techniques are described generally in Klee et al. Ann. Rev. of Plant Phys. 38:467-486 (1987).
The nucleic acids of the invention can be used to confer desired traits on essentially any plant. Thus, the invention has use over a broad range of plants, including species from the genera Anacardium, Arachis, Asparagus, Atropa, Avena, Brassica, Citrus, Citrullus, Capsicum, Carthamus, Cocos, Coffea, Cucumis, Cucurbita, Daucus, Elaeis, Fragaria, Glycine, Gossypium, Helianthus, Heterocallis, Hordeum, Hyoscyamus, Lactuca, Linum, Lolium, Lupinus, Lycopersicon, Malus, Manihot, Majorana, Medicago, Nicotiana, Olea, Oryza, Panieum, Pannesetum, Persea, Phaseolus, Pistachia, Pisum, Pyrus, Prunus, Raphanus, Ricinus, Secale, Senecio, Sinapis, Solanum, Sorghum, Theobromus, Trigonella, Triticum, Vicia, Vitis, Vigna, and Zea.
One of skill will recognize that after the expression cassette is stably incorporated in transgenic plants and confirmed to be operable, it can be introduced into other plants by sexual crossing. Any of a number of standard breeding techniques can be used, depending upon the species to be crossed.
Using known procedures one of skill can screen for plants of the invention by detecting the increase or decrease of IAP mRNA or protein in transgenic plants. Means for detecting and quantitating mRNAs or proteins are well known in the art. In addition, modulation of apoptosis in plant cells can be monitored. Apoptosis in plants follows an analogous pathway as in animal cells. Two molecular analytic tools are available and established to determine when apoptosis is occurring in plants (as well as animal cells) as distinguished from cell death due to lethal toxins (such as toxic levels of Fe2SO4) or hypoxic conditions. The first is demonstration of an orderly fragmentation of the cellular DNA. These are called DNA ladders and are readily analyzed using a variety of electrophoretic techniques. The specific gel or running conditions are not critical. Suitable electrophoretic conditions are provided by Wang et al. (1996), Cell, 8:375-391.
Alternatively, fragmentation of DNA during apoptosis can be detected in situ by reagents that react with exposed 3'hydroxyl groups on the nucleosomal units. The assay procedure involves end labeling the DNA fragments by terminal deoxynucleotidyl transferase (TdT) with UTP conjugated to a detectable marker. The method is termed (TUNEL) and more details of this method can be found in Wang et al. (supra). Finally one can visually identify apoptotic bodies containing fragmented DNA which is one of the hallmarks of apoptosis.
One of skill can also assay for disease resistance by traditional methods. These methods involve visual observation of the effects of a pathogen on a host plant. Observable symptoms include wilt, rot, stunted growth, color changes and mycelial growth. The symptoms are scored for their degree of intensity in sufficient repeated trials until statistically meaningful information is generated. The generic experimental parameters for reproducible study of infection and resistance in plants is well known.
Preparation of recombinant plant vectors
To use isolated sequences to transform plants, recombinant DNA vectors suitable for transformation of plant cells are prepared. Techniques for transforming a wide variety of higher plant species are well known and described in the technical and scientific literature. See, for example, Weising et al. Ann. Rev. Genet. 22:421-477 (1988). A DNA sequence coding for the desired polypeptide, for example a cDNA sequence encoding a full length protein, will preferably be combined with transcriptional and translational initiation regulatory sequences which will direct the transcription of the sequence from the gene in the intended tissues of the transformed plant.
For example, for overexpression, a plant promoter fragment may be employed which will direct expression of the gene in all tissues of a regenerated plant. Such promoters are referred to herein as "constitutive" promoters and are active under most environmental conditions and states of development or cell differentiation. Examples of constitutive promoters include the cauliflower mosaic virus (CaMV) 35S transcription initiation region, the 1'- or 2'- promoter derived from T-DNA of Agrobacterium tumafaciens, and other transcription initiation regions from various plant genes known to those of skill. Such genes include for example, ACT 11 from Arabidopsis (Huang et al. Plant Mol. Biol. 33:125-139 (1996)), Cat3 from Arabidopsis (GenBank No. U43147, Zhong et al, Mol. Gen. Genet. 251:196-203 (1996)), the gene encoding stearoyl-acyl carrier protein desaturase from Brassica napus (Genbank No. X74782, Solocombe et al. Plant Physiol. 104:1167-1176 (1994)), GPcl from maize (GenBank No. X15596, Martinez et al J. Mol Biol 208:551-565 (1989)), and Gpc2 from maize (GenBank No. U45855, Manjunath et al, Plant Mol Biol. 33:97-112 (1997)).
Alternatively, the plant promoter may direct expression of nucleic acid in a specific tissue, organ or cell type (i.e. tissue-specific promoters) or may be otherwise under more precise environmental or developmental control (i.e. inducible promoters). Examples of environmental conditions that may effect transcription by inducible promoters include anaerobic conditions, elevated temperature, the presence of light, or sprayed with chemicals/hormones. In a preferred embodiment, the promoter is specifically induced by infection of a pathogen. Tissue-specific promoters can be inducible. Similarly, tissue-specific promoters may only promote transcription within a certain time frame of developmental stage within that tissue. Other tissue specific promoters may be active throughout the life cycle of a particular tissue. One of skill will recognize that a tissue-specific promoter may drive expression of operably linked sequences in tissues other than the target tissue. Thus, as used herein a tissue-specific promoter is one that drives expression preferentially in the target tissue or cell type, but may also lead to some expression in other tissues as well.
