AU2001236774A1 - Inhibitors of apoptosis - Google Patents
Inhibitors of apoptosisInfo
- Publication number
- AU2001236774A1 AU2001236774A1 AU2001236774A AU3677401A AU2001236774A1 AU 2001236774 A1 AU2001236774 A1 AU 2001236774A1 AU 2001236774 A AU2001236774 A AU 2001236774A AU 3677401 A AU3677401 A AU 3677401A AU 2001236774 A1 AU2001236774 A1 AU 2001236774A1
- Authority
- AU
- Australia
- Prior art keywords
- iap
- seq
- nucleic acid
- polypeptide
- apoptosis
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 230000006907 apoptotic process Effects 0.000 title description 55
- 239000003112 inhibitor Substances 0.000 title description 10
- 108091007065 BIRCs Proteins 0.000 claims description 145
- 108091007602 SLC58A1 Proteins 0.000 claims description 99
- 238000000034 method Methods 0.000 claims description 75
- 150000001875 compounds Chemical class 0.000 claims description 52
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 50
- 150000007523 nucleic acids Chemical class 0.000 claims description 49
- 108020004707 nucleic acids Proteins 0.000 claims description 47
- 102000039446 nucleic acids Human genes 0.000 claims description 46
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 41
- 229920001184 polypeptide Polymers 0.000 claims description 35
- 230000027455 binding Effects 0.000 claims description 30
- 108091033319 polynucleotide Proteins 0.000 claims description 27
- 102000040430 polynucleotide Human genes 0.000 claims description 27
- 239000002157 polynucleotide Substances 0.000 claims description 27
- 150000001413 amino acids Chemical class 0.000 claims description 23
- 230000000694 effects Effects 0.000 claims description 23
- 239000002299 complementary DNA Substances 0.000 claims description 22
- 241000238631 Hexapoda Species 0.000 claims description 21
- 241000701447 unidentified baculovirus Species 0.000 claims description 21
- 238000012360 testing method Methods 0.000 claims description 20
- 239000007787 solid Substances 0.000 claims description 16
- 238000003556 assay Methods 0.000 claims description 15
- 239000012634 fragment Substances 0.000 claims description 15
- 238000000338 in vitro Methods 0.000 claims description 14
- 230000001939 inductive effect Effects 0.000 claims description 13
- 238000009396 hybridization Methods 0.000 claims description 11
- 125000003729 nucleotide group Chemical group 0.000 claims description 9
- 238000003259 recombinant expression Methods 0.000 claims description 9
- 239000002773 nucleotide Substances 0.000 claims description 8
- 230000009261 transgenic effect Effects 0.000 claims description 8
- 238000001514 detection method Methods 0.000 claims description 5
- 239000003547 immunosorbent Substances 0.000 claims 1
- 102100024319 Intestinal-type alkaline phosphatase Human genes 0.000 description 125
- 210000004027 cell Anatomy 0.000 description 90
- 241000196324 Embryophyta Species 0.000 description 71
- 108090000623 proteins and genes Proteins 0.000 description 71
- 241000713321 Intracisternal A-particles Species 0.000 description 42
- 230000014509 gene expression Effects 0.000 description 37
- 102000011727 Caspases Human genes 0.000 description 33
- 108010076667 Caspases Proteins 0.000 description 33
- 102000004169 proteins and genes Human genes 0.000 description 29
- 235000018102 proteins Nutrition 0.000 description 25
- 102000004039 Caspase-9 Human genes 0.000 description 24
- 108090000566 Caspase-9 Proteins 0.000 description 24
- 108020004414 DNA Proteins 0.000 description 24
- 239000013598 vector Substances 0.000 description 24
- 210000001519 tissue Anatomy 0.000 description 21
- 239000000126 substance Substances 0.000 description 19
- 235000001014 amino acid Nutrition 0.000 description 17
- 229940024606 amino acid Drugs 0.000 description 16
- 239000000523 sample Substances 0.000 description 16
- 241000700605 Viruses Species 0.000 description 14
- 239000013612 plasmid Substances 0.000 description 14
- 108091028043 Nucleic acid sequence Proteins 0.000 description 13
- 230000004913 activation Effects 0.000 description 12
- 101100505657 Drosophila melanogaster grim gene Proteins 0.000 description 11
- 239000000284 extract Substances 0.000 description 11
- 102000003952 Caspase 3 Human genes 0.000 description 10
- 108090000397 Caspase 3 Proteins 0.000 description 10
- 102000004091 Caspase-8 Human genes 0.000 description 10
- 108090000538 Caspase-8 Proteins 0.000 description 10
- 230000002401 inhibitory effect Effects 0.000 description 10
- 101710197780 E3 ubiquitin-protein ligase LAP Proteins 0.000 description 9
- 102400000401 Latency-associated peptide Human genes 0.000 description 9
- 241000256251 Spodoptera frugiperda Species 0.000 description 9
- 241001465754 Metazoa Species 0.000 description 8
- 238000004458 analytical method Methods 0.000 description 8
- 239000013604 expression vector Substances 0.000 description 8
- 244000052769 pathogen Species 0.000 description 8
- 238000013518 transcription Methods 0.000 description 8
- 230000035897 transcription Effects 0.000 description 8
- 239000003153 chemical reaction reagent Substances 0.000 description 7
- 238000013537 high throughput screening Methods 0.000 description 7
- 208000015181 infectious disease Diseases 0.000 description 7
- 210000004962 mammalian cell Anatomy 0.000 description 7
- 239000000203 mixture Substances 0.000 description 7
- -1 peptidyl phosphonates Chemical class 0.000 description 7
- 230000009466 transformation Effects 0.000 description 7
- 108020004705 Codon Proteins 0.000 description 6
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 6
- 241000124008 Mammalia Species 0.000 description 6
- 238000011161 development Methods 0.000 description 6
- 230000018109 developmental process Effects 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 239000003550 marker Substances 0.000 description 6
- 230000007246 mechanism Effects 0.000 description 6
- 108020004999 messenger RNA Proteins 0.000 description 6
- 210000000056 organ Anatomy 0.000 description 6
- 238000003752 polymerase chain reaction Methods 0.000 description 6
- 241000201370 Autographa californica nucleopolyhedrovirus Species 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 206010028980 Neoplasm Diseases 0.000 description 5
- 108700026244 Open Reading Frames Proteins 0.000 description 5
- 102000035195 Peptidases Human genes 0.000 description 5
- 108091005804 Peptidases Proteins 0.000 description 5
- 239000004365 Protease Substances 0.000 description 5
- 238000003782 apoptosis assay Methods 0.000 description 5
- 230000003115 biocidal effect Effects 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- 230000002018 overexpression Effects 0.000 description 5
- 230000001717 pathogenic effect Effects 0.000 description 5
- 239000008194 pharmaceutical composition Substances 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 210000001938 protoplast Anatomy 0.000 description 5
- 230000008929 regeneration Effects 0.000 description 5
- 238000011069 regeneration method Methods 0.000 description 5
- 239000000758 substrate Substances 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- 241000894006 Bacteria Species 0.000 description 4
- 102100030497 Cytochrome c Human genes 0.000 description 4
- 108010075031 Cytochromes c Proteins 0.000 description 4
- 208000035240 Disease Resistance Diseases 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 108091069885 IAP family Proteins 0.000 description 4
- 102000040104 IAP family Human genes 0.000 description 4
- 102000055031 Inhibitor of Apoptosis Proteins Human genes 0.000 description 4
- 101710182846 Polyhedrin Proteins 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 102100024483 Sororin Human genes 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 230000001640 apoptogenic effect Effects 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 229940049706 benzodiazepine Drugs 0.000 description 4
- 150000001557 benzodiazepines Chemical class 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000001186 cumulative effect Effects 0.000 description 4
- 238000012217 deletion Methods 0.000 description 4
- 230000037430 deletion Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 238000003119 immunoblot Methods 0.000 description 4
- 230000001965 increasing effect Effects 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 150000002611 lead compounds Chemical class 0.000 description 4
- 238000001638 lipofection Methods 0.000 description 4
- 230000005522 programmed cell death Effects 0.000 description 4
- 238000000159 protein binding assay Methods 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 238000010561 standard procedure Methods 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 3
- 241000589158 Agrobacterium Species 0.000 description 3
- 241000701489 Cauliflower mosaic virus Species 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 241000233866 Fungi Species 0.000 description 3
- 239000007995 HEPES buffer Substances 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000804865 Homo sapiens E3 ubiquitin-protein ligase XIAP Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 230000005775 apoptotic pathway Effects 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 230000030833 cell death Effects 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 238000004520 electroporation Methods 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 230000007613 environmental effect Effects 0.000 description 3
- 238000013467 fragmentation Methods 0.000 description 3
- 238000006062 fragmentation reaction Methods 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 102000052732 human XIAP Human genes 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 238000000520 microinjection Methods 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 230000008488 polyadenylation Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 238000003757 reverse transcription PCR Methods 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 230000001629 suppression Effects 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 239000003053 toxin Substances 0.000 description 3
- 231100000765 toxin Toxicity 0.000 description 3
- 108700012359 toxins Proteins 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- BQWBEDSJTMWJAE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[(2-iodoacetyl)amino]benzoate Chemical compound C1=CC(NC(=O)CI)=CC=C1C(=O)ON1C(=O)CCC1=O BQWBEDSJTMWJAE-UHFFFAOYSA-N 0.000 description 2
- GZDRODOYEFEHGG-NUDCOPPTSA-N (4s)-4-[[(2s)-2-acetamido-3-carboxypropanoyl]amino]-5-[[(2s)-1-[[(2s)-3-carboxy-1-oxo-1-[[2-oxo-4-(trifluoromethyl)chromen-7-yl]amino]propan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-oxopentanoic acid Chemical compound FC(F)(F)C1=CC(=O)OC2=CC(NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(C)=O)C(C)C)=CC=C21 GZDRODOYEFEHGG-NUDCOPPTSA-N 0.000 description 2
- IEUUDEWWMRQUDS-UHFFFAOYSA-N (6-azaniumylidene-1,6-dimethoxyhexylidene)azanium;dichloride Chemical compound Cl.Cl.COC(=N)CCCCC(=N)OC IEUUDEWWMRQUDS-UHFFFAOYSA-N 0.000 description 2
- AASYSXRGODIQGY-UHFFFAOYSA-N 1-[1-(2,5-dioxopyrrol-1-yl)hexyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1C(CCCCC)N1C(=O)C=CC1=O AASYSXRGODIQGY-UHFFFAOYSA-N 0.000 description 2
- JZPGURKWXUBQLP-UHFFFAOYSA-N 2-[[2-(2-methylpropylsulfanyl)-1,3-benzothiazol-6-yl]iminomethyl]phenol Chemical compound CC(C)CSC1=NC2=C(S1)C=C(C=C2)N=CC3=CC=CC=C3O JZPGURKWXUBQLP-UHFFFAOYSA-N 0.000 description 2
- JBNOVHJXQSHGRL-UHFFFAOYSA-N 7-amino-4-(trifluoromethyl)coumarin Chemical compound FC(F)(F)C1=CC(=O)OC2=CC(N)=CC=C21 JBNOVHJXQSHGRL-UHFFFAOYSA-N 0.000 description 2
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 2
- 241000219194 Arabidopsis Species 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 108020004635 Complementary DNA Proteins 0.000 description 2
- 230000004544 DNA amplification Effects 0.000 description 2
- 108010008286 DNA nucleotidylexotransferase Proteins 0.000 description 2
- 102100033215 DNA nucleotidylexotransferase Human genes 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 108700006349 Drosophila DIAP1 Proteins 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 102100021239 G protein-activated inward rectifier potassium channel 2 Human genes 0.000 description 2
- 101710158550 G protein-activated inward rectifier potassium channel 2 Proteins 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- 241000227653 Lycopersicon Species 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 108091061960 Naked DNA Proteins 0.000 description 2
- 108010027206 Nucleopolyhedrovirus inhibitor of apoptosis Proteins 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- 235000014676 Phragmites communis Nutrition 0.000 description 2
- 108700001094 Plant Genes Proteins 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- FKNQFGJONOIPTF-UHFFFAOYSA-N Sodium cation Chemical compound [Na+] FKNQFGJONOIPTF-UHFFFAOYSA-N 0.000 description 2
- 108700009124 Transcription Initiation Site Proteins 0.000 description 2
- 108020005202 Viral DNA Proteins 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 240000008042 Zea mays Species 0.000 description 2
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 2
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 238000000376 autoradiography Methods 0.000 description 2
- 239000003139 biocide Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000024245 cell differentiation Effects 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 239000007822 coupling agent Substances 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- LRHXBHUTQWIZTN-UHFFFAOYSA-N dimethyl heptanediimidate;dihydrochloride Chemical compound Cl.Cl.COC(=N)CCCCCC(=N)OC LRHXBHUTQWIZTN-UHFFFAOYSA-N 0.000 description 2
- ILKCDNKCNSNFMP-UHFFFAOYSA-N dimethyl octanediimidate;hydron;dichloride Chemical compound Cl.Cl.COC(=N)CCCCCCC(=N)OC ILKCDNKCNSNFMP-UHFFFAOYSA-N 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 230000002363 herbicidal effect Effects 0.000 description 2
- 239000004009 herbicide Substances 0.000 description 2
- 230000013632 homeostatic process Effects 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 239000000411 inducer Substances 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 230000009545 invasion Effects 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 231100000518 lethal Toxicity 0.000 description 2
- 230000001665 lethal effect Effects 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 235000009973 maize Nutrition 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 208000015122 neurodegenerative disease Diseases 0.000 description 2
- 244000000003 plant pathogen Species 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 239000004800 polyvinyl chloride Substances 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 229910001415 sodium ion Inorganic materials 0.000 description 2
- HHSGWIABCIVPJT-UHFFFAOYSA-M sodium;1-[4-[(2-iodoacetyl)amino]benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1=CC=C(NC(=O)CI)C=C1 HHSGWIABCIVPJT-UHFFFAOYSA-M 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 125000003396 thiol group Chemical group [H]S* 0.000 description 2
- 150000003573 thiols Chemical class 0.000 description 2
- 230000005026 transcription initiation Effects 0.000 description 2
- 230000014621 translational initiation Effects 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- NKUZQMZWTZAPSN-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-bromoacetate Chemical compound BrCC(=O)ON1C(=O)CCC1=O NKUZQMZWTZAPSN-UHFFFAOYSA-N 0.000 description 1
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- KUXLVFFUSZCVHJ-YWDSYVAPSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-acetamido-3-carboxypropanoyl]amino]-4-carboxybutanoyl]amino]-3-methylbutanoyl]amino]butanedioic acid Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(C)=O KUXLVFFUSZCVHJ-YWDSYVAPSA-N 0.000 description 1
