ZA200204949B - Treatment of hibernating myocardium witha GLP-1 peptide. - Google Patents
Treatment of hibernating myocardium witha GLP-1 peptide. Download PDFInfo
- Publication number
- ZA200204949B ZA200204949B ZA200204949A ZA200204949A ZA200204949B ZA 200204949 B ZA200204949 B ZA 200204949B ZA 200204949 A ZA200204949 A ZA 200204949A ZA 200204949 A ZA200204949 A ZA 200204949A ZA 200204949 B ZA200204949 B ZA 200204949B
- Authority
- ZA
- South Africa
- Prior art keywords
- glp
- patient
- compound
- group
- compound selected
- Prior art date
Links
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 title claims description 114
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 title claims description 90
- 210000004165 myocardium Anatomy 0.000 title claims description 47
- 238000011282 treatment Methods 0.000 title claims description 46
- 108090000765 processed proteins & peptides Proteins 0.000 title description 26
- 102100025101 GATA-type zinc finger protein 1 Human genes 0.000 title 1
- 102400000322 Glucagon-like peptide 1 Human genes 0.000 claims description 90
- 150000001875 compounds Chemical class 0.000 claims description 53
- 238000000034 method Methods 0.000 claims description 37
- 206010019280 Heart failures Diseases 0.000 claims description 31
- 208000032781 Diabetic cardiomyopathy Diseases 0.000 claims description 26
- 210000002216 heart Anatomy 0.000 claims description 24
- SSAAJZQUEUTACT-MDBKHZGBSA-N exendin 2 Chemical compound C([C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(N)=O)C1=CN=CN1 SSAAJZQUEUTACT-MDBKHZGBSA-N 0.000 claims description 22
- 108010028997 heliodermin Proteins 0.000 claims description 22
- 108010063245 glucagon-like peptide 1 (7-36)amide Proteins 0.000 claims description 21
- 239000003814 drug Substances 0.000 claims description 20
- 206010007559 Cardiac failure congestive Diseases 0.000 claims description 18
- 101800004266 Glucagon-like peptide 1(7-37) Proteins 0.000 claims description 16
- 238000004519 manufacturing process Methods 0.000 claims description 16
- 108010011459 Exenatide Proteins 0.000 claims description 12
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 claims description 12
- 229960001519 exenatide Drugs 0.000 claims description 12
- 108010069764 helospectin I Proteins 0.000 claims description 11
- 108010093781 helospectin II Proteins 0.000 claims description 11
- HTMVMVKJOPFRMK-OYZAELBCSA-N helospectin i Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=C(O)C=C1 HTMVMVKJOPFRMK-OYZAELBCSA-N 0.000 claims description 11
- LKDLKXMXYPSIRO-ZXFPMOGVSA-N helospectin ii Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=C(O)C=C1 LKDLKXMXYPSIRO-ZXFPMOGVSA-N 0.000 claims description 11
- 150000001408 amides Chemical class 0.000 claims description 10
- LMHMJYMCGJNXRS-IOPUOMRJSA-N exendin-3 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@H](C)O)[C@H](C)O)C(C)C)C1=CC=CC=C1 LMHMJYMCGJNXRS-IOPUOMRJSA-N 0.000 claims description 10
- 102400000324 Glucagon-like peptide 1(7-37) Human genes 0.000 claims description 9
- 230000003247 decreasing effect Effects 0.000 claims description 9
- 108010015174 exendin 3 Proteins 0.000 claims description 9
- 206010048858 Ischaemic cardiomyopathy Diseases 0.000 claims description 8
- 230000009467 reduction Effects 0.000 claims description 4
- SFLSHLFXELFNJZ-QMMMGPOBSA-N (-)-norepinephrine Chemical compound NC[C@H](O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-QMMMGPOBSA-N 0.000 claims 6
- 229960002748 norepinephrine Drugs 0.000 claims 6
- SFLSHLFXELFNJZ-UHFFFAOYSA-N norepinephrine Natural products NCC(O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-UHFFFAOYSA-N 0.000 claims 6
- 241000282472 Canis lupus familiaris Species 0.000 description 21
- 102000004196 processed proteins & peptides Human genes 0.000 description 17
- 206010012601 diabetes mellitus Diseases 0.000 description 15
- 230000002107 myocardial effect Effects 0.000 description 15
- 241001465754 Metazoa Species 0.000 description 13
- 102000007446 Glucagon-Like Peptide-1 Receptor Human genes 0.000 description 12
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 description 12
- 235000001014 amino acid Nutrition 0.000 description 12
- 150000001413 amino acids Chemical group 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- 230000000747 cardiac effect Effects 0.000 description 10
- 210000004027 cell Anatomy 0.000 description 10
- 238000001802 infusion Methods 0.000 description 10
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 10
- 230000002829 reductive effect Effects 0.000 description 10
- 229940024606 amino acid Drugs 0.000 description 9
- 238000001356 surgical procedure Methods 0.000 description 9
- 102000005962 receptors Human genes 0.000 description 8
- 230000000694 effects Effects 0.000 description 7
- 230000000004 hemodynamic effect Effects 0.000 description 7
- 239000000902 placebo Substances 0.000 description 7
- 229940068196 placebo Drugs 0.000 description 7
- 108020003175 receptors Proteins 0.000 description 7
- 239000000556 agonist Substances 0.000 description 6
- 230000008602 contraction Effects 0.000 description 6
- 230000008719 thickening Effects 0.000 description 6
- 230000002861 ventricular Effects 0.000 description 6
- QOJJMJKTMKNFEF-ZKWXMUAHSA-N Asp-Val-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CC(O)=O QOJJMJKTMKNFEF-ZKWXMUAHSA-N 0.000 description 5
- JRWZLRBJNMZMFE-UHFFFAOYSA-N Dobutamine Chemical compound C=1C=C(O)C(O)=CC=1CCNC(C)CCC1=CC=C(O)C=C1 JRWZLRBJNMZMFE-UHFFFAOYSA-N 0.000 description 5
- HPJLZFTUUJKWAJ-JHEQGTHGSA-N Glu-Gly-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O HPJLZFTUUJKWAJ-JHEQGTHGSA-N 0.000 description 5
- 101800004295 Glucagon-like peptide 1(7-36) Proteins 0.000 description 5
- 102000004877 Insulin Human genes 0.000 description 5
- 108090001061 Insulin Proteins 0.000 description 5
- GQZMPWBZQALKJO-UWVGGRQHSA-N Lys-Gly-Arg Chemical compound [H]N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O GQZMPWBZQALKJO-UWVGGRQHSA-N 0.000 description 5
- GNRMAQSIROFNMI-IXOXFDKPSA-N Phe-Thr-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O GNRMAQSIROFNMI-IXOXFDKPSA-N 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 150000003943 catecholamines Chemical class 0.000 description 5
- 230000001684 chronic effect Effects 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 229960001089 dobutamine Drugs 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 239000004041 inotropic agent Substances 0.000 description 5
- 229940125396 insulin Drugs 0.000 description 5
- 108091033319 polynucleotide Proteins 0.000 description 5
- 239000002157 polynucleotide Substances 0.000 description 5
- 102000040430 polynucleotide Human genes 0.000 description 5
- GCYXWQUSHADNBF-AAEALURTSA-N preproglucagon 78-108 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 GCYXWQUSHADNBF-AAEALURTSA-N 0.000 description 5
- 230000035882 stress Effects 0.000 description 5
- 230000009885 systemic effect Effects 0.000 description 5
- 208000031229 Cardiomyopathies Diseases 0.000 description 4
- PLQWGQUNUPMNOD-KKUMJFAQSA-N Ser-Tyr-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(O)=O PLQWGQUNUPMNOD-KKUMJFAQSA-N 0.000 description 4
- WMBFONUKQXGLMU-WDSOQIARSA-N Trp-Leu-Val Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N WMBFONUKQXGLMU-WDSOQIARSA-N 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 230000004064 dysfunction Effects 0.000 description 4
- UKVFVQPAANCXIL-FJVFSOETSA-N glp-1 (1-37) amide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 UKVFVQPAANCXIL-FJVFSOETSA-N 0.000 description 4
- 230000004217 heart function Effects 0.000 description 4
- 208000028867 ischemia Diseases 0.000 description 4
- 230000010412 perfusion Effects 0.000 description 4
- 108090000623 proteins and genes Proteins 0.000 description 4
- 230000002685 pulmonary effect Effects 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 108010073969 valyllysine Proteins 0.000 description 4
- NGJOFQZEYQGZMB-KTKZVXAJSA-N (4S)-5-[[2-[[(2S,3R)-1-[[(2S)-1-[[(2S,3R)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[2-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-2-oxoethyl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-2-oxoethyl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-2-oxoethyl]amino]-4-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-4-yl)propanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 NGJOFQZEYQGZMB-KTKZVXAJSA-N 0.000 description 3
- ODHCTXKNWHHXJC-VKHMYHEASA-N 5-oxo-L-proline Chemical compound OC(=O)[C@@H]1CCC(=O)N1 ODHCTXKNWHHXJC-VKHMYHEASA-N 0.000 description 3
- 239000005541 ACE inhibitor Substances 0.000 description 3