A number of tissue-specific promoters can also be used in the invention. For instance, promoters that direct expression of nucleic acids in leaves, roots or flowers are useful for enhancing resistance to pathogens that infect those organs. For expression of a IAP in the aerial vegetative organs of a plant, photosynthetic organ-specific promoters, such as the RBCS promoter (Khoudi, et al, Gene 197:343, 1997), can be used. Root-specific expression of IAP polynucleotides can be achieved under the control of the root-specific ANR1 promoter (Zhang & Forde, Science, 279:407, 1998). Any strong, constitutive promoters, such as the CaMV 35S promoter, can be used for the expression of IAP polynucleotides throughout the plant.
If proper polypeptide expression is desired, a polyadenylation region at the 3'-end ofthe coding region should be included. The polyadenylation region can be derived from the natural gene, from a variety of other plant genes, or from T-DNA.
The vector comprising the sequences (e.g., promoters or coding regions) from genes of the invention will typically comprise a marker gene that confers a selectable phenotype on plant cells. For example, the marker may encode biocide resistance, particularly antibiotic resistance, such as resistance to kanamycin, G418, bleomycin, hygromycin, or herbicide resistance, such as resistance to chlorosulfuron or Basta.
Expression in recombinant Baculovirus
Another use of the IAP polynucleotides is in the construction of recombinant baculoviruses that are useful as insecticides. It is known that apoptosis is one of the mechanisms by which insects defend against baculoviral infection. Thus, recombinant baculoviruses comprising the IAP polynucleotides of the invention can be useful in overcoming this defense mechanism.
The construction of most baculovirus expression vector systems has been based on replacement of the polyhedrin gene or other coding region with a foreign gene under the transcriptional control of the polyhedrin gene promoter or other promoter (Pennock, et al. , Mol. and Cell. Bio. 4:399-406 (1984); and Smith, et al. Molecular and Cell. Biol. 3:2156-2165(1983)).
Baculoviruses are natural pathogens of many agriculturally important insect pests (Wood, and Granados, Ann. Rev. Microbiol 45:69-87 (1991)). There has thus been an increased interest in exploiting recombinant baculoviruses to express foreign proteins which would improve the pesticidal properties of the native baculoviruse (see, e.g. Carbonell et al, Gene 73:409-418 (1988); Hammock, et al, Nature 344:458-461 (1990); Maeda, S., Biochem. Biophys. Res. Comm. 165: 1177-1183 (1989); Maeda, et al, Virol. 184:777-780 (1991) and US Patent No. 5,908,785). Administration of IAP Inhibitors, IAPs, and IAP Nucleic Acids and Anti-IAP Nucleic Acids As Pharmaceuticals
Apoptosis plays a major role in development, viral pathogenesis, cancer, autoimmune diseases and neurodegenerative disorders. Inappropriate increases in apoptosis may cause or contribute to a variety of diseases, including AIDS, neurodegenerative diseases (e.g. Alzheimer's Disease, Parkinson's Disease, Amyotrophic Lateral Sclerosis (ALS), retinitis pigmentosa and other diseases of the retina, myelodysplastic syndrome (e.g., aplastic anemia), toxin-induced liver disease (e.g., alcoholism) and ischemic injury (e.g., myocardial infarction, stroke, and reperfusion injury). In addition, disruption of normally occurring apoptosis has been implicated in the development of some cancers (e.g. follicular lymphoma, p53 carcinomas, and hormone dependent tumors), autoimmune disorders (e.g., lupus erythematosis and multiple sclerosis) and viral infections (e.g., herpes virus, poxvirus, and adenovirus infections). See, e.g., Korneluk, U.S. Patent No. 5,919,912. The invention provides modulators (e.g., inhibitors) of IAP activity and their therapeutic administration. These compounds include those found by the methods of the invention. Modulators that can be used therapeutically also include antibodies and small molecules which bind to IAP to inhibit its ability to bind caspaces. In another embodiment, the modulator is a peptide inhibitor of IAP activity. The peptides, polypeptides and other compositions of the invention are administered with a pharmaceutically acceptable carrier(s) (excipient) to form the pharmacological composition.
Pharmaceutically acceptable carriers and formulations, e.g., for peptides and polypeptides, are known to the skilled artisan and are described in detail in the scientific and patent literature, see e.g., the latest edition of Remington's Pharmaceutical Science, Mack Publishing Company, Easton, PA ("Remington's"); Banga; Putney (1998) Nat. Biotechnol. 16:153-157; Patton (1998) Biotechniques 16:141-143; Edwards (1997) Science 276: 1868-1871; Ho, U.S. Patent No. 5,780,431; Webb, U.S. Patent No. 5,770,700; Goulmy, U.S. Patent No. 5,770,201. The compositions used in the methods of the invention can be delivered alone or as pharmaceutical compositions by any means known in the art, e.g., systemically, regionally, or locally; by intraarterial, intrathecal (IT), intravenous (IV), parenteral, intra-pleural cavity, topical, oral, or local administration, as subcutaneous, intra-tracheal (e.g., by aerosol) or transmucosal (e.g., buccal, bladder, vaginal, uterine, rectal, nasal mucosa). Actual methods for delivering compositions will be known or apparent to those skilled in the art and are described in detail in the scientific and patent literature, see e.g., Remington's.