- BEJKOYIMCGMNRB-GRHHLOCNSA-N (2s)-2-amino-3-(4-hydroxyphenyl)propanoic acid;(2s)-2-amino-3-phenylpropanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1.OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 BEJKOYIMCGMNRB-GRHHLOCNSA-N 0.000 description 1
- PSLCKQYQNVNTQI-BHFSHLQUSA-N (2s)-2-aminobutanedioic acid;(2s)-2-aminopentanedioic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O.OC(=O)[C@@H](N)CCC(O)=O PSLCKQYQNVNTQI-BHFSHLQUSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- VGONTNSXDCQUGY-RRKCRQDMSA-N 2'-deoxyinosine Chemical group C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC2=O)=C2N=C1 VGONTNSXDCQUGY-RRKCRQDMSA-N 0.000 description 1
- 150000003923 2,5-pyrrolediones Chemical class 0.000 description 1
- ZBMRKNMTMPPMMK-UHFFFAOYSA-N 2-amino-4-[hydroxy(methyl)phosphoryl]butanoic acid;azane Chemical compound [NH4+].CP(O)(=O)CCC(N)C([O-])=O ZBMRKNMTMPPMMK-UHFFFAOYSA-N 0.000 description 1
- UMCMPZBLKLEWAF-BCTGSCMUSA-N 3-[(3-cholamidopropyl)dimethylammonio]propane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 UMCMPZBLKLEWAF-BCTGSCMUSA-N 0.000 description 1
- FFEARJCKVFRZRR-FOEKBKJKSA-N 3654-96-4 Chemical compound C[35S]CC[C@H](N)C(O)=O FFEARJCKVFRZRR-FOEKBKJKSA-N 0.000 description 1
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 208000010370 Adenoviridae Infections Diseases 0.000 description 1
- 208000007848 Alcoholism Diseases 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 244000296825 Amygdalus nana Species 0.000 description 1
- 235000003840 Amygdalus nana Nutrition 0.000 description 1
- 235000001271 Anacardium Nutrition 0.000 description 1
- 241000693997 Anacardium Species 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 208000032467 Aplastic anaemia Diseases 0.000 description 1
- 101100323274 Arabidopsis thaliana ANR1 gene Proteins 0.000 description 1
- 235000003911 Arachis Nutrition 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 244000003416 Asparagus officinalis Species 0.000 description 1
- 235000005340 Asparagus officinalis Nutrition 0.000 description 1
- 241001106067 Atropa Species 0.000 description 1
- 235000005781 Avena Nutrition 0.000 description 1
- 244000075850 Avena orientalis Species 0.000 description 1
- 108700003918 Bacillus Thuringiensis insecticidal crystal Proteins 0.000 description 1
- 241000194110 Bacillus sp. (in: Bacteria) Species 0.000 description 1
- 241000193388 Bacillus thuringiensis Species 0.000 description 1
- 108700003785 Baculoviral IAP Repeat-Containing 3 Proteins 0.000 description 1
- 102100021662 Baculoviral IAP repeat-containing protein 3 Human genes 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 241000219198 Brassica Species 0.000 description 1
- 235000011331 Brassica Nutrition 0.000 description 1
- 240000002791 Brassica napus Species 0.000 description 1
- 235000011293 Brassica napus Nutrition 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 102000002164 CARD domains Human genes 0.000 description 1
- 108050009503 CARD domains Proteins 0.000 description 1
- QCMYYKRYFNMIEC-UHFFFAOYSA-N COP(O)=O Chemical class COP(O)=O QCMYYKRYFNMIEC-UHFFFAOYSA-N 0.000 description 1
- 235000002566 Capsicum Nutrition 0.000 description 1
- 240000008574 Capsicum frutescens Species 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- WLYGSPLCNKYESI-RSUQVHIMSA-N Carthamin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1[C@@]1(O)C(O)=C(C(=O)\C=C\C=2C=CC(O)=CC=2)C(=O)C(\C=C\2C([C@](O)([C@H]3[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O)C(O)=C(C(=O)\C=C\C=3C=CC(O)=CC=3)C/2=O)=O)=C1O WLYGSPLCNKYESI-RSUQVHIMSA-N 0.000 description 1
- 241000208809 Carthamus Species 0.000 description 1
- 108090000567 Caspase 7 Proteins 0.000 description 1
- 102100035904 Caspase-1 Human genes 0.000 description 1
- 108090000426 Caspase-1 Proteins 0.000 description 1
- 102100038902 Caspase-7 Human genes 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 241000219109 Citrullus Species 0.000 description 1
- 241000207199 Citrus Species 0.000 description 1
- 241000737241 Cocos Species 0.000 description 1
- 241000723377 Coffea Species 0.000 description 1
- 108091028732 Concatemer Proteins 0.000 description 1
- 241000700626 Cowpox virus Species 0.000 description 1
- 101710151559 Crystal protein Proteins 0.000 description 1
- 244000024469 Cucumis prophetarum Species 0.000 description 1
- 235000010071 Cucumis prophetarum Nutrition 0.000 description 1
- 241000219122 Cucurbita Species 0.000 description 1
- 241001135545 Cydia pomonella granulovirus Species 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 238000007399 DNA isolation Methods 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 241000208175 Daucus Species 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 241000512897 Elaeis Species 0.000 description 1
- 235000001942 Elaeis Nutrition 0.000 description 1
- 102000010911 Enzyme Precursors Human genes 0.000 description 1
- 108010062466 Enzyme Precursors Proteins 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 241000220223 Fragaria Species 0.000 description 1
- 230000020172 G2/M transition checkpoint Effects 0.000 description 1
- 235000009438 Gossypium Nutrition 0.000 description 1
- 241000219146 Gossypium Species 0.000 description 1
- 101150094780 Gpc2 gene Proteins 0.000 description 1
- 241000208818 Helianthus Species 0.000 description 1
- 208000029433 Herpesviridae infectious disease Diseases 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 101000688216 Homo sapiens Intestinal-type alkaline phosphatase Proteins 0.000 description 1
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 description 1
- 101000616014 Homo sapiens Magnesium transporter protein 1 Proteins 0.000 description 1
- 241000209219 Hordeum Species 0.000 description 1
- 241000208278 Hyoscyamus Species 0.000 description 1
- 206010020649 Hyperkeratosis Diseases 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 101000844800 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) D-alanyl carrier protein 1 Proteins 0.000 description 1
- 241000208822 Lactuca Species 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 241000208204 Linum Species 0.000 description 1
- 241000209082 Lolium Species 0.000 description 1
- 241000219745 Lupinus Species 0.000 description 1
- 235000002262 Lycopersicon Nutrition 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000121629 Majorana Species 0.000 description 1
- 241000220225 Malus Species 0.000 description 1
- 240000003183 Manihot esculenta Species 0.000 description 1
- 241000219823 Medicago Species 0.000 description 1
- 102000003792 Metallothionein Human genes 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 241000208125 Nicotiana Species 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 241000795633 Olea <sea slug> Species 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 241000283283 Orcinus orca Species 0.000 description 1
- 241000052303 Orgyia pseudotsugata multiple nucleopolyhedrovirus Species 0.000 description 1
- 241000209094 Oryza Species 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 108010043958 Peptoids Proteins 0.000 description 1
- 241000218196 Persea Species 0.000 description 1
- 241000219833 Phaseolus Species 0.000 description 1
- 241000219843 Pisum Species 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 208000005585 Poxviridae Infections Diseases 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 235000011432 Prunus Nutrition 0.000 description 1
- 241000220324 Pyrus Species 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 241000220259 Raphanus Species 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- 208000007014 Retinitis pigmentosa Diseases 0.000 description 1
- 235000003846 Ricinus Nutrition 0.000 description 1
- 241000322381 Ricinus <louse> Species 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241000209056 Secale Species 0.000 description 1
- 241000780602 Senecio Species 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 241000220261 Sinapis Species 0.000 description 1
- 241000710960 Sindbis virus Species 0.000 description 1
- 101150019148 Slc7a3 gene Proteins 0.000 description 1
- 241000207763 Solanum Species 0.000 description 1
- 235000002634 Solanum Nutrition 0.000 description 1
- 240000006394 Sorghum bicolor Species 0.000 description 1
- 235000011684 Sorghum saccharatum Nutrition 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 241001312519 Trigonella Species 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000219873 Vicia Species 0.000 description 1
- 241000219977 Vigna Species 0.000 description 1
- 235000009392 Vitis Nutrition 0.000 description 1
- 241000219095 Vitis Species 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 241000209149 Zea Species 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 108010036419 acyl-(acyl-carrier-protein)desaturase Proteins 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 201000007930 alcohol dependence Diseases 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 239000012131 assay buffer Substances 0.000 description 1
- 238000002820 assay format Methods 0.000 description 1
- 239000005441 aurora Substances 0.000 description 1
- 229940097012 bacillus thuringiensis Drugs 0.000 description 1
- 238000013320 baculovirus expression vector system Methods 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000001390 capsicum minimum Substances 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000006721 cell death pathway Effects 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 210000004671 cell-free system Anatomy 0.000 description 1
- 108091092356 cellular DNA Proteins 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 150000005829 chemical entities Chemical class 0.000 description 1
- 239000013626 chemical specie Substances 0.000 description 1
- VJYIFXVZLXQVHO-UHFFFAOYSA-N chlorsulfuron Chemical compound COC1=NC(C)=NC(NC(=O)NS(=O)(=O)C=2C(=CC=CC=2)Cl)=N1 VJYIFXVZLXQVHO-UHFFFAOYSA-N 0.000 description 1
- 235000020971 citrus fruits Nutrition 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 1
- SUYVUBYJARFZHO-UHFFFAOYSA-N dATP Natural products C1=NC=2C(N)=NC=NC=2N1C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-UHFFFAOYSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000008260 defense mechanism Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000005183 environmental health Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 238000001952 enzyme assay Methods 0.000 description 1
- 150000002118 epoxides Chemical class 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 238000007667 floating Methods 0.000 description 1
- 201000003444 follicular lymphoma Diseases 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 125000002485 formyl group Chemical class [H]C(*)=O 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000003167 genetic complementation Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 208000037824 growth disorder Diseases 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229910052736 halogen Inorganic materials 0.000 description 1
- 150000002367 halogens Chemical class 0.000 description 1
- 238000012203 high throughput assay Methods 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 230000009215 host defense mechanism Effects 0.000 description 1
- 102000053119 human ALPI Human genes 0.000 description 1
- 150000001469 hydantoins Chemical class 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 230000001146 hypoxic effect Effects 0.000 description 1
- 101150100002 iap gene Proteins 0.000 description 1
- 150000002463 imidates Chemical class 0.000 description 1
- 230000003100 immobilizing effect Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000000749 insecticidal effect Effects 0.000 description 1
- 239000002917 insecticide Substances 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 108010027775 interleukin-1beta-converting enzyme inhibitor Proteins 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 208000037906 ischaemic injury Diseases 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- 239000012948 isocyanate Substances 0.000 description 1
- 150000002513 isocyanates Chemical class 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 235000005739 manihot Nutrition 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960004452 methionine Drugs 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 230000002438 mitochondrial effect Effects 0.000 description 1
- 230000010070 molecular adhesion Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 210000002850 nasal mucosa Anatomy 0.000 description 1
- 230000006654 negative regulation of apoptotic process Effects 0.000 description 1
- 230000010807 negative regulation of binding Effects 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 238000007826 nucleic acid assay Methods 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 230000000361 pesticidal effect Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000008196 pharmacological composition Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 150000008298 phosphoramidates Chemical class 0.000 description 1
- 230000000243 photosynthetic effect Effects 0.000 description 1
- 229930195732 phytohormone Natural products 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920002704 polyhistidine Polymers 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000012354 positive regulation of binding Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 235000014774 prunus Nutrition 0.000 description 1
- 150000003235 pyrrolidines Chemical class 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000025915 regulation of apoptotic process Effects 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 238000012827 research and development Methods 0.000 description 1
- 210000001525 retina Anatomy 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000013545 self-assembled monolayer Substances 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 230000001568 sexual effect Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 230000036435 stunted growth Effects 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 150000003505 terpenes Chemical class 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000030968 tissue homeostasis Effects 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000012036 ultra high throughput screening Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000029812 viral genome replication Effects 0.000 description 1
- 244000052613 viral pathogen Species 0.000 description 1
- 230000009447 viral pathogenesis Effects 0.000 description 1
- 244000000006 viral plant pathogen Species 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 239000000277 virosome Substances 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8262—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield involving plant development
- C12N15/8263—Ablation; Apoptosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43563—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4747—Apoptosis related proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2799/00—Uses of viruses
- C12N2799/02—Uses of viruses as vector
- C12N2799/021—Uses of viruses as vector for the expression of a heterologous nucleic acid
- C12N2799/026—Uses of viruses as vector for the expression of a heterologous nucleic acid where the vector is derived from a baculovirus
Description
Inhibitors of Apoptosis
CROSS-REFERENCE TO RELATED APPLICATIONS Not applicable.
STATEMENT AS TO RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED RESEARCH AND DEVELOPMENT
This invention was made with government support under RO1 ES 02710 awarded by the National Institute of Environmental Health Sciences and under 97 35302 4406 awarded by the United States Department of Agriculture. The government has certain rights in the invention.
FIELD OF THE INVENTION
The present invention is directed to polynucleotides encoding inhibitors of apoptosis. The polynucleotides can be used to control apoptosis in target cells.