- HTQBXNHDCUEHJF-XWLPCZSASA-N Exenatide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 HTQBXNHDCUEHJF-XWLPCZSASA-N 0.000 description 3
- YJIUYQKQBBQYHZ-ACZMJKKPSA-N Gln-Ala-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O YJIUYQKQBBQYHZ-ACZMJKKPSA-N 0.000 description 3
- WRNAXCVRSBBKGS-BQBZGAKWSA-N Glu-Gly-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O WRNAXCVRSBBKGS-BQBZGAKWSA-N 0.000 description 3
- WZPIKDWQVRTATP-SYWGBEHUSA-N Ile-Ala-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](N)[C@@H](C)CC)C(O)=O)=CNC2=C1 WZPIKDWQVRTATP-SYWGBEHUSA-N 0.000 description 3
- DUTMKEAPLLUGNO-JYJNAYRXSA-N Lys-Glu-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O DUTMKEAPLLUGNO-JYJNAYRXSA-N 0.000 description 3
- XMBSYZWANAQXEV-UHFFFAOYSA-N N-alpha-L-glutamyl-L-phenylalanine Natural products OC(=O)CCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XMBSYZWANAQXEV-UHFFFAOYSA-N 0.000 description 3
- 230000001154 acute effect Effects 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- 229940044094 angiotensin-converting-enzyme inhibitor Drugs 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 208000027744 congestion Diseases 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 230000002427 irreversible effect Effects 0.000 description 3
- 230000007774 longterm Effects 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000003680 myocardial damage Effects 0.000 description 3
- -1 norepinepherine Chemical class 0.000 description 3
- 230000036470 plasma concentration Effects 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 238000011084 recovery Methods 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 108010080629 tryptophan-leucine Proteins 0.000 description 3
- FJVAQLJNTSUQPY-CIUDSAMLSA-N Ala-Ala-Lys Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCCCN FJVAQLJNTSUQPY-CIUDSAMLSA-N 0.000 description 2
- MFMDKJIPHSWSBM-GUBZILKMSA-N Ala-Lys-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O MFMDKJIPHSWSBM-GUBZILKMSA-N 0.000 description 2
- 206010003211 Arteriosclerosis coronary artery Diseases 0.000 description 2
- 101100337060 Caenorhabditis elegans glp-1 gene Proteins 0.000 description 2
- 108010003795 GW002 peptide Proteins 0.000 description 2
- JZJGEKDPWVJOLD-QEWYBTABSA-N Glu-Phe-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JZJGEKDPWVJOLD-QEWYBTABSA-N 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- RPTUSVTUFVMDQK-UHFFFAOYSA-N Hidralazin Chemical compound C1=CC=C2C(NN)=NN=CC2=C1 RPTUSVTUFVMDQK-UHFFFAOYSA-N 0.000 description 2
- AFPFGFUGETYOSY-HGNGGELXSA-N His-Ala-Glu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O AFPFGFUGETYOSY-HGNGGELXSA-N 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- 208000013016 Hypoglycemia Diseases 0.000 description 2
- 206010061216 Infarction Diseases 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- YQFZRHYZLARWDY-IHRRRGAJSA-N Leu-Val-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCCN YQFZRHYZLARWDY-IHRRRGAJSA-N 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 206010028594 Myocardial fibrosis Diseases 0.000 description 2
- WUGMRIBZSVSJNP-UHFFFAOYSA-N N-L-alanyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)C(N)C)C(O)=O)=CNC2=C1 WUGMRIBZSVSJNP-UHFFFAOYSA-N 0.000 description 2
- 206010028851 Necrosis Diseases 0.000 description 2
- VZFPYFRVHMSSNA-JURCDPSOSA-N Phe-Ile-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CC1=CC=CC=C1 VZFPYFRVHMSSNA-JURCDPSOSA-N 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- KSCVLGXNQXKUAR-JYJNAYRXSA-N Tyr-Leu-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O KSCVLGXNQXKUAR-JYJNAYRXSA-N 0.000 description 2
- 230000005856 abnormality Effects 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 238000002399 angioplasty Methods 0.000 description 2
- 230000001466 anti-adreneric effect Effects 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000036765 blood level Effects 0.000 description 2
- NPAKNKYSJIDKMW-UHFFFAOYSA-N carvedilol Chemical compound COC1=CC=CC=C1OCCNCC(O)COC1=CC=CC2=NC3=CC=C[CH]C3=C12 NPAKNKYSJIDKMW-UHFFFAOYSA-N 0.000 description 2
- 229960004195 carvedilol Drugs 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 208000029078 coronary artery disease Diseases 0.000 description 2
- 208000026758 coronary atherosclerosis Diseases 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 238000002592 echocardiography Methods 0.000 description 2
- 230000004761 fibrosis Effects 0.000 description 2
- 125000000524 functional group Chemical group 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 230000002218 hypoglycaemic effect Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000007574 infarction Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000000297 inotrophic effect Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 230000000302 ischemic effect Effects 0.000 description 2
- 108010009298 lysylglutamic acid Proteins 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 230000010016 myocardial function Effects 0.000 description 2
- 208000002089 myocardial stunning Diseases 0.000 description 2
- 230000017074 necrotic cell death Effects 0.000 description 2
- 230000036284 oxygen consumption Effects 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 238000002600 positron emission tomography Methods 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 235000018102 proteins Nutrition 0.000 description 2
- 102000004169 proteins and genes Human genes 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 210000002820 sympathetic nervous system Anatomy 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- CEGXZKXILQSJHO-KODRXGBYSA-N (3r,4s,5r)-3,4,5,6-tetrahydroxyhexanoyl fluoride Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)CC(F)=O CEGXZKXILQSJHO-KODRXGBYSA-N 0.000 description 1
- SLNCSSWAIDUUGF-LSJOCFKGSA-N Arg-His-Ala Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(O)=O SLNCSSWAIDUUGF-LSJOCFKGSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 206010007572 Cardiac hypertrophy Diseases 0.000 description 1
- 102100037355 Chromosome alignment-maintaining phosphoprotein 1 Human genes 0.000 description 1
- 206010011953 Decreased activity Diseases 0.000 description 1
- 201000010046 Dilated cardiomyopathy Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- 102100023374 Forkhead box protein M1 Human genes 0.000 description 1
- LSPKYLAFTPBWIL-BYPYZUCNSA-N Glu-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)NCC(O)=O LSPKYLAFTPBWIL-BYPYZUCNSA-N 0.000 description 1
- JDUKCSSHWNIQQZ-IHRRRGAJSA-N Glu-Phe-Glu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O JDUKCSSHWNIQQZ-IHRRRGAJSA-N 0.000 description 1
- 102000051325 Glucagon Human genes 0.000 description 1
- 108060003199 Glucagon Proteins 0.000 description 1
- 108010088406 Glucagon-Like Peptides Proteins 0.000 description 1
- 102400000325 Glucagon-like peptide 1(7-36) Human genes 0.000 description 1
- 102400000326 Glucagon-like peptide 2 Human genes 0.000 description 1
- 101800000221 Glucagon-like peptide 2 Proteins 0.000 description 1
- RJIVPOXLQFJRTG-LURJTMIESA-N Gly-Arg-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)CN)CCCN=C(N)N RJIVPOXLQFJRTG-LURJTMIESA-N 0.000 description 1
- CQZDZKRHFWJXDF-WDSKDSINSA-N Gly-Gln-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CN CQZDZKRHFWJXDF-WDSKDSINSA-N 0.000 description 1
- LLWQVJNHMYBLLK-CDMKHQONSA-N Gly-Thr-Phe Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O LLWQVJNHMYBLLK-CDMKHQONSA-N 0.000 description 1
- 241000270431 Heloderma suspectum Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- FRJIAZKQGSCKPQ-FSPLSTOPSA-N His-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CN=CN1 FRJIAZKQGSCKPQ-FSPLSTOPSA-N 0.000 description 1
- MDCTVRUPVLZSPG-BQBZGAKWSA-N His-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CNC=N1 MDCTVRUPVLZSPG-BQBZGAKWSA-N 0.000 description 1
- RXVOMIADLXPJGW-GUBZILKMSA-N His-Asp-Glu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O RXVOMIADLXPJGW-GUBZILKMSA-N 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000741320 Homo sapiens Cathelicidin antimicrobial peptide Proteins 0.000 description 1
- 101000880066 Homo sapiens Chromosome alignment-maintaining phosphoprotein 1 Proteins 0.000 description 1
- 101000907578 Homo sapiens Forkhead box protein M1 Proteins 0.000 description 1
- 101000788682 Homo sapiens GATA-type zinc finger protein 1 Proteins 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- NEEOBPIXKWSBRF-IUCAKERBSA-N Leu-Glu-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O NEEOBPIXKWSBRF-IUCAKERBSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 208000021908 Myocardial disease Diseases 0.000 description 1