The pharmaceutical compositions can be administered by any protocol and in a variety of unit dosage forms depending upon the method of administration, whether it is being co-administered a chemotherapeutic agent, and the like. Dosages for typical peptide and polypeptide pharmaceutical compositions are well known to those of skill in the art. Such dosages are typically advisorial in nature and are adjusted depending on a variety of factors, such as the particular therapeutic context, patient health and the like. The amount of composition or peptide adequate to generate the desired response is defined as a "therapeutically effective dose." The dosage schedule and amounts effective for this use, i.e., the "dosing regimen," will depend upon a variety of factors, including the stage of the disease being treated; timing of co-administration of other agents; the general state of the patient's health; the patient's physical status; age; the pharmaceutical formulation, and the like. The dosage regimen also takes into consideration pharmacokinetics, e.g., the peptide pharmaceutical composition's rate of absorption, bioavailability, metabolism, clearance, and the like, see, e.g., Remington.
Dosages can be determined empirically, e.g, by abatement or amelioration of symptoms, or by objective criteria, analysis of blood or histopathology specimens (amount of apoptosis in a biopsy), and the like.
Vectors used for therapeutic administration of IAP-encoding nucleic acids or anti-IAP nucleic acids, such as antisense molecules, may be viral or nonviral. Viral vectors are usually introduced into a patient as components of a virus. Illustrative viral vectors into which one can incorporate nucleic acids include, for example, adenovirus- based vectors (Cantwell (1996) Blood 88:4676-4683; Ohashi (1997) Proc. Nat 7. Acad. Sci USA 94:1287-1292), Epstein-Barr virus-based vectors (Mazda (1997) J. Immunol. Methods 204:143-151), adenovirus-associated virus vectors, Sindbis virus vectors (Strong (1997) Gene Ther. A: 624-627), herpes simplex virus vectors (Kennedy (1997) Brain 120: 1245-1259) and retroviral vectors (Schubert (1997) Curr. Eye Res. 16:656-662). Nonviral vectors encoding products useful in gene therapy can be introduced into an animal by means such as lipofection, biolistics, virosomes, liposomes, immunoliposomes, polycatio nucleic acid conjugates, naked DNA injection, artificial virions, agent-enhanced uptake of DNA, ex vivo transduction. Lipofection is described in e.g., U.S. Patent Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., Transfectam™ and Lipofectin™). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424 and WO 91/16024. Naked DNA genetic vaccines are described in, for example, US Patent No. 5,589,486.
EXAMPLES The following examples are offered by way of illustration, and are not intended to limit the scope of the present invention or appended claims.
Example 1. Cloning of SflAP. mRNA was isolated from Sf-21 cells using a kit from Qiagen. Degenerate primers were designed according to the consensus amino acid sequences between baculoviral IAPs and Drosophila IAPs, 5 ' GC(A C/G/T)GA( A C/G/T)GC( A/C/G/T)GG(A C/G/T)TT(T/C)TT(T/C)TA3 ' and 5 ' AC(A/C/G/T)AC(A/G)TG(A/C/G/T)CC(A/G)C A(A/C/G/T)GG3 ' . RT-PCR was performed using a RT-PCR kit from TakaRa under the following conditions: 94° C for i minute, 42°C for 1.5 minute, 72° for 1 min, for 40 cycles. Amplified fragments were blunted-end cloned into Hindi site of ptzl9, then sequenced. To obtain full-length SflAP cDNAs, 5' RACE and 3' RACE were performed from Sf-21 mRNA using kits from Gibco BRL and TakaRa, respectively, and 5 'CACTTGGTTTTGTCTCCCTGACC3 ' and 5' ACTCAAAGTTGTGTAAAATCTG3' as internal PCR-primers.
Example 2. Plasmid Constructions.
A portion of the full-length SflAP cDNA encompassing the complete open reading frame (ORF) was PCR-amplified and subcloned into the EcoRJ-XhoI sites in pcDNA3-myc and pGEX4T-l vectors for expression in mammalian cells as a myc- epitope tagged protein and in E. coli as a GST-fusion protein, respectively. The complete ORF of CpIAP was subcloned into the EcoRI-EcoRV sites of pcDNA3-myc or the EcoRI-Sall sites in pGEX4T-l. Plasmids encoding fragments of the SflAP and CpIAP, including BIR1+2 (amino acid residues 1-323 for SflAP, residues 1-220 for CpIAP) and RING (residues 324-377 for SflAP and residues 221-275 for CpIAP) were amplified by PCR using primers containing either start or stop codons as appropriate and subcloned into pcDNA3-myc or pGEX4T-l plasmids. Example 3. Protein Expression and Purification. pGEX4T-l -SflAP and pGEX4T-l -CpIAP plasmids were introduced into E. coli strain BL21 (DE3) containing the plasmid pT-Trx. GST fusion proteins were obtained by induction with 0.05 mM IPTG at 25°C for 8 hours, then purified using glutathione-Sepharose, essentially as described (Deveraux, Q., Welsh, K. & Reed, J. Methods of Enzymology in press). Caspases-3, and -7, containing C-terminal His6-tags, and caspase-8 containing an N-terminal His6-tag were purified as described previously (Stennicke, H. R. & Salvesen, G. S. (1997) J. Biol. Chem. 272, 25719-25723; Stennicke, H., et al., (1998) J. Biol. Chem. 273, 27084-27090; Stennicke, H., et al., (1999) J. Biol. Chem. 21 A, 8359-8362). Casρase-9 lacking the CARD domain (ΔCARD-caspase-9) was constructed by truncating the cDNA and introducing a start codon substituting Vail 39. The resulting cDNA was subcloned into pET-23b and expressed in BL21 (DE3), yielding fully processed enzyme when cells were induced using 0.2 mM IPTG at OD600=0.6 for 4 hrs (Stennicke, H., Deveraux, Q., Humke, E., Reed, J., Dixit, V. & Salvesen, G. (1999) J. Biol Chem. 21 A, 8359-8362). All expressed caspases were purified by Ni-chelation affinity-chromatography, as described (Stennicke, H., et al., (1999) J. Biol. Chem. 21 A, 8359-8362; Stennicke, H. R. & Salvesen, G. S. (1997) J. Biol Chem. 272, 25719-25723; Stennicke, H., et al., (1998) supra). Concentrations of purified enzymes were determined from absorbance at 280 nm based on the molar absorption coefficients: caspase-3 (A280 = 26,000M-1 cm-1), caspase-7 (A280= 24,500 M-l cm-1), caspase-9 (A280=30,010M-1 cm-1).