BACKGROUND OF THE INVENTION
Apoptosis denotes a type of programmed cell death in which the cell nucleus shrinks, the genetic material (DNA) progressively degrades, and the cell collapses (see, e.g. Kawabe, et al. Nature 349:245-248 (1991). In many organisms, apoptosis plays an important physiological role in development, tissue homeostasis, eradication of virus-infected cells, and other events (Wyllie, A. H., Kerr, J. F. R. & Currie, A. R. (1980) Int. Rev. Cytol. 68, 251-306)). Caspases are a family of intracellular proteases responsible for execution of the apoptotic program (Salvesen, G. S. & Dixit, V. M. (1997) Cell 91, 443-446). They are initially synthesized as inactive zymogens that are activated by proteolytic processing, generating the requisite large- and small-subunits which comprise the active caspase enzyme. The functional conservation of caspases in inducing apoptosis within various insect, plant, and animal species makes them appropriate targets for influencing the apoptosis process. Some viruses harbor genes which encode caspase inhibitory proteins, thereby suppressing host defense mechanisms which would otherwise eliminate virus-
infected cells by apoptosis. Examples of viral caspase inhibitors include the baculoviral p35 protein (Clem, R. J. et al., (1991) Science 254, 1388-1390 and the crmA protein of the Poxviridae-family cowpox virus (Ray, C, et al., (1992) Cell 69, 597-604). IAP family proteins were first discovered in baculoviruses (Birnbaum, M., et al, (1994) Journal of Virology 68:2521-2525; Crook, N. E., et al., (1993) J. Virol. 67: 2168-2174). Genetic complementation analysis revealed that the Inhibitor of Apoptosis Protein ("IAP") genes of the CpGV and OpMNPV baculoviruses can rescue p35-defιcient viruses, maintaining host cell survival so that viral replication successfully occurs (Birnbaum, M., (1994), supra, Crook, N. E., et al., (1993) supra). Baculoviral IAPs contain two tandem copies of a Baculovirus Inhibitory Repeat (BIR) domain followed by a C-terminal RING domain. Mutagenesis studies suggest a requirement for both the BIR and RING domains for their anti-apoptotic function in insect cells. Since these initial discoveries, cellular IAP homologs have been found in many animal species, including Drosophila, mammals, and humans (reviewed in (Miller, L. (1999) Trends in Cell Biology 9:323-328; Deveraux, Q. & Reed, J. C. (1998) Genes Dev. 13:239-252)). All cellular IAPs contain one to three copies of a baculoviral inhibitory repeat (BIR) domain and most also contain a RING domain located near their C-termini. A mechanism for IAP-family proteins was shown when it was reported that several human IAPs, including XIAP, cIAPl, cIAP2, can directly bind and inhibit certain caspases, including caspases-3, -7, and -9 (Deveraux, Q., et al., (1999) EMBO J., in press.; Deveraux, Q. & Reed, J. C.
(1998) supra; Deveraux, Q., et al. (1997) Nature 388:300-303; Roy, N., et al., (1997) EMBO J. 16, 6914-6925). Subsequent deletional analysis indicated that the second BIR domain (BIR2) of XIAP is sufficient for inhibiting mammalian caspases-3 and -7 (Roy, N., et al., (1997), supra; Takahashi, R. et al., (1998) J. Biol. Chem. 273, 7787-7790). However, recently it was shown that a fragment of XIAP encompassing the third BIR domain (BIR3) and RING domain specifically inhibits mammalian caspase-9 (Takahashi, R. et al., (1998), supra). Thus, among mammalian IAPs, different regions of these proteins appear to mediate inhibitory interactions with specific caspases.
Though other types of mechanisms have not been excluded, it has been suggested that Drosophila and baculovirus IAPs also may inhibit some caspases. It has been shown that Drosophila IAP1 (DIAP1) is able to inhibit drICE and DCP-1 in insect cells and in yeast (Kaiser, W. et al., (1998) FEBSLett. 440, 243-248; Hawkins, C, et al,
(1999) Proc. Natl. Acad. Sci. USA 96, 2885-2890). It has also been shown that CpIAP and OpIAP require both BIR and RING domains to inhibit activation of Sf-caspase-1
during baculovirus-induced apoptosis in Sf-21 cells. (Seshagiri, S. & Miller, L. K. (1997) Proc. Natl. Acad. Sci. USA 94, 13606-13611.)
Interestingly, a group of apoptosis-inducing genes which encode IAP- binding proteins has been identified in Drosophila, including reaper , hid, and grim (White, E. & Cipriani, R. (1989) Proc. Natl. Acad. Sci. USA 86, 9886-9890). The Reaper, Hid, and Grim proteins contain a homologous -14 amino acid N-terminal domain which is both necessary and sufficient for binding DIAPl and for inducing apoptosis (Vucic, D., et al., (1991) Proc. Natl. Acad. Sci. USA 94, 10183-10188; Vucic, D., et al, (1998) Mo/. Cell. Biol. 18, 3300-3309). Though initially controversial (reviewed in Deveraux, Q. & Reed, J. C. (1998) Genes Dev. 13, 239-252; Miller, L. (1999) Trends in Cell Biology 9, 323-328), recent data suggest that Reaper, Hid, and Grim induce apoptosis by inhibiting IAPs thus interfering with IAP -mediated suppression of caspases (Wang, S., et al., (1999) Cell 98, 453-463).
SUMMARY OF THE INVENTION
The invention provides a cDNA for an Inhibitor of Apoptosis Protein ("IAP") from Spodoptera frugiperda (fall armyworm) (SEQ ID NO:l), as well as nucleic acids that are 85% or more identical to that cDNA. Further, the invention provides polypeptides that are at least 90% identical to a polypeptide encoded by SEQ ID NO:l (the polypeptide is SEQ ID NO:3). In preferred embodiments, the polypeptides are at least 95% identical to SEQ ID NO:3.
The invention further provides host cells comprising recombinant expression cassettes comprising a promoter operably linked to a polynucleotide at least 85% identical to SEQ ID NO:l, at least 95% identical to SEQ ID NO:l, or that comprises SEQ ID NO: 1. The promoter can be inducible or can be constitutive. The host cell can be an insect cell, a plant cell, a mammalian cell. The invention provides recombinant expression cassettes comprising polynucleotides that are 85% or more identical to, 95% or more identical to, or that comprises SEQ ID NO: 1. The recombinant expression cassette will typically comprise a promoter, which promoter can be inducible or can be constitutive.
The invention further provides recombinant baculoviruses which have been engineered to contain a nucleic acid which is 85% or more identical to SEQ ID NO:l, which is 95% or more identical to SEQ ID NO:l, or which comprises SEQ ID NO: 1. The invention further provides transgenic plants which contain a nucleic acid
which is 85% or more identical to SEQ ID NO:l, which is 95% or more identical to SEQ ID NO:l, or which comprises SEQ ID NO:l.
The invention further provides in vitro methods of assaying for compounds capable of specifically binding to an IAP, wherein the method comprises combining an IAP with a test compound and assaying whether the test compound specifically binds to the IAP, where the IAP has a sequence at least 90% or more identical to SEQ ID NO:3. In preferred embodiments, the IAP has a sequence at least 95% identical to SEQ D NO:3. The IAP can be immobilized on a solid support or can be in an aqueous solution. In some embodiments, the test compound can be bound to a solid support and contacted with the IAP.
The invention further provides in vitro methods of assaying for modulators of IAP activity wherein the method comprises combining an LAP with a test compound and assaying whether the test compound can increase or decrease IAP binding specifically to a capsase polypeptide. The IAP can be immobilized on a solid support or can be in an aqueous solution. In some embodiments, the test compound can be bound to a solid support and contacted with the LAP.
The invention further provides an in vitro method of assaying for the presence of IAP cDNA comprising hybridizing said cDNA to a nucleic acid 85% or more identical to SEQ ID NO:l or to a contiguous portion of SEQ ID NO:l at least 20 nucleotides in length and detecting hybridization of the cDNA and the nucleic acid, wherein detection of said hybridization is indicative of the presence of said LAP cDNA. The method further provides an in vitro method of assaying for the presence of an IAP comprising binding the IAP with an antibody which specifically binds said IAP, or with a fragment of said antibody which retains specificity for said LAP, and detecting said binding, wherein said detection is indicative of the presence of the IAP. The detection can be by an ELISA, a Western blot, or other methods known in the art.
DESCRIPTION OF THE SPECIFIC EMBODIMENTS INTRODUCTION Apoptosis, or programmed cell death, is an essential process for normal development and homeostasis in multicellular organisms. It plays an important role in disease resistance in organisms as diverse as insects, plants and higher animals, including mammals. In insects, for example, resistance to viral infection includes apoptosis of infected cells, thereby limiting the spread of the invading pathogen. Similarly, in plants,
apoptosis of infected cells limits the ability of viral and other infections to spread. This tendency of plants to react to infection by apoptosis of infected cells is in fact exploited by some fungi to create lesions exposing plant tissue more susceptible to fungal invasion. In mammals, such as humans, apoptosis kills cells which have undergone damage to their DNA when they go through the G2/M checkpoint. Many cancers are able to grow because they are able to avoid this control mechanism. Thus, the ability to modulate apoptosis (that is, to increase or to decrease it at will) is useful for modulating the ability of plants and of insects and other animals to pathogens and cancer,
Spodoptera frugiperda (fall armyworm) is a lepidopteran host of the Autographa Californica Nuclear Polyhedrosis Virus (AcMNPV), a member of the baculovirus family. Despite extensive use of S. frugiperda-deήved cells for studies of apoptosis-regulation by baculoviruses (reviewed in (Miller, L. (1999) Trends in Cell Biology 9, 323-328)), no endogenous apoptosis-regulating genes have yet been identified in these insect cells, with the exception of Sf-caspases-1 (Ahmad, M., Srinivasula, S., Wang, L., Litwack, G., Fernandes-Alnemri, T. & Alnemri, E. (1997) J. Biol. Chem. 272, 1421-1424).
The present invention demonstrates the cloning and characterization of a cellular IAP from S. frugiperda (SflAP). SflAP has been deposited with GenBank and will be publicly available after the filing of this specification under accession number AF186378. SflAP shares considerable sequence similarity with baculoviral IAPs
(vIAPs), suggesting these viruses acquired their vIAP genes from host cells. Analysis of the SflAP and CpIAP proteins indicates that they are direct inhibitors of mammalian caspase-9, suggesting evolutionary conservation of IAP-family protein functions and providing an explanation for previous reports that baculovirus IAPs can inhibit apoptosis induced by many stimuli in mammalian cells (Hawkins, C. J., Uren, A. G., Hacker, G., Medcalf, R. L. & Vaux, D. L. (1996) Proc. Natl. Acad. Sci. USA 93, 13786-13790; Hawkins, C, Ekert, P., Uren, A., Holmgreen, S. & Vaux, D. (1998) Cell Death and Differentiation 5, 569-576; Uren, A. G., Pakusch, M., Hawkins, C. L, Puls, K. L. & Vaux, D. L. (1996) Proc. Natl. Acad. Sci. USA 93, 4974-4978). Other IAPs are available in GenBank under accession numbers U45880 (human),U75285 (human),U45879 (human), U45878 (human), NM 009689 (mouse), NM 009688 (mouse), L05494 (baculovirus), and L224564 (baculovirus).
Peptides corresponding the N-terminal IAP -binding domain of Grim negate the ability of SflAP and CpIAP to inhibit mammalian caspases in vitro, providing
evidence that mechanisms similar to those described in Drosophila may be used to regulate the IAPs of Spodoptera frugiperda and baculoviruses.
The IAPs of the invention provide a convenient new way to screen for compounds which can modulate apoptosis. Additionally, recombinant viruses encoding IAPs of the invention can be used to infect undesirable insects. The IAPs then decrease the ability of the insects to limit the resulting infection, with increased mortality. Further, IAPs of the invention can be used to transfect plants to render the plants less susceptible to fungi and other organisms which exploit the normal apoptosis response of the plant to render it more vulnerable to invasion. Further, the IAPs of the invention can be used in animals to combat various disorders in which apoptosis plays a role. In preferred embodiments, the animal is a mammal. In particularly preferred uses, the mammal is a human.
The invention can be exploited in a variety of ways. Polypeptides of the invention can be directly administered as therapeutic agents. For use in animals, such as humans, the polypeptides can be administered intravenously, or they can be encapsulated and administered orally. Cells can be transfected with antisense oligonucleotides to bind to IAP-encoding nucleic acids and block their expression. Small chemical compounds which block the binding of IAPs to caspases can be used to interfere with the normal activity of IAPs. The IAPs of the invention can also be used in vitro to monitor for expression of IAP cDNA. Conveniently, this can be done by immobilizing nucleic acid of an LAP of the invention on a solid substrate, such as a "chip," permitting the nucleic acid to act as a probe to screen a cDNA library or cDNA from a sample of interest. Typically, the length of the nucleic acid from the IAP of the invention used as a probe is chosen to be sufficiently long to permit specific hybridization to a cDNA of a IAP of the invention as opposed to other IAPs. Conveniently, such probes are 20 nucleotides or more, or 25, 30, 35, 40, 45, 50, or even more in length, to permit specific detection of the target cDNAs.
In another set of embodiments, the IAPs of the invention can be used to detect and monitor the presence of IAPs in a sample. Typically, antibodies are generated against an IAP of the invention. Depending on the purpose of the assays, the antibodies can be such that they detect all IAPs, or the antibodies can be absorbed against other known IAPs to eliminate antibodies which recognize IAPs other than those of the invention. Methods of generating antibodies against antigens are well known in the art.
Typically, monoclonal antibodies are preferred. Fragments of antibodies which retain binding specificity for the IAP can also be used. Fragments such as single chain Fvs (scFvs), disufide stabilized Fvs (dsFvs), Fabs, and Fab's are well known in the art. Assays employing such antibodies, such as ELISAs and Western blots, are also well known in the art.
DEFINITIONS
"IAP" refers generally to an inhibitor of apoptosis protein and, more specifically herein, to an inhibitor of apoptosis protein of the invention. Which use is intended will be clear in context. IAPs of the invention typically are at least substantially identical to SEQ ID NO:3. "SflAP" specifically denotes an IAP of the invention cloned from Spodoptera frugiperda (fall armyworm). All cellular IAPs contain one to three copies of a baculoviral inhibitory repeat (BIR) domain and most also contain a RING domain located near their C-termini. SflAP contains two BIR domains, followed by a RING domain near its C- terminus. Within the BIR and RING regions, SflAP shares 85% amino acid identity (90% similarity) with baculoviral CpIAP and 70% identity (80% similarity) with OpIAP.
"Apoptosis" refers to programmed cell death. It is an essential process for normal development and homeostasis in multicellular organisms such as mammals, insects and plants. Apoptosis differs from general cell death as from a toxin or ischemic event in that the cell is shutting down according to a controlled pattern of events.
" Apoptosis-inducing chemical" refers to a chemical that promotes programmed cell death. The chemical can be a administered directly to the plant or indirectly by secretion of a pathogen.
"Heterologous gene" refers to a gene introduced into a host cell via recombinant technology where that gene is either not naturally present in the cell or represents an additional copy of an endogenous gene or is operably linked to a promoter that is not normally found in association with the gene in the host cell. "Inducible plant promoter" refers to a promoter which directs expression of a gene where the level of expression is alterable by factors such as temperature, pH, transcription factors and chemicals.
"Insecticidal protein" refers to a diverse group of compounds that are lethal to insects when ingested. Examples include the crystal proteins or delta endotoxins from Bacillus thuringiensis.