- 208000031481 Pathologic Constriction Diseases 0.000 description 1
- HOYQLNNGMHXZDW-KKUMJFAQSA-N Phe-Glu-Arg Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O HOYQLNNGMHXZDW-KKUMJFAQSA-N 0.000 description 1
- ODHCTXKNWHHXJC-GSVOUGTGSA-N Pyroglutamic acid Natural products OC(=O)[C@H]1CCC(=O)N1 ODHCTXKNWHHXJC-GSVOUGTGSA-N 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 206010038748 Restrictive cardiomyopathy Diseases 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 239000002262 Schiff base Substances 0.000 description 1
- 150000004753 Schiff bases Chemical class 0.000 description 1
- SWSRFJZZMNLMLY-ZKWXMUAHSA-N Ser-Asp-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O SWSRFJZZMNLMLY-ZKWXMUAHSA-N 0.000 description 1
- OLKICIBQRVSQMA-SRVKXCTJSA-N Ser-Ser-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O OLKICIBQRVSQMA-SRVKXCTJSA-N 0.000 description 1
- MXNAOGFNFNKUPD-JHYOHUSXSA-N Thr-Phe-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MXNAOGFNFNKUPD-JHYOHUSXSA-N 0.000 description 1
- IVDFVBVIVLJJHR-LKXGYXEUSA-N Thr-Ser-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O IVDFVBVIVLJJHR-LKXGYXEUSA-N 0.000 description 1
- LCPVBXOHXMBLFW-JSGCOSHPSA-N Trp-Arg Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)=CNC2=C1 LCPVBXOHXMBLFW-JSGCOSHPSA-N 0.000 description 1
- DIOSYUIWOQCXNR-ONGXEEELSA-N Val-Lys-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O DIOSYUIWOQCXNR-ONGXEEELSA-N 0.000 description 1
- PZTZYZUTCPZWJH-FXQIFTODSA-N Val-Ser-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PZTZYZUTCPZWJH-FXQIFTODSA-N 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- ODHCTXKNWHHXJC-UHFFFAOYSA-N acide pyroglutamique Natural products OC(=O)C1CCC(=O)N1 ODHCTXKNWHHXJC-UHFFFAOYSA-N 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000036586 afterload Effects 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 239000002220 antihypertensive agent Substances 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 150000001483 arginine derivatives Chemical class 0.000 description 1
- 230000004872 arterial blood pressure Effects 0.000 description 1
- 210000001367 artery Anatomy 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 150000001510 aspartic acids Chemical class 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 102000012740 beta Adrenergic Receptors Human genes 0.000 description 1
- 108010079452 beta Adrenergic Receptors Proteins 0.000 description 1
- 230000027455 binding Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- VHYCDWMUTMEGQY-UHFFFAOYSA-N bisoprolol Chemical compound CC(C)NCC(O)COC1=CC=C(COCCOC(C)C)C=C1 VHYCDWMUTMEGQY-UHFFFAOYSA-N 0.000 description 1
- 229960002781 bisoprolol Drugs 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 230000036770 blood supply Effects 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- WDRMVIMVHHWVBI-STCSGHEYSA-N chembl1222074 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)N[C@@H](CC=1NC=NC=1)C(O)=O)[C@@H](C)O)[C@H](C)O)C(C)C)C1=CC=CC=C1 WDRMVIMVHHWVBI-STCSGHEYSA-N 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 230000004087 circulation Effects 0.000 description 1
- 208000035850 clinical syndrome Diseases 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000001010 compromised effect Effects 0.000 description 1
- 230000009091 contractile dysfunction Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 238000013480 data collection Methods 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 230000000994 depressogenic effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011833 dog model Methods 0.000 description 1
- 210000003158 enteroendocrine cell Anatomy 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- 230000003090 exacerbative effect Effects 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000000446 fuel Substances 0.000 description 1
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 1
- 229960004666 glucagon Drugs 0.000 description 1
- TWSALRJGPBVBQU-PKQQPRCHSA-N glucagon-like peptide 2 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 TWSALRJGPBVBQU-PKQQPRCHSA-N 0.000 description 1
- 230000009229 glucose formation Effects 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- 108010010147 glycylglutamine Proteins 0.000 description 1
- 230000005802 health problem Effects 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 230000006266 hibernation Effects 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000013537 high throughput screening Methods 0.000 description 1
- 108010040030 histidinoalanine Proteins 0.000 description 1
- 229960002474 hydralazine Drugs 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 230000007954 hypoxia Effects 0.000 description 1
- 210000003405 ileum Anatomy 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 210000002660 insulin-secreting cell Anatomy 0.000 description 1
- 206010022498 insulinoma Diseases 0.000 description 1
- 230000002473 insulinotropic effect Effects 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 125000000468 ketone group Chemical group 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000011866 long-term treatment Methods 0.000 description 1
- 208000020442 loss of weight Diseases 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- IUBSYMUCCVWXPE-UHFFFAOYSA-N metoprolol Chemical compound COCCC1=CC=C(OCC(O)CNC(C)C)C=C1 IUBSYMUCCVWXPE-UHFFFAOYSA-N 0.000 description 1
- 229960002237 metoprolol Drugs 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 208000031225 myocardial ischemia Diseases 0.000 description 1
- 210000000107 myocyte Anatomy 0.000 description 1
- 210000004457 myocytus nodalis Anatomy 0.000 description 1
- 230000002182 neurohumoral effect Effects 0.000 description 1
- 150000002823 nitrates Chemical class 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- 230000010627 oxidative phosphorylation Effects 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 238000006213 oxygenation reaction Methods 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 208000021255 pancreatic insulinoma Diseases 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 230000036581 peripheral resistance Effects 0.000 description 1
- 229940080469 phosphocellulose Drugs 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000036316 preload Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 238000005086 pumping Methods 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 239000000018 receptor agonist Substances 0.000 description 1
- 229940044601 receptor agonist Drugs 0.000 description 1
- 208000037803 restenosis Diseases 0.000 description 1
- 230000000250 revascularization Effects 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 231100000241 scar Toxicity 0.000 description 1
- 230000037390 scarring Effects 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 238000002603 single-photon emission computed tomography Methods 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 230000036262 stenosis Effects 0.000 description 1
- 208000037804 stenosis Diseases 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000000153 supplemental effect Effects 0.000 description 1
- 238000007892 surgical revascularization Methods 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- XOAAWQZATWQOTB-UHFFFAOYSA-N taurine Chemical group NCCS(O)(=O)=O XOAAWQZATWQOTB-UHFFFAOYSA-N 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 238000003325 tomography Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 230000000304 vasodilatating effect Effects 0.000 description 1
- 229940124549 vasodilator Drugs 0.000 description 1
- 239000003071 vasodilator agent Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 239000002435 venom Substances 0.000 description 1
- 210000001048 venom Anatomy 0.000 description 1
- 231100000611 venom Toxicity 0.000 description 1
Landscapes
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Description
LR
TREATMENT OF HIBERNATING MYOCARDIUM
AND DIABETIC CARDIOMYOPATHY
WITH A GLP-1 PEPTIDE
Inventors: Thomas R. Coolidge and Mario Ehlers
This application claims priority to U.S. Application Ser. Nos. 60/241,834, filed
October 20, 2000, 60/60/242,139, filed October 23, 2000, and 60/245,234, filed November 3, 2000, all of which are hereby incorporated by reference. ~ BACKGROUND OF THE INVENTION
Heart failure continues to be a major health problem. Approximately four million persons in the U.S. population have heart failure. With a steadily aging population, four hundred thousand individuals experience new onset heart failure each year, with a five year mortality rate approaching fifty percent.