Example 4. Protein binding assay.
[35S]Pro-caspase-9 was in vitro transcribed and translated in the presence of [35S]L-methionine using TNT kit from Promega. Protein were desalted and exchanged into buffer (20 mM HEPES pH 7.5, 10 mM KC1, 1.5 mM MgC12, 1 mM EDTA and 1 mM DTT) with Bio-spin P-6 columns (Bio-Rad). GST-SflAP, GST-CpIAP, GST-XIAP or GST-XIAPBIR1 (10 μg) immobilized on glutathione-Sepharose (5 μ 1) were incubated with in vitro-translated pro-caspase-9 (4 μ 1) in a total volume of 100 μ 1 with caspase assay buffer (20 mM HEPES, pH7.4, 10% sucrose, 0.1 % CHAPS, 1 mM EDTA, 100 mM NaCl). After incubation at 4 °C for 1 hour, beads were removed by centrifugation and washed twice with 0.5 ml of 50 mM Tris (pH 7.5), 150 mM NaCl, 2 mM DTT before analysis by SDS-PAGE and autoradiography. Example 5. Enzyme Assays
Caspase activity was assayed by release of 7-amino-4-trifluoromethyl- coumarin (AFC) from Ac-DEVD or Ac-LEHD-containing synthetic peptides (Calbiochem) using continuous-reading instuments as described (Quan, L. T. et al., (1995) J. Biol Chem. 270:10377-10379).
Example 6. Cell Extracts
Cytosolic extracts were prepared as described (Deveraux, Q., Takahashi, R., Salvesen, G. S. & Reed, j. C. (1997) Nature 388, 300-303) using human embryonic kidney (HEK) 293 cells. Cells were washed with ice-cold buffer A (20 mM HEPES pH 7.5, 10 mM KC1, 1.5 mM MgCl2, 1 mM EDTA and 1 mM DTT), suspended in 1 volume of buffer A, incubated on ice for 20 mins, and then disrupted by 15 passages through a 26-gauge needle. Cell extracts were purified by centrifugation at 15000g for 12 mins and supernatants were stored at -80 °C. For initiating caspase activation, either 100 nM of purified recombinant caspase-8 or 1 μM horse heart cytochrome c (Sigma) together with 1 mM dATP was added to extracts (Deveraux, Q. L., et al., (1998) EMBO J. 17, 2215- 2223).
Example 7. Cell Culture, Transfections, and Apoptosis assays. Insect Sf-21 cells were maintained at 27 °C in Excell 401 media (JHR
Bioscience) supplemented with 2.5% fetal bovine serum. vP35del, containing a deletion in the p35 gene, was propagated in TΝ-368 cells (Clem, R. J., et al., (1991) Science 254, 1388-1390). Plasmids encoding full-length or deletion mutants of SflAP (1 μg) were co- transfected with 1 μg vP35del viral DNA into Sf-21 cells using Lipofectin from Gibco. Occlusion body formation was observed under light microscopy 3 days post-transfection. HEK293 and 293T cells were maintained in DMEM (Irvine Scientific) supplemented with 10% fetal bovine serum, 1 mM L-glutamine and antibiotics. 293 cells (106) were co-transfected using Superfect with 0.1 μg Green Fluoresence Protein (GFP) marker plasmid pEGFP (Clontech), 0.25 ug of either pcDNA3-Bax or pcDNA3-Fas, and 1.5 μg of either pcDNA3myc-SfIAP or pcDNA3myc-CpIAP. Alternatively, cells were co-transfected with 0.35 μg pcDNA3-caspase-9-Flag and 2.1 μg of either SflAP or CpIAP. Both floating and adherent cells were recovered 24-36 hour post-transfection, pooled, and the percentage of GFP -positive cells that exhibited nuclear apoptotic morphology was determined by staining with 0.1 mg/ml DAPI (mean+/- S.D.) (Deveraux, Q., et al. (1997) Nature 388, 300-303; Deveraux, Q. L., et al., (1998) EMBOJ. 17, 2215- 2223; Roy, N., et al. (1997) EMBO J. 16, 6914-6925; Takahashi, R., et al. (1998) J. Biol. Chem. 273, 7787-7790). In some cases, lysates were prepared from transfected cells, normalized for total protein content, and analyzed by SDS-PAGE/immunoblotting as described (Deveraux, Q., et al., (1997) supra; Deveraux, Q. L., et al. (1998) supra; Roy, N. et al. (1997) supra; Takahashi, R., et al., (1998), supra.).
Example 8. Results of cloning of SflAP. RT-PCR was used to amplify a fragment of SflAP from mRNA derived from Sf-21 cells. 5 'RACE and 3 'RACE were performed to obtain the full-length cDNA. The full-length SflAP cDNA (SEQ ID NO:l) contains a continuous ORF (SEQ ID NO:2) encoding a protein of 377 amino acids (SEQ ID NO:3). This ORF is initiated by an AUG within a favorable context for translation and is preceded by upstream stop codons in all three reading frames. Similar to baculoviral IAPs, the predicted SflAP contains two BIR domains, followed by a RING domain near its C-terminus. Within the BIR and RING regions, SflAP shares 85% amino acid identity (90% similarity) with baculoviral CpIAP and 70%) identity (80%) similarity) with OpIAP. The sequence similarity between this cellular lepidopteran IAP and baculoviral IAPs suggests that baculoviral IAPs may have derived from host IAP genes.
Example 9. SflAP rescues AcNPV p35-deleted virus in Sf-21 cells.
Previous studies showed that CpIAP and OpIAP require their BIR and RING domains to rescue AcMNPV p35-deleted virus in Sf cells (Clem, R. j. & Miller, L. K. (1994) Mol. Cell Biol. 14, 5212-5222). SflAP was tested to see if it also complements p35-defιciency, preventing apoptosis by this mutant virus, thereby allowing its replication in insect cells. Plasmids containing full-length SflAP or fragments of SflAP comprising the two BIRs or the RING domain were co-transfected with AcMNPV p35 mutant viral DNA into Sf-21 cells. Cells were observed 72 hrs post-transfection. While full-length SflAP complemented p35 deficiency, allowing replication of this mutant virus, as evidenced by occlusion body formation in Sf21 cells, the BIR and RING truncation mutants of SflAP failed to rescue in this assay. Thus, analogous to CpIAP and OpIAP, BIR and RING domains of SflAP are required in combination for inhibition of apoptosis induced by AcMNPV p35 mutant virus. Example 10. SflAP and CpIAP inhibit Bax-induced not Fas-induced apoptosis in mammalian cells.