"Viral plant disease resistance" refers to the ability of a plant to prevent or inhibit a viral pathogen from successfully infecting it.
"Operably linked" refers to nucleotide sequences which are joined in such a manner that their individual function complements each other. Examples are promoters, transcription terminators, enhancers or activators and heterologous genes which when transcribed and if appropriate to translate will produce a functional product, i.e. a protein, ribozyme or anti-sense construct.
"Plant" includes whole plants, plant organs (e.g., leaves, stems, roots, etc.), seeds and plant cells and progeny of same. The class of plants which can be used in the methods of the invention is generally as broad as the class of higher plants amenable to transformation techniques, including both monocotyledonous and dicotyledonous plants.
"Plant pathogens" refer to fungi, bacteria, virus and insects that infect plants and have negative effects on their growth and health.
"Promoter" refers to a region of DNA involved in binding the RNA polymerase to initiate transcription. "Transformation rate" refers to the percent of cells that are successfully incorporate a heterologous gene into its genome and survive.
"Transfecting" refers to the process of introducing a heterologous gene into a cell.
The term "protein" is used herein interchangeably with "polypeptide" and "peptide."
"Nucleic acid" refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. The term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non- naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).
Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al. (1991) Nucleic Acid Res . 19:5081; Ohtsuka et al. (1985) J Biol. Chem. 260:2605-2608; Rossolini et al. (1994) Mo/. Cell. Probes 8:91-98). The term nucleic acid is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and polynucleotide.
A polynucleotide sequence comprising a fusion protein of the invention hybridizes under stringent conditions to each of the nucleotide sequences encoding each individual polypeptide of the fusion protein. The polynucleotide sequences encoding the individual polypeptides of the fusion polypeptide therefore include conservatively modified variants, polymorphic variants, alleles, mutants, subsequences, and interspecies homologs.
"Percentage of sequence identity" is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
The term "substantial identity" of polynucleotide sequences means that a polynucleotide comprises a sequence that has at least 85% sequence identity. Alternatively, percent identity can be any integer from 85% to 100%. More preferred embodiments include at least: 85%, 90%, 95%, or 99% or higher, compared to a reference sequence using the programs described herein; preferably BLAST using standard parameters, as described below. One of skill will recognize that these values can be appropriately adjusted to determine corresponding identity of proteins encoded by two nucleotide sequences by
taking into account codon degeneracy, amino acid similarity, reading frame positioning and the like. "Substantial identity" of amino acid sequences for these purposes normally means sequence identity of at least 87%. Preferred percent identity of polypeptides can be any integer from 87% to 100%. More preferred embodiments include at least 87%, 90%, 95%, or 99% identity. Polypeptides which are "substantially similar" share sequences as noted above except that residue positions which are not identical may differ by conservative amino acid changes. Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur- containing side chains is cysteine and methionine. Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, aspartic acid-glutamic acid, and asparagine- glutamine. Optimal alignment of sequences for comparison may be conducted by the local identity algorithm of Smith and Waterman (1981) Add. API. Math. 2:482, by the identity alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc. Natl. Acad. Sci. (U.S.A.) 85: 2444, by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, WI), or by inspection.
A preferred example of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402 and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). Cumulative scores are calculated using, for nucleotide
sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff ( 1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
Another indication that nucleotide sequences are substantially identical is if two molecules hybridize to each other, or to a third nucleic acid, under moderately, and preferably highly, stringent conditions. Stringent conditions are sequence dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques in Biochemistry and Molecular Biology—Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays" (1993) (Elsevier Science, Inc., New York). Generally, stringent conditions are selected to be about 5-10°C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., 10 to 50 nucleotides) and at least about 60°C for long probes (e.g., greater than 50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal is at least two times background, preferably 10 times background hybridization.
Exemplary stringent hybridization conditions can be as following: 50% formamide, 5x SSC, and 1% SDS, incubating at 42°C, or, 5x SSC, 1% SDS, incubating at 65°C, with wash in 0.2x SSC, and 0.1% SDS at 65°C.
For the purpose of the invention, suitable "moderately stringent conditions" include, for example, prewashing in a solution of 5 X SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridizing at 50°C-65°C, 5X SSC overnight, followed by washing twice at 65°C for 20 minutes with each of 2X, 0.5X and 0.2X SSC (containing 0.1% SDS). Such hybridizing DNA sequences are also within the scope of this invention.
SCREENING FOR IAP BINDING ACTIVITY
The invention provides in vitro and in vivo methods of assaying for a modulator of IAP activity by identifying molecules that specifically bind an LAP, thereby affecting its activity. While the invention is not limited by what means the IAP activity is inhibited, specific embodiments include assaying for IAP binding to members of the caspase family, as described herein. The methods of the invention also include screening for antibodies directed to an IAP or small molecule binders of IAPs. To assay for specific binding of a putative modulatory molecule, the IAP can be in solution or can be attached to a fixed substrate. In some embodiments, an IAP is fixed to a solid substrate for high throughput screenings or column chromatography.
High-Throughput Screening of Candidate Agents that Bind IAPs of the invention
Conventionally, new chemical entities with useful properties are generated by identifying a chemical compound (called a "lead compound") with some desirable property or activity, creating variants of the lead compound, and evaluating the property and activity of those variant compounds. The current trend is to shorten the time scale for all aspects of drug discovery. Because of the ability to test large numbers quickly and efficiently, high throughput screening (HTS) methods are replacing conventional lead compound identification methods. In one embodiment, high throughput screening methods are used to identify compositions that specifically bind an IAP and modulate its activity. This involves providing a library containing a large number of potential compounds (candidate compounds). Such "combinatorial chemical libraries" are then screened in one or more assays to identify those library members (particular chemical species or subclasses) that bind IAP. The compounds thus identified can serve as conventional "lead compounds" or can themselves be used as potential or actual reagents.
Combinatorial chemical libraries
A combinatorial chemical library is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis by combining a number of chemical "building blocks" such as reagents. For example, a linear combinatorial chemical library such as a polypeptide library is formed by combining a set of chemical building blocks called amino acids in every possible way for a given compound length (i.e., the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks. For example, the systematic, combinatorial mixing of 100 interchangeable chemical building blocks can result in the theoretical synthesis of 100 million tetrameric compounds or 10 billion pentameric compounds (see, e.g., Gallop (1994) 37:1233-1250).
Preparation and screening of combinatorial chemical libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Patent 5,010,175, Furka (1991) Int. J. Pept. Prot. Res., 37:487-493, Houghton (1991) Nature, 354: 84-88). Peptide synthesis is by no means the only approach envisioned and intended for use with the present invention. Other chemistries for generating chemical diversity libraries can also be used. Such chemistries include, but are not limited to: peptoids (PCT Publication No WO 91/19735, 26 Dec. 1991), encoded peptides (PCT Publication WO 93/20242, 14 Oct. 1993), random bio-oligomers (PCT Publication WO 92/00091, 9 Jan. 1992), benzodiazepines (U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs (1993) Proc. Nat. Acad. Sci. USA 90: 6909-6913), vinylogous polypeptides (Hagihara (1992) J Amer. Chem. Soc. 114: 6568), nonpeptidal peptidomimetics with a Beta- D- Glucose scaffolding (Hirschmann (1992)J Amer. Chem. Soc. 114: 9217-9218), analogous organic syntheses of small compound libraries (Chen (1994) J. Amer. Chem. Soc. 116: 2661), ohgocarbamates (Cho (1993) Science 261 : 1303), and/or peptidyl phosphonates (Campbell (1994) J. Org. Chem. 59: 658). See, generally, Gordon (1994) J. Med. Chem. 37:1385, nucleic acid libraries, peptide nucleic acid libraries (see, e.g., U.S. Patent 5,539,083) antibody libraries (see, e.g., Vaughn (1996) Nature Biotechnol 14:309-314), and PCT/US96/10287), carbohydrate libraries (see, e.g., Liang (1996) Science 274:1520-1522, and U.S. Patent
5,593,853), and small organic molecule libraries (see, e.g., benzodiazepines, Baum (1993) C&EN, Jan 18, page 33, isoprenoids U.S. Patent 5,569,588, thiazolidinones and metathiazanones U.S. Patent 5,549,974, pyrrolidines U.S. Patents 5,525,735 and 5,519,134, morpholino compounds U.S. Patent 5,506,337, benzodiazepines 5,288,514).
Devices for the preparation of combinatorial libraries are commercially available; see, e.g., 357 MPS, 390 MPS, Advanced Chem Tech, Louisville KY; Symphony, Rainin, Wobum, MA; 433A Applied Biosystems, Foster City, CA; 9050 Plus, Millipore, Bedford, MA; the Ultra-high Throughput Screening System (UHTSS™) capable of screening over 100,000 compounds per day, Aurora BioSciences, San Diego, CA.
A number of well known robotic systems have also been developed for solution phase chemistries. These systems include automated workstations like the automated synthesis apparatus developed by Takeda Chemical Industries, LTD. (Osaka, Japan) and many robotic systems utilizing robotic arms (Zymate II, Zymark Corporation, Hopkinton, MA; Orca, Hewlett-Packard, Palo Alto, C A.) which mimic the manual synthetic operations performed by a chemist. Any of the above devices are suitable for use with the present invention. The nature and implementation of modifications to these devices (if any) so that they can operate as discussed herein will be apparent to persons skilled in the relevant art. In addition, numerous combinatorial libraries are themselves commercially available (see, e.g., ComGenex, Princeton, NJ; Tripos, Inc., St. Louis, MO; 3D Pharmaceuticals, Exton, PA; Martek Biosciences, Columbia, MD).
High throughput assays of chemical libraries
Any of the assays for compounds capable of binding IAPs and/or modulating IAP activity described herein are amenable to high throughput screening. These systems (examples of which are described above) can automate entire procedures including all sample and reagent pipetting, liquid dispensing, timed incubations, and final readings of the microplate in detector(s) appropriate for the assay. These configurable systems provide high throughput and rapid start up as well as a high degree of flexibility and customization.
Attaching of the IAP to a Solid Support IAP, whether full length, or subsequences thereof (e.g., a BIR domain or
RING domain) can be bound to a variety of solid supports. Solid supports that can be used in the methods of the invention include polymer beads, membranes (e.g., nitrocellulose or nylon), microtiter dishes (e.g., PVC or polystyrene), test tubes, dip sticks (e.g., glass, PVC, polypropylene, and the like), micro fuge tubes, glass, silica, plastic, metallic beads, or substrates such as paper.
Adhesion of a IAP "target" molecule to the solid support can be direct (i.e. directly contacting the solid support) or indirect (a particular compound or compounds are bound to the support and IAP binds to this compound rather than the solid support).
Immobilization of compounds can be covalent, e.g., utilizing single reactive thiol groups of cysteine residues (see, e.g., Colliuod (1993) Bioconjugate Chem. 4:528-536). Alternatively, compounds can be immobilized non-covalently but specifically, e.g., via immobilized antibodies (see above), as described by Schuhmann (1991) Adv. Mater. 3:388-391; Lu (1995) Anal. Chem. 67:83-87; or, the biotin/strepavidin system, see, e.g., Iwane (1991) Biophys. Biochem. Res. Comm. 230:76-80); or metal chelating, e.g., Langmuir-Blodgett films (Ng (1995) Langmuir 11:4048-4055; Schmitt (1996) Angew. Chem. Int. Ed. Engl. 35:317-20; Frey (1996) Proc. Natl. Acad. Sci. USA 93:4937-41; Kubalek (1994) J. Struct. Biol. 113:117-123; or, metal-chelating self-assembled monolayers, see, e.g., Sigal (1996) Anal. Chem. 68:490-497, for binding of polyhistidine fusion proteins.
Indirect binding of IAP can be achieved using a variety of linkers, many of which are commercially available. The reactive ends can be any of a variety of functionalities, e.g., amino reacting ends such as N-hydroxysuccinimide (NHS) active esters, aldehydes, epoxides, isocyanate, and nitroaryl halides; and thiol reacting ends such as pyridyl disulfides, maleimides, and active halogens. The heterobifunctional crosslinking reagents have two different reactive ends, e.g. , an amino-reactive end and a thiol-reactive end, while homobifunctional reagents have two similar reactive ends, e.g., bismaleimidohexane (BMH) which permits the cross-linking of sulfhydryl-containing compounds. The spacer can be aliphatic or aromatic. Examples of commercially available homobifunctional cross-linking reagents include, but are not limited to, the imidoesters such as dimethyl adipimidate dihydrochloride (DMA), dimethyl pimelimidate dihydrochloride (DMP); and dimethyl suberimidate dihydrochloride (DMS). Heterobifunctional reagents include commercially available active halogen-NHS active esters coupling agents such as N-succinimidyl bromoacetate and N-succinimidyl (4- iodoacetyl)aminobenzoate (SIAB) and the sulfosuccinimidyl derivatives such as sulfosuccinimidyl(4-iodoacetyl)aminobenzoate (sulfo-SIAB) (Pierce Chemicals, Rockford, IL). Another group of coupling agents is the heterobifunctional and thiol cleavable agents such as N-succinimidyl 3-(2-pyridyidithio)propionate (SPDP) (Pierce). By manipulating the solid support and the mode of attachment of the target
IAP molecule to the support, it is possible to control the orientation of the IAP. Thus, for example, it is possible to attach the IAP molecule to a surface in a manner that leaves a "tail" free to interact with other molecules, e.g., a IAP fusion protein with a non-IAP tag (e.g., FLAG, myc, GST, polyHis, etc.) for attachment to the column.
Once bound there are a variety of assay formats that can be used to screen for modulators of the IAP. For example, molecules that interact with a IAP binding domain can be identified by attaching the IAP to a solid support, contacting a second molecule with the support coated with IAP, and detecting the binding of the second molecule to the IAP. Molecules that interact or bind with the target are then eluted, thereby isolating molecules that interacted with the LAP.
Assays
A variety of different assays for detecting compounds and compositions capable of binding IAP can be used in this invention. For a general description of different formats for binding assays, see BASIC AND CLINICAL IMMUNOLOGY, 7th Ed. (D. Stiles and A. Terr, ed.)(1991); ENZYME IMMUNOASSAY, E.T. Maggio, ed., CRC Press, Boca Raton, Florida (1980); and "Practice and Theory of Enzyme Immunoassays" in P. Tijssen, LABORATORY TECHNIQUES IN BIOCHEMISTRY AND MOLECULAR BIOLOGY, Elsevier Science Publishers, B.V. Amsterdam (1985). In competitive binding assays, the test compound competes with a second compound (known to specifically bind IAP) for specific binding sites on the IAP molecule attached to the solid support. Binding is determined by assessing the amount of second compound associated with the fixed IAP molecule. The amount of second compound associated with IAP is inversely proportional to the ability of a test compound to compete in the binding assay.