Rather than a single pathological entity, “heart failure” defines a clinical syndrome with many different etiologies that reflects a fundamental abnormality in effective mechanical performance of the heart, such that the heart is unable to meet the demands of the body. There are various forms of heart failure, including “forward” and “backward” heart failure.
Backward failure, synonymous with congestive heart failure, is due to increase in venous pressure (i.e., increase in pressure in the veins that return blood to the heart) resulting from the inability of the heart to discharge its contents normally, leading to pulmonary and systemic congestion. By contrast, forward failure is caused by an inability of the heart to maintain normal tissue perfusion, resulting in fatigue, weakness, loss of weight, and impairment of cerebral function.
Hibernating Myocardium “Hibernating myocardium” constitutes a significant fraction of forward heart failures, and it may or may not be accompanied by pulmonary or systemic congestion. This condition reflects localized depressed myocardial function as a result of chronic non-critical ischemia
(hypoxia resulting from low blood supply). The degree of ischemia is not sufficient to produce necrosis (infarction), but it locally restricts myocardial oxygenation and fuel supply, such that a part of the myocardium becomes hypoactive or dormant. Hibernating myocytes remain viable but do not contribute to the pumping action of the heart. The severity of myocardial damage depends on the duration of hibernation. Eventually, the damage may become irreversible and may lead to heart failure when the extent of myocardial dysfunction is great enough to compromise cardiac performance and reduce the cardiac output; that is, ischemic cardiomyopathy may be the ultimate result of hibernating myocardium, if it is not treated appropriately.
Traditionally, hibernating myocardium has been treated by surgical revascularization through coronary bypass surgery or angioplasty. The inconvenience of surgery and the incidence of morbidity or restenosis associated with these techniques underscores the need for supplemental or alternative pharmacological intervention. Fath-Ordoubadi ef al., Heart 82: 210-216 (1999) and Pagano et al., Curr. Opin. Cardiol. 14: 506-509 (1999). Effective pharmacological intervention would be especially useful where surgery is contraindicated, as in the case of mild hibernating myocardium, or where the patient’s condition is considered too serious for surgery.
Congestive heart failure was first treated pharmacologically with vasodilators and inotropic agents, which increase cardiac muscle contractility. See WO 99/40788. While these drugs improved hemodynamics over the short term, recent studies have found a discrepancy between improved hemodynamics and clinical outcome. In fact, the only risk factor found predictive of morbidity associated with congestive heart failure is the plasma level of the catecholamine norepinepherine. Cohn ef al., “Plasma norepinepherine as a guide to prognosis in patients with chronic congestive heart failure.” N. Engl. J. Med. 311: 819-823 (1984);
Lahiri et al., J. Cardio. Pharm. 33 (Suppl. 3): S9-S16 (1999). Thus, in the case of congestive heart failure, long term administration of inotropic agents is contraindicated. The compounds most useful to treat congestive heart failure have proven to be ACE inhibitors, which have a
= WO 02/34285 PCT/US01/32559 + vasodilating effect, and multi-functional B-blockers like carvedilol, which exert an anti- adrenergic effect. Lahiri er al. (1999).
Like congestive heart failure, there is evidence that administration of inotropic agents may worsen ischemia associated with hibernating myocardium. In one study, low level treatment with the inotrope dobutamine increased myocardial function in hibernating myocardium, but high levels of dobutamine increased myocardial demand to the point where it ~ passed an ischemic threshold. Senioer ef al., “Enhanced detection of myocardial ischaemia by stress dobutamine echocardiography utilising the ‘biphasis’ response of wall thickening during low and high dose dobutamine infusion.” J. Am. Coll. Cardiol. 26: 26-32 (1995). This and similar studies have raised questions about the long term benefit to mortality from inotropic agents, despite their short term hemodynamic benefit. In particular, it has been proposed that further increases in myocardial demand may enhance ishemia associated with hibernating myocardium, thereby exacerbating necrosis and apoptosis. Lahiri et al. (1999).
Accordingly, it has been suggested that inotropic agents also are contraindicated for hibernating myocardium, and that hibernating myocardium should be treated with the same non-inotropic, or anti-adrenergic, agents that are used to treat congestive heart failure. By analogy to congestive heart failure, it has also been suggested that high plasma levels of catecholamines, like norepinepherine, are deleterious to clinical outcome of hibernating myocardium, because of their inotropic properties. Lahiri ef al. (1999).
As there are only a handful of agents known to have limited efficacy for the long term treatment of hibernating myocardium, there remains a strong need for new therapeutic agents which have the potential to revitalize hibernating cells. In particular, there remains a strong need to find agents that can reduce the plasma blood level of catecholamines.
Diabetic Cardiomyopathy
Patients with diabetes are at high risk for developing diabetic cardiomyopathy (DCM).
The exact etiology of this disease remains controversial, in part because many myocardial abnormalities are associated with diabetes. DCM is clearly defined, however, as a reversible cardiomyopathy that occurs in the absence of coronary atherosclerosis. Bell, Diabetes Care
18: 708-714 (1995). DCM is further characterized by myocardial fibrosis, that can be partially attributable to ischemia. Id. Hypertension, also characteristic of diabetes, can aggravate fibrosis to the point where DCM can become a serious, even fatal, condition. Id.
This hypertension is at least in part due to an abnormal activation of the sympathetic nervous system. Pallab er al., Am. J. Physiol. 252: E734-739. Among the manifestations of this aberrant activation is an increase in the level of norepinepherine in the heart, as well as its altered metabolism by the heart. Id. High levels of catecholamines, such as norepinepherine, in the heart or circulation result in the development of DCM. The accompanying myocardial damage is believed to be in part caused by the oxidative breakdown products of norepinepherine. Jd. An ideal anti-hypertension agent for the diabetic patient thus would reduce the activation of the sympathetic nervous system without worsening hyperglycemia or hypoglycemia. Presently, very few compounds provide these characteristics.
Administration of GLP-1 has been found unexpectedly to suppress plasma blood levels of norepinepherine. ~ By analogy to congestive heart failure, reduction in plasma norepinepherine levels will be expected to ease the ischemic stress to hibernating myocardium, thereby improving the clinical outcome. Accordingly, administration of GLP-1 will be useful in a method to treat hibernating myocardium, either alone or in conjunction with existing treatment regimes. Likewise, GLP-1 will be useful in reducing norepinepherine levels in the heart and/or plasma that are associated with the development of diabetic cardiomyopathy.
GLP-1 reduces plasma norepinepherine levels in a method of treating hibernating myocardium or diabetic cardiomyopathy. Thus, a method for treating hibernating myocardium or diabetic cardiomyopathy comprises administering a therapeutically effective amount of a
GLP-1 molecule to said patient. A GLP-1 molecule also may be administered in therapeutically effective amount to a patient suffering from congestive heart failure or ischemic cardiomyopathy, particularly one who also has hibernating myocardium. A therapeutically effective amount of a GLP-1 molecule reduces the plasma and/or heart norepinepherine level.
a. WO 02/34285 PCT/US01/32559
A GLP-1 molecule preferably is delivered intravenously or subcutaneously. The former is preferred for acute treatment with a GLP-1 molecule, while the latter is preferred in chronic treatment regimens.
Preferred GLP-1 molecules of the invention include GLP-1(7-36) amide, GLP-1(7-37), and exendin-4. GLP-1 molecules include those molecules that specifically bind to and activate the GLP-1 receptor.
FIGURES 1-4 summarize the results obtained from two representative animals, Dog A (treatment) and Dog B (placebo).
FIGURE 1 demonstrates changes in left ventricular (LV) contractility, as measured by } the rate of change of LV pressure (dP/dt).
FIGURE 2 demonstrates changes in LV ejection fraction (EF), as measured by percent emptying of the LV during systole. :
FIGURE 3 illustrates LV contraction, as reflected by the degree of wall thickening.
FIGURE 4 reflects changes in overall cardiac function, as measured by cardiac output (CO), which is the volume of blood (in mL) pumped per minute,
The present invention provides movel methods and compositions for treatment of hibernating myocardium (HM). In particular, the present invention includes a method of treating a patient with HM by administering a therapeutically effective amount of a GLP-1 molecule to the patient. The present inventors have surprisingly discovered that in mammals suffering from HM, administration of a GLP-1 molecule resulted in rapid recovery of heart function, compared with non-treated subjects. This recovery is associated with an unexpected decrease in the plasma levels of norepinepherine in treated mammals.