Baculoviral IAPs have been reported to protect mammalian cells from some apoptotic stimuli (Hawkins, C. J. et al., (1996) Proc. Natl Acad. Sci. USA 93,
13786-13790; Hawkins, C. et al., (1998) Cell Death and Differentiation 5, 569-576; Uren, A. G. et al, (1996) Proc. Natl. Acad. Sci. USA 93, 4974-4978). Tests were performed to determine whether SflAP is also capable of functioning as an apoptosis suppressor in a mammalian cell context. For these experiments, apoptosis was induced in HEK293 cells by over-expression of either Fas or Bax — representing prototypical apoptotic stimuli which trigger alternative apoptosis pathways. The TNF-family receptor member Fas recruits pro-caspase-8 to receptor complexes and induces its activation. Caspase-8 then cleaves and activates caspase-3 and other downstream caspases that cause apoptosis. In contrast, Bax induces release of cytochrome c from mitochondria. Cytochrome c (cyto c) then binds Apaf- 1 , inducing recruitment of pro-caspase-9 to cytochrome c/Apaf- 1 complexes and resulting in caspaes-9 activation. Active caspase-9 then cleaves and activates caspase-3 and other downstream caspases.
Plasmids encoding various IAPs were co-transfected with Bax or Fas into 293 cells and % apoptosis was determined 24-36 hours later. SflAP, CpIAP and human XIAP inhibited Bax-induced apoptosis. In contrast, the BIR and RING truncation mutants of SflAP and CpIAP failed to suppress apoptosis induced by Bax, as did the full- length IAP (OpIAP; AcIAP) from other baculovirus strains. Unlike Bax, SflAP and CpIAP were ineffective at suppressing Fas-induced apoptosis in HEK293 cells (Figure 2B), whereas XIAP did protect against Fas. Immunoblot analysis confirmed production of these various IAPs, excluding gross differences in the levels of these proteins as an explanation for the results. Thus, SflAP and CpIAP are capable of inhibiting mammalian apoptosis pathways but they inhibit only a subset of the cell death pathways which are suppressed by their human counterpart, XIAP.
Example 11. Recombinant SflAP and CpIAP suppress caspase activation induced by cyto c in vitro.
To further explore the mechanisms by which SflAP and CpIAP inhibit mammalian apoptosis, a cell-free system in which exogenously added active caspase-8 or cyto c induces activation of caspase-3 and similar proteases, as measured by hydrolysis of Ac-DEVD-AFC (Quan, L. T. et al., (1995) J Biol. Chem. 270, 10377-10379) was used. Caspase-8 and cyto c trigger the same apoptosis pathways in extracts which are activated by Fas and Bax in intact cells. In cell extracts treated with cyto c, recombinant SflAP, CpIAP and XIAP completely blocked the hydrolysis of Ac-DEVD-AFC. A control protein consisting of the BIR1 domain of XIAP did not interfere with caspase activity, demonstrating the specificity of these results. In contrast, recombinant SflAP and CpIAP had no effect on DEVD-cleaving proteases in cell extracts treated with caspase-8.
Immunoblot analysis of caspase-3 processing confirmed the findings of protease assays. In cell extracts activated by cyto c or active caspase-8, ~33 kDa pro- caspase-3 was processed to yield -17-20 kDa forms of the large-subunit, indicative of active caspase-3 (the ~12 kDa subunit of caspase-3 is undetectable with this anti-caspase- 3 antibody). Recombinant SflAP and CpIAP suppressed the processing of pro-caspase-3 in cyto c-treated but not in caspase-8-treated extracts, whereas XIAP suppressed in both cases. Taken together, these data suggest that SflAP and CpIAP inhibit the caspase cascade activated by cyto c pathway at a step upstream of caspase-3 but do not suppress the cascade initiated by caspase-8.
Example 12. Grim peptide negatively regulates SflAP.
It has been proposed that Drosophila apoptosis-inducers such as Grim function as negative regulators of IAPs (Deveraux, Q. & Reed, j. C. (1998) Genes Dev. 13, 239-252; Wang, S. et al. (1999) Cell 98, 453-463). The effects of a peptide corresponding to the IAP-binding domain of Grim (first 18 amino acid of Grim) were tested on SflAP -mediated suppression of caspases in cyto c-stimulated cell extracts. While recombinant SflAP was able to inhibit cyto c-induced activation of DEVD- cleaving caspases in cytosol extracts, addition of Grim peptide abrogated this inhibitory effect of SflAP in a concentration-dependent manner, with a 5-fold excess of Grim peptide relative to SflAPs resulting in complete restoration of caspase activity. In contrast, several control peptides of similar length had no effect. These results support the hypothesis that the fly apoptosis-inducer Grim is an inhibitor of S. frugiperda and baculoviral IAPs. Example 13. SflAP and CpIAP directly bind and inhibit mammalian caspase-9.
The observation that SflAP and CpIAP suppress apoptosis induced by Bax and block caspase activation induced by cyto c suggested that these IAPs might inhibit caspase-9, the pinnacle caspase in the mitochondrial/cyto c pathway. To test this hypothesis, 293T cells were transfected with plasmids encoding pro-caspase-9 alone or in combination with SflAP and CpIAP. Caspase activity and apoptosis were then assayed 24-36 hours later. Both SflAP and CpIAP, as well as human XIAP (included as a positive control), markedly suppressed activation of downstream DEVD-cleaving caspases induced by overexpression of caspase-9 and also inhibited caspase-9-induced apoptosis. In contrast, OpIAP and AcIAP failed to suppress caspase activation or apoptosis, demonstrating the specificity of these results. Immunoblotting confirmed expression of all these IAP-family proteins at comparable levels. In contrast to full- length SflAP and CpIAP, fragments of these IAPs containing only the BIR domains were unable to suppress activation of DEVD-cleaving caspases induced by overexpression of pro-caspase-9. Moreover, fragments of SflAP and CpIAP containing only the RING domain enhanced rather than suppressing caspase activation and apoptosis induced by over-expression of pro-caspase-9.