The amount of inhibition or stimulation of binding of a labeled second compound by the test compound depends on the binding assay conditions and on the concentrations of labeled analyte and test compounds used. Under specified assay conditions, a test compound is said to be capable of inhibiting the binding of a second compound to a IAP target compound if the amount of bound second compound is decreased by 50% or more compared to a control (no test compound) sample.
Alternatively, various known or unknown compounds, including proteins, carbohydrates, and the like, can be assayed for their ability to directly, and specifically, bind to the target immobilized IAP. In one embodiment, samples from various tissues are contacted with IAP. In another embodiment, small molecule libraries and high throughput screening methods are used to identify compounds that bind to the target. The IAP -binding molecules is then eluted using any method, e.g., column chromatography techniques.
Isolation of nucleic acids of the invention
The nucleic acids of the invention can be used to prepare recombinant proteins and transgenic organisms for a number of purposes. Generally, the nomenclature and the laboratory procedures in recombinant DNA technology described below are those well known and commonly employed in the art. Standard techniques are used for cloning, DNA and RNA isolation, amplification and purification. Generally enzymatic reactions involving DNA ligase, DNA polymerase, restriction endonucleases and the like are performed according to the manufacturer's specifications. These techniques and various other techniques are generally performed according to Sambrook et al,
Molecular Cloning - A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, (1989) or Current Protocols in Molecular Biology Volumes 1-3, John Wiley & Sons, Inc. (1994-1998).
The isolation of nucleic acids may be accomplished by a number of techniques. For instance, oligonucleotide probes based on the sequences disclosed here can be used to identify the desired gene in a genomic DNA library. To construct genomic libraries, large segments of genomic DNA are generated by random fragmentation, e.g. using restriction endonucleases, and are ligated with vector DNA to form concatemers that can be packaged into the appropriate vector.
The genomic library can then be screened using a probe based upon the sequence of a cloned IAP gene disclosed here. Probes may be used to hybridize with genomic DNA sequences to isolate homologous genes in the same or different species. Alternatively, antibodies raised against a polypeptide such as an IAD of the invention can be used to screen an expression library. Making antibodies against an antigen of choice is well known in the art.
Alternatively, the nucleic acids of interest can be amplified from nucleic acid samples using amplification techniques. For instance, polymerase chain reaction (PCR) technology can be used to amplify the sequences of IAP genes directly from genomic DNA or from cDNA libraries. PCR and other in vitro amplification methods may also be useful, for example, to clone nucleic acid sequences that code for proteins to be expressed, to make nucleic acids to use as probes for detecting the presence of the desired RNA in samples, for nucleic acid sequencing, or for other purposes. For a general overview of PCR
see PCR Protocols: A Guide to Methods and Applications. (Innis, M, Gelfand, D., Sninsky, J. and White, T., eds.), Academic Press, San Diego (1990). Appropriate primers and probes for identifying sequences from tissues are generated from comparisons of the sequences provided here (e.g. SEQ ID NO: 1, etc.).
Polynucleotides may also be synthesized by well-known techniques as described in the technical literature. See, e.g., Carruthers et al, Cold Spring Harbor Symp. Quant. Biol. 47:411-418 (1982), and Adams et al, J. Am. Chem. Soc. 105:661 (1983). Double stranded DNA fragments may then be obtained either by synthesizing the complementary strand and annealing the strands together under appropriate conditions, or by adding the complementary strand using DNA polymerase with an appropriate primer sequence.
Expression in prokaryotes and eukaryotes To obtain high level expression of a cloned gene, such as polynucleotides encoding IAPs of the invention, one typically subclones polynucleotides encoding the IAP into an expression vector that contains a strong promoter to direct transcription, a transcription/translation terminator, and if for a nucleic acid encoding a protein, a ribosome binding site for translational initiation. Suitable bacterial promoters are well known in the art and described, e.g., in Sambrook et al. and Ausubel et al. Bacterial expression systems for expressing the IAP are available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et al, Gene 22:229-235 (1983); Mosbach et al, Nature 302:543-545 (1983). Kits for such expression systems are commercially available. Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
Selection of the promoter used to direct expression of a heterologous nucleic acid depends on the particular application. The promoter is preferably positioned about the same distance from the heterologous transcription start site as it is from the transcription start site in its natural setting. As is known in the art, however, some variation in this distance can be accommodated without loss of promoter function.
In addition to the promoter, the expression vector typically contains a transcription unit or expression cassette that contains all the additional elements
required for the expression of the IAP encoding nucleic acid in host cells. A typical expression cassette thus contains a promoter operably linked to the nucleic acid sequence encoding IAP and signals required for efficient polyadenylation of the transcript, ribosome binding sites, and translation termination. Additional elements of the cassette may include enhancers and, if genomic DNA is used as the structural gene, introns with functional splice donor and acceptor sites.
In addition to a promoter sequence, the expression cassette should also contain a transcription termination region downstream of the structural gene to provide for efficient termination. The termination region may be obtained from the same gene as the promoter sequence or may be obtained from different genes.
The particular expression vector used to transport the genetic information into the cell is not particularly critical. Any of the conventional vectors used for expression in eukaryotic or prokaryotic cells may be used. Standard bacterial expression vectors include plasmids such as pBR322 based plasmids, pSKF, pET23D, and fusion expression systems such as GST and LacZ. Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, e.g., c-myc. Expression vectors containing regulatory elements from eukaryotic viruses are typically used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus. Other exemplary eukaryotic vectors include pMSG, pAV009/A+, pMTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the CMV promoter, SV40 early promoter, SV40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
Some expression systems have markers that provide gene amplification such as thymidine kinase and dihydrofolate reductase.
Alternatively, high yield expression systems not involving gene amplification are also suitable, such as using a baculovirus vector in insect cells, with a LAP encoding sequence under the direction of the polyhedrin promoter or other strong baculovirus promoters.
The elements that are typically included in expression vectors also include a replicon that functions in E. coli, a gene encoding antibiotic resistance to permit selection of bacteria that harbor recombinant plasmids, and unique restriction sites in nonessential regions of the plasmid to allow insertion of eukaryotic sequences. The particular antibiotic resistance gene chosen is not critical, any of the many resistance genes known in the art are suitable. The prokaryotic sequences are preferably chosen such that they do not interfere with the replication of the DNA in eukaryotic cells, if necessary.
Standard transfection methods are used to produce bacterial, mammalian, yeast or insect cell lines that express large quantities of the IAP, which are then purified using standard techniques (see, e.g., Colley et al, J. Biol. Chem. 264:17619-17622 (1989); Guide to Protein Purification, in Methods in Enzymology, vol. 182 (Deutscher, ed., 1990)). Transformation of eukaryotic and prokaryotic cells are performed according to standard techniques (see, e.g., Morrison, J. Bact. 132:349-351 (1977); Clark-Curtiss & Curtiss, Methods in Enzymology 101:347-362 (Wu et al, eds, 1983).
Any of the well-known procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, liposomes, microinjection, plasma vectors, viral vectors and any of the other well known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell (see, e.g., Sambrook et al, supra). It is only necessary that the particular genetic engineering procedure used be capable of successfully introducing at least one gene into the host cell capable of expressing IAP.
After the expression vector is introduced into the cells, the transfected cells are cultured under conditions favoring expression of LAP, which is recovered from the culture using standard techniques. A number of procedures can be employed when recombinant polypeptides are being purified. For example, proteins having established molecular adhesion properties can be reversible fused to the polypeptides. With the appropriate ligand, the polypeptides can be selectively adsorbed to a purification column and then freed from the column in a relatively pure form. The fused protein is then removed by
enzymatic activity. Finally the polypeptides could be purified using immunoaffinity columns.
Production of trans genie plants The IAPs of the invention can be used for increasing plant disease resistance. More specifically, IAPs can be used to delay, suppress or inhibit an apoptosis response in plants. Many plant pathogens, in particular, non-viral plant pathogens, induce apoptosis in plants as a part of the infection process. When a plant is transformed with IAP of the invention, the plant will not be as susceptible to pathogen induced apoptosis and a resistance phenotype is generated.
DNA constructs of the invention may be introduced into the genome of the desired plant host by a variety of conventional techniques. For example, the DNA construct may be introduced directly into the genomic DNA of the plant cell using techniques such as electroporation and microinjection of plant cell protoplasts, or the DNA constructs can be introduced directly to plant tissue using ballistic methods, such as DNA particle bombardment.
Microinjection techniques are known in the art and well described in the scientific and patent literature. The introduction of DNA constructs using polyethylene glycol precipitation is described in Paszkowski et al. (1984) EMBO J. 3:2717-2722. Electroporation techniques are described in Fromm et al. (1985) Proc. Natl. Acad. Sci. USA 82:5824. Ballistic transformation techniques are described in Klein et al. (1987) Nature 327:70-73.
Alternatively, the DΝA constructs may be combined with suitable T-DΝA flanking regions and introduced into a conventional Agrobacterium tumefaciens host vector. The virulence functions of the Agrobacterium tumefaciens host will direct the insertion of the construct and adjacent marker into the plant cell DΝA when the cell is infected by the bacteria. Agrobacterium tume ά 'eMs-mediated transformation techniques, including disarming and use of binary vectors, are well described in the scientific literature. See, for example Horsch et al. Science 233:496-498 (1984), and Fraley et al. Proc. Natl. Acad. Sci. USA 80:4803 (1983) and Gene Transfer to Plants, Potrykus, ed. (Springer- Verlag, Berlin 1995).
Transformed plant cells which are derived by any of the above transformation techniques can be cultured to regenerate a whole plant which
possesses the transformed genotype and thus the desired phenotype such as increased seed mass. Such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium, typically relying on a biocide and/or herbicide marker that has been introduced together with the desired nucleotide sequences. Plant regeneration from cultured protoplasts is described in Evans et al., Protoplasts Isolation and Culture, Handbook of Plant Cell Culture, pp. 124-176, MacMillilan Publishing Company, New York, 1983; and Binding, Regeneration of Plants, Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985. Regeneration can also be obtained from plant callus, explants, organs, or parts thereof. Such regeneration techniques are described generally in Klee et al. Ann. Rev. of Plant Phys. 38:467-486 (1987).
The nucleic acids of the invention can be used to confer desired traits on essentially any plant. Thus, the invention has use over a broad range of plants, including species from the genera Anacardium, Arachis, Asparagus, Atropa, Avena, Brassica, Citrus, Citrullus, Capsicum, Carthamus, Cocos, Coffea, Cucumis, Cucurbita, Daucus, Elaeis, Fragaria, Glycine, Gossypium, Helianthus, Heterocallis, Hordeum, Hyoscyamus, Lactuca, Linum, Lolium, Lupinus, Lycopersicon, Malus, Manihot, Majorana, Medicago, Nicotiana, Olea, Oryza, Panieum, Pannesetum, Persea, Phaseolus, Pistachia, Pisum, Pyrus, Prunus, Raphanus, Ricinus, Secale, Senecio, Sinapis, Solanum, Sorghum, Theobromus, Trigonella, Triticum, Vicia, Vitis, Vigna, and Zea.
One of skill will recognize that after the expression cassette is stably incorporated in transgenic plants and confirmed to be operable, it can be introduced into other plants by sexual crossing. Any of a number of standard breeding techniques can be used, depending upon the species to be crossed.
Using known procedures one of skill can screen for plants of the invention by detecting the increase or decrease of IAP mRNA or protein in transgenic plants. Means for detecting and quantitating mRNAs or proteins are well known in the art. In addition, modulation of apoptosis in plant cells can be monitored. Apoptosis in plants follows an analogous pathway as in animal cells. Two molecular analytic tools are available and established to determine when apoptosis is occurring in plants (as well as animal cells) as distinguished from cell death due to lethal toxins (such as toxic levels of Fe2SO4) or hypoxic
conditions. The first is demonstration of an orderly fragmentation of the cellular DNA. These are called DNA ladders and are readily analyzed using a variety of electrophoretic techniques. The specific gel or running conditions are not critical. Suitable electrophoretic conditions are provided by Wang et al. (1996), Cell, 8:375-391.
Alternatively, fragmentation of DNA during apoptosis can be detected in situ by reagents that react with exposed 3'hydroxyl groups on the nucleosomal units. The assay procedure involves end labeling the DNA fragments by terminal deoxynucleotidyl transferase (TdT) with UTP conjugated to a detectable marker. The method is termed (TUNEL) and more details of this method can be found in Wang et al. (supra). Finally one can visually identify apoptotic bodies containing fragmented DNA which is one of the hallmarks of apoptosis.
One of skill can also assay for disease resistance by traditional methods. These methods involve visual observation of the effects of a pathogen on a host plant. Observable symptoms include wilt, rot, stunted growth, color changes and mycelial growth. The symptoms are scored for their degree of intensity in sufficient repeated trials until statistically meaningful information is generated. The generic experimental parameters for reproducible study of infection and resistance in plants is well known.
Preparation of recombinant plant vectors
To use isolated sequences to transform plants, recombinant DNA vectors suitable for transformation of plant cells are prepared. Techniques for transforming a wide variety of higher plant species are well known and described in the technical and scientific literature. See, for example, Weising et al. Ann. Rev. Genet. 22:421-477 (1988). A DNA sequence coding for the desired polypeptide, for example a cDNA sequence encoding a full length protein, will preferably be combined with transcriptional and translational initiation regulatory sequences which will direct the transcription of the sequence from the gene in the intended tissues of the transformed plant.
For example, for overexpression, a plant promoter fragment may be employed which will direct expression of the gene in all tissues of a regenerated plant. Such promoters are referred to herein as "constitutive" promoters and are
active under most environmental conditions and states of development or cell differentiation. Examples of constitutive promoters include the cauliflower mosaic virus (CaMV) 35S transcription initiation region, the 1'- or 2'- promoter derived from T-DNA of Agrobacterium tumafaciens, and other transcription initiation regions from various plant genes known to those of skill. Such genes include for example, ACT 11 from Arabidopsis (Huang et al. Plant Mol. Biol. 33:125-139 (1996)), Cat3 from Arabidopsis (GenBank No. U43147, Zhong et al, Mol. Gen. Genet. 251:196-203 (1996)), the gene encoding stearoyl-acyl carrier protein desaturase from Brassica napus (Genbank No. X74782, Solocombe et al. Plant Physiol. 104:1167-1176 (1994)), GPcl from maize (GenBank No. X15596, Martinez et al J. Mol Biol 208:551-565 (1989)), and Gpc2 from maize (GenBank No. U45855, Manjunath et al, Plant Mol Biol. 33:97-112 (1997)).