As used in this application “congestive heart failure” (“CHF”) denotes a condition characterized by an increase in venous pressure that results from the inability of the heart to discharge its contents normally, leading to pulmonary and systemic congestion. The heart muscle of a patient with CHF has a reduced ability to act as a pump. CHF is accompanied by circulatory and neurohumoral changes which result in failure to deliver sufficient blood and oxygen supply to peripheral tissues and vital organs. “Hibernating myocardium” means viable myocardium with impaired function due to reduced perfusion. HM retains cellular integrity, but cannot sustain high-energy requirements of contraction. HM is distinguished from infarcted myocardium, which is irreversible myocardial damage with formation of a scar, and from stunned myocardium, which is myocardium with contractile dysfunction despite normalization of perfusion. Jadvar ez al.,
RadioGraphics 19: 915-926 (1999).
Clinically, HM may be detected by the use of dobutamine stress echocardiography.
Shan ef al., In Cardiology Clinics, G. Aurigemma, ed., W.B. Saunders Co., Philadelphia,
Vol. 17, No. 3, pages 539-553 (1999). HM may also be detected by cardiac positron emission tomography (PET), which is more accurate than single photon emission tomography (SPECT).
PET with 2-(fluorine-18) fluoro-2-deoxy-D-glucose is considered the standard of reference for determining regional or left ventricular function, following revascularization, to identify viable hibernating myocardium. Stress magnetic resonance imaging has been used to further diagnose hibernating myocardium and distinguish this disease from other myocardial disease states. HM is characterized by decrease in left ventricular (LV) function that is moderate, compared to the severe decrease associated with irreversible dysfunction or scarring. The degree of systolic wall thickening (SWT) is also characteristic of myocardial hibernation. SWT is severely decreased at rest, compared to normal or irreversibly damaged or scarred myocardium, and
SWT dysfunction distinctively improves during stress. Sensky ef al., Radiology 215: 608-614. “Diabetic cardiomyopathy” (DCM) is defined as a reversible cardiomyopathy in diabetics that occurs in the absence of coronary atherosclerosis. Bell, Diabetes Care 18: 708- 714 (1995); Fein, Diabetes Care 13: 1169-1179 (1990). DCM is characterized by myocardial hypertrophy and fibrosis. Microvascular pathology is also present, and, in some cases, both congestive and restrictive cardiomyopathies are present. Id.
The “paced dog” model, used in the Example below, provides a system to study HM, because the exertion of the heart exceeds the heart’s ability to respond, which creates an energy-limited situation. Other suitable animal models are available to study chronically dysfunctional viable myocardium, in dogs and pigs, for example, which allow laboratory study of therapeutic regimens. For example, the fixed LAD (left anterior descending artery) stenosis model in pigs demonstrates cardiac dysfunction with reduced myocardial perfusion that is analogous to humans with HM in the absence of infarction. Canty et al., Am. J. Physiol. 277.
H417-H422 (1999). Similar animal models in diabetic dogs, mice and rats are available for the study of DCM. Bell (1995); Fein (1990).
A “GLP-1 molecule” includes the following. Mammalian GLP peptides and glucagon are encoded by the same gene. In the ileum, the phenotype is processed into two major classes of GLP peptide hormones, namely GLP-1 and GLP-2. GLP-1 (1-37) has the sequence His Asp
Glu Phe Glu Arg His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly Gln Ala
Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg Gly (SEQ ID NO:1). GLP-1 (1-37) is amidated by post-translational processing to yield GLP-1 (1-36) NH, which has the sequence
His Asp Glu Phe Glu Arg His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly
Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg (NH,) (SEQ ID NO:2); or is enzymatically processed to yield GLP-1 (7-37) which has the sequence His Ala Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val
Lys Gly Arg Gly (SEQ ID NO:3). GLP-1 (7-37) can also be amidated to yield GLP-1 (7-36) amide which is the natural form of the GLP-1 molecule, and which has the sequence His Ala
Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly Gln Ala Ala Lys Glu Phe Ile Ala
Trp Leu Val Lys Gly Arg (NH,) (SEQ ID NO:4) and in the natural form of the GLP-1 molecule. Likewise, GLP-1(1-36) (NH,) can be processed to GLP-1 (7-36) (NH,).
Intestinal L cells secrete GLP-1 (7-37) (SEQ ID NO:3) and GLP-1(7-36)NH, (SEQ ID
NO: 4) in a ratio of 1 to 5, respectively. These truncated forms of GLP-1 have short in situ half-lives, i.e., less than 10 minutes, and are inactivated by an aminodipeptidase IV to yield
Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly Gln Ala Ala Lys Glu Phe Ile Ala
Trp Leu Val Lys Gly Arg Gly (SEQ ID NO:5); and Glu Gly Thr Phe Thr Ser Asp Val Ser Ser
Tyr Leu Glu Gly Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg (NH,) (SEQ ID NO:6); respectively. The peptides Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly
Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg Gly (SEQ ID NO:5) and Glu Gly
Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu
Val Lys Gly Arg (NH,) (SEQ ID NO:6), have been speculated to affect hepatic glucose production, but do not stimulate production or release of insulin from the pancreas.
As used in this specification, the term “GLP-1 molecule” includes GLP-1 (1-37), GLP- 1 (1-36) NH,, GLP-1 (7-37), GLP-1 (7-36) NH, (“GLP-1 (7-36) amide”) (collectively referred to as “GLP-1 peptides”). The present invention includes the use of recombinant human GLP-1 peptides as well as GLP-1 peptides derived from other species, whether recombinant or synthetic. “GLP-1 molecule” further denotes biologically active variants, analogs and derivatives of GLP-1 peptides. “Biologically active,” in this context, means having GLP-1 (7-36) biological activity, but it is understood that the activity of the variant can be either less potent or more potent than native GLP-1 (7-36) amide. GLP-1 (7-36) amide is a native, biologically active form of GLP-1. See Goke et al., Diabetic Medicine. 13:854-860 (1996). GLP-1 molecules of the present invention include polynucleotides that express agonists of GLP-1, i.e. activators of the GLP-1 receptor molecule and its secondary messenger activity found on insulin-producing B-cells, among others. GLP-1 mimetics that also are agonists of GLP-1 receptors on P-cells include, for example, chemical compounds specifically designed to activate the GLP-1 receptor.
GLP-1 molecule biological activity can be determined by in vitro and in vivo animal models and human studies as is well known to the skilled artisan. Included as GLP-1 molecules are any molecules, whether they be peptides, peptide mimetics, or other molecules that bind to or activate a GLP-1 receptor, such as the GLP-1 (7-36) amide receptor, and its second messenger cascade. GLP-1 receptors are cell-surface proteins found, for example, on insulin-producing pancreatic B-cells. The GLP-1 (7-36) receptor has been characterised in the art. Methods of determining whether a chemical or peptide binds to or activates a GLP-1 receptor are known to the skilled artisan and are preferably carried out with the aid of combinatorial chemical libraries and high throughput screening techniques. GLP-1 molecules include species having insulinotropic activity and that are agonists of the GLP-1 receptor molecule and its second messenger activity on insulin producing B-cells, among others.
GLP-1 biological activity can be determined by standard methods, in general, by receptor-binding activity screening procedures which involve providing appropriate cells that express the GLP-1 receptor on their surface, for example, insulinoma cell lines such as
RINmSF cells or INS-1 cells. See Mosjov, Int. J. Peptide Protein Res. 40: 333-343 (1992) and EP 708170: Cells that are engineered to express a GLP-1 receptor also can be used. In addition to measuring specific binding of tracer to membrane using radioimmunoassay methods, CAMP activity or glucose dependent insulin production can also be measured. In one method, a polynucleotide encoding the receptor of the present invention is employed to transfect cells to thereby express the GLP-1 receptor protein. Thus, for example, these methods may be employed for screening for a receptor agonist by contacting such cells with compounds to be screened and determining whether such compounds activate the receptor and generate a signal.
Polyclonal and monoclonal antibodies can be utilized to detect purify and identify GLP- 1 like peptides for use in the methods described herein. Antibodies such as ABGA1178 detect intact unspliced GLP-1 (1-37) or N-terminally-truncated GLP-1 (7-37) or (7-36) amide. Other antibodies detect on the very end of the C-terminus of the precursor molecule, a procedure which allows by subtraction to calculate the amount of biologically active truncated peptide, such as GLP-1 (7-37) amide. See Orskov et al., Diabetes 42: 658-661 (1993) and Orskov et al., J. Clin. Invest. 87: 415-423 (1991).