To directly examine the possibility that SflAP and CpIAP inhibit caspase- 9, enzyme inhibition assays were performed using bacteria-produced recombinant active caspase-9, recombinant-purified SflAP and CpIAP, and Ac-LEHD-AFC as a caspase-9 substrate. SflAP and CpIAP inhibited recombinant active caspase-9 in a concentration- dependent manner. The molar-excess of SflAP and CpIAP relative to caspase-9 which produced ~ 50% inhibition of protease activity was 8- and 12-fold respectively, similar to results reported previously for XIAP suppression of this member of the caspase family (Deveraux, Q. L. et al., (1998) EMBO J. 17, 2215-2223).
SflAP and CpIAP also bound to caspase-9, as determined by experiments in which [35S]-pro-caspase-9 was incubated with GST-SflAP, GST-CpIAP, GST-XIAP and GST-XIAP-BIR1. Autoradiography showed that GST-SflAP, GST-CpIAP and GST- XIAP associated with pro-caspase-9. In contrast, various control GST-fusion proteins, including XIAP-BIRl, failed to bind caspase-9, confirming the specificity of these results.
Unlike caspase-9, SflAP and CpIAP neither bound nor inhibited recombinant purified caspases-3 and -7. In contrast, human XIAP was a potent inhibitor of caspases-3 and -7 in vitro, demonstrating that XIAP can inhibit a broader range of mammalian caspases than SflAP and CpIAP.
Example 14. Production of transgenic plants.
Transgenic tomato plants containing SflAP were made by conventional techniques. Agrobacterium was used as a vehicle to introduce the heterologous gene into the plants.
All publications, patents, and patent applications cited in this specification are herein incorporated by reference as if each individual publication, patent, or patent application were specifically and individually indicated to be incorporated by reference. Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.
SEQUENCE LISTING:
AGTTTTAGTC CGAACGCCGA CGAGTGACGC ATGTTACGAG CCTACTGTAC TGACTCGACT CGAACCGCGA TCGATCGTGG ACCGCTGTAA ACGTCACTTC GTTTCGTTCG TTAGTCGCGA GTTTCGCACT CATGTTGGAG AGTTGTGTTG TTTGTTTATC AGTCCGTTAA CGTTTGACCA GTGAGAGTGA GAACAGTTTT TAAAACCTAG TCATAAACAA TCAATTTGAT GTGGTCGTGT TCCTTACCTT GTTGGAATAC AAAAAAATCT GGATTACAAA TGGATATTAC CAAAGTGGCA TCCAATGGCT CCTCCTCAAC ATTAACGCTA TTCAAGAGCG GATCGCTTGA GGCTAAAATT CGACCTCTCG CGCCACTAAT GCTGCCGACG CCAAGTTACG ACTCCAACGC CGGCTCTCCA TCTTTGTCTC CATCCACGCC TTGCTCTTCA TCTTCTTTCT CCATTGATAA AACCGACAAC CACGACACCT TCGGCTTCAG TGCGGACACA GTTGATATGA GAAAAGAGGA TGAACGTATG AAAACATTTG AAAAATGGCC CGTAAGTTTT CTATCCGGAG AGCAACTTGC TCGAAATGGA TTTTACTACC TCGGCCGTAG AGATGAAGCC CGTTGCGCTT TCTGTAAAGT GGAGATTATG AGGTGGGTGG AGGGCGATGA CCCTGCGAAG GACCATCAGC GTTGGGCGCC ACAGTGCCCA TTTGTGCGCA AATTGAACGG TACTGCAGCA GCAGACACGG GTAGTTCGGG CCAGGACGAG TGTGGTGCCC GCGCCGCTCC CTCCGGTACC TCTCCGCCGC GTATGGCCGG TCCCGTGCAC CCACGATATG CATCTGAAGC CGCACGACTA CGCAGTTTTA AAGACTGGCC ACGATGCATG CGACAAAAAC CTGAAGAACT CGCCGAGGCT GGCTTTTTTT ACACTGGTCA GGGAGACAAA ACCAAGTGTT TTTATTGCGA TGGTGGATTA AAAGATTGGG AGAACCATGA CGTACCCTGG GAACAACACG CAAGGTGGTT TGACCGTTGC GCCTACGTGC AATTGGTGAA GGGTCGAGAA TACGTTCAAA AGGTGATTTC TGAAGCTTGT GAGGTATCCG CGTCAGAAGC GGAACGTGAT GTAGCACCCG CACGGACTGC CGAGCCAAGC CCGCCAGCAG AGGCGCCAGA AAACTCAGTC GATGACTCAA AGTTGTGTAA AATCTGTTAT GCTGAAGAGC GTAACGTGTG CTTCGTGCCG TGCGGCCACG TGGTGGCTTG CGCCAAGTGC GCGCTGGCGG CCGACAAGTG CCCCATGTGC CGCAGGACGT TTCAAAATGC AGTGCGGTTA TATTTCTCGT GAGAAGAGCC ACCAATTTGC AGGCTCAATT CTAGTCTTAA GGGACGACCG GACAGAGCTG TGTGCTGAAA CCATGAGCTC GTATGTCACG TTTCCACAGG CGGAGAAACC TATTAAAACT TATTGTTTGA TGGTTTCGAT AGGAACTCGC TCGCTAGTGT AGCAAAAGAC GAAATTGAAA GGTTCCTCAG GAGTAAGACA GATATACTTA GTTATAGTGA ATTATAAAAT ACATAGCATA CATTAAGATT ATATATTGAT GACGCTTATT ACTTTAATTC ACGTTCCAAT TTGACGTGTT ATTACAATTA TTTATTTTAC ACAGATGTAA CGAAAACTTT GTGTGAGATG TAACATTTAC ACCGAAAAAA AAAAAAAAA_
SEQUENCE ID NO :1 (SflAP nucleotide sequence including 5' and 3 'untranslated regions)
ATGTGGTCGT GTTCCTTACC TTGTTGGAAT ACAAAAAAAT CTGGATTACA AATGGATATT ACCAAAGTGG CATCCAATGG CTCCTCCTCA ACATTAACGC TATTCAAGAG CGGATCGCTT GAGGCTAAAA TTCGACCTCT CGCGCCACTA ATGCTGCCGA CGCCAAGTTA CGACTCCAAC GCCGGCTCTC CATCTTTGTC TCCATCCACG CCTTGCTCTT CATCTTCTTT CTCCATTGAT
AAAACCGACA ACCACGACAC CTTCGGCTTC AGTGCGGACA CAGTTGATAT GAGAAAAGAG GATGAACGTA TGAAAACATT TGAAAAATGG CCCGTAAGTT TTCTATCCGG AGAGCAACTT GCTCGAAATG GATTTTACTA CCTCGGCCGT AGAGATGAAG CCCGTTGCGC TTTCTGTAAA GTGGAGATTA TGAGGTGGGT GGAGGGCGAT GACCCTGCGA AGGACCATCA GCGTTGGGCG CCACAGTGCC CATTTGTGCG CAAATTGAAC GGTACTGCAG CAGCAGACAC GGGTAGTTCG GGCCAGGACG AGTGTGGTGC CCGCGCCGCT CCCTCCGGTA CCTCTCCGCC GCGTATGGCC GGTCCCGTGC ACCCACGATA TGCATCTGAA GCCGCACGAC TACGCAGTTT TAAAGACTGG CCACGATGCA TGCGACAAAA ACCTGAAGAA CTCGCCGAGG CTGGCTTTTT TTACACTGGT CAGGGAGACA AAACCAAGTG TTTTTATTGC GATGGTGGAT TAAAAGATTG GGAGAACCAT GACGTACCCT GGGAACAACA CGCAAGGTGG TTTGACCGTT GCGCCTACGT GCAATTGGTG AAGGGTCGAG AATACGTTCA AAAGGTGATT TCTGAAGCTT GTGAGGTATC CGCGTCAGAA GCGGAACGTG ATGTAGCACC CGCACGGACT GCCGAGCCAA GCCCGCCAGC AGAGGCGCCA GAAAACTCAG TCGATGACTC AAAGTTGTGT AAAATCTGTT ATGCTGAAGA GCGTAACGTG TGCTTCGTGC CGTGCGGCCA CGTGGTGGCT TGCGCCAAGT GCGCGCTGGC GGCCGACAAG TGCCCCATGT GCCGCAGGAC GTTTCAAAAT GCAGTGCGGT TATATTTCTC GTGA
SEQUENCE ID NO:2
(SflAP nucleotide sequence (reading frame only))
MWSCSLPCWNTKKSGLQMDITKVASNGSSSTLTLFKSGSLEAKIRPLAPLMLPTPS YDSNAGSPSLSPSTPCSSSSFSIDKTDNHDTFGFSADTVDMRKEDERMKTFEKWP VSFLSGEQLARNGFYYLGRRDEARCAFCKVEIMRWVEGDDPAKDHQRWAPQCPF VRKLNGTAAADTGSSGQDECGARAAPSGTSPPRMAGPVHPRYASEAARLRSFKD WPRCMRQKPEELAEAGFFYTGQGDKTKCFYCDGGLKDWENHDVPWEQHARWF DRCAYVQLVKGREYVQKVISEACEVSASEAERDVAPARTAEPSPPAEAPENSVDD SKLCKICYAEERNVCFVPCGHVVACAKCALAADKCPMCRRTFQNAVRLYFS *
SEQUENCE ID NO:3
SflAP amino acid sequence