Alternatively, the plant promoter may direct expression of nucleic acid in a specific tissue, organ or cell type (i.e. tissue-specific promoters) or may be otherwise under more precise environmental or developmental control (i.e. inducible promoters). Examples of environmental conditions that may effect transcription by inducible promoters include anaerobic conditions, elevated temperature, the presence of light, or sprayed with chemicals/hormones. In a preferred embodiment, the promoter is specifically induced by infection of a pathogen. Tissue-specific promoters can be inducible. Similarly, tissue-specific promoters may only promote transcription within a certain time frame of developmental stage within that tissue. Other tissue specific promoters may be active throughout the life cycle of a particular tissue. One of skill will recognize that a tissue-specific promoter may drive expression of operably linked sequences in tissues other than the target tissue. Thus, as used herein a tissue-specific promoter is one that drives expression preferentially in the target tissue or cell type, but may also lead to some expression in other tissues as well.
A number of tissue-specific promoters can also be used in the invention. For instance, promoters that direct expression of nucleic acids in leaves, roots or flowers are useful for enhancing resistance to pathogens that infect those organs. For expression of a IAP in the aerial vegetative organs of a plant, photosynthetic organ-specific promoters, such as the RBCS promoter (Khoudi, et al, Gene 197:343, 1997), can be used. Root-specific expression of IAP polynucleotides can be achieved under the control of the root-specific ANR1
promoter (Zhang & Forde, Science, 279:407, 1998). Any strong, constitutive promoters, such as the CaMV 35S promoter, can be used for the expression of IAP polynucleotides throughout the plant.
If proper polypeptide expression is desired, a polyadenylation region at the 3'-end ofthe coding region should be included. The polyadenylation region can be derived from the natural gene, from a variety of other plant genes, or from T-DNA.
The vector comprising the sequences (e.g., promoters or coding regions) from genes of the invention will typically comprise a marker gene that confers a selectable phenotype on plant cells. For example, the marker may encode biocide resistance, particularly antibiotic resistance, such as resistance to kanamycin, G418, bleomycin, hygromycin, or herbicide resistance, such as resistance to chlorosulfuron or Basta.
Expression in recombinant Baculovirus
Another use of the IAP polynucleotides is in the construction of recombinant baculoviruses that are useful as insecticides. It is known that apoptosis is one of the mechanisms by which insects defend against baculoviral infection. Thus, recombinant baculoviruses comprising the IAP polynucleotides of the invention can be useful in overcoming this defense mechanism.
The construction of most baculovirus expression vector systems has been based on replacement of the polyhedrin gene or other coding region with a foreign gene under the transcriptional control of the polyhedrin gene promoter or other promoter (Pennock, et al. , Mol. and Cell. Bio. 4:399-406 (1984); and Smith, et al. Molecular and Cell. Biol. 3:2156-2165(1983)).
Baculoviruses are natural pathogens of many agriculturally important insect pests (Wood, and Granados, Ann. Rev. Microbiol 45:69-87 (1991)). There has thus been an increased interest in exploiting recombinant baculoviruses to express foreign proteins which would improve the pesticidal properties of the native baculoviruse (see, e.g. Carbonell et al, Gene 73:409-418 (1988); Hammock, et al, Nature 344:458-461 (1990); Maeda, S., Biochem. Biophys. Res. Comm. 165: 1177-1183 (1989); Maeda, et al, Virol. 184:777-780 (1991) and US Patent No. 5,908,785).
Administration of IAP Inhibitors, IAPs, and IAP Nucleic Acids and Anti-IAP Nucleic Acids As Pharmaceuticals
Apoptosis plays a major role in development, viral pathogenesis, cancer, autoimmune diseases and neurodegenerative disorders. Inappropriate increases in apoptosis may cause or contribute to a variety of diseases, including AIDS, neurodegenerative diseases (e.g. Alzheimer's Disease, Parkinson's Disease, Amyotrophic Lateral Sclerosis (ALS), retinitis pigmentosa and other diseases of the retina, myelodysplastic syndrome (e.g., aplastic anemia), toxin-induced liver disease (e.g., alcoholism) and ischemic injury (e.g., myocardial infarction, stroke, and reperfusion injury). In addition, disruption of normally occurring apoptosis has been implicated in the development of some cancers (e.g. follicular lymphoma, p53 carcinomas, and hormone dependent tumors), autoimmune disorders (e.g., lupus erythematosis and multiple sclerosis) and viral infections (e.g., herpes virus, poxvirus, and adenovirus infections). See, e.g., Korneluk, U.S. Patent No. 5,919,912. The invention provides modulators (e.g., inhibitors) of IAP activity and their therapeutic administration. These compounds include those found by the methods of the invention. Modulators that can be used therapeutically also include antibodies and small molecules which bind to IAP to inhibit its ability to bind caspaces. In another embodiment, the modulator is a peptide inhibitor of IAP activity. The peptides, polypeptides and other compositions of the invention are administered with a pharmaceutically acceptable carrier(s) (excipient) to form the pharmacological composition.
Pharmaceutically acceptable carriers and formulations, e.g., for peptides and polypeptides, are known to the skilled artisan and are described in detail in the scientific and patent literature, see e.g., the latest edition of Remington's Pharmaceutical Science, Mack Publishing Company, Easton, PA ("Remington's"); Banga; Putney (1998) Nat. Biotechnol. 16:153-157; Patton (1998) Biotechniques 16:141-143; Edwards (1997) Science 276: 1868-1871; Ho, U.S. Patent No. 5,780,431; Webb, U.S. Patent No. 5,770,700; Goulmy, U.S. Patent No. 5,770,201. The compositions used in the methods of the invention can be delivered alone or as pharmaceutical compositions by any means known in the art, e.g., systemically, regionally, or locally; by intraarterial, intrathecal (IT), intravenous (IV), parenteral, intra-pleural cavity, topical, oral, or local administration, as subcutaneous, intra-tracheal (e.g., by aerosol) or transmucosal (e.g., buccal, bladder, vaginal, uterine,
rectal, nasal mucosa). Actual methods for delivering compositions will be known or apparent to those skilled in the art and are described in detail in the scientific and patent literature, see e.g., Remington's.
The pharmaceutical compositions can be administered by any protocol and in a variety of unit dosage forms depending upon the method of administration, whether it is being co-administered a chemotherapeutic agent, and the like. Dosages for typical peptide and polypeptide pharmaceutical compositions are well known to those of skill in the art. Such dosages are typically advisorial in nature and are adjusted depending on a variety of factors, such as the particular therapeutic context, patient health and the like. The amount of composition or peptide adequate to generate the desired response is defined as a "therapeutically effective dose." The dosage schedule and amounts effective for this use, i.e., the "dosing regimen," will depend upon a variety of factors, including the stage of the disease being treated; timing of co-administration of other agents; the general state of the patient's health; the patient's physical status; age; the pharmaceutical formulation, and the like. The dosage regimen also takes into consideration pharmacokinetics, e.g., the peptide pharmaceutical composition's rate of absorption, bioavailability, metabolism, clearance, and the like, see, e.g., Remington.
Dosages can be determined empirically, e.g, by abatement or amelioration of symptoms, or by objective criteria, analysis of blood or histopathology specimens (amount of apoptosis in a biopsy), and the like.
Vectors used for therapeutic administration of IAP-encoding nucleic acids or anti-IAP nucleic acids, such as antisense molecules, may be viral or nonviral. Viral vectors are usually introduced into a patient as components of a virus. Illustrative viral vectors into which one can incorporate nucleic acids include, for example, adenovirus- based vectors (Cantwell (1996) Blood 88:4676-4683; Ohashi (1997) Proc. Nat 7. Acad. Sci USA 94:1287-1292), Epstein-Barr virus-based vectors (Mazda (1997) J. Immunol. Methods 204:143-151), adenovirus-associated virus vectors, Sindbis virus vectors (Strong (1997) Gene Ther. A: 624-627), herpes simplex virus vectors (Kennedy (1997) Brain 120: 1245-1259) and retroviral vectors (Schubert (1997) Curr. Eye Res. 16:656-662). Nonviral vectors encoding products useful in gene therapy can be introduced into an animal by means such as lipofection, biolistics, virosomes, liposomes, immunoliposomes, polycatio nucleic acid conjugates, naked DNA injection, artificial virions, agent-enhanced uptake of DNA, ex vivo transduction. Lipofection is described in e.g., U.S. Patent Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are
sold commercially (e.g., Transfectam™ and Lipofectin™). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424 and WO 91/16024. Naked DNA genetic vaccines are described in, for example, US Patent No. 5,589,486.
EXAMPLES The following examples are offered by way of illustration, and are not intended to limit the scope of the present invention or appended claims.
Example 1. Cloning of SflAP. mRNA was isolated from Sf-21 cells using a kit from Qiagen. Degenerate primers were designed according to the consensus amino acid sequences between baculoviral IAPs and Drosophila IAPs, 5 ' GC(A C/G/T)GA( A C/G/T)GC( A/C/G/T)GG(A C/G/T)TT(T/C)TT(T/C)TA3 ' and 5 ' AC(A/C/G/T)AC(A/G)TG(A/C/G/T)CC(A/G)C A(A/C/G/T)GG3 ' . RT-PCR was performed using a RT-PCR kit from TakaRa under the following conditions: 94° C for i minute, 42°C for 1.5 minute, 72° for 1 min, for 40 cycles. Amplified fragments were blunted-end cloned into Hindi site of ptzl9, then sequenced. To obtain full-length SflAP cDNAs, 5' RACE and 3' RACE were performed from Sf-21 mRNA using kits from Gibco BRL and TakaRa, respectively, and 5 'CACTTGGTTTTGTCTCCCTGACC3 ' and 5' ACTCAAAGTTGTGTAAAATCTG3' as internal PCR-primers.
Example 2. Plasmid Constructions.
A portion of the full-length SflAP cDNA encompassing the complete open reading frame (ORF) was PCR-amplified and subcloned into the EcoRJ-XhoI sites in pcDNA3-myc and pGEX4T-l vectors for expression in mammalian cells as a myc- epitope tagged protein and in E. coli as a GST-fusion protein, respectively. The complete ORF of CpIAP was subcloned into the EcoRI-EcoRV sites of pcDNA3-myc or the EcoRI-Sall sites in pGEX4T-l. Plasmids encoding fragments of the SflAP and CpIAP, including BIR1+2 (amino acid residues 1-323 for SflAP, residues 1-220 for CpIAP) and RING (residues 324-377 for SflAP and residues 221-275 for CpIAP) were amplified by PCR using primers containing either start or stop codons as appropriate and subcloned into pcDNA3-myc or pGEX4T-l plasmids.
Example 3. Protein Expression and Purification. pGEX4T-l -SflAP and pGEX4T-l -CpIAP plasmids were introduced into E. coli strain BL21 (DE3) containing the plasmid pT-Trx. GST fusion proteins were obtained by induction with 0.05 mM IPTG at 25°C for 8 hours, then purified using glutathione-Sepharose, essentially as described (Deveraux, Q., Welsh, K. & Reed, J. Methods of Enzymology in press). Caspases-3, and -7, containing C-terminal His6-tags, and caspase-8 containing an N-terminal His6-tag were purified as described previously (Stennicke, H. R. & Salvesen, G. S. (1997) J. Biol. Chem. 272, 25719-25723; Stennicke, H., et al., (1998) J. Biol. Chem. 273, 27084-27090; Stennicke, H., et al., (1999) J. Biol. Chem. 21 A, 8359-8362). Casρase-9 lacking the CARD domain (ΔCARD-caspase-9) was constructed by truncating the cDNA and introducing a start codon substituting Vail 39. The resulting cDNA was subcloned into pET-23b and expressed in BL21 (DE3), yielding fully processed enzyme when cells were induced using 0.2 mM IPTG at OD600=0.6 for 4 hrs (Stennicke, H., Deveraux, Q., Humke, E., Reed, J., Dixit, V. & Salvesen, G. (1999) J. Biol Chem. 21 A, 8359-8362). All expressed caspases were purified by Ni-chelation affinity-chromatography, as described (Stennicke, H., et al., (1999) J. Biol. Chem. 21 A, 8359-8362; Stennicke, H. R. & Salvesen, G. S. (1997) J. Biol Chem. 272, 25719-25723; Stennicke, H., et al., (1998) supra). Concentrations of purified enzymes were determined from absorbance at 280 nm based on the molar absorption coefficients: caspase-3 (A280 = 26,000M-1 cm-1), caspase-7 (A280= 24,500 M-l cm-1), caspase-9 (A280=30,010M-1 cm-1).
Example 4. Protein binding assay.
[35S]Pro-caspase-9 was in vitro transcribed and translated in the presence of [35S]L-methionine using TNT kit from Promega. Protein were desalted and exchanged into buffer (20 mM HEPES pH 7.5, 10 mM KC1, 1.5 mM MgC12, 1 mM EDTA and 1 mM DTT) with Bio-spin P-6 columns (Bio-Rad). GST-SflAP, GST-CpIAP, GST-XIAP or GST-XIAPBIR1 (10 μg) immobilized on glutathione-Sepharose (5 μ 1) were incubated with in vitro-translated pro-caspase-9 (4 μ 1) in a total volume of 100 μ 1 with caspase assay buffer (20 mM HEPES, pH7.4, 10% sucrose, 0.1 % CHAPS, 1 mM EDTA, 100 mM NaCl). After incubation at 4 °C for 1 hour, beads were removed by centrifugation and washed twice with 0.5 ml of 50 mM Tris (pH 7.5), 150 mM NaCl, 2 mM DTT before analysis by SDS-PAGE and autoradiography.
Example 5. Enzyme Assays
Caspase activity was assayed by release of 7-amino-4-trifluoromethyl- coumarin (AFC) from Ac-DEVD or Ac-LEHD-containing synthetic peptides (Calbiochem) using continuous-reading instuments as described (Quan, L. T. et al., (1995) J. Biol Chem. 270:10377-10379).
Example 6. Cell Extracts
Cytosolic extracts were prepared as described (Deveraux, Q., Takahashi, R., Salvesen, G. S. & Reed, j. C. (1997) Nature 388, 300-303) using human embryonic kidney (HEK) 293 cells. Cells were washed with ice-cold buffer A (20 mM HEPES pH 7.5, 10 mM KC1, 1.5 mM MgCl2, 1 mM EDTA and 1 mM DTT), suspended in 1 volume of buffer A, incubated on ice for 20 mins, and then disrupted by 15 passages through a 26-gauge needle. Cell extracts were purified by centrifugation at 15000g for 12 mins and supernatants were stored at -80 °C. For initiating caspase activation, either 100 nM of purified recombinant caspase-8 or 1 μM horse heart cytochrome c (Sigma) together with 1 mM dATP was added to extracts (Deveraux, Q. L., et al., (1998) EMBO J. 17, 2215- 2223).