Other screening techniques include the use of cells which express the GLP-1 receptor, for example, transfected CHO cells, in a system which measures extracellular pH or ionic oe WO 02/34285 PCT/US01/32559 changes caused by receptor activation. For example, potential agonists may be contacted with a cell which expresses the GLP-1 protein receptor and a second messenger response, €.g. signal transduction or ionic or pH changes, may be measured to determine whether the potential agonist is effective.
Agonists of glucagon-like peptide that exhibit activity through the GLP-1 (7-36) amide receptor have been described in EP 0708179; Hjorth et al., J. Biol. Chem. 269 (48): 30121- 30124 (1994); Siegel et al., Amer. Diabetes Assoc. 57% Scientific Sessions, Boston (1997);
Hareter et al., Amer. Diabetes Assoc. 57% Scientific Sessions, Boston (1997); Adelhorst et al.,
J. Biol. Chem. 269(9): 6275-6278 (1994); Deacon ef al., 16" International Diabetes Federation
Congress Abstracts, Diabetologia Supplement (1997); Irwin et al., Proc. Natl. Acad. Sci.
USA. 94: 7915-7920 (1997); Mosjov, Int. J. Peptide Protein Res. 40: 333-343 (1992). See also Goke et al., Diabetic Medicine 13: 854-860 (1996). Recent publications disclose Black
Widow GLP-1 and Ser” GLP-1. See Holz er al., Comparative Biochemistry and Physiology,
Part B 121: 177-184 (1998) and Ritzel ez al., “A synthetic glucagon-like peptide-1 analog with improved plasma stability,” J. Endocrinol. 159(1): 93-102 (1998). “GLP-1 molecules” also include peptides that are encoded by polynucleotides that express biologically active GLP-1 variants as defined herein. Also included in the present invention are GLP-1 molecules that are peptides containing ome or more amino acid substitutions, additions or deletions, compared with GLP-1 (7-36) amide. In one embodiment, the number of substitutions, deletions, or additions is 30 amino acids or less, 25 amino acids or less, 20 amino acids or less, 15 amino acids or less, 10 amino acids or less, 5 amino acids or less or any integer in between these amounts. In one aspect of the invention, the substitutions include one or more conservative substitutions. A “conservative” substitution denotes the replacement of an amino acid residue by another, biologically active similar residue.
Examples of conservative substitution include the substitution of one hydrophobic residue, such as isoleucine, valine, leucine or methionine for another, or the substitution of one polar residue for another, such as the substitution of arginine for lysine, glutamic for aspartic acids,
Te WO 02/34285 PCT/US01/32559 or glutamine for asparagine, and the like. The following table lists illustrative, but non- limiting, conservative amino acid substitutions.
ORIGINAL RESIDUE EXEMPLARY SUBSTITUTIONS
ALA SER, THR
ARG LYS
ASN HIS, SER
ASP GLU, ASN
CYS SER
GLN ASN, HIS
GLU ASP, GLU
GLY ALA, SER
HIS ASN, GLN
ILE LEU, VAL, THR
LEU ILE, VAL
LYS ARG, GLN, GLU, THR
MET LEU, ILE, VAL
PHE LEU, TYR
SER THR, ALA, ASN
THR SER, ALA
TRP ARG, SER
TYR PHE
VAL ILE, LEU, ALA
ES ALA
It is further understood that GLP-1 peptide variants include the above described peptides which have been chemically derivatized or altered, for example, peptides with non-
Loe WO 02/34285 PCT/US01/32559 natural amino acid residues (e.g., taurine residue, beta and gamma amino acid residues and D- amino acid residues), C-terminal functional group modifications such as amides, esters, and C- terminal ketone modifications and N-terminal functional group modifications such as acylated amines, Schiff bases, or cyclization, such as found for example in the amino acid pyroglutamic acid.
Also included in the present invention are peptide sequences having greater than 50 percent sequence identity, and preferably greater than 90 percent sequence identity to (1) SEQ
ID NOS:1, 2, 3, 4; and (2) to truncated sequences thereof. As used herein, sequence identity refers to a comparison made between two molecules using standard algorithms well known in the art. The preferred algorithm for calculating sequence identity for the present invention is the Smith-Waterman algorithm, where SEQ ID NO:1 is used as the reference sequence to define the percentage identity of polynucleotide homologs over its length. The choice of parameter values for matches, mismatches, and inserts or deletions is arbitrary, although some parameter values have been found to yield more biologically realistic results than others. One preferred set of parameter values for the Smith-Waterman algorithm is set forth in the “maximum similarity segments” approach, which uses values of 1 for a matched residue and - 1/3 for a mismatched residue (a residue being either a single nucleotide or single amino acid) (Waterman, Bulletin of Mathematical Biology 46:473-500 (1984)). Insertions and deletions (indels), x, are weighted as x = 1+ K3, where k is the number of residues in a given insert or deletion (Id.).
For instance, a sequence that is identical to the 42 amino acid residue sequence of SEQ
ID NO:1, except for 18 amino acid substitutions and an insertion of 3 amino acids, would have a percent identity given by: [(1 x 42 matches) - (V5 x 18 mismatches) - (1 + 3/3 indels)] / 42 = 81% identity.
se WO 02/3428 PCT/US01/32559
Also included in “GLP-1 molecules” of the present invention are six peptides in Gila monster venoms that are homologous to GLP-1. Their sequences are compared to the sequence of GLP-1 in Table 1.
TABLE 1
Position 1 a. HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (NH) b. HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (NH,
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS(NH) d HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (NH) e. HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS f. HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS
B. HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP (NH =n HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP (NH) a=GLP-1 (7-36) amide (SEQ. ID NO:4) b=Exendin 3(SEQ. ID NO:7). c=Exendin 4(9-39(NH,(SEQ. ID NO:8). d=Exendin 4(SEQ. ID NO:9). e=Helospectin I(SEQ. ID NO:10). f=Helospectin II(SEQ. ID NO:11). g=Helodermin(SEQ. ID NO:12). h=Q® Q’ Helodermin(SEQ. ID No:13).
Peptides (a, b, d, ¢, f and g) are homologous in positions 1, 7, 11 and 18. GLP-1 and exendins are further homologous in positions, 4, 5, 6, 8, 9, 15, 22, 23, 25,26 and 29. In position 2, A, S and G are structurally similar. In position 3, residues D arid E (Asp and Glu) are structurally similar. In positions 22 and 23, F (Phe) and I (Ile) are structurally similar to Y (Tyr) and L (Leu), respectively. Likewise, in position 26, L and I are structurally equivalent.
“a WO 02/34285 PCT/US01/32559
Thus, of the 30 residues of GLP-1, exendins 3 and 4 are identical in 15 positions and equivalent in 5 additional positions. The only positions where radical structural changes are evident are at residues 16, 17, 19, 21, 24, 27, 28 and 30. Exendins also have 9 extra residues at the carboxyl terminus.
The GLP-1 molecules of the invention that are peptides that can be made by solid state chemical peptide synthesis. Such peptides can also be made by conventional recombinant techniques using standard procedures described in, for example, Sambrook ef al., “Molecular
Cloning, a Laboratory Manual,” Cold Spring Harbor Press, N.Y (1989). “Recombinant”, as used herein, means that a gene is derived from a recombinant (e.g., microbial or mammalian) expression system which has been genetically modified to contain polynucleotide encoding a
GLP-1 molecule as described herein.
The GLP-1 like peptides can be recovered and purified from recombinant cell cultures by methods including, but not limited to, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chroma- tography and lectin chromatography. High performance liquid chromatography (HPLC) can be employed for final purification steps.
The GLP-1 molecule peptides of the present invention may be a naturally purified product, or a product of chemical synthetic procedures, or produced by recombinant techniques from prokaryotic or eukaryotic hosts (for example, by bacteria, yeast, higher plant, . insect and mammalian cells in culture or in vivo). Depending on the host employed in a recombinant production procedure, the polypeptides of the present invention are generally non- glycosylated, but may be glycosylated. Particularly preferred GLP-1 molecules of the invention are GLP-1(7-36) amide, and GLP-1(7-37) and exendin-4.