Claims (13)

WHAT IS CLAIMED IS:
1. An isolated nucleic acid construct comprising a polynucleotide sequence at least 85% identical to SEQ ID NO:l .
2. The isolated nucleic acid construct of claim 1, wherein the polynucleotide sequence is at least 95% identical to SEQ ID NO:l .
3. The isolated nucleic acid construct of claim 2, wherein the polynucleotide is SEQ ID NO: 1.
4. An isolated polypeptide, wherein the polypeptide comprises: a. a polypeptide at least 90%) identical to a polypeptide encoded by SEQ ID NO: 1 ; and b. at least 50 amino acids.
5. The isolated polypeptide of claim 4, wherein the polypeptide is at least 95% identical to SEQ ID NO:3.
6. The isolated polypeptide of claim 5, wherein the polypeptide is SEQ ID NO:3.
7. A host cell comprising a recombinant expression cassette comprising a promoter operably linked to a polynucleotide at least 85% identical to SEQ ID NO:l .
8. The host cell of claim 7, wherein the polynucleotide at least 95% identical to SEQ ID NO: 1.
9. The host cell of claim 7, wherein the polynucleotide is SEQ ID NO:l.
10. The host cell of claim 7, wherein the promoter is inducible.
11. The host cell of claim 7, wherein the promoter is constitutive.
12. The host cell of claim 7, which is an insect cell.
13. The host cell of claim 7, which is a plant cell. 14 A recombinant expression cassette comprising a polynucleotide sequence at least 85% identical to SEQ ID NO 1
15 The recombinant expression cassette of claim 14, wherein the polynucleotide sequence is at least 95% identical to SEQ ID NO 1
16 The recombinant expression cassette of claim 14, wherein the polynucleotide sequence is SEQ ID NO 1
17 The recombinant expression cassettte of claim 14, wherein the promotei is inducible
18 The recombinant expression cassettte of claim 14, wherein the promoter is constitutive
19 A recombinant baculovirus comprising a nucleic acid of claim 1
20 A recombinant baculovirus comprising a nucleic acid of claim 2
21 A transgenic plant comprising a nucleic acid of claim 1
22 A transgenic plant comprising a nucleic acid of claim 2
23 An in vitro method of assaying for a compound capable of specifically binding to an IAP, wherein the method comprises combining an IAP with a test compound and assaying whether the test compound specifically binds to the IAP, wherein the IAP has a sequence at least 95% identical to SEQ ID NO 3
24 An in vitro method of assaying for a modulator of IAP activity, wherein the method comprises combining an IAP with a test compound and assaying whether the test compound can increase or decrease IAP binding specifically to a capsase polypeptide
25 An in vitro method of assaying for the presence of IAP cDNA comprising hybridizing of said cDNA to a nucleic acid of claim 1 , or to a contiguous portion of said nucleic acid at least 20 nucleotides m length, and detecting said hybridization, wherein detection of said hybπdization is indicative of the presence of said IAD cDNA 26 The method of claim 25, wherein said hybridization is conducted on a solid support
27 An in viti o method of assaying for the presence of an IAP comprising binding the IAP with an antibody which specifically binds said IAP, or with a fragment of said antibody which retains specificity for said IAP, and detecting said binding, wherein said detection is indicative of the presence of the IAP
28 The method of claim 27, wherein the binding of the antibody or fragment thereof and of the IAP is detected by means of a enzyme-lmked immunosorbent assay (ELISA)
AU2001236774A 2000-02-10 2001-02-07 Inhibitors of apoptosis Abandoned AU2001236774A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US09502528 2000-02-10
US09/502,528 US6570069B1 (en) 2000-02-10 2000-02-10 Nucleic acids encoding plant inhibitors of apoptosis and transgenic cells and plants expressing them
PCT/US2001/004071 WO2001059108A2 (en) 2000-02-10 2001-02-07 Inhibitors of apoptosis