Example 7. Cell Culture, Transfections, and Apoptosis assays. Insect Sf-21 cells were maintained at 27 °C in Excell 401 media (JHR
Bioscience) supplemented with 2.5% fetal bovine serum. vP35del, containing a deletion in the p35 gene, was propagated in TΝ-368 cells (Clem, R. J., et al., (1991) Science 254, 1388-1390). Plasmids encoding full-length or deletion mutants of SflAP (1 μg) were co- transfected with 1 μg vP35del viral DNA into Sf-21 cells using Lipofectin from Gibco. Occlusion body formation was observed under light microscopy 3 days post-transfection. HEK293 and 293T cells were maintained in DMEM (Irvine Scientific) supplemented with 10% fetal bovine serum, 1 mM L-glutamine and antibiotics. 293 cells (106) were co-transfected using Superfect with 0.1 μg Green Fluoresence Protein (GFP) marker plasmid pEGFP (Clontech), 0.25 ug of either pcDNA3-Bax or pcDNA3-Fas, and 1.5 μg of either pcDNA3myc-SfIAP or pcDNA3myc-CpIAP. Alternatively, cells were co-transfected with 0.35 μg pcDNA3-caspase-9-Flag and 2.1 μg of either SflAP or CpIAP. Both floating and adherent cells were recovered 24-36 hour post-transfection, pooled, and the percentage of GFP -positive cells that exhibited nuclear apoptotic
morphology was determined by staining with 0.1 mg/ml DAPI (mean+/- S.D.) (Deveraux, Q., et al. (1997) Nature 388, 300-303; Deveraux, Q. L., et al., (1998) EMBOJ. 17, 2215- 2223; Roy, N., et al. (1997) EMBO J. 16, 6914-6925; Takahashi, R., et al. (1998) J. Biol. Chem. 273, 7787-7790). In some cases, lysates were prepared from transfected cells, normalized for total protein content, and analyzed by SDS-PAGE/immunoblotting as described (Deveraux, Q., et al., (1997) supra; Deveraux, Q. L., et al. (1998) supra; Roy, N. et al. (1997) supra; Takahashi, R., et al., (1998), supra.).
Example 8. Results of cloning of SflAP. RT-PCR was used to amplify a fragment of SflAP from mRNA derived from Sf-21 cells. 5 'RACE and 3 'RACE were performed to obtain the full-length cDNA. The full-length SflAP cDNA (SEQ ID NO:l) contains a continuous ORF (SEQ ID NO:2) encoding a protein of 377 amino acids (SEQ ID NO:3). This ORF is initiated by an AUG within a favorable context for translation and is preceded by upstream stop codons in all three reading frames. Similar to baculoviral IAPs, the predicted SflAP contains two BIR domains, followed by a RING domain near its C-terminus. Within the BIR and RING regions, SflAP shares 85% amino acid identity (90% similarity) with baculoviral CpIAP and 70%) identity (80%) similarity) with OpIAP. The sequence similarity between this cellular lepidopteran IAP and baculoviral IAPs suggests that baculoviral IAPs may have derived from host IAP genes.
Example 9. SflAP rescues AcNPV p35-deleted virus in Sf-21 cells.
Previous studies showed that CpIAP and OpIAP require their BIR and RING domains to rescue AcMNPV p35-deleted virus in Sf cells (Clem, R. j. & Miller, L. K. (1994) Mol. Cell Biol. 14, 5212-5222). SflAP was tested to see if it also complements p35-defιciency, preventing apoptosis by this mutant virus, thereby allowing its replication in insect cells. Plasmids containing full-length SflAP or fragments of SflAP comprising the two BIRs or the RING domain were co-transfected with AcMNPV p35 mutant viral DNA into Sf-21 cells. Cells were observed 72 hrs post-transfection. While full-length SflAP complemented p35 deficiency, allowing replication of this mutant virus, as evidenced by occlusion body formation in Sf21 cells, the BIR and RING truncation mutants of SflAP failed to rescue in this assay. Thus, analogous to CpIAP and OpIAP, BIR and RING domains of SflAP are required in combination for inhibition of apoptosis induced by AcMNPV p35 mutant virus.
Example 10. SflAP and CpIAP inhibit Bax-induced not Fas-induced apoptosis in mammalian cells.
Baculoviral IAPs have been reported to protect mammalian cells from some apoptotic stimuli (Hawkins, C. J. et al., (1996) Proc. Natl Acad. Sci. USA 93,
13786-13790; Hawkins, C. et al., (1998) Cell Death and Differentiation 5, 569-576; Uren, A. G. et al, (1996) Proc. Natl. Acad. Sci. USA 93, 4974-4978). Tests were performed to determine whether SflAP is also capable of functioning as an apoptosis suppressor in a mammalian cell context. For these experiments, apoptosis was induced in HEK293 cells by over-expression of either Fas or Bax — representing prototypical apoptotic stimuli which trigger alternative apoptosis pathways. The TNF-family receptor member Fas recruits pro-caspase-8 to receptor complexes and induces its activation. Caspase-8 then cleaves and activates caspase-3 and other downstream caspases that cause apoptosis. In contrast, Bax induces release of cytochrome c from mitochondria. Cytochrome c (cyto c) then binds Apaf- 1 , inducing recruitment of pro-caspase-9 to cytochrome c/Apaf- 1 complexes and resulting in caspaes-9 activation. Active caspase-9 then cleaves and activates caspase-3 and other downstream caspases.
Plasmids encoding various IAPs were co-transfected with Bax or Fas into 293 cells and % apoptosis was determined 24-36 hours later. SflAP, CpIAP and human XIAP inhibited Bax-induced apoptosis. In contrast, the BIR and RING truncation mutants of SflAP and CpIAP failed to suppress apoptosis induced by Bax, as did the full- length IAP (OpIAP; AcIAP) from other baculovirus strains. Unlike Bax, SflAP and CpIAP were ineffective at suppressing Fas-induced apoptosis in HEK293 cells (Figure 2B), whereas XIAP did protect against Fas. Immunoblot analysis confirmed production of these various IAPs, excluding gross differences in the levels of these proteins as an explanation for the results. Thus, SflAP and CpIAP are capable of inhibiting mammalian apoptosis pathways but they inhibit only a subset of the cell death pathways which are suppressed by their human counterpart, XIAP.
Example 11. Recombinant SflAP and CpIAP suppress caspase activation induced by cyto c in vitro.
To further explore the mechanisms by which SflAP and CpIAP inhibit mammalian apoptosis, a cell-free system in which exogenously added active caspase-8 or cyto c induces activation of caspase-3 and similar proteases, as measured by hydrolysis of
Ac-DEVD-AFC (Quan, L. T. et al., (1995) J Biol. Chem. 270, 10377-10379) was used. Caspase-8 and cyto c trigger the same apoptosis pathways in extracts which are activated by Fas and Bax in intact cells. In cell extracts treated with cyto c, recombinant SflAP, CpIAP and XIAP completely blocked the hydrolysis of Ac-DEVD-AFC. A control protein consisting of the BIR1 domain of XIAP did not interfere with caspase activity, demonstrating the specificity of these results. In contrast, recombinant SflAP and CpIAP had no effect on DEVD-cleaving proteases in cell extracts treated with caspase-8.
Immunoblot analysis of caspase-3 processing confirmed the findings of protease assays. In cell extracts activated by cyto c or active caspase-8, ~33 kDa pro- caspase-3 was processed to yield -17-20 kDa forms of the large-subunit, indicative of active caspase-3 (the ~12 kDa subunit of caspase-3 is undetectable with this anti-caspase- 3 antibody). Recombinant SflAP and CpIAP suppressed the processing of pro-caspase-3 in cyto c-treated but not in caspase-8-treated extracts, whereas XIAP suppressed in both cases. Taken together, these data suggest that SflAP and CpIAP inhibit the caspase cascade activated by cyto c pathway at a step upstream of caspase-3 but do not suppress the cascade initiated by caspase-8.
Example 12. Grim peptide negatively regulates SflAP.
It has been proposed that Drosophila apoptosis-inducers such as Grim function as negative regulators of IAPs (Deveraux, Q. & Reed, j. C. (1998) Genes Dev. 13, 239-252; Wang, S. et al. (1999) Cell 98, 453-463). The effects of a peptide corresponding to the IAP-binding domain of Grim (first 18 amino acid of Grim) were tested on SflAP -mediated suppression of caspases in cyto c-stimulated cell extracts. While recombinant SflAP was able to inhibit cyto c-induced activation of DEVD- cleaving caspases in cytosol extracts, addition of Grim peptide abrogated this inhibitory effect of SflAP in a concentration-dependent manner, with a 5-fold excess of Grim peptide relative to SflAPs resulting in complete restoration of caspase activity. In contrast, several control peptides of similar length had no effect. These results support the hypothesis that the fly apoptosis-inducer Grim is an inhibitor of S. frugiperda and baculoviral IAPs.
Example 13. SflAP and CpIAP directly bind and inhibit mammalian caspase-9.
The observation that SflAP and CpIAP suppress apoptosis induced by Bax and block caspase activation induced by cyto c suggested that these IAPs might inhibit caspase-9, the pinnacle caspase in the mitochondrial/cyto c pathway. To test this hypothesis, 293T cells were transfected with plasmids encoding pro-caspase-9 alone or in combination with SflAP and CpIAP. Caspase activity and apoptosis were then assayed 24-36 hours later. Both SflAP and CpIAP, as well as human XIAP (included as a positive control), markedly suppressed activation of downstream DEVD-cleaving caspases induced by overexpression of caspase-9 and also inhibited caspase-9-induced apoptosis. In contrast, OpIAP and AcIAP failed to suppress caspase activation or apoptosis, demonstrating the specificity of these results. Immunoblotting confirmed expression of all these IAP-family proteins at comparable levels. In contrast to full- length SflAP and CpIAP, fragments of these IAPs containing only the BIR domains were unable to suppress activation of DEVD-cleaving caspases induced by overexpression of pro-caspase-9. Moreover, fragments of SflAP and CpIAP containing only the RING domain enhanced rather than suppressing caspase activation and apoptosis induced by over-expression of pro-caspase-9.
To directly examine the possibility that SflAP and CpIAP inhibit caspase- 9, enzyme inhibition assays were performed using bacteria-produced recombinant active caspase-9, recombinant-purified SflAP and CpIAP, and Ac-LEHD-AFC as a caspase-9 substrate. SflAP and CpIAP inhibited recombinant active caspase-9 in a concentration- dependent manner. The molar-excess of SflAP and CpIAP relative to caspase-9 which produced ~ 50% inhibition of protease activity was 8- and 12-fold respectively, similar to results reported previously for XIAP suppression of this member of the caspase family (Deveraux, Q. L. et al., (1998) EMBO J. 17, 2215-2223).
SflAP and CpIAP also bound to caspase-9, as determined by experiments in which [35S]-pro-caspase-9 was incubated with GST-SflAP, GST-CpIAP, GST-XIAP and GST-XIAP-BIR1. Autoradiography showed that GST-SflAP, GST-CpIAP and GST- XIAP associated with pro-caspase-9. In contrast, various control GST-fusion proteins, including XIAP-BIRl, failed to bind caspase-9, confirming the specificity of these results.
Unlike caspase-9, SflAP and CpIAP neither bound nor inhibited recombinant purified caspases-3 and -7. In contrast, human XIAP was a potent inhibitor
of caspases-3 and -7 in vitro, demonstrating that XIAP can inhibit a broader range of mammalian caspases than SflAP and CpIAP.
Example 14. Production of transgenic plants.
Transgenic tomato plants containing SflAP were made by conventional techniques. Agrobacterium was used as a vehicle to introduce the heterologous gene into the plants.
All publications, patents, and patent applications cited in this specification are herein incorporated by reference as if each individual publication, patent, or patent application were specifically and individually indicated to be incorporated by reference. Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.