Therapeutic Methods
The therapeutic methods of the invention are useful for treating any patient suffering from HM. Such a patient also may suffer from congestive heart failure. Alternately, such a oC WO 02/34285 PCT/US01/32559 patient may suffer from, or be predisposed to, DCM. Typically, a GLP-1 molecule of the invention will be administered in a parenteral formulation. Other well known methods for administering a GLP-1 molecule to a patient suffering from HM also can be employed in the methods of the invention. These administration methods include, but are not limited to, subcutaneous or micropressure injection, external or implant pump, depot injection, and other types of prolonged application dispensing devices. Other methods of administration, such as transdermal or transmembrane administration, using patch or buccal means, also can be employed. Oral administration also may be suitable. Pulmonary administration, such as inhalation, also can be employed.
The route of administration may be optimized for particular treatments regimens. If chronic treatment of HM is required, for example, administration preferably will be via continuous subcutaneous infusion, using an external infusion pump. By contrast, if acute treatment of HM is required, as in the case of associated heart failure, then intravenous infusion is preferred.
The timing of administration of a GLP-1 molecule will depend on the nature of the condition being treated. Administration of a GLP-1 molecule may be as soon as HM or DCM is diagnosed, and the administration can be either continuous or on an intermittent basis, for as long as necessary. For acute conditions, where heart failure suddenly worsens, several hours to several days of continuous infusion are preferred. For chronic treatment, a GLP-1 molecule may be administered for weeks to months, even years, by continuous infusion.
The amount of a GLP-1 molecule that should be administered will vary according to the severity of the conditions and the patient. An advantage of using GLP-1 (7-36) amide is that high doses can be used without consequent hypoglycemia, because the action of GLP-1 (7-36) amide is dependent on glucose levels. Therefore, doses of up to 10.0 nmol/kg can be used without adverse effects. For intravenous administration, a typical dose of a GLP-1 molecule will be 1.5 pmol/kg/min. The range of the dose may vary between about 0.1-10 pmol/kg/min.
For subcutaneous administration, the optimal dose is 5 pmol/kg/min, with a range between about 0.5-50 pmol/kg/min.
or WO 02/34285 PCT/US01/32559
GLP-1 can also be co-administeréd with other therapeutic agents that are known for treating HM or DCM. For HM, these therapeutic agents include carvedilol, ACE inhibitors, and other anti-HM drugs, such as nitrates and hydralazine, bisoprolol, and metoprolol. See
Lahiri et al. GLP-1 can be administered as an adjunct to surgerical treatment of HM, by cardiac by-pass surgery or by angioplasty, for example. Administration of GLP-1 may be made to an individual before, during or following surgical treatment. Where surgery is not indicated or is undesirable, GLP-1 may be administered as an alternative treatment regime.
Treatment with GLP-1 would be especially useful, not only when surgery is contraindicated, as in the case of mild hibernating myocardium, but also when the patient’s condition is considered too serious for surgery. ACE inhibitors likewise are among the preferred compounds for treating DCM. Bell (1995). “Treating” embraces the amelioration of an existing condition. The skilled artisan would understand that treatment does not necessarily result in the complete absence or removal of symptoms. Treatment also embraces palliative effects: that is, those that reduce the likelihood of a subsequent medical condition. The alleviation of a condition that results in a more serious condition is encompassed by this term. A method to treat diabetic cardiomyopathy thus may comprise a method to reduce plasma norepinepherine levels in a diabetic patient, since the latter. may lead to or aggravate cardiomyopathy.
EXAMPLE1
Beagle dogs were fitted with telemetry devices that permit long-term ambulatory data collection in conscious animals. These devices measured LV pressure, myocardial oxygen consumption (MVO,, an expression of myocardial efficiency), coronary flow (CBF), and cardiac output (CO). The dogs were “paced,” such that heart rate was forced up to about 240 beats per minute, for 3-4 weeks, which induces moderate HM in a predictable manner. This
HM dog model is an accepted model for assessing the effectiveness of treatments for HM.
Kiuchi ef al., “Myocardial beta-adrenergic receptor function during the development of pacing- induced heart failure.” J. Clin. Invest. 91: 907-914 (1993).
or WO 02/34285 PCT/US01/32559
Following induction of HF, five dogs were given an intravenous infusion of rGLP-1 (7-36) amide (1.5 pmol/kg/min) for 48 hours and four dogs served as controls. During the treatment period, “pacing” was discontinued. Plasma catecholamines were assessed before and after infusion, along with LV pressures, coronary and systemic hemodynamics, and MVO,.
The results are summarized in Table 1. GLP-1 treatment significantly reduced (*p<0.05) plasma norepinepherine (NE) levels from 2.30+0.15 nmol/ml to 1.62+0.11 nmol/ml.
Moreover, GLP-1 treatment significantly (*p <0.05) increased left ventricular pressure (LVP), left ventricular contractility (LV dP/dt), cardiac output (CO), coronary blood flow (CBF), and myocardial oxygen consumption (MVO,), while significantly decreasing LV end-diastolic pressure (LVEDP). These data indicate that the rGLP-1-treated dogs demonstrated a remarkable recovery of heart function within 48 hours of GLP-1 treatment. This was associated with increases in oxidative phosphorylation as measured by MVO,, suggesting improved myocardial energetics. Thus, GLP-1 infusion is associated with decreased plasma
NE and significant improvement in myocardial energetics. The placebo-treated control dogs did not, in this study, show the same degree of heart failure as the GLP-1 group before treatment. However, the control animals clearly had compromised hemodynamics, which did not improve during the 48-hour placebo treatment period. :
Figures 1-4 summarize the results obtained from two representative animals, Dog A (treatment) and Dog B (placebo). Figure 1 reflects changes in left ventricular (LV) contractility, as measured by the rate of change of LV pressure (dP/dt). In the treated animal (dog A), pacing reduced contractility by 60%, as expected in a model of HM. Remarkably, 24 hours of GLP-1 treatment restored contractility to 80% of baseline, and 48 hours of treatment restored contractility to 90% of baseline. In contrast, in the control animal (dog B), pacing reduced contractility by 40%, which did not improve with placebo infusion over the next 48 hours. Hence, GLP-1 markedly improves myocardial contractility after pacing-induced heart failure (or hibernating myocardium).
Figure 2 reflects changes in LV ejection fraction (EF), as measured by percent emptying of the LV during systole. In the treated animal (dog A), pacing reduced LVEF by or WO 02/34285 PCT/US01/32559 40%, which then improved to 88% and 95% of the baseline value after 24 and 48 hours of
GLP-1 treatment, respectively. In the control animal (dog B), pacing reduced LVEF by about 30%, which subsequently improved only modestly over the next 48 hours. Hence, GLP-1 treatment improves LVEF after pacing-induced heart failure.
Figure 3 illustrates LV contraction, as reflected by the degree of wall thickening. In the treated animal (dog A), pacing resulted in a 20% reduction of wall thickening, which recovered after 24 hours of GLP-1 treatment and actually increased to 147% of the baseline value after 48 hours of treatment. In contrast, in the control animal (dog B), wall thickening was reduced by 25% after pacing, and this declined further to 62% of the baseline value over the 48-hour placebo treatment period. Hence, GLP-1 treatment markedly improves LV contraction after pacing-induced heart failure.
Figure 4 reflects changes in overall cardiac function, as measured by cardiac output (CO), which is the volume of blood (in mL) pumped per minute. CO is a product of stroke volume (volume of blood in mL expelled per systolic contraction) and heart rate (beats per minute). CO is a reflection of myocardial contractility (i.e., the intrinsic force of contraction) as well as of systemic hemodynamics, including pre-load (i.e., venous filling pressures) and after-load (i.e., mean arterial pressure and systemic vascular resistance). In the treated animal (dog A), pacing resulted in a 30% reduction of CO, which was restored to baseline levels after 24 hours of GLP-1 treatment, and actually increased to 116% of baseline after 48 hours of treatment. In contrast, in the control animal (dog B), CO only fell by 7% after pacing, which may indicate that in this particular animal there was hemodynamic compensation for the reduced myocardial contractility (Fig. 1) and LVEF (Fig. 2), thereby maintaining CO near normal. Nevertheless, over the 48-hour placebo treatment, CO declined further, to 89% of baseline. Hence, GLP-1 treatment markedly improves cardiac output after pacing-induced heart failure.