Publications (1)

Publication Number Publication Date
AU2001236774A1 true AU2001236774A1 (en) 2001-08-20

Family

ID=23998234

Family Applications (1)

Application Number Title Priority Date Filing Date
AU2001236774A Abandoned AU2001236774A1 (en) 2000-02-10 2001-02-07 Inhibitors of apoptosis

Country Status (6)

Country Link
US (1) US6570069B1 (en)
EP (1) EP1254226A2 (en)
CN (1) CN1419603A (en)
AU (1) AU2001236774A1 (en)
CA (1) CA2399769A1 (en)
WO (1) WO2001059108A2 (en)

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002053586A2 (en) * 2001-01-08 2002-07-11 The Burnham Institute Inhibitor of apoptosis proteins and nucleic acids and methods for making and using them
CA2450669A1 (en) 2001-06-12 2002-12-19 Pioneer Hi-Bred International, Inc. Anti-apoptosis genes and methods of use thereof
IL162090A0 (en) * 2001-11-21 2005-11-20 Torrey Pines Inst Agents having a core peptide which derepresses iap-inhibited caspase and pharmaceutical compositionscontaining the same
WO2005017109A2 (en) * 2003-06-30 2005-02-24 Massachusetts Institute Of Technology Nucleic acids and polypeptides required for cell survival in the absence of rb
US20050227870A1 (en) * 2004-04-07 2005-10-13 Cotney Floyd C Method to kill kudzu
CN106802349A (en) * 2016-12-30 2017-06-06 广东华南联合疫苗开发院有限公司 Sf insect cell host cell proteins Double-antibody sandwich enzymelinked immunosorbent detection kits and method

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU760765B2 (en) 1997-05-22 2003-05-22 Burnham Institute, The Screening assays for agents that alter inhibitor of apoptosis (IAP) protein regulation of caspase activity
MX257801B (en) 1997-06-02 2008-06-10 Syngenta Participations Ag Plant transformation methods
US6162965A (en) * 1997-06-02 2000-12-19 Novartis Ag Plant transformation methods

Also Published As

Publication number Publication date
WO2001059108A3 (en) 2002-06-13
WO2001059108A2 (en) 2001-08-16
US6570069B1 (en) 2003-05-27
CN1419603A (en) 2003-05-21
CA2399769A1 (en) 2001-08-16
EP1254226A2 (en) 2002-11-06

Similar Documents

Publication Publication Date Title
Siebel et al. Soma-specific expression and cloning of PSI, a negative regulator of P element pre-mRNA splicing.
Xie et al. GRAB proteins, novel members of the NAC domain family, isolated by their interaction with a geminivirus protein
Du et al. A novel family of Ca 2+/calmodulin-binding proteins involved in transcriptional regulation: interaction with fsh/Ring3 class transcription activators
Leu et al. Molecular cloning and characterization of an inhibitor of apoptosis protein (IAP) from the tiger shrimp, Penaeus monodon
SK131799A3 (en) Plants with modified growth
US20040123349A1 (en) SINAT5, an Arabidopsis thaliana gene promotes ubiquitin related degradation
Freire et al. Plant lipoxygenase 2 is a translation initiation factor-4E-binding protein
EP1161546A2 (en) Trans-species transfer of apoptotic genes and transgenic plants developed thereby
US6570069B1 (en) Nucleic acids encoding plant inhibitors of apoptosis and transgenic cells and plants expressing them
Yamada et al. An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction
Ham et al. Isolation of a putative tobacco host factor interacting with cucumber mosaic virus-encoded 2b protein by yeast two-hybrid screening
Kang et al. Interaction of Bombyx mori nucleopolyhedrovirus BRO-A and host cell protein laminin
Fan et al. Identification and characterization of a protein kinase-interacting protein encoded by theautographa californicanuclear polyhedrosis virus
CA2289863A1 (en) Plant grab proteins
JP2002514423A (en) Transgenic plant cells expressing recombinant plant E2F peptide
EP1214436A2 (en) Wheat dp proteins and uses thereof
Ramirez‐Parra et al. E2F–DP transcription factors
US7052843B2 (en) Transcription-based assay for identification of post-translational modification and its application in proteomics
US7172880B2 (en) Inhibitor of apoptosis proteins and nucleic acids and methods for making and using them
US7202352B2 (en) Tumor and senescence marker
WO2000026634A2 (en) Compositions and methods for screening agents that inhibit mapk mediated anti-apoptotic signals
US20020116734A1 (en) Plant derived bag homologues
Tang et al. Characterization of an inhibitor of apoptosis gene (BmSurvivin-2) from the silkworm, Bombyx mori
EP1259617B1 (en) Bunyaviridal reaper proteins and uses therefor
US20070271634A1 (en) Preventing stress-induced apoptosis in plants