SEQUENCE LISTING:
AGTTTTAGTC CGAACGCCGA CGAGTGACGC ATGTTACGAG CCTACTGTAC TGACTCGACT CGAACCGCGA TCGATCGTGG ACCGCTGTAA ACGTCACTTC GTTTCGTTCG TTAGTCGCGA GTTTCGCACT CATGTTGGAG AGTTGTGTTG TTTGTTTATC AGTCCGTTAA CGTTTGACCA GTGAGAGTGA GAACAGTTTT TAAAACCTAG TCATAAACAA TCAATTTGAT GTGGTCGTGT TCCTTACCTT GTTGGAATAC AAAAAAATCT GGATTACAAA TGGATATTAC CAAAGTGGCA TCCAATGGCT CCTCCTCAAC ATTAACGCTA TTCAAGAGCG GATCGCTTGA GGCTAAAATT CGACCTCTCG CGCCACTAAT GCTGCCGACG CCAAGTTACG ACTCCAACGC CGGCTCTCCA TCTTTGTCTC CATCCACGCC TTGCTCTTCA TCTTCTTTCT CCATTGATAA AACCGACAAC CACGACACCT TCGGCTTCAG TGCGGACACA GTTGATATGA GAAAAGAGGA TGAACGTATG AAAACATTTG AAAAATGGCC CGTAAGTTTT CTATCCGGAG AGCAACTTGC TCGAAATGGA TTTTACTACC TCGGCCGTAG AGATGAAGCC CGTTGCGCTT TCTGTAAAGT GGAGATTATG AGGTGGGTGG AGGGCGATGA CCCTGCGAAG GACCATCAGC GTTGGGCGCC ACAGTGCCCA TTTGTGCGCA AATTGAACGG TACTGCAGCA GCAGACACGG GTAGTTCGGG CCAGGACGAG TGTGGTGCCC GCGCCGCTCC CTCCGGTACC TCTCCGCCGC GTATGGCCGG TCCCGTGCAC CCACGATATG CATCTGAAGC CGCACGACTA CGCAGTTTTA AAGACTGGCC ACGATGCATG CGACAAAAAC CTGAAGAACT CGCCGAGGCT GGCTTTTTTT ACACTGGTCA GGGAGACAAA ACCAAGTGTT TTTATTGCGA TGGTGGATTA AAAGATTGGG AGAACCATGA CGTACCCTGG GAACAACACG CAAGGTGGTT TGACCGTTGC GCCTACGTGC AATTGGTGAA GGGTCGAGAA TACGTTCAAA AGGTGATTTC TGAAGCTTGT GAGGTATCCG CGTCAGAAGC GGAACGTGAT GTAGCACCCG CACGGACTGC CGAGCCAAGC CCGCCAGCAG AGGCGCCAGA AAACTCAGTC GATGACTCAA AGTTGTGTAA AATCTGTTAT GCTGAAGAGC GTAACGTGTG CTTCGTGCCG TGCGGCCACG TGGTGGCTTG CGCCAAGTGC GCGCTGGCGG CCGACAAGTG CCCCATGTGC CGCAGGACGT TTCAAAATGC AGTGCGGTTA TATTTCTCGT GAGAAGAGCC ACCAATTTGC AGGCTCAATT CTAGTCTTAA GGGACGACCG GACAGAGCTG TGTGCTGAAA CCATGAGCTC GTATGTCACG TTTCCACAGG CGGAGAAACC TATTAAAACT TATTGTTTGA TGGTTTCGAT AGGAACTCGC TCGCTAGTGT AGCAAAAGAC GAAATTGAAA GGTTCCTCAG GAGTAAGACA GATATACTTA GTTATAGTGA ATTATAAAAT ACATAGCATA CATTAAGATT ATATATTGAT GACGCTTATT ACTTTAATTC ACGTTCCAAT
TTGACGTGTT ATTACAATTA TTTATTTTAC ACAGATGTAA CGAAAACTTT GTGTGAGATG TAACATTTAC ACCGAAAAAA AAAAAAAAA_
SEQUENCE ID NO :1 (SflAP nucleotide sequence including 5' and 3 'untranslated regions)
ATGTGGTCGT GTTCCTTACC TTGTTGGAAT ACAAAAAAAT CTGGATTACA AATGGATATT ACCAAAGTGG CATCCAATGG CTCCTCCTCA ACATTAACGC TATTCAAGAG CGGATCGCTT GAGGCTAAAA TTCGACCTCT CGCGCCACTA ATGCTGCCGA CGCCAAGTTA CGACTCCAAC GCCGGCTCTC CATCTTTGTC TCCATCCACG CCTTGCTCTT CATCTTCTTT CTCCATTGAT
AAAACCGACA ACCACGACAC CTTCGGCTTC AGTGCGGACA CAGTTGATAT GAGAAAAGAG GATGAACGTA TGAAAACATT TGAAAAATGG CCCGTAAGTT TTCTATCCGG AGAGCAACTT GCTCGAAATG GATTTTACTA CCTCGGCCGT AGAGATGAAG CCCGTTGCGC TTTCTGTAAA GTGGAGATTA TGAGGTGGGT GGAGGGCGAT GACCCTGCGA AGGACCATCA GCGTTGGGCG CCACAGTGCC CATTTGTGCG CAAATTGAAC GGTACTGCAG CAGCAGACAC GGGTAGTTCG GGCCAGGACG AGTGTGGTGC CCGCGCCGCT CCCTCCGGTA CCTCTCCGCC GCGTATGGCC GGTCCCGTGC ACCCACGATA TGCATCTGAA GCCGCACGAC TACGCAGTTT TAAAGACTGG CCACGATGCA TGCGACAAAA ACCTGAAGAA CTCGCCGAGG CTGGCTTTTT TTACACTGGT CAGGGAGACA AAACCAAGTG TTTTTATTGC GATGGTGGAT TAAAAGATTG GGAGAACCAT GACGTACCCT GGGAACAACA CGCAAGGTGG TTTGACCGTT GCGCCTACGT GCAATTGGTG AAGGGTCGAG AATACGTTCA AAAGGTGATT TCTGAAGCTT GTGAGGTATC CGCGTCAGAA GCGGAACGTG ATGTAGCACC CGCACGGACT GCCGAGCCAA GCCCGCCAGC AGAGGCGCCA GAAAACTCAG TCGATGACTC AAAGTTGTGT AAAATCTGTT ATGCTGAAGA GCGTAACGTG TGCTTCGTGC CGTGCGGCCA CGTGGTGGCT TGCGCCAAGT GCGCGCTGGC GGCCGACAAG TGCCCCATGT GCCGCAGGAC GTTTCAAAAT GCAGTGCGGT TATATTTCTC GTGA
SEQUENCE ID NO:2
(SflAP nucleotide sequence (reading frame only))
MWSCSLPCWNTKKSGLQMDITKVASNGSSSTLTLFKSGSLEAKIRPLAPLMLPTPS YDSNAGSPSLSPSTPCSSSSFSIDKTDNHDTFGFSADTVDMRKEDERMKTFEKWP VSFLSGEQLARNGFYYLGRRDEARCAFCKVEIMRWVEGDDPAKDHQRWAPQCPF VRKLNGTAAADTGSSGQDECGARAAPSGTSPPRMAGPVHPRYASEAARLRSFKD WPRCMRQKPEELAEAGFFYTGQGDKTKCFYCDGGLKDWENHDVPWEQHARWF DRCAYVQLVKGREYVQKVISEACEVSASEAERDVAPARTAEPSPPAEAPENSVDD SKLCKICYAEERNVCFVPCGHVVACAKCALAADKCPMCRRTFQNAVRLYFS *
SEQUENCE ID NO:3
SflAP amino acid sequence
Claims (13)
1. An isolated nucleic acid construct comprising a polynucleotide sequence at least 85% identical to SEQ ID NO:l .
2. The isolated nucleic acid construct of claim 1, wherein the polynucleotide sequence is at least 95% identical to SEQ ID NO:l .
3. The isolated nucleic acid construct of claim 2, wherein the polynucleotide is SEQ ID NO: 1.
4. An isolated polypeptide, wherein the polypeptide comprises: a. a polypeptide at least 90%) identical to a polypeptide encoded by SEQ ID NO: 1 ; and b. at least 50 amino acids.
5. The isolated polypeptide of claim 4, wherein the polypeptide is at least 95% identical to SEQ ID NO:3.
6. The isolated polypeptide of claim 5, wherein the polypeptide is SEQ ID NO:3.
7. A host cell comprising a recombinant expression cassette comprising a promoter operably linked to a polynucleotide at least 85% identical to SEQ ID NO:l .
8. The host cell of claim 7, wherein the polynucleotide at least 95% identical to SEQ ID NO: 1.
9. The host cell of claim 7, wherein the polynucleotide is SEQ ID NO:l.
10. The host cell of claim 7, wherein the promoter is inducible.
11. The host cell of claim 7, wherein the promoter is constitutive.
12. The host cell of claim 7, which is an insect cell.
13. The host cell of claim 7, which is a plant cell. 14 A recombinant expression cassette comprising a polynucleotide sequence at least 85% identical to SEQ ID NO 1
15 The recombinant expression cassette of claim 14, wherein the polynucleotide sequence is at least 95% identical to SEQ ID NO 1
16 The recombinant expression cassette of claim 14, wherein the polynucleotide sequence is SEQ ID NO 1
17 The recombinant expression cassettte of claim 14, wherein the promotei is inducible
18 The recombinant expression cassettte of claim 14, wherein the promoter is constitutive
19 A recombinant baculovirus comprising a nucleic acid of claim 1
20 A recombinant baculovirus comprising a nucleic acid of claim 2
21 A transgenic plant comprising a nucleic acid of claim 1
22 A transgenic plant comprising a nucleic acid of claim 2
23 An in vitro method of assaying for a compound capable of specifically binding to an IAP, wherein the method comprises combining an IAP with a test compound and assaying whether the test compound specifically binds to the IAP, wherein the IAP has a sequence at least 95% identical to SEQ ID NO 3
24 An in vitro method of assaying for a modulator of IAP activity, wherein the method comprises combining an IAP with a test compound and assaying whether the test compound can increase or decrease IAP binding specifically to a capsase polypeptide
25 An in vitro method of assaying for the presence of IAP cDNA comprising hybridizing of said cDNA to a nucleic acid of claim 1 , or to a contiguous portion of said nucleic acid at least 20 nucleotides m length, and detecting said hybridization, wherein detection of said hybπdization is indicative of the presence of said IAD cDNA 26 The method of claim 25, wherein said hybridization is conducted on a solid support
27 An in viti o method of assaying for the presence of an IAP comprising binding the IAP with an antibody which specifically binds said IAP, or with a fragment of said antibody which retains specificity for said IAP, and detecting said binding, wherein said detection is indicative of the presence of the IAP
28 The method of claim 27, wherein the binding of the antibody or fragment thereof and of the IAP is detected by means of a enzyme-lmked immunosorbent assay (ELISA)
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US09502528 | 2000-02-10 | ||
US09/502,528 US6570069B1 (en) | 2000-02-10 | 2000-02-10 | Nucleic acids encoding plant inhibitors of apoptosis and transgenic cells and plants expressing them |
PCT/US2001/004071 WO2001059108A2 (en) | 2000-02-10 | 2001-02-07 | Inhibitors of apoptosis |
Publications (1)
Publication Number | Publication Date |
---|---|
AU2001236774A1 true AU2001236774A1 (en) | 2001-08-20 |
Family
ID=23998234
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2001236774A Abandoned AU2001236774A1 (en) | 2000-02-10 | 2001-02-07 | Inhibitors of apoptosis |
Country Status (6)
Country | Link |
---|---|
US (1) | US6570069B1 (en) |
EP (1) | EP1254226A2 (en) |
CN (1) | CN1419603A (en) |
AU (1) | AU2001236774A1 (en) |
CA (1) | CA2399769A1 (en) |
WO (1) | WO2001059108A2 (en) |
Families Citing this family (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2002053586A2 (en) * | 2001-01-08 | 2002-07-11 | The Burnham Institute | Inhibitor of apoptosis proteins and nucleic acids and methods for making and using them |
CA2450669A1 (en) | 2001-06-12 | 2002-12-19 | Pioneer Hi-Bred International, Inc. | Anti-apoptosis genes and methods of use thereof |
IL162090A0 (en) * | 2001-11-21 | 2005-11-20 | Torrey Pines Inst | Agents having a core peptide which derepresses iap-inhibited caspase and pharmaceutical compositionscontaining the same |
WO2005017109A2 (en) * | 2003-06-30 | 2005-02-24 | Massachusetts Institute Of Technology | Nucleic acids and polypeptides required for cell survival in the absence of rb |
US20050227870A1 (en) * | 2004-04-07 | 2005-10-13 | Cotney Floyd C | Method to kill kudzu |
CN106802349A (en) * | 2016-12-30 | 2017-06-06 | 广东华南联合疫苗开发院有限公司 | Sf insect cell host cell proteins Double-antibody sandwich enzymelinked immunosorbent detection kits and method |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU760765B2 (en) | 1997-05-22 | 2003-05-22 | Burnham Institute, The | Screening assays for agents that alter inhibitor of apoptosis (IAP) protein regulation of caspase activity |
MX257801B (en) | 1997-06-02 | 2008-06-10 | Syngenta Participations Ag | Plant transformation methods |
US6162965A (en) * | 1997-06-02 | 2000-12-19 | Novartis Ag | Plant transformation methods |
-
2000
- 2000-02-10 US US09/502,528 patent/US6570069B1/en not_active Expired - Fee Related
-
2001
- 2001-02-07 EP EP01908973A patent/EP1254226A2/en not_active Withdrawn
- 2001-02-07 CN CN01807095.7A patent/CN1419603A/en active Pending
- 2001-02-07 WO PCT/US2001/004071 patent/WO2001059108A2/en not_active Application Discontinuation
- 2001-02-07 AU AU2001236774A patent/AU2001236774A1/en not_active Abandoned
- 2001-02-07 CA CA002399769A patent/CA2399769A1/en not_active Abandoned
Also Published As
Publication number | Publication date |
---|---|
WO2001059108A3 (en) | 2002-06-13 |
WO2001059108A2 (en) | 2001-08-16 |
US6570069B1 (en) | 2003-05-27 |
CN1419603A (en) | 2003-05-21 |
CA2399769A1 (en) | 2001-08-16 |
EP1254226A2 (en) | 2002-11-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Siebel et al. | Soma-specific expression and cloning of PSI, a negative regulator of P element pre-mRNA splicing. | |
Xie et al. | GRAB proteins, novel members of the NAC domain family, isolated by their interaction with a geminivirus protein | |
Du et al. | A novel family of Ca 2+/calmodulin-binding proteins involved in transcriptional regulation: interaction with fsh/Ring3 class transcription activators | |
Leu et al. | Molecular cloning and characterization of an inhibitor of apoptosis protein (IAP) from the tiger shrimp, Penaeus monodon | |
SK131799A3 (en) | Plants with modified growth | |
US20040123349A1 (en) | SINAT5, an Arabidopsis thaliana gene promotes ubiquitin related degradation | |
Freire et al. | Plant lipoxygenase 2 is a translation initiation factor-4E-binding protein | |
EP1161546A2 (en) | Trans-species transfer of apoptotic genes and transgenic plants developed thereby | |
US6570069B1 (en) | Nucleic acids encoding plant inhibitors of apoptosis and transgenic cells and plants expressing them | |
Yamada et al. | An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction | |
Ham et al. | Isolation of a putative tobacco host factor interacting with cucumber mosaic virus-encoded 2b protein by yeast two-hybrid screening | |
Kang et al. | Interaction of Bombyx mori nucleopolyhedrovirus BRO-A and host cell protein laminin | |
Fan et al. | Identification and characterization of a protein kinase-interacting protein encoded by theautographa californicanuclear polyhedrosis virus | |
CA2289863A1 (en) | Plant grab proteins | |
JP2002514423A (en) | Transgenic plant cells expressing recombinant plant E2F peptide | |
EP1214436A2 (en) | Wheat dp proteins and uses thereof | |
Ramirez‐Parra et al. | E2F–DP transcription factors | |
US7052843B2 (en) | Transcription-based assay for identification of post-translational modification and its application in proteomics | |
US7172880B2 (en) | Inhibitor of apoptosis proteins and nucleic acids and methods for making and using them | |
US7202352B2 (en) | Tumor and senescence marker | |
WO2000026634A2 (en) | Compositions and methods for screening agents that inhibit mapk mediated anti-apoptotic signals | |
US20020116734A1 (en) | Plant derived bag homologues | |
Tang et al. | Characterization of an inhibitor of apoptosis gene (BmSurvivin-2) from the silkworm, Bombyx mori | |
EP1259617B1 (en) | Bunyaviridal reaper proteins and uses therefor | |
US20070271634A1 (en) | Preventing stress-induced apoptosis in plants |