AMENDED SHEET
®
TABLE 2
GLP-1 CONTROL
EOE [ATER [amon [eR
LVEDP 25+ 1 15+ 1* 25+2 2112 dP/dt 1127 + 86 2212 + 86" 1650 + 100 1736 + 112 a
MVO, 246 + 18 297 + 16* 280 + 38 287 £23
Et a "Comprises/comprising" when used in this specification is taken to specify the presence of stated features, integers, steps or components but does not preclude the presence or addition of one or more other features, integers, steps or components or groups thereof.
Claims (33)
1. Use of a compound selected from the group consisting of GLP-1 (7-36) amide, GLP-1(7-37), GLP-1(1-37), GLP-1(1-36) amide, and biologically active variants, analogs and derivatives thereof, for the manufacture of a medicament for treating hibernating myocardium.
2. Use of a compound selected from the group consisting of exendin-4 and exendin-3, for the manufacture of a medicament for treating hibernating myocardium.
3. Use of a compound selected from the group consisting of helospectin I, helospectin II, helodermin, and Qd, Q° helodermin, for the manufacture of a medicament for treating hibernating myocardium.
4. Use of a compound selected from the group consisting of helospectin I, helospectin II, helodermin, and Q%, Q° helodermin, for the manufacture of a medicament for treating a patient suffering from congestive heart failure and hibernating myocardium.
5. Use of a compound selected from the group consisting of GLP-1 (7-36) amide, GLP-1(7-37), GLP-1(1-37), GLP-1(1-36) amide, and biologically active variants, analogs and derivatives thereof, for the manufacture of a medicament for treating a patient suffering from ischemic cardiomyopathy and hibernating myocardium.
6. Use of a compound selected from the group consisting of exendin-4 and exendin-3, for the manufacture of a medicament for treating a patient suffering from ischemic cardiomyopathy and hibernating myocardium.
7. Use of a compound selected from the group consisting of helospectin I, helospectin II, helodermin, and Q°, Q° helodermin, for the manufacture of a medicament for treating a patient suffering from ischemic cardiomyopathy and hibernating myocardium.
AMENDED SHEET
8. Use of a compound selected from the group consisting of GLP-1 (7-36) amide, GLP-1(7-37), GLP-1(1-37), GLP-1(1-36) amide, and biologically active variants, analogs and derivatives thereof, for the manufacture of a medicament for treating a patient suffering from diabetic cardiomyopathy.
9. Use of a compound selected from the group consisting of exendin-4 and exendin-3, for the manufacture of a medicament for treating a patient suffering from diabetic cardiomyopathy.
10. Use of a compound selected from the group consisting of helospectin I, helospectin II, helodermin, and Q®, Q° helodermin, for the manufacture of a medicament for treating a patient suffering from diabetic cardiomyopathy.
11. Use of a compound selected from the group consisting of GLP-1 (7-36) amide, GLP-1(7-37), GLP-1(1-37), GLP-1(1-36) amide, for the manufacture of a medicament for decreasing the plasma or heart norepinephrine level in a patient.
12. Use of a compound selected from the group consisting of exendin-4 and exendin-3, for the manufacture of a medicament for decreasing the plasma or heart norepinephrine level in a patient.
13. Use of a compound selected from the group consisting of helospectin I, helospectin II, helodermin, and Q°, Q° helodermin, for the manufacture of a medicament for decreasing the plasma or heart norepinephrine level in a patient.
14. A compound selected from the group consisting of GLP-1 (7-36) amide, GLP-1(7- 37), GLP-1(1-37), GLP-1(1-36) amide, and biologically active variants, analogs and derivatives thereof, for use in the treatment of hibernating myocardium by a method which comprises administering a therapeutically effective amount of said compound to a patient.
AMENDED SHEET
15. A compound selected from the group consisting of exendin-4 and exendin-3, for use in the treatment of hibernating myocardium by a method which comprises administering a therapeutically effective amount of said compound to a patient.
16. A compound elected from the group consisting of helospectin I, helospectin II, helodermin, and Q®, Q° helodermin, for use in the treatment of hibernating myocardium by a method which comprises administering a therapeutically effective amount of said compound to a patient.
17. A compound selected from the group consisting of helospectin I, helospectin II, helodermin, and Q%, Q° helodermin, for use in the treatment of a patient suffering from congestive heart failure, wherein said patient also has hibernating myocardium, by a method which comprises administering a therapeutically effective amount of said compound to said patient.
18. A compound selected from the group consisting of GLP-1 (7-36) amide, GLP-1(7-37), GLP-1(1-37), GLP-1(1-36) amide, and biologically active variants, analogs and derivatives thereof, for use in the treatment of a patient suffering from ischemic cardiomyopathy, wherein said patient also has hibernating myocardium, by a method which comprises administering a therapeutically effective amount of said compound to said patient.
19. A compound selected from the group consisting of exendin-4 and exendin-3, for use in the treatment of a patient suffering from ischemic cardiomyopathy, wherein said patient also has hibernating myocardium, by a method which comprises administering a therapeutically effective amount of said compound to said patient.
20. A compound selected from the group consisting of helospectin I, helospectin II, helodermin, and Q®, Q° helodermin, for use in the treatment of a patient suffering from ischemic cardiomyopathy, wherein said patient also has hibernating myocardium, by a method which comprises administering a therapeutically effective amount of said compound to said patient.
AMENDED SHEET
21. A compound selected from the group consisting of GLP-1 (7-36) amide, GLP-1(7-37), GLP-1(1-37), GLP-1(1-36) amide, and biologically active variants, for use in the treatment of diabetic cardiomyopathy by a method which comprises administering a therapeutically effective amount of said compound to a patient.
22. A compound selected from the group consisting of exendin-4 and exendin-3, for use in the treatment of diabetic cardiomyopathy by a method which comprises administering a therapeutically effective amount of said compound to a patient.
23. A compound selected from the group consisting of helospectin I, helospectin II, helodermin, and Q®, Q° helodermin, for use in the treatment of diabetic cardiomyopathy by a method which comprises administering a therapeutically effective amount of said compound to a patient.
24. A compound selected from the group consisting of GLP-1 (7-36) amide, GLP-1(7-37), GLP-1(1-37), GLP-1(1-36) amide, and biologically active variants, analogs and derivatives thereof, for use in decreasing the plasma or heart norepinephrine level in a patient by a method which comprises administering a therapeutically effective amount of said compound to said patient.
25. A compound selected from the group consisting of exendin-4 and exendin-3, for use in decreasing the plasma or heart norepinephrine level in a patient by a method which comprises administering a therapeutically effective amount of said compound to said patient.
26. A compound selected from the group consisting of helospectin I, helospectin II, helodermin, and Q®, Q° helodermin, for use in decreasing the plasma or heart norepinephrine level in a patient by a method which comprises administering a therapeutically effective amount of said compound to said patient.
27. The compound of any one of claims 16 to 30, wherein said administration is continuous.
28. The compound of any one of claims 16 to 30, wherein said administration is parenteral.
AMENDED SHEET
29. The compound of any one of claims 16 to 30, wherein said effective amount of said compound is effective to cause a reduction in the plasma or heart norepinepherine.
30. Use of a compound as claimed in any one of claims 1 to 13, substantially as hereinbefore described and exemplified.
31. Use of a compound according to the invention including any new and inventive integer or combination of integers, substantially as herein described.
32. The compound as claimed in any one of claims 14 to 29, substantially as hereinbefore described and exemplified.
33. The compound according to the invention including any new and inventive integer or combination of integers, substantially as herein described.
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US24183400P | 2000-10-20 | 2000-10-20 |
Publications (1)
Publication Number | Publication Date |
---|---|
ZA200204949B true ZA200204949B (en) | 2005-03-16 |
Family
ID=34699716
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
ZA200204949A ZA200204949B (en) | 2000-10-20 | 2001-10-22 | Treatment of hibernating myocardium witha GLP-1 peptide. |
Country Status (1)
Country | Link |
---|---|
ZA (1) | ZA200204949B (en) |
-
2001
- 2001-10-22 ZA ZA200204949A patent/ZA200204949B/en unknown
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CA2395165C (en) | Treatment of hibernating myocardium and diabetic cardiomyopathy with a glp-1 peptide | |
US6706689B2 (en) | Treatment of acute coronary syndrome with GLP-1 | |
US7265087B1 (en) | Exendin improves β-cell response in subjects with impaired glucose tolerance | |
AU2001263230A1 (en) | Treatment of acute coronary syndrome with GLP-1 | |
ZA200204949B (en) | Treatment of hibernating myocardium witha GLP-1 peptide